3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
3EDQA 1I3OA 2XZDA 1CP3A 1RWPA 3H11A 4JJ7A 3GJSA 4N6OA 4IYRA 3GJQA 4M9RA 1QDUA 3H13A 3R5KA 4NBKA 4QUIA 4QTYA 1PYOA 4N7MA 5IAEA 1CVRA 2H54A 2C1EA 3S8EA 4JR1A 4QU5A 2DKOA 1QX3A 5LU8A 1NMEA 1SC1A 5LUAA 1RE1A 4QULA 4NBLA 3KJFA 4EHLA 2C2MA 4JB8A 2FQQA 4AWBA 4ZVTA 1RHKA 4NOMA 5IAGA 5LU9A 5IC6A 1RWWA 1RHUA 2CNLA 2FP3A 1I4EB 3OD5A 2J30A 4N5DA 1GFWA 4EHDA 1JXQA 3GJTA 4JJ8A 4I1PA 5IARA 4QUEA 3P4UA 4JQYA 5I9BA 3NKFA 4D3XA 3V4OA 2QLJA 1I4OA 3V4LA 4AWAA 1SHLA 3DEKA 4JR2A 4QUDA 3E4CA 4NOLA 5IAJA 3R6GA 4ZVQA 3R7SA 5H0IA 2K7ZA 2HBYA 2CNKA 2J33A 2QLFA 1KMCA 1SC3A 5IBCA 3DEIA 1QTNA 3P45A 2H4WA 4PS1A 5IABA 3V6MA 1RHMA 4PRYA 1SHJA 4N7JA 1SC4A 1RHJA 2H65A 4HQ0A 4FDLA 2C2OA 4IEFB 4JR0A 3SIPA 2H5IA 4LSZA 1I51A 2CJYA 2CNNA 2XYPA 3D6MA 3NR2A 4NOJA 3H11B 5I9TA 2H4YA 1NMQA 2HBQA 2Y0BA 1RWKA 4QU8A 2NN3C 5IC4A 2H51A 2QL9A 3H0EA 3IBCA 4JQZA 4N6GA 1BMQA 4QU9A 3IBFA 2XZTA 4QUJA 4I1RA 5LUBA 4AW9A 4EHHA 1IBCA 3BIJA 4DCPA 2CNOA 2WDPA 4EHAA 3KJNA 4EHFA 1GQFA 4PRZA 4ZVOA 1RWOA 2AR9A 4EHNA 4QUGA 1F1JA 3DEJA 3ITNA 4ZVSA 1RHQA 4HVAA 5IASA 4ZVRA 2C2KA 4QUBA 4DCJA 5IANA 2H48A 1RHRA 1NMSA 4JJEA 4FEAA 4QUAA 3R5JA 2QL7A 2XYGA 2J31A 1RWNA 5IBPA 3V3KA 2CDRA 3R6LA 4NOKA 5IAKA 2FUNB 3D6FA 4FXOA 4QU0A 1M72A 3NS7A 2CJXA 4QUHA 3D6HA 3DEHA 4PS0A 4EHKA 1F9EA 3EDRA 4HQRA 5K20A 2C2ZA 2HBRA 5IBRA 1RWMA 2HBZA 4D3ZA 1RWVA 1RWXA 2QLBA 3K7EA 2Y1LA 3PCXA 3V6LA 4D3YA 3SIRA 3KJQA 3GJRA 1K86A 3PD0A 4ZVUA 2P2CA 4QTXA 3RJMA 2QL5A 3V55A 1PAUA 3PD1A 2XYHA 4N6NA 3R7BA 2H5JA 4EJFA 4DCOA 3H1PA 1ICEA 3UO8B 3QNWA 5JFTA 3S70A 4ZVPA 1K88A 4FGUA 3UOAB 3R7NA 2J32A 4NBNA 1NW9B
chains in the Genus database with same CATH superfamily
3A9UA 2P9ZA 4N6OA 3P1JA 1QYIA 3CBKB 4OZGB 3TK1A 1AHPA 1Z4LA 2Z08A 3MJEA 5A1AA 3VR2A 4WUUD 5CDTA 3BH9A 5GGSY 3NGXA 2A5UA 1WA1X 3W81A 3HCNA 5FB3A 3B43A 2V1UA 4DP4X 4HG2A 4YBQD 1YCFA 1HQDA 4KUGA 2Q49A 2A9NH 4EZEA 1W6WA 3RPIA 2PKEA 3AFGA 3SDSA 1NCHA 1GPLA 3H9HB 3IWVA 1EFXA 1F2TB 4IM7A 5DD3L 1A04A 1U81A 1GU0A 1IGML 3B3QA 3H3BC 2X9NA 1UFGA 3K0KA 2VUHB 4GX5A 4FJ1A 4ZJ9A 2JJVA 4WRRA 1Y6RA 3J7HA 1B0WA 1KDTA 2W1NA 3PIDA 1Q38A 5TF1H 4LS3A 2Q0XA 3AR5A 2KBFA 3F00A 3EZ8A 3ZMRA 3WIEA 3AEQA 1HT0A 3Q06A 2IHVA 3LS5H 3NJGA 4HUTA 1YRYE 1EO7A 2DQIL 2YHAA 5J2TB 1P7KA 4AUJA 1PG7H 2RGUA 3R6LA 2B16A 2YHGA 2HUNA 2IY9A 3TT3H 1M6OB 2GKIA 1JZQA 3LZDA 4O4HF 2R5WA 4GOKA 2C3MA 4RF4A 2O54A 4G8BA 4DDTA 4G9FB 1RH8A 2VXOA 5EUQB 1L5ZA 2QL5A 3I6GA 4M62H 1D6JA 2CCJA 2ZIAA 4IMIB 4O1HA 5HBGA 3QZLA 2BUAA 2EXXA 4LLYA 1CR4A 1C9YA 3A05A 2JEZA 4UU7A 4PW4A 4X3CA 1DBBH 1ZEMA 4B3HA 4BFCA 1FFPA 4R1LA 4YQYA 1NV9A 1DBKL 3RVTD 3HY3A 3L3GB 1XJ5A 1FRFS 4YSDA 2JFWA 4B3BA 4DIDA 5FYLE 2VDQL 3PCTA 4DADA 3IETB 4PTUB 2R8RA 3HJNA 4MQLA 2AYXA 4D43A 3AZQA 3KZKA 4X1YB 5D6NA 5K9JL 1MFDH 3IDYC 4HJIA 1DXHA 4CFSA 1A1MA 1YIAA 5C4GB 2DULA 3UB3A 1GPWB 4FQ1H 3U3XA 4HDIB 3LQAC 5SICE 2QBYA 2WNGA 2JHGA 3BWVA 4BKQA 2ZYAA 4AKEA 1SJHB 1YZTA 3WIFA 4B4OA 3BUYA 1BWSA 3GUCA 3ADPA 4ZD3L 3GD1C 5E99L 2JDIA 1HDXA 1DKOA 3SD7A 3WDMA 3OKLA 2FEXA 3PGKA 3GXFA 3JR3A 4JZYA 3EODA 3UGXA 4B5KA 3E8SA 2ZAYA 3UTTA 4OQLA 3RFVA 4J2XA 1IM5A 2JPDA 3GMSA 1XH0A 3APMA 4KX3A 4KRYA 3OCZA 5F7YC 1YVEI 4YONB 2QYOA 4Y2YA 3ZL2A 2OENG 1A4KA 3MRJA 2AEIT 2M1ZA 3NAZA 1YA4A 3KWWA 1I1QB 1MH5B 4V0KA 2NQDA 3CBGA 2AJUH 1CFTA 4TWAA 5EGNA 4LCYB 3WFCL 2B39A 3P2BA 1X14A 1I2MA 2X87A 2WTEA 5B58C 1EJBA 5BVHA 3I39X 1CQJB 5C7LO 1ZK1A 5FK9B 5T57A 5DEFB 2F08A 2CB9A 3SLKA 4AP6A 4LLUA 3AM8A 3U4DA 3SHSA 1Y0LB 2F8XC 1XD2B 4FMCB 2X8JA 1FZMB 1B93A 3ROMA 5L3RA 4P5MB 2X0NA 5FTWA 2EDWA 2WMPB 2WHQA 5KVEH 2P1YA 3KPOB 2F3PA 3AG6A 3IERA 4BMXA 1A7UA 4EKGA 1JU9A 4E30A 5AVSA 3VGGA 3WBFA 2PXXA 2JFFA 5GY7A 4DNOA 2NOYA 4G7YL 3BCHA 4TYNA 2H6EA 4X0EA 5DWDA 1BCIA 4YDZA 2CR3A 3DDWA 2BM0A 3N44F 4BCZA 5I2IB 1GAJA 5CIPA 4FHZA 3D2UA 1KYOK 4GW4B 3MBWA 3NB0A 2CDGA 4LPXA 2HU2A 3KJGA 2HRHA 4N0PA 5KSOA 2FOXA 2GJ6D 2BNRB 1A2YB 3QR2A 4R1NA 2MINB 4AENB 1VMEA 3FI0A 3MXVL 2JV6A 1IU1A 1R0BA 5CYGA 3SF8B 3H9YA 3BA6A 1XO1A 1I0LA 1HDRA 4LHYA 3CR7A 1A4XA 3V7AG 3G2QA 5D86A 4ALNA 1OAYL 1YPZF 3Q1SH 4OX9B 4DGYH 5IQLA 4EB3A 4X7TA 1FFYA 3RD5A 4XNZC 3QIWC 5DGCA 4FJZA 5I74B 4LRSB 5E4EC 4GKAA 4OLVL 7AT1A 3VGJA 4D4KA 4DPMA 2EFGA 4I0CC 5C97A 2IWFA 4L1LA 4JO2H 2FOIA 4GX2A 1QBBA 3BAZA 3PDUA 1XWIA 2Q9BA 4I8IA 4G4GA 1U42A 1STOA 1LVEA 1RUQL 3L6DA 4MMZC 1X80B 5LZ9A 1QG0A 5ESDA 3IDSA 4H7JA 5HCUA 5DJCB 3FFBA 3U4IA 3DTUB 1KCKA 5AKSA 1Y1RA 4TYQA 5CK5A 1F42A 2MYUA 3HY6A 1RZKC 3VG9C 4KY2A 3TOPA 4RIHA 5CEJA 4GBXD 1XF3A 2GEBA 4Z7VE 1N7HA 4W5TA 5GGVL 3X1XA 3RVXD 2LRHA 4AWJC 1DQJA 3W3ZB 4J03A 1QVVA 2XOXA 5CEZH 4M00A 4G1FA 2WTOA 2WB4A 4ALMA 1NHGA 2VJNA 2Q5QA 3D5TA 4M1YA 1CE6A 4IO0A 3QEKA 4PYJA 3DEJA 3B6ZA 1AB6A 3UMNA 5L3VA 3C3DA 5FCUH 4DXDA 1EM6A 3OJFA 4BFZA 4H0HB 3TQCA 1UBNA 2AK2A 2WUWE 4BQFA 3MREB 1QNLA 3MFYA 2JLVA 1MIEH 3G5XA 4LLDB 1MIHA 3SC4A 2YWJA 5SYNA 3NRJA 3SDAC 4PRNB 4RFNC 2OP4L 3WU1A 2C4TA 1ZIPA 5HR5A 3QQ5A 5H02A 4EZJA 2AX3A 4NQEE 3CNQS 3LB6D 5JPMC 1OGAE 3BVDB 2B69A 4HDSB 1L3CA 3CRRA 3GVIA 4R90H 2P4QA 2VS1A 5CN2A 5L7XL 1ZT1A 2ZT5A 4IXNA 2WLLB 1RIUH 5IBTL 2XMGA 5IKPA 1MG0A 3RAFC 4K28A 1SBYA 3ESYA 4KXAA 3R24A 3WUZA 3X2QB 5EIFA 4IZOA 3H5TA 3DGDA 4ADGA 3ARZA 2II6A 3MCVA 2PO7A 4UFNA 4ZWNA 4B48A 4J3WA 2QTVB 4M38A 2QKYA 5HYSB 3DHPA 2CLZB 4ITVA 3L4SO 4Q52A 4N2LA 2AGVA 4K9EL 2R1TA 4A3SA 3E5MA 3VXNA 3QUMB 4J3OD 4ZFZB 4X98A 3Q05A 4CIVA 4XJSA 1AXSA 3CXDL 4MJIB 4HEHA 2CK2A 2ZCLL 3UWOA 2BDTA 2N1BA 1Z74A 3ZVVA 3TB4A 1D6SA 3TA3B 5SYAA 3S98A 1J2EA 1G0YR 1TW2A 5TK4A 4LSTH 1LSJA 2EVIA 4FKEA 1ZK0A 4TMPA 5TJ9A 3IHLA 1CUYA 1E65A 1JR2A 3MRDA 1KFAH 1OAQL 1JIIA 5DI8B 1T3SA 1N6PA 1KI7A 1OA1A 4CR7A 2IOYA 3GHEL 4QXUH 3H9SE 1UC9A 4BELD 4RKWA 1FJHA 5BUCA 2O9JA 2IYOA 4NMHA 3RTLA 4WECA 3PJLA 2EFEB 1E2WA 4ZOQI 2IWRA 1IFHL 9GPBA 2L7JA 3BCRA 4JO5A 5BV0A 1OB5A 2PXYA 1W30A 3MAGA 5F3BB 3IALA 1USWA 1O95D 3RKRA 4LOFA 5T5NF 5DYNA 4WXEA 4BQCA 3T8YA 4PGDA 1BJ1H 5G1PA 5ILGA 4NUMA 5D2NE 5CAYB 3HJEA 4F15C 4BRZA 1ZKMA 2J2ZB 1MREH 3CLFL 3DMFA 3WY9A 3DJRA 3DZKA 2VI5A 3ZX4A 1SJEA 4HB0A 4JGJA 1YDPB 4Q48A 2EG9A 5G4KA 5C07D 2NY5L 1QV9A 1NG9A 5EJIA 4F57L 2YMOA 1F41A 3N8GA 2EZ0D 2PMZA 1EJOL 1JJBA 5CM8B 5EUBA 3WHKA 4ZPTB 1KTIA 5DRTA 2XZZA 1P4GA 2TMYA 1V6CA 5DMKA 2BLNA 3DJFA 1SH7A 2DZDA 1N7GA 1RUML 4LDOB 1SG9A 1JLLB 5A4IS 3UMSA 4FLEA 4PP2B 1CICB 3HZKB 2OV8A 5EHXA 1X3LA 4OXKA 5DW0A 3GLQA 3V5DB 3EEQA 1DAHA 3Q7SA 1ODTC 1NCGA 2Y71A 4E31A 4N3AA 1ODLA 3O31A 2MTPA 2C95A 1GJWA 3HBMA 4WI1A 3CE6A 1AXIB 2V74B 2W9LA 4OZHA 1THZA 1E2VA 1YA8A 4K8RD 2FLVA 3TH4T 2V4LA 2X2FA 4L2YA 2DMHA 3L7EB 2EUZA 1U4NA 2Z1DA 1FQOA 3RFCA 3BX7C 1SBHA 1FMTA 4X8OA 4QG3A 4YSPA 2J8UE 1DLFH 2IOIA 3VDXA 4NNPA 4IJVA 2G08A 1RC8A 3D43A 1AVAA 4CW7A 2O1EA 3RRJA 3FOMA 1ZR4A 4WI8A 3QEUA 1FX1A 3TJHC 3RBXA 4GW5B 1TUGA 5HYEA 2G17A 4H44C 2XUQA 3CV5A 2FR8A 3E4CA 3II6X 2QADC 4P2YA 2V6IA 3S36L 4I48A 4O2FB 3RIFK 5DUJA 1G66A 1TSRA 1OWNA 2PLFA 4KDCA 4IMKC 3KXDA 1TQ4A 3S1SA 5G02A 1Q0LA 4QPPA 1U3HA 1ZIOA 3WJLC 4LKXB 3L3JA 1WEHA 4HV4A 1Z2AA 3CGWA 1YEGL 4BEJA 4DO5A 2NSMA 1WMFA 3S2SA 3BKJH 2L0DA 4Y5VC 4FYQA 1NAML 2W0LA 2EH7L 4Z9BA 3U2JA 3KETA 1I8KB 2HZ7A 5HI3D 5DEIA 1DAOA 3QDGB 4DVGA 2GNPA 3UUFA 4PC6A 3W06A 1NXSA 4HYQA 3UT6A 1T1XA 3LUKA 1T2CA 3O3BB 4TSCH 1Q91A 1TJHH 2B1QA 4CN6A 3PDCA 3MOSA 3BE5A 3ARGD 1KPVB 2I6FA 3CXFA 2H57A 2FT7A 1HETA 4YRDA 1EAJA 3S5ZA 1MCPL 4CNIA 3LQFA 3CX5J 5JQHC 4HWEH 2R56H 3QUMH 3VR2D 3NBZC 1NU8A 3FH7A 3D3NA 4KVAA 1ZJZA 5IQ9B 2JF0A 1XQ1A 5JVDB 4MZIA 3L1KA 5FV4A 3RQ3A 3ROKA 1CL7H 4XMUA 4C89A 4N1AA 3FYUA 1WDWB 4AF6A 3DIDA 4R9SA 4B27A 2HEIA 2R4QA 1QFUH 4C0BA 2YWCA 4JYCA 5JQ6H 4ZAFA 4ZW5A 1E99A 4B32A 5I8ZA 5JNYA 3QJXA 3HN6A 3CVCA 1NDMB 1GPJA 3IMCA 1EFXD 5AW7B 2IBZX 1NJGA 2QLLA 1XVSA 5CCJA 1SJVA 4H1LH 1OZHA 2XWRA 5IB1A 5JH7B 3B2VL 4YDRA 1GVIA 2FPRA 3QJQB 4KO5A 4BE5A 1L5MA 1SD5A 2ZB4A 5TSDA 2O72A 4OBWA 3ENNA 1AP2A 1YO4A 3ZQJA 3IAGC 2AQRA 1OF2B 3PP3H 1RXSA 2B7DT 4RD1A 4O4JB 3N3EA 4UQPA 2CO1A 4M1TA 4Q7MB 4KXLA 4TS4A 2AK4B 3ZKMC 1DN2A 4WADA 3OMAB 4ISBA 5CKAA 4NOKA 4JFDE 3SJVB 3CEJA 1B9ZA 4OM0H 2NUAA 4ANVA 3P9ZA 1AOZA 2W6NA 4FE9A 3MLXL 2YRBA 5HYJB 4OP3A 1UVQB 1P62B 3D39E 5DMJB 1Q1JH 3PRYA 4HJEA 1HURA 4QTXA 5HJDA 1YS9A 3ZW8A 4OUOA 4CLRB 2NY1B 2I7CA 3OOWA 1ZC4A 4B6RA 1J9QA 1OP3H 1K7SN 4M0DA 1UQUA 3QBDA 2C3OA 1M34E 2NSYA 1SVLA 2Q3MA 3UWMA 1ZK9A 1T1EA 2FXIA 1PSZA 5EQTA 4L1SA 3FCCA 3HS3A 2TECE 5GTDA 4RISL 3H65A 1JPUA 3ZIAA 4MJ4A 4XBGA 3BP6B 2IALA 3N04A 1OPGH 1ZC3A 4RTMA 3ZVRA 4Y16A 3MHZA 1PEZA 4NDZA 1ZV2A 4JLUA 3EPLA 1RYMA 2BGTA 1C08B 5JD5A 4ZUWA 1L8OA 3ATFA 1IKNC 3O5AA 4G5SA 1ETB1 3DE3X 2G5CA 4U1NB 3TZEA 1E2PA 1FBTA 4JDUA 2JDID 2F7SA 2H0AA 4G8CA 2VDKB 4WVLA 4FA8A 4TSAL 3UTTD 4OZGA 5JLJA 1AF7A 3FA2A 1R27A 4RMNA 1V4BA 5GOZA 3X44A 3ZS8A 1LHZA 3DCIA 3QFGA 3ROTA 3BYTA 3CRNA 3WKEA 3CVXA 1HZZA 3SBEA 3TM4A 3IXAB 3E7DA 3KPLB 3T3MB 2M1KA 4YI3A 4P53A 1U21A 4ZXBC 2WAXA 3LP8A 4ZV7A 5LQSA 4JSRA 2GWRA 4D42A 5CT9A 1DFHA 1EWHA 4CG0A 3C5ZB 5BCAA 3OZRA 4K0OA 1PFKA 3BREA 2R1VB 3W4IA 1K86A 3KR2A 4RKRA 4BQRA 3JVVA 2XZOA 3SQRA 4IS3A 5FTKA 1Z45A 3I04M 3QEOA 3H9HA 2W98A 4LY3A 4QTZA 5DF0A 3B56A 4UQIM 5FO9A 3U7GA 1F2TA 4QTFA 2P9CA 3DV4B 1I8TA 5DYYA 4PJ9C 4FB4A 3S34H 2QG6A 3NASA 3BJIC 5KSVB 4ZW6A 1RUPL 4WJKB 3RSLA 4TX1A 1IBZA 5ALSA 1U8XX 3H7LA 2OHJA 3CZEA 3FW1A 2HWXA 5J2TA 3DBXB 2IV8A 2OCLA 3C45A 4KMOA 1JHKH 3PE9A 4EF6A 3GB7B 2JKJA 2LVCA 5TQJA 3OHXA 1RHJA 4DW2L 1RLTA 2Q5HA 3Q0EA 3R8QA 4G9FA 2FSPA 3D2UD 2YQ4A 2OCGA 2RHJA 4R2IA 2BRRH 5JUWA 4EYQA 2XCOA 1KELL 2HJLB 1PZHA 5AW9B 3D4PA 2XN9E 5EJEA 1D2EA 2V2XA 3C08L 2GM3A 3O4RA 2NX2A 4X0KB 1E8DA 2C2BA 3ELBA 4IVRA 4A8JB 5HKLA 4MPRA 2K87A 3WKAA 4NC1E 1FCGA 2N3JA 5H35B 3ZE1E 3L3GA 5E23A 3RJOA 2Y2YA 1QEWB 2E8YA 3EGDB 1TQCB 1RYHA 3IETA 4KNVA 2OC9A 4PTUA 4I3RL 2C5DC 1NCIA 1M3IA 4KXQA 4LYAA 4X1YA 5K1JA 4TMWA 2GK3A 5EOCH 3AM1A 2A86A 4JLKA 1P4HA 3BESR 1V27A 3PR2B 1E9VA 1NYTA 1EHLH 3P77B 4HDIA 1YFZA 1COZA 3O3CA 5DS2A 3KHQA 1SJHA 5JADA 1GZPB 1MXDA 1NPJA 3RNKB 2FVNA 3PEWA 2PMCA 1MFBL 1KH3A 2FP3A 2Q7YB 4QGYA 5LN8A 3V4UL 1ZGJA 2ZSKA 4KJWC 5JHGB 1KAGA 3WLLA 5HF9A 3OQOA 4YA6A 2YYAA 3ESOA 3LEVL 1Y7VA 1S78D 4OG2A 2ZAIA 2SNIE 4XI9A 3MCTA 4KLRA 1E3JA 1KOFA 13PKA 2IW3A 3WTUA 4M89A 2OHIA 2XVBA 1QATA 1JSRA 1WZEA 4H8HA 4LCYA 2O7VA 5CM9C 4JN2A 3GMNB 3FZUC 3L1GA 5FK9A 2K4MA 5DEFA 4N9QA 5CDFE 1Z7BA 2O5VA 4N4AA 2HPVA 1Y0LA 4RKFA 4JB9H 1YNTF 4AH2B 4JJEA 1E2FA 3TSOA 1G9XA 1R3LB 3WLBB 4JFHD 1XD2A 5DNCA 4WFFD 5BUAA 4JUFA 4WTZG 5EQJB 2PGDA 4P5MA 2N9UA 1Q7BA 2WMPA 3MG9A 6REQB 1ID2A 1SXGA 4XE5B 1WTCA 1DVRA 1XKXA 4LZNA 3BD8A 3KPOA 3F83A 3R5FA 2OK0L 5CNKA 4BX2A 5BOJA 3WLKX 2M2DA 4AEIH 1ZOSA 3TBCA 1F2DA 3WY2A 2JIMA 5C8ZA 3L9WA 2BO0A 4HPHA 1YA6A 3MV9E 1HWYA 1ZD8A 2EQ5A 5EQFA 3UCQA 5I2IA 1BNCA 1UHVA 4GW4A 4JKMA 4Y0VA 3TBKA 3ZY4A 4KHXH 1DYZA 1WMDA 3Q9SA 1OIWA 1QBML 2XBUA 1TA0A 4FZJA 3CT6A 1VKOA 4JJ6A 4EI5B 3PHHA 1LC0A 1RYDA 5A4JA 4XE0A 2BNRA 1A2YA 4YK4C 1K68A 2MINA 4AENA 3L4XA 2DYRB 2ZCZA 2C83A 1HVXA 3SF8A 1F4XL 3US1A 1T0NB 4J3VA 1Q57A 2GX6A 1X7XB 1IGJB 3QMPA 1CD9B 2A5JA 2L82A 9LDTA 5CMLA 4JVNA 5GV8A 2CXNA 4IDOA 2FWRA 3FULA 4Z3HA 2GK0B 4MZDA 5HHNB 1MIMH 3ATDA 2HWZH 2Q8AL 5FXMA 4K7PH 4PCAA 3MJ9H 4L15A 3A6OA 2FX5A 2FJHB 4UQBA 3QXGA 1DSFH 4BKTC 1J0ZA 3A5VA 2XBZA 1LDYA 1NX9A 4LXQA 4Q34A 4M9UA 2BJMH 1X80A 4KO9A 1J86A 1ECJA 4GXVH 5TIIA 2HWYA 3PA8A 4XI5D 5I66B 2Q1SA 4FGSA 2R47A 3EVTA 4WLFA 2I6TA 4IBLT 2EIMB 2PXYD 4HP5A 5D1ZB 2ZIWB 4JA2A 1TUEA 3WNBA 4Z1PA 2ZPUA 4X5PA 4XO3A 1Z8HA 5J6SA 3TO2B 5DH9A 1ILUA 1RPKA 3EH4B 5DZOA 3KSBC 4LRIC 2PU5A 1E2JA 3FU5A 3PX3A 2EZ4A 4JJOA 2PQ0A 1OV6A 2ZIZA 2H4HA 2YWZA 1ESEA 4XMVA 2ZI9A 2CE2X 3QYAA 5I9QB 1EEYB 3I30X 3R9XB 4P3NA 1J7JA 4IV5A 4K2UL 4LLDA 1HXMA 1SM4A 1EJ2A 4X6XA 3ID6C 4PRNA 1AC5A 3DUFB 1KY2A 4JGNA 1E58A 2D1TA 1F14A 2GVYA 1ZAYA 4PQFA 2Q76B 4FYMA 1JIXA 1CY8A 4FDUA 3UIEA 4UILL 4YLCA 4HDSA 4UJ3A 3EXHC 1R74A 2QL6A 1J7KA 5IESH 2WLLA 2O0MA 3N9IA 3MTJA 3SCMC 4NBWA 1RRKA 4HMDA 1HT3A 1R50A 3VB8A 4AEEA 3K74B 1PSKL 1RADA 5IBRA 3ONWA 4RFEB 3HNOA 3G7TA 4LEOB 3RQSA 2QQNL 2NNLD 3MJSA 2XUHA 3HTXA 2R83A 1PR5A 5D1XC 2QTVA 2PSFA 1E7UA 1SUBA 5HYSA 1OEZW 3RYIB 2CLZA 1CIVA 2D8MA 5FGCB 5LXTF 4C0AC 1S2GA 5D7HA 1JHPA 5EXDA 1W85B 2K7FA 3IBEA 4TSRA 1AKWA 1HQ4A 3O7MA 1L1FA 4H08A 4FOTA 3QUMA 5I0ZA 1X92A 4ZFZA 1REQB 2GPWA 4MYCA 4MJIA 2EP5A 1OVMA 2NTEA 5A6LA 4L72A 3B2UD 4DN3H 2VDLB 3G2NA 3FB5B 4EIBA 3TA3A 3GXBA 2A35A 4TL4A 3QEQE 4ZT1A 1M8KA 2NU9B 3O2VL 2XX3A 2WTNA 1USGA 1N9KA 5G40A 1JTOA 1GN9A 3HCEA 5K6AC 1G7LB 3PS9A 5DZPA 5DI8A 3V7AE 1U3HD 1OB0A 3PU7A 1M1XB 4L29B 5K4GA 3EFOA 3EXAA 1B4DA 2VL5B 2MRYA 2KQNA 5KPDA 2ZWYA 4KMRA 4RK1A 1CLZH 3T0EE 2OV3A 4ELDA 4L4SA 4Y8VA 2HYMA 5TQVA 1R0KA 4CL2A 1G3QA 4WNYA 3VW3L 4R2GB 1SD1A 2D7DA 2WGXA 3LY9A 4PD4K 2B4YA 3NZEA 5I5RA 1HCVA 3BAEH 5IROA 5EYPB 1N0XH 3RC3A 3PFBA 4KKVA 5BQXA 4GG6B 4BQSA 3I9GH 1BLIA 4JG1H 1IGYB 4NYIQ 2AXGB 1V8FA 3L6FB 1ABEA 1L8LA 3ONDA 4XIJA 2VUOA 1VFMA 1MG3C 2EBUA 4O2AF 3UHPA 1YDPA 4HUQB 1I1AA 1DAEA 4ONHB 2J0VA 4W4OA 2ENPA 1I7DA 3PRKE 1RWPA 2HKFH 2BS8A 3B2MA 4MGKR 5IEJA 4ZPTA 1F6AB 3NRBA 4G70B 3D30A 1ECZA 2ZITA 3OPVA 4HLDA 3UADA 1DBAL 1WP4A 1CLYL 3FUDA 3WB1A 3LRTA 3K0YA 2X86A 3CCHB 5THQA 4GZ5A 2CM6A 4A82A 1JLLA 4PP2A 4GRWB 4YUEH 1YHYA 1CICA 3HZKA 4P2GA 4LSSL 1TC2A 4Q39A 1VESA 3J2PA 2ODTX 3V5DA 3H2BA 5F9OH 2QAGC 4IJUA 2ENJA 4L2IB 4FQ2L 4WWPA 1FVCB 2OR9L 4I18B 5IJKC 2YD5A 4FZ3A 4O4HB 5HW0A 3L7EA 3T1HB 3RS4A 3C5SB 2QDXA 3BPCB 4Z5XA 1PYWB 3W2HA 2I66A 5IN4A 4C03A 2UZIR 4X1OA 5IGXL 4NDAA 5D1QB 4BNVA 3P9LB 4RPGA 3UB2A 1IY0A 4G6FD 3QDJB 4GW5A 3HXOA 1QTPA 1HYGA 2IPNA 4LNAA 3T5CA 2A6KB 3RLFA 1KORA 2R7MA 1ZL2A 3D8RA 3DGEC 5J13B 3IR5A 5DVLA 4UXIA 2ZR0A 1HIML 3FMFA 4I99A 5E8RA 5AI8A 5GS0L 4ZNEA 4BVKA 4QD2E 3CN1A 3K4DA 4TULL 4YCBA 4JQCA 1RJZB 2LLLA 3DOUA 1EVKA 4LKXA 2NQ2C 3B9VA 3EFDL 1OT3A 2ECKA 2I4OA 2HHCA 5E1IA 2IELA 3FSRA 4AW7A 2OM5A 3U37A 3B9RA 1MCKA 3ZIAD 3IDMB 1JZ7A 2NUPB 2NY6C 3S2CA 1IO4C 3JZ7A 5F8RC 4EYSA 1RT9A 2CE6A 4LLQB 1H3GA 4Y16D 6FABL 1I8KA 4CHTA 3SEFA 3QDGA 3LNHA 2CJUH 2AQSA 3QU2A 1TJIH 4R2LA 4K6CA 1XU9A 4YS6A 1JZTA 5J58A 4KTEL 4TN1A 1AN9A 3O3BA 4IGFA 1KGJA 1JJIA 2OFWA 5JRZA 1Y5RA 3KX2A 3SHQA 2YPVL 1EX6A 1WD9A 2F61A 5DK4A 1VCAA 4AWXA 1PGPA 2WJYA 3GT7A 3R8BB 4ZJUA 3ILHA 5DPMA 2X4NB 1OLXB 4AYMC 5K7SA 4JREC 3CIOA 3DXZA 1AGFB 3E05A 1EO5A 4EG4A 4H20L 1D5ZB 4GAFB 5IQ9A 5I48A 5JVDA 2VDLH 1YQQA 1DVYA 5FDFA 3N5CA 4O59O 3WNNA 2RCSL 3UL4A 5C6TL 3IAM1 2H17A 3LH9A 3HJHA 4I08A 1TVKA 2OGTA 2ZI5A 3RE1A 4AQYB 3DROB 2Z31B 1Y9ZA 1UCTA 1H5QA 1E9OB 4OMDA 1OH5A 5F1KA 1E7WA 1RI2A 3AHCA 2AAVA 2BERA 1KENH 4WU5B 1G59A 5AT1A 4AM0B 2VRWA 4C0KA 1NDMA 2ZSBA 5AW7A 3QPQC 4OXQA 1UC8A 4JCCA 1BS1A 2OKCA 4H88H 3MYJB 2QUZA 4LCVA 1PP4A 2ODPA 3H13A 3F58L 5JH7A 1LGYA 4CN4A 4DKEL 2OEPA 2F5AH 3IJYB 3KJFA 4ZC1A 1QYGH 3OAYK 3NEPX 5LUMA 1DUYB 1OF2A 1R3IH 5K8LA 3MLBA 5IFHH 4O4JA 3BPLC 1U4EA 3ICPA 2C7RA 5J89A 1A3RL 3HBGA 4OGYL 4JITA 2Z6VA 2PWDA 2AK4A 1MLDA 3AG2B 2COKA 1AB5A 4LEXL 3M17B 3SJVA 2ZTUA 4G9FD 5AI9A 5HYJA 1QK3A 1UVQA 1LK3H 2XKSA 1NBIA 1LPAB 3HMXA 2RK4A 4A8PA 2PT9A 4CLRA 4LCCC 3MC1A 1NF2A 1Y3CE 1Z5WA 2VDOH 1RYFA 4M5ZH 4DK3A 5LUBA 1CUVA 4EHHA 1BV8A 1ZHNB 4UZEA 4P38A 1JHTA 1KJVB 1XCOA 4PRHE 3FNRA 1QIIA 2HFFB 3C3MA 4BO2A 1WAPA 3PC8C 1XJQA 4FNAA 4JCOA 2HHJA 1L7IL 3BUSA 3FQ4A 5BNZA 1W75A 3NDJA 3I9KA 2ZE6A 4LSRL 4BHUA 3EUFA 5JCOA 4FMVA 2RB5A 3BP6A 3CKLA 4D02A 3AQDA 3EHEA 1H2YA 4Q3OA 2QRQA 3A31A 3MLEA 2JW5A 2WSKA 4MP8A 2P91A 1TZ2A 3ZZUA 4PWHA 4MDYA 3Q9QA 3SHVA 2XZCH 5EVJA 3IR6A 4O51B 1TO2E 1C08A 1XXHE 5CJ2A 4DZRA 3ODPA 3ET4A 3HO1A 4N76A 4JHAL 4U1NA 2JEYA 4GYYA 3P9PA 3U83A 5TARA 3SZ3A 5BSEA 5MEQB 4X5XB 3I6LE 5E5UB 2YR3A 1E98A 3JQ9A 3MRVA 3UPRB 4IF6A 5K59F 1F1AA 4Z78B 1GG8A 3IXAA 2BZ1A 1FRNA 4E12A 3HVKA 3FN0H 1EEHA 3F7VB 1XCBA 1P5UC 1UFOA 3NYIA 4I81A 3C5ZA 3K5SA 4HIJB 5HNKA 2Y0DA 2IYPA 4TV3A 4BZXA 2R1VA 1K63A 3TTVA 3N9GL 3P27A 5G3YA 1UWXH 3G9UA 4P5PA 1KMGA 4YSAA 4YALA 4P2RB 3U61B 4M1DL 4WIQA 2AXFB 4XPTL 1Q0HA 4XAKE 3EZJB 3DV4A 1FO0H 2PIAA 2NYAA 1IBMB 4PG2C 4RTPA 1WWCA 1PLKA 5HVWA 4ZMLA 2PLTA 3L4VA 3MJ9A 1XKTA 5KSVA 1NJ9B 3I64A 2FJGB 3UJ6A 4WWKB 3UROR 4G63A 5FYLL 3D6AA 1ESNA 1H6DA 1EZVX 2J9RA 3OWRA 5CT4A 3WYCA 1RKBA 4FR2A 3DBXA 1HDYA 1JQ5A 5I26A 1CYGA 5K3EA 3EDKA 4IJ3C 3AM4A 3F4LA 3GB7A 1AZVA 3CIQA 4D45A 2O2DA 3IDXL 3Q6NA 5ADWA 1UD8A 4OI1A 1NLDH 2PIDA 5EIQA 5A7GA 1QHSA 2G1PA 3FMGA 3QORB 3LIUA 4YHHB 2HJLA 3N0VA 1MUUA 5AW9A 4PY2A 2YUZA 3R7FA 3CVIL 2DWXA 4ZUSB 4X0KA 2BNRD 3X12B 3A11A 4MQ7B 4WW1B 3P2DA 5FV1L 2IU0A 4J9VA 3G6JB 1F90H 4WTQA 1ZUNB 4R1SA 3MUNA 3RVBA 4YHBA 5C2BL 3O8NA 4L37B 4U3JB 3BVXA 5H35A 2KDGA 3WZLA 2CUHA 5DE3A 2NVUB 1QEWA 2HT4D 1E5XA 3FPJA 3EGDA 3M1BB 1EJ8A 3OFVA 4FQIH 5D4IA 3J7AC 2P40A 3IE9A 3C43A 1F2QA 4BB5A 3M8OL 3ET5A 1QRRA 2XICA 3LZ6A 4IO1A 3F7YB 2Q4EA 3IBCA 4REQB 4TKWA 4I50F 1U1GA 4R9HA 2PCXA 1PJQA 4NMXB 4I14A 1I36A 3FZNA 3P77A 2AMVA 3F96A 3KS9A 3F3KA 5FBVB 3QJFB 1CUEA 2GZMA 4U2BA 3RNKA 1N6UA 5E5LA 1R2QA 4A4DA 2Q7YA 4QD3A 2QL1A 2OKGA 4AYID 3CBRA 2DQYA 4DG8A 3QX9A 2GEQA 4WFKA 4IIFA 1N0UA 4R8LA 3C09C 1XF4B 3DEHA 1NWCA 2KZKA 5D7LE 3UY4A 2C7BA 4QOSA 2EU8A 3DVRX 4E2FA 4XW2A 1RKRA 16PKA 3ED1A 5BMFH 1VP9A 1LJ8A 3GRFA 4B47A 1JV2B 3P52A 5EA0H 4EN3C 2IY8A 3H6JA 3WGYA 1EWVA 3O6ML 1CNMA 3LZRA 2X05A 3S27A 1X19A 1XZIA 2EACA 3VHQA 2XX0A 1G21B 2AFIB 3C8UA 2RHGB 2DKOA 5CLXA 3V0AC 5DLMH 3A0OA 1QK5A 4WN3A 4M7PA 3VRHA 3QE4A 5ALZA 3GMNA 3IK2A 1JR3A 5FFNA 1M54A 4I3SH 4YQFA 1U8QB 5HGGS 3AZOA 2ATVA 4AH2A 1NKSA 3WLBA 2A58A 1GS8A 1T2JA 1WW3A 3U4QA 1FTYA 3QO0B 4QQKA 3MCAA 5FL7A 1L0QA 5ISMA 4ZYTA 1J5EB 3TIXB 4UT9L 3MNMA 4ODTL 3WMPA 1YQGA 3K09A 4D41A 6REQA 1MZYA 5B1JC 3L8ZA 1YDGA 2R9HC 1A6WH 5FC9A 2PWGA 2V8BA 3P9YA 3VQ2C 1LNZA 3IKTA 1SYSB 1WUYA 3GXNA 1NQOA 4B60A 2XPYA 3VFVB 3JQOB 1KY4A 1GYCA 4HXBL 2OCYC 4BGEA 4OSOA 4J0GA 1WR8A 4G5ZL 5D55A 1CRPA 3WIBA 4PNZA 4NP9A 2C4KA 1X1AA 1JEQB 3ZKQD 2WWMC 1FUUA 4P06A 5A3VA 4EI5A 2VZVA 4HS3A 2OP0A 2LDXA 2OYSA 5FLEX 1YEKH 1JFQH 5HZKA 1T0NA 5EHNA 4BLOA 4LAJH 4PCYA 1X7XA 3BB4A 1IGJA 4DMCA 5EEWA 2MFNA 3S3SA 3GZTB 4PQEA 4MJID 3VI4F 1T66C 1F11B 3IQFA 1QZUA 2WM8A 2GK0A 4HQ6A 2VZEA 3I9LA 5HHNA 4ZANA 3PIRA 3TA3D 2FRDC 3JSAA 3M1IA 2FLMA 3ZLBA 4N8PA 3EW7A 2J67A 2YD4A 3O90A 2FJHA 5CDSA 4QPCA 1BQHB 4PW0A 5DTJA 2FPWA 1JI1A 3QCVH 1MB0A 1UWGH 5MFPA 3EJWA 4JCMA 2MPAL 1I3RB 3O2SB 5E2TH 3WKNA 3GMRA 3FT4B 3KJ4B 4YP9A 3OKPA 2EO7A 5I66A 1DHTA 4MNQE 4EZBA 2G04A 3ISRA 2R7KA 5IROD 2WMOB 4P2QE 1TVEA 3B7TA 2UYOA 5IDWA 2Z7UA 5AMXA 3TO2A 3T08A 2R7EB 1BZ7A 2DQCH 2WR8A 3TFQA 1MJGM 3ZHOA 3F9RA 4YGAB 1J9RA 1D2AA 4RPJA 4S1SH 4AZTA 2DLTA 1PVVA 4EBFA 4TNWK 3IU3B 1BXUA 4NFLA 4WAUA 1HH6B 1CUBA 4FI7A 4RDHA 1I3NA 2XUOA 3ZHQA 1I1AD 4EQZA 1TEGA 3UMCA 4R3WA 1PX8A 4QC2A 1BBJB 3R9XA 1QZ1A 1ST3A 5JAMA 4CA4A 1X74A 4BNNA 1JKIA 4U7TB 4K9OA 5EV7A 1FDUA 3RL1B 4R1MA 3DUFA 1Z0SA 3DEZA 3FB4A 2IGFL 4N2FA 2UVPB 2H1VA 4EHLA 2GQ0A 4X54A 1L9RA 1CICD 2X2UA 4C43A 3RRYA 3EGEA 2Q76A 4GI2A 3QW9A 3P0IA 1BLNB 4Z7UE 1Q6YA 1QWNA 1HHKB 4O58H 1N2EA 2HN9A 4IMRA 3ICCA 3EIUA 4EIZC 3SR3A 4I6JA 4F93B 4ZT6A 1UPXA 3JWDC 3ABIA 2ZYIA 3DARA 1PT9A 3ZU2A 1UOPA 3JU3A 4RFEA 4LEOA 4BCCA 2P24B 4I9WE 1H0RA 3RYIA 5JY1A 3QCUH 2ZFUA 2P9BA 2IUYA 2FYVA 1W85A 3KJ6H 1UG9A 1N12A 3IAXA 4Y89A 2XEDA 3NA9L 2O07A 5I1IL 4OMFG 5FRDA 3RS8A 1WCXA 3N3BC 1ZA2A 2JARA 1IGCL 3NJHA 4LQFH 3W1VA 3FB5A 3F7KA 3IWUA 3EYSL 1RJLB 2NADA 4JO3L 4Q3NA 1EQWA 1K4MA 3BEOA 2NU9A 2WGNB 1ID5I 4P31A 2O06A 1AU9A 2W8ZA 1GRQA 1H05A 2D74A 3RILA 2P4EA 1G7LA 2H9IA 1FSGA 2G9KA 3WGOA 1M1XA 4L29A 2VL5A 4PLKD 3P4NB 1GC1C 2Y1WA 2PWYA 3QJYA 3IQEA 3OIFA 5CR1A 2H1PL 2C9ZA 1WSAA 3TO5A 2H1SA 2R0ZH 2DFTA 3KOYA 3QHFH 4ZQFA 1JWUB 3NH6A 3QDGD 1I7PA 3BT7A 5EYPA 2BHZA 1H2AS 4DMUB 4F1SA 4GG6A 5TV2A 1F8YA 5A40E 1IGYA 2E4VA 2AXGA 1AIZA 3L6FA 2G1KA 4NT6B 2PS9A 3RYTC 5BV7A 3OPMA 3IU4L 3JTBA 5E4OA 3KKOA 2PX6A 4DDUA 1X7GA 4JFQB 3BFWA 2YS6A 1RJYB 3T7AA 3H1GA 2HV8A 1A9BB 1JLKA 4HUQA 5IVIA 3VU1A 4ONHA 3S28A 1CFVL 4RFVA 3ZPDA 2FDRA 4TXMA 3ZDBA 3TNJA 3UBGA 3GDWA 1W72L 1F6AA 2E4ZA 3WSQH 5JZ9A 4O0MA 4KRMB 2B61A 7CGTA 4OBSA 3VO2A 3BSGA 4TUKH 4Q3DA 3VSBA 1ND5A 1JFVA 6Q21A 2X6QA 3IRCA 2WSMA 3CCHA 1ZV5A 2K5UA 2VB5A 4NH4A 4ODSL 4XVUC 3FO0L 1CMOA 2DTDA 2H07A 3TW6A 3NCMA 2BZDA 2D3VA 1S0UA 4LF3B 4EUNA 2J87A 3C8HA 4AIZB 3PXEA 1Z12A 3JAKB 5ADOL 4B9CA 3OB0H 4CVXB 2PW1B 4L2IA 4RWZA 2HIMA 2JCSA 4D9LL 1FVCA 1FI8C 2RGDA 5J3JA 4I18A 5DHRA 1S3RA 4UNTA 5E4FA 3S40A 1KKMA 4YP0A 2AUTA 3SQMA 4B3VA 3VO0A 2CG9X 2WK2A 5IFLA 4O4HA 2PT6A 4X6FB 3Q8FA 1LBHA 4TMFA 5IMOB 1JL3A 2JKWA 3WLSA 2VMEA 4BKSC 3C5SA 1E2DA 2PRSA 3CSDA 3BPCA 1PYWA 3ZE1F 1V5WA 4L22A 4IILA 3ZTJH 2AK4D 2VUKA 2A9VA 2DH6A 4JRYB 3CDCA 4CGTA 2F8MA 5D1QA 3SJVD 4K9SA 1AHKA 4RIGA 3P9LA 3FQYA 4ZYXA 2X6CA 2NCEA 3QDJA 5HYJD 3N43B 3EJUA 1I80A 3ZGXA 2ZJ0A 3HG2A 1KVSA 4LP4A 1ACJA 2AC4A 1SHMA 3HWRA 3T61A 5LMNB 2NY1D 3PXBA 4M99A 3GNML 1SOSA 3KZ1E 5J7CC 1MH9A 1ZPUA 4Y2TA 2B7BA 1NEZB 3INUL 4R01A 1XZKA 1W4AA 4KZEH 3MPOA 1I3MA 4AICA 1RJZA 1TITA 5K3AA 4JBHA 2HG0A 4TVPE 4KGDA 3T4XA 4CMHC 3BJ91 4RELA 3FWKA 4ZJYA 2BHRA 3IDMA 3SE6A 4FFWA 2NUPA 1XWVA 1LX7A 4KE7A 4KITB 3BGDA 3PL6B 3MT7A 3SXUB 4JL5A 4LLQA 4HQNA 1BAFH 4PMEA 3CZFB 1RC1A 5CWSB 2QD1A 1KSFX 1WCWA 4NEHB 2Z8ZA 2BEJA 3LCRA 1RIVH 2GFHA 2VDMH 3AXSA 4JEGB 2BT4A 4MCZB 2CN1A 1RBMA 1HY3A 1C0KA 4KRGA 4BNHA 3KDSE 3EKCA 1JDCA 4BB9A 2R11A 2VRKA 4O00A 2AN5A 2OL3L 3G5WA 5F64A 3D2AA 2ZRFA 4PVBA 3MK31 3P3TA 1NQVA 2MDTA 3D8UA 3GGSA 2X4NA 1OLXA 1J2YA 3IVMA 5L8LB 1Y4SA 1YJDL 2Z7WA 3RAJL 1T5KA 1FX0B 2F43B 2OMXB 4WINA 2XUDA 2EYTB 1F3RB 3WB0A 2X3AA 5M2QA 1MXGA 2Y9PB 1D5ZA 3O6VA 3HE6A 4KDWA 5DTFB 2HFGL 3H9GA 1CZRA 1WU8A 1SQ6A 1Q5PA 3C5ZD 3E9TA 1OVGA 4J91A 1GT6A 2XMZA 1D2NA 4O6VA 2Z31A 1E9OA 1QZXA 3PGLA 1YNTB 5F1IB 2XNHA 5K0NA 4WU5A 1Z0DA 5JHMA 4AM0A 4Y0AA 2WHPA 3IXQA 4NN6C 3DMYA 3AF6A 5K5EA 1A8SA 3R1GL 1C0PA 4COOA 4HDAA 3CMOH 3LS2A 3MYJA 1O4WA 3FSEA 4I1NB 4GF5A 4J9UE 1T0OA 5EE1A 3ANYB 4WLUA 4MLIA 5FYKU 3ZQKA 4OFWA 3VOAA 4CQJA 3DDZX 3KXPA 3PQ4A 1XALA 2OFFA 3IDQA 1Q4NX 3IJYA 3F98A 3DXAB 4DB4A 1PV4A 1NMCC 1VEPA 1DUYA 3KU4A 4TYUA 4Z18A 3OESA 5F0LB 1JZ5A 4CT4B 4KRPB 2GC4C 1G6OA 1FMLA 4XVTL 1CXEA 2PXHA 3OSVA 4HWUA 1E3FA 3T6QC 4DPBX 3EDYA 3KCWA 4UU9B 1YF3A 3M17A 3WIUA 3L7LA 5ERGB 3NZHH 4MNTA 4YDIH 4HAVA 5SZHB 1DUIA 1GQOA 5IVKA 4B53A 2PX8A 3UUGA 4B3TB 1JFLA 4CDNA 2XE6A 4L4ZA 2FQQA 1ZHNA 2PR2A 4PF1A 4EDWL 2XYVA 3AKYA 1KJVA 3FTFA 1NIAA 4JO1L 2WLJA 2HFFA 3UO1L 4A39A 4LHWA 3JWOL 1R0ZA 3D0LB 3PNQA 4AWAA 5CS7A 2XTNA 2WLSA 1KO1A 3CQ9A 1OZUA 4TZ6A 1V95A 4FAAB 5A4MS 4WV1C 4KGLA 4UJ5A 3HZMB 2FGZA 3HG3A 1A9PA 2F7IA 3RHWK 3EJQA 4KKAC 4O51A 4O9HH 3QG1A 3SN6A 5J4VA 4H7PA 1TTRA 3I5YA 1LDSA 3PVSA 1Y4ZA 2NTYC 3V6OC 4WSGA 1XDZA 4L28A 1XEXA 5MEQA 4CWAA 4HCJA 5KX5F 4QNPE 4X5XA 4NZTL 1I14A 1VE9A 3ZBTA 2COQA 3UPRA 5FCDA 5CEYB 2WKRA 4Z78A 2HO5A 2BMWA 3UC9A 1Y6FA 3QKIA 4F9FA 4G4JA 3F7VA 4DTGL 3VA2C 2X44D 2J3LA 1JLRA 1XCTB 3GAFA 4RC9A 3L4BA 5ICMA 4AURA 4HIJA 4ZCLA 5KSBB 3MRMB 2FUCA 3WK6A 2IFFL 1HYQA 2VSNA 4A8TA 2FZ5A 4G01B 3L17A 5KSUA 4C3ZA 3WMFA 1ZLVH 2DMKA 4ZTZB 1NTRA 1NW3A 1CGSL 1JR3D 4P2RA 3WSTA 4EH1A 1CF2O 3VXSE 2AXFA 3WS6A 1AA6A 3VMPA 1B0UA 5ECDA 1USZA 4G0VA 1C9NA 2LCIA 3QIBB 2AEQH 1NJ9A 1IHPA 3QUGA 5FL7D 4N3BA 2FJGA 3AY4A 2OTCA 3P2YA 4WWKA 3W5HA 1TZIB 4DMLA 3FU6A 4EA8A 2XJLA 3GOHA 2XD9A 5EOQH 1MR3F 1F4PA 4WSKA 2K7QA 3FRUB 2J5LC 4JM0A 4K05A 3EJTA 1E2KA 3KEQA 3K15A 3AMLA 1BVYF 1T4BA 3OXSB 4KSBA 3ILQD 4AO8A 1ZRSA 5DC0A 3ETSA 4NU0A 2E27H 1TEXA 1KIUB 3RZCC 1EHYA 3QORA 3T1FB 1G6VK 1LK7A 5LXTB 4UMSA 3QVKA 1IUPA 1NICA 4EI5D 4F3FB 1DT3A 4ZUSA 3X12A 3L6BA 3GK8L 4MQ7A 4WW1A 2NVOA 4NDNE 3H1AA 5EQDA 3G6JA 5LP6A 4N2IA 1E5AA 2Q6KA 2Q1YA 3D6HA 3CDGB 5BZWB 1ZUNA 3ICEA 2A77L 3FE2A 2JAQA 3SSMA 2UZ1B 5DNYB 4L37A 4U3JA 1ZIXA 1O0CA 1O5IA 1ZLSH 3WWPA 2NVUA 2WKLA 3IUYA 3M1BA 2ARJA 4XNQB 1BJTA 4NBZB 4F9PA 1UXHA 2QROA 1H6EA 4PZEA 2BFEB 4FJ0A 2D8AA 1FYTB 1ISPA 2QTBA 2V58A 3F7YA 4PRBB 1H93A 1HX7A 4W5HA 2R15A 5JTWA 5FHRA 3MUEA 3DLHA 1XZMA 1TZ8A 4NN5B 4X7SL 4R8MA 1YR1A 2CO4A 3FU0A 1E6UA 2C2GA 1PT7A 4CHGA 1A6ZB 2HT2C 3QJFA 2ZQZA 4QEDA 4BMCA 2YJ5A 3CAFA 3L3IB 4OIBA 4MV9A 5JDCA 3OMZA 1DXQA 2EO1A 4MWDA 5ES3A 4ZS6C 3WHIA 2I1VB 4JZOB 1J1PH 1L6IA 5CGBA 3N6RA 1XHFA 1CT9A 1TZAA 1ZN9A 2CLFB 5EIBD 1XF4A 4B2LA 4KTYA 4YCLA 5HSGA 4Z3OA 1M9SA 1VKHA 3PVCA 4A6YB 3VNVA 4B50A 1RPNA 5AVUB 1JV2A 2WLMA 1D0VA 4M1QA 2J07A 1EXHA 3ALXA 3C6ZA 4RNRB 3UH8A 1BQLH 3N86A 3MT8A 1ETJA 2V9QA 2W2PA 1ZHLB 3QZBA 4NAQA 3A9SA 3PREA 1G21A 4RGNB 2AFIA 2JG3A 3E3MA 3DZCA 3MMEB 4R71A 4FB5A 4TKMA 4NM4L 1HU8A 4D74A 4D80A 3AADB 1YE3A 1VP3A 3NHZA 4M2LA 4AM8A 1WM1A 4H1HA 4DR5B 1JVKA 4A7VA 1P9MA 1N2XA 2YA1A 721PA 1J00A 3QO0A 2LE9A 3B5GA 5IW6B 3ES9A 3BH7A 2NY3B 4QTYA 3ZCUA 3GLFB 1M7BA 5DDIP 2EKSB 4AIEA 1JI3A 5GS1B 1L9KA 5HHXH 3PWUB 1SYSA 4F5ZA 3TQIA 3VFVA 3I2IA 4HWNA 4Z0PA 3ZXUB 1HE5A 4LHZA 4XPZA 2XWEA 1KXVC 4HRYA 4YC7A 1JVBA 1ISSA 2ZRIA 4YI5A 1S2MA 3WZMA 3AR3A 1JEQA 3EDDA 2M1XA 3CHQA 4YZFF 1LNUB 3QVMA 1JF1B 2VYNA 1EV2E 2HN7B 3H3XA 5F7HA 1BJ8A 4APQC 4X6LA 3VVMA 1OT1A 2RBGA 2NMVA 2VYVD 4BA8A 2GA8A 1XDDA 1R6XA 5AAWA 4UDNA 3SYCA 3MQ4A 2SODB 2RAUA 1WLHA 1F11A 4MAAA 3PGJA 3FGNA 4BFJA 5FHAL 1ZM7A 5GQBA 4W1QA 3T9AA 3L5XH 4JRWA 3CJQA 2F54B 3KDPB 5BQOA 4WXPA 3NIDF 2PUCA 3T5BA 4WTWA 3LGAA 3SS9X 2HY7A 2ET6A 5DM60 1BQHA 5SX5K 3QOWA 4HF7A 3A70A 2KLTA 4LAQH 4WY5A 1E1LA 4ND2A 3D12B 5FHBH 5CVDA 4UU0A 1IHOA 5T64A 4MH0R 4EJFA 1I3RA 4P81A 5BPFA 4MZXA 1T5WB 1Z39A 2QPFA 3G2KA 3UICA 3IEUA 3FT4A 2WQZA 2JGFA 1KCVL 3ZY6A 2IE8A 4IUBS 4RFLA 4R2GD 1HCFX 2VDPL 1GOHA 4QJ4B 3GF4A 4KQHA 3Q8BA 2Y77A 1IL0A 5EG5A 4I1IA 4FEMA 4UTOA 3OFSA 4OV6B 4EQ6B 3TZHA 2VWPA 3FT1A 4L0PB 1XJ0A 3KD3A 4PAZA 4PZAA 2R7EA 2B94A 2Q3XA 3QJVB 3RHZA 2BFOA 2D7TL 3I3DA 4EIWA 4ZQBA 3TDMA 4DSZA 3KVOA 1YAIA 1LPBB 1ZSVA 5HG0A 1XGRB 3F3HA 1LRLA 1P2UA 3IU3A 4M9SA 1HH6A 1R5VB 5JJCA 3MRFB 1O08A 2WIGA 3CK0L 4H1VA 2BE9A 1BBJA 3NMEA 3FNQA 5KSYA 1X87A 3NBYC 4U1IB 4HB4A 2ERCA 4L5FE 1DQVA 2ZDQA 2WIBA 1PWZA 2CNOA 2OG1A 3RL1A 1GY1A 1GOGA 1TCVA 2A38A 4U2ZA 2UVPA 1P6QA 2CMFA 1KTVA 2FJFB 5EJAA 1XGTB 5JJLA 3DUUB 5E9DB 4BK8A 4FCVA 5DUBB 1XK7A 3I50H 4NEGA 1U7PA 1BLNA 4XJVA 1HHKA 2LKDA 4PPYA 2N1MA 5IKOA 4ZS7H 2P28B 2Q7XA 2WTMA 5I4CA 4R0LC 1ORWA 4XIYA 4LSPL 2GAFA 3VG0H 1FVEB 2FW0A 2VN8A 1TVMA 3UCFA 4A6YH 2F53E 4B3RB 2FBJH 1V47A 5CT5A 3SJBA 2C92A 2Y06L 1XEWX 1E7SA 3R6WA 2UY7A 3ZDEA 1ZAKA 1ES9A 1GZQB 1C9MA 2P24A 4UV7H 1KBWA 4UDTB 3M3PA 1WEKA 3ZWMA 5CVJA 5I9MA 3QWRA 1LPMA 4B0OA 2Y2TA 4FCWA 4H26B 5D1QD 4AJHA 4AGOA 3RC1A 5EZIH 2Y9MB 4RV5A 3QDJD 1U7WA 3EVDA 3A2MA 1WVIA 3L95B 4F38A 2AOVA 2EEXA 2IXGA 1BD2E 2PPVA 5G0SA 3U80A 2JKIS 3CLVA 3VH8G 5IBCA 4M9QA 4HJGB 5KQSA 2ZG2A 1UUNA 3GN2A 2Q4RA 2FEOA 3IVRA 3P4NA 5EEUA 1QVAA 1TX4B 4FFWD 1JKXA 4DCVA 2YHIB 1I4DD 2HLNA 2EKZA 1RZJC 3C3YA 4KDVA 5I8OL 1FDLL 4GIBA 1JWUA 3AO0B 2JJYA 2QIPA 3CLTC 1UINA 4QBFA 4HUWB 1CR1A 1ENZA 2FB4H 1A6TB 4XGRA 1K3UB 4RQAA 5B55A 1VIMA 1Q0PA 4YVNA 4EVIA 1O9GA 3IQXA 1DHKA 3PPXA 3P9SA 1KZGB 4NT6A 3Q8XB 4NC2B 4R7XA 4JFQA 3NHBA 1A14L 1V7QA 5CJ8A 5F35A 3QPXH 1A9BA 1X5XA 3EPJA 2JK1A 4X9GA 1E32A 3D8NA 5DZJA 2GZAA 2XDAA 3K8YA 3M6AA 3UGQA 1D3AA 5CK4A 2EDJA 4N1EA 3KLPX 4FGZA 2E7MA 4O2LA 3UAXA 4U4IA 3HE6D 2AS5M 1L9OA 1GGIH 1MRFL 1YEWA 2B4TO 3UKDA 3MKKA 3VXUB 4JKOA 4K71B 2A5FA 3OFKA 4PCLA 3LUGA 1VLLA 1RZIB 1WU7A 4W70A 2R7AA 2Z31D 2ZIUB 2PMEA 4HV8B 1CUWA 1J97A 3QWIA 5BSVA 5F4ZA 4ZK6A 5CXQA 3P45A 3AB0B 1JIBA 4EX7A 5I51A 4E2XA 1XCGB 1RZGB 5J5CA 1PZFA 4U7DA 5C5DA 4ZO8A 2PZMA 4AEHL 4AIZA 4PLCA 3JAKA 5CW2A 4W6XB 4BOYA 4CVXA 1ZRUA 1ZD6A 2PW1A 3EAFA 3VH2A 3HI6A 4LHSA 2V5YA 4TNFA 3T4YB 4ICIA 3UOGA 2GN1A 1ZH4A 3FDFA 2RH8A 1FXWA 1UODA 3P69A 3LIPA 4PLFA 1XD1A 1ZEJA 2CL0X 4X6FA 4UUAA 4BNYA 5IMOA 3PG2A 4H1LB 2P26A 2QUAA 5FLVA 4ABVA 3VKGA 1T35A 2VLIA 1CCWA 3DMGA 2DQGL 4JRYA 3T2OA 1I5OA 2R6HA 1JPTL 5MHSE 5T5FH 1DTSA 3DUSB 1P6XA 3Q6GL 2EZUA 4Z76A 3NHAA 4IQGA 3MA0A 5DGDA 5DBOA 4M3NA 4LZAA 1KC5L 3ORRA 2DQ4A 4QFMA 2A4CA 1L4KA 3BSSA 2D5BA 4N2EA 2WNIA 1VEOA 8ATCA 2JFPA 1NEZA 5HJEA 2JKTM 2NXYD 2DUJA 2V3EA 1I7TB 2LOEA 2Q5JA 4PLWA 1KDJA 5DT1L 4CPDA 4C7MA 4E5UA 4ZCRA 3VO9A 1ECPA 3OT1B 4I50B 2ZRCA 4U1MB 2HRZA 4KQ3L 2J4WL 3PL6A 3SXUA 3GIZH 4QHPA 2JI2A 3CZFA 5CWSA 2JI9A 2DTEA 5BR7A 1QOPB 4DLAA 2FWUA 4MCZA 5G1OA 1M1YE 2BGGA 5ADPL 4MUMA 5A9TA 2HUEA 2I6QA 3HCRA 2C29D 2X0UA 1M7HA 3NCTA 2O5CA 4ZALA 3IB6A 2D7OA 4DESA 3U5ZB 2HPTA 1P84J 3PCYA 4JKPH 4BGUA 4LIQE 4FX2A 1OGJA 4CUCA 3R6DA 2FPUA 1KB9K 1UENA 1S96A 4GLBA 4QY8B 2F43A 1I9RL 1FX0A 2OMXA 2EYTA 1NOAA 3G8YA 4K2HA 1B43A 4XMWA 4CU5A 5DTFA 4MCNA 1N92A 4MDRA 1KI1A 4TWIA 3D7PA 5B3LA 4C0HA 3O8LA 3STZB 3N0AA 1FDRA 2VJYA 3LDFA 5KVVA 4KXDA 5EP2A 1YNTA 3RABA 1XMIA 5TR9A 4P2RD 5DTQA 3NWOA 4MD4B 3OOSA 1TO4A 2QGFA 3QTTA 3G68A 4O5OA 3R44A 5CB0A 3V0VB 2Y0SA 1M2EA 3O3OB 1VPWA 4JDTL 4DARA 1Q0QA 1NW4A 1M7XA 2YEQA 4RTKA 5TH2B 1CFQB 4YGXB 5L4SA 4LZLA 2G1AA 4WWKD 3DXAA 3U7HB 5ALCL 1E9PB 1ZD3A 2V5UA 4YR6B 2G76A 3SKXA 2IXEA 3WL5A 2BY3A 4GHWA 1QFWM 2PK3A 1ZOIA 1Z5YD 1KJ3L 3L1OL 4MW6A 1DQSA 4BN0A 3LC2O 4HMPA 4H7DA 3KH3A 4HN9A 1ROWA 2BLFA 4UU9A 3QFCA 4LWZA 2VP9A 4CMMB 4UV4H 1ORVA 2ZRGA 2BGLA 1SUFA 1Y9JA 2B2CA 4J27A 3QORD 3ZV5A 4UREA 3JWNC 3ZL1A 1IQ0A 4HLZH 4UOZA 2E0PA 2HIAA 3BB1A 1SEQH 2G63A 1M6UA 3WNPA 2PSHA 1IMHC 3VI4B 3ATBA 1F3DJ 3T6ZA 3TOCA 1HGXA 4X2UA 2FUNB 4N0MA 1X7TA 1MX3A 5K0JA 2ZYVX 3D0LA 4L05A 3WEAA 5CURA 3U4BL 2X4UB 4ZBJA 1SVBA 2HT1A 1GKYA 1SVKA 1U7TA 3CKMA 2OBXA 5KHLB 1A88A 1DQLL 3HZMA 2CXQA 4WEMB 1V5IA 2DJUA 4ESOA 1NQXA 3V0EA 5CGYD 3EIHA 3K6JA 2A4ZA 4ZFGL 5D7BA 1H9BA 3ZK7A 1BO6A 1C7TA 3C8DA 4UVDA 1LDPL 1NP7A 2I2BA 1O7DC 2JKYA 4NQDB 4CNBA 2D2FA 3BDYL 4LTNA 1XR9B 2D1YA 4X7MA 3L49A 3DMNA 1ML4A 1ODUA 3ZKXB 4FQCL 2QQLL 1E0DA 2V2WB 1JNHB 5CGZA 4PS4L 1MFEH 4QDJA 5TS3A 2FZGA 5DYIA 4N7JA 5BYAA 2DKSA 3LUBA 2ZDHA 5K9QG 5JMPA 3MQFA 3WP0A 1XCTA 2WMNB 1U36A 5KSBA 3MRMA 4Q9QL 1MAUA 1UJBA 4OH7A 1OF1A 3R5SA 4JB0A 4BO7A 1R16A 4ICXA 2RH4A 4BMPB 3UHJA 5DMGC 1W73A 2C2KA 4R69A 2Y0PA 3EHBB 5HYQB 1KFBB 3QIBA 1Z5NA 4X9BA 1BSVA 3NHWA 2X0FA 2I27N 2Z3ZA 3R5XA 1R7RA 3R06B 2B9EA 3KZNA 2QXTA 1TZIA 4MJ7A 1W46A 4D2NA 1U0GA 1EK5A 3FRUA 1LTXA 3LOPA 2OBBA 3SOBL 2C1ZA 3OXSA 5DFAA 1SMKA 3EJCA 2OGZA 2D8KA 1CW2B 4IRSB 4QJIA 3S5LG 1ZJWA 1SAYA 3VC2A 1DQDH 1B4RA 1O6CA 1XAUA 1KIUA 4QARA 3FHTA 4MRAA 4TPRH 3T1FA 2HADA 2HA0A 4F4JA 3TQQA 3BAFA 5CHEA 3FDZB 1BP3B 5BS0B 3WE6B 5LXTA 1DJLA 2UYHA 1QF9A 5BSFA 1MFPA 1MWAL 5F3WB 2VYND 2I29A 4UHJA 3OLEA 3C16C 3ECVA 1EWTA 3VO8A 1OE1A 4ALKA 4OLUL 3CDGA 3WS7A 5BZWA 2YD0A 4C0WA 2UZ1A 1BA3A 1T5OA 3PXGA 3LPDA 4PYLA 2YJQA 3JVFC 1WP9A 4KK8C 5C7OO 4XNQA 3AH8A 1Z06A 5FTJA 2BIFA 2BFEA 3U48A 1FYTA 4WOCA 821PA 4DC0A 2CMKA 4HZIA 1UAYA 4PRBA 3NPSB 1G3RA 1NN3A 1ZANH 4QM7A 1LE9B 1E2ZA 4KI1A 3TLXA 3SKUD 4OI8A 5L2KE 2WUVA 3I1YA 2YCBA 3VDAA 2F58H 5KQPA 3NM5A 1A6ZA 3M6MD 4JEIA 1E0KA 2YD3A 2AMJA 5DX1A 1K72A 3L3IA 1WIPA 2JI4A 3B3AA 3I2KA 3MCG1 2GITB 3ZYIA 5DJ6B 3WGJA 4JZOA 1W91A 4TQIA 1I7UB 3O2DL 1AKEA 3G8DA 2AI3A 3GLSA 3A26A 3GRPA 4E11A 4BFLA 3TBVB 3ENQA 1NBYB 1AO7B 4A6YA 5IAEA 4OU3A 1W96A 1RHFA 2GO7A 4ITUA 5AVUA 2BGRA 2IIVA 4MGIR 1ZD9A 3VR0A 1U8OB 4Q5IA 3LJKA 2PPCA 3AJRA 4RNRA 4DVRL 4QTIL 4JZJC 1R9JA 1M6OA 2YV1A 1PI3A 3HA7A 5AJHA 5CJXA 2DCMA 3ME5A 4B2IA 4GI6A 4XPGL 1ZHLA 2OMZB 5F44A 1SWVA 1Z75A 4DSTA 5C6PB 2JKXA 1C41A 4WGWB 3L4JA 10MHA 4HWPA 4KEAA 3MCWA 5LCXA 4FXKC 5JYBA 1IB6A 2M98A 5EPUA 4RV9A 3AV0B 1QR2A 1NSFA 5CF3A 5GV7A 1CDCA 1CYXA 2YZ8A 2JATA 3MLWL 2APBA 1A2OA 5IW6A 3DOCA 4AJ9A 2E9BA 3ZJ4A 3EZNA 4AQ7A 5FR1A 3GUHA 1FYDA 1MMFB 2B0JA 3E4DA 3M33A 4OQZA 1E7RA 4FHBD 3RFZB 3GLFA 4V24A 1NQAO 2EKSA 4KYTA 2AQPA 1Z9MA 5GS1A 3KPJA 3ILDA 3QCTH 1RQNA 3PWUA 4OK6A 3DMTC 1WJ3A 1DVQA 1I8MB 2NDGA 4MB4A 1B76A 1RMQA 3EZGA 5HXAA 5TMBA 2ZUWA 2V97A 1KZYA 5KYVA 5KAPA 1FBIH 4L7QA 4UTBL 3Q44A 1GJUA 3FUFA 1S2OA 3O4OC 4JT2A 5FBRB 1CIPA 2E9IA 5TMDA 3GJ4A 2K8MA 4PIPA 4NMMA 3LUDA 3VI3E 5DIZA 5JMOA 3QZNA 4ETMA 3ASOB 3IA7A 1LNUA 1LF5A 3WFJA 2QGZA 4NKIL 1JF1A 1SU6A 5SY6A 2HN7A 2WUBH 1X9QA 3QWRD 3PSHA 1XL0A 3W7VA 5DJ0B 2JFHA 1F4WL 2ODAA 4NQTA 1GTJ1 4MGZR 2CF6A 3BD9A 4J8PA 5LQMA 5E4TA 4WNIA 3NNDA 3V4VH 4HYTB 1T83C 1PZXA 2IIJA 3ISTA 2PUBA 2H0EA 1RURH 4QOKE 4R2WA 1MH5A 3FSOA 5DM4A 3UEOA 4DPKA 2QT6A 2BI8A 2R48A 3GW8A 4BNXA 2XR1A 2F54A 3QG6B 3KDPA 2I62A 2IQ9L 2O5YL 4JK0D 3F4KA 3WJAA 5KVDE 1CQJA 2EIEA 1ZVKA 2GK4A 3FZQA 1SHJA 2FFBA 1CB7A 1RXYA 2AMUA 4KQXA 4LPWA 4QDTA 2CJYA 3ABSB 5KTKA 4BNMA 1C1EH 1QRNE 1MQAA 4DXHA 3WKML 1PUIA 4MB0A 1T5WA 1CJBA 3UQYS 3U09A 1FZMA 1SR8A 4I6EA 3DO8A 2HJ9A 1EIZA 2HLHA 5LDSA 3QWNA 4NOFA 4QJ4A 3C8MA 3WLWD 5L0QC 4EQ6A 1F8GA 4LY6A 3P9IA 3UABA 3F12B 2CGEA 1PK7A 3ZTEA 3ZVKA 3K0CC 4I3HA 4FCAA 5E08H 3FPKA 1CWUA 2XI4A 1XGRA 1Z28A 3E9ZA 1CRLA 2YUXA 3IM1A 3UK0A 3ZWOA 1R5VA 1I3GH 3MRFA 4YVUA 2GUWA 2EH8H 3QU7A 2EFJA 3UIYA 1MIOB 1KTLB 4ZPVB 2DM7A 4PLJC 4U1IA 3BDBA 5JASA 1I9JH 4XGZB 3P32A 3QA3E 1BH6A 3NP4A 1JWAB 2DE0X 4FNLH 3RARA 2GI0A 4F7WA 4ZDJA 4XGQA 2HQ1A 1D6MA 4HK3N 1XX9C 2FJFA 4ZMSA 3C3WA 1XGTA 3M4JA 3DUUA 1DBVO 5DUBA 4ZI2A 5B8CB 1P1VA 1O97C 2CBMA 2W95A 4HWBH 1NQBA 3AWDA 4AUUA 5EZ5A 5KKAA 2QN9A 2MSKA 1J5OL 2P8SA 4FILA 1Q1NA 4KPEC 1TF2A 3FCOA 5JNTA 2DH2A 1OPRA 3GJ7A 3ZQUA 1FVEA 3ZJUA 5K9QI 1AHMA 2UXDB 5AKHA 1KO7A 1MD9A 4S2UA 2ECFA 3GHPA 2J4CA 4P5DA 4IOSA 4OF7A 3DBOB 3NKLA 4P3PA 3CHSA 4JIGA 3WNVA 1GZQA 2VDQB 5DJCA 4UDTA 4MVBC 2AEPL 1T9ZA 2ZYGA 5IJ0B 2ZYHA 1OXTA 3RRFA 4K3JH 3DHVA 2O4CA 2FPGB 4H26A 3NBQA 4JRYD 1ZBDA 2QVGA 1LBQA 1OSPL 1UK6A 2BFVH 2EIXA 6YASA 3VZBA 1E2BA 3RWDB 3L95A 3FNKA 4JU9A 4ZU3A 3WL4A 1FHGA 2NZIA 3ZNPA 1ZN8A 3VXRE 1X8LA 3KQYA 4IIJB 2R8YA 5DYOB 4HJGA 3Q12A 4U7JA 3VWKB 1HK7A 2VZUA 4J0EA 4H0CA 4HNGA 1JQDA 1G9EA 3FFTA 4B4DA 3D6UA 4LQDA 3IJ7A 1DB3A 3EVBA 3I32A 4B4VA 3MREA 5ILTH 2HXSA 4XCFL 2RH0A 4QNPF 3LXMA 1JLSA 3O3AB 3AAZB 2FSIA 2YHIA 1V5EA 3PL6D 3SF0A 2XTSA 4JKLA 3RSHA 1KTJA 4AJIA 2R23B 2X89A 2IPMA 1FFHA 4X8GA 4HH8A 2X9ZA 2A4KA 1UKVY 4KLZA 1MOQA 1GA1A 5LWYH 3THYB 4U1RA 1PF7E 1UM4H 1NRIA 3CMGA 1A6TA 5EBMB 2Z9TA 3RVWD 4S1DD 4NJEB 1J05B 2I33A 4LJ4A 1BGVA 2XTZA 2F4VB 2JBAB 1A95A 3QG7L 4X4ME 3ZZLA 1JG3A 5ETJA 4EA9A 3MJHA 3IE0A 1N7JA 1BEYH 4II3A 1CQIB 5DVOA 1SOAA 2XXFA 2WIIB 1KJIA 4X5RA 4HRVA 1NU6A 4BK5C 3OIUA 2HGZA 4M0KA 5IUCA 1A27A 2IITA 3HZOA 2PNDA 3VXUA 2BIOA 3ZV6A 4U7PB 1L9TA 1RZIA 1EWYA 3EOZA 1XBRA 3FSAA 1QLEL 4NPCA 4H6PA 2YJLA 1ZVJA 2ZIGA 4EI2A 1U04A 3CZRA 3QXDB 3PB3A 2XBTA 2ROQA 2OXFA 1UBUS 1GUAA 1RZGA 3KPPB 2QTEA 4ISCA 2DUUA 1Z5ZA 3WGTA 3TS1A 3VQTA 3TEZA 2IHYA 3P19A 3GI9L 2IYLD 4DV1B 2A9JA 2O6EA 5JDIC 4ZQTA 3IO5A 3OAZH 3SG0A 3T4YA 5D6OA 4I8DA 1R8YA 5IEKB 3ACDA 4TVPL 3DXAD 1Y5LA 4MO2A 2ZP1A 2QT0A 4PB9H 3GFVA 4L0DA 4H1LA 3R7AA 3NCJL 1ORTA 1RJFA 5C8DA 1MFZA 3TFWA 5DD3H 1IGMH 1JHOA 3U3MA 1C5BL 5F3BA 1E94E 3PFCA 3DUSA 4PSCA 4PWFA 1CR0A 3BLPX 4LMQI 3OY7A 5IFAL 5K3BA 4MUAA 1YBVA 3L0ZA 1SXSA 4G2TA 4V1CB 2MTAA 3WMSA 3RRMA 2IU3A 2DQIH 3CRQA 3RT7A 1PEAA 2J2ZA 1NVGA 4MUIA 2G4CA 4Q3CA 3TURA 3A4DA 3F64A 1U3ZA 1I7TA 3NC4A 4D5GA 3G88A 3IGAB 3IOYA 4U6HB 3M34A 3RDTC 4E13A 1UBJS 3S7ZA 3KLOA 3OT1A 4I50A 2VDOB 1GNVA 2VSOA 3KD4A 4U1MA 3NEEA 4CR8A 1L1RA 5JRJA 1GKLA 3MNVB 3UJ9A 2MCFA 1BBDL 3WGVB 5LKAA 2LKCA 4MW4A 4JQVC 2OFPA 3WOVA 3IS1X 3N8NA 1R00A 1P6UA 3LTNC 1UBLS 4FD3A 3EVGA 4HVCA 1WCBB 1NVTA 2LIVA 3HFFA 1DBKH 3DX7B 2Q9OA 5E4IA 3BMNB 2ZNXA 2ENSA 2BFFB 2VDQH 2I0FA 3STWA 2Q4OA 2NNRA 1QEXA 5K8UA 3QXXA 1H22A 3ALWA 2WJWA 4DP7X 5GGYA 1BYOA 3E0GA 4QY8A 4BQNA 3NHSA 3RNOA 5EU7C 1I30A 1BE8A 1O7VA 3K6OA 1T91A 5FYDA 1DAIA 1GVNB 5KN5B 1KYZA 4XWOC 4ZD3H 4RD0A 1SDAB 5E99H 4EOGA 3UMFA 1OW3B 5KIAA 1EFUA 2O0KA 5AKJA 3GFSA 3DECA 1IPFA 3GXIA 3O7WA 3X1ZA 3VBEA 4KI5C 4UBLA 3R0QA 4MD4A 1Y6QA 2IY7A 4ALAL 4EY3A 4GGPA 4BJ6A 4RTLA 4O2FA 2CVHA 2C3HA 2HJWA 1EVIA 3QIUC 1YQ2A 4RTOA 2GEUA 3DE0X 3QIBD 1W36B 4ZSOB 5TH2A 3K1KC 1CFQA 3KPSE 5JWOA 2V8MA 2BRQA 2RBKA 1N7ML 5GM1A 2RD2A 1GZ3A 1E9PA 3WFCH 1FO0B 1JNNL 4AQAB 2BKAA 1MJ8L 4YR6A 4YC2B 3RVSA 4KKQA 4C0QC 1JF5A 1D6VL 5DTIA 3AWEA 3H7BB 3NTCL 1OZ0A 4WWHA 2RMKA 3AI3A 5CD5D 2LT9A 3NATA 5NLLA 4CMMA 3WYGA 3TZBA 4LDZA 3IF1B 1PUJA 5L7TA 4HZGA 4Q0XL 1SN5A 3O2WL 2FMFA 1KPVA 4HX1B 1U2DA 4RZCB 1B6GA 1ZT4B 2EFDB 2DEUA 5GZ6A 3CYFA 4FHEA 3I9AA 4GOJA 1UJCA 1N57A 3W04A 3VI4A 3D0KA 4KIGA 5TTRA 4G7YH 1QPZA 3KNZA 1QQ7A 3HK2A 3SEQA 3R76A 1SMAA 3TLBA 1NPDA 1NR7A 2QZZA 1EO8L 3JV4B 3NIDB 2X4UA 1XUOA 3B8SA 1ZQ1A 3UW1A 5IBQA 5KVSA 5JZ7C 2R0LL 1GUZA 1ZH0A 4AQ8C 2VDJA 4JGUA 4ILDA 1FYTD 1XYYA 1ND0B 4UW9A 1TTBA 4LC9A 2QQKL 1VAHA 3MXVH 1GZVA 2DQHL 3FQNB 4BE9A 4ZVOA 1O9HA 3K0WA 4S2EA 3MCYA 3TN0B 5E3JA 2P5WB 3DMPA 3ULVL 4MV0A 2EJ1A 2PP7A 1XTQA 5SWZB 4NQDA 1G6HA 4E0RB 1POXA 4QXMA 3SE7A 4Q03A 3IP3A 4AK9A 1XR9A 4OLVH 4EPRA 4BIKA 3H97A 2DPHA 3KSMA 4KR0A 43C9B 2Y1YA 2V2WA 1JNHA 2Q3ZA 3DD5A 3OPYB 4QXGL 3N44B 1ZH8A 3LRHA 1JNYA 4WFED 2FNAA 2LIPA 4ENZA 1WVZA 5GRYA 1RUQH 1DXOA 4YJHB 3DNKA 2OQRA 5GZNA 1XQXA 4RGND 4KREA 1XT5A 2HYDA 5J4LA 3VJKA 4HIHB 3SR0A 5EIWA 2ERJB 3EWNA 1AE6L 4EJ6A 3KKEA 3BE4A 1YHZA 4WRLA 2PRYA 2WJGA 2RIRA 1NKRA 2OV6A 1MVLA 5CEZD 5KWYC 1YPZB 2OHGA 4P3KA 3U4MA 5HYQA 5GGVH 4RRPG 1XLTA 3E1GA 3OC0A 2CNZA 4WY2A 5D00A 3G5LA 3IDUA 3L9BA 4POZC 4YH6A 4NH0A 2QPEB 4QRPB 2X58A 3BD6A 1AQDB 4PC1A 3R06A 2FNWA 2NY3D 4G1BA 3EUAA 3IURA 3AR7A 2GEEA 4KKLC 3O1JC 1VKXB 4Z7VF 4BKMA 4C21A 4IRSA 3BYYA 5AB0A 4ZOBA 4MICA 4YV2A 5IJVB 1FWXA 3V4PL 1P0PA 3KWMA 3ESQA 3WY3A 2OP4H 3FDZA 5BS0A 3WE6A 1NVVQ 1JQKA 3FPBA 2I80A 3BPOC 4XCCL 2VTVA 4GE3A 5JYCA 3GX1A 4Q9RL 1CK0L 1Q50A 3A0UA 3ZY3A 2QTTA 5LDDC 3FTPA 3QUSA 5L7XH 5IVPA 3QYPA 5UKDA 5AKXA 1MRCL 4DV7B 5IBTH 3C3CA 2C34A 3KPLA 4Y5XC 4IFIA 4FPXA 4LRQA 5J9FA 1T0JB 1HQCA 3RNLA 2JKLA 3MB5A 1YS7A 4D0SA 1YU9A 1NOFA 1G5QA 5I1HL 3COYA 1VDGA 2RGCA 4WQMA 2F54D 2GTPA 5IKEA 1LE9A 3VTTA 3KKZA 3L3KB 4ZU6X 4RW0A 2AXWA 1U9IA 2F1RA 3GT0A 1BMGA 4XWTA 1BEXA 4K9EH 2GSMB 5EUKB 4KJPD 1FS4A 1OM9A 2J3IA 1P9WA 2GITA 5DHVH 2B8NA 3L4TA 3CXDH 1KSHA 4HK4A 3X1BA 2ZCLH 5DJ6A 3VSCA 1ZJAA 4J2QA 3NNSA 1I7UA 4GI8A 4KRXA 2P5EE 4QBTA 3VFMB 5LLTA 3TBVA 1L5YA 1NBYA 1AO7A 2QZSA 1XTSA 1SVMA 4NPJA 3I2FA 3CF6R 3T0VA 2XWJB 3KOWA 1SBBA 2WF8A 1U8OA 4G36A 1DBRA 1RZ3A 1OAQH 4R3NA 4HOMA 3M3HA 4JFFE 2GM5A 2Z91B 3HHEA 4FC3E 1CPUA 2YX1A 4O08A 2OMZA 2PLAA 2O0LA 2DJ4A 2IXBA 1KOGA 4BUZA 2FW8A 4MPPA 2QENA 1TQ2A 1GL6A 1IFHH 1PZSA 2ZS9A 2UYCA 1U8HB 4EW6A 4E5XB 1GNRA 2F8OA 3SDDC 5I7OA 4KIJA 2QSCL 1T3TA 3HYCA 1M1UA 1XD8A 2XFGB 4A8JA 5ERYA 2LLGA 2BUCA 3DCJA 2OSVA 3FAXA 3G2PA 4ZMVA 2IJ0C 2IP1A 4E5SA 3CLFH 2OHXA 2R8SL 3RFZA 2ODHA 3TEYA 3HE7C 4MVXA 2NY5H 3DK0A 4UEWA 1GSKA 4F57H 4F7CB 1I8MA 2OSXA 4Q1BA 1EJOH 4OKNA 2XTJB 3WK8A 3G0GA 1AZBA 4TOYL 2ZAOA 3PICA 1XCWA 2YQ5A 2I6SA 4O3FA 1ZHHA 2OW6A 2CVOA 3GSWB 1GZPA 2Q4BA 3NSXA 1GGKA 1FL5B 4JM2F 2ZG3A 1RUMH 5KNCH 1P1HA 4O1IA 3PE4A 2V65A 3DGGB 4IOSD 2Z8YA 3ZD7A 4IXMA 3ZLJA 4RMUA 2P11A 3MUJA 2KMWA 3FOAA 5DMHA 1NGXB 4S12A 4D9EA 2A0XA 5TGBB 1YVRA 1JZ8A 1JYVA 3HL0A 4XH9B 4NZUL 3SE3C 4P0PB 2Q20A 4R26L 5E24E 1U3VA 1VI2A 3ACBA 1BIHA 1VPTA 5IG2A 4M4RB 5IB3B 1A71A 1NCWL 3PUZA 2GSDA 4HLUC 3AWGA 3QFJE 1JTEA 4LKRA 1Z26A 5I71B 1Z6AA 2BC9A 4L3EE 1QAQA 1W9MA 3HPLB 2Y0CA 3QG6A 3HUDA 5IF3A 2D7CA 4ABQA 4DKFL 4JSYA 2FZ4A 3Q8WA 4BMZA 4M1SA 1VLVA 2OA0A 2WU0A 4L3WA 3AF4A 5P8WA 1LDBA 3RT1A 4PV8B 1R3LA 4ZIRB 4PB0L 4N7MA 1U0BB 4L5FL 1TI7A 4OLYL 3TOSA 2AOTB 3IP5A 4HK3J 3LZNA 3S36H 3WV4A 4HG4J 4RDQG 4XE5A 2X89D 3ADCA 4IIQB 4FLMA 1WGOA 3ZWDA 5DNDA 2J8UF 2XGOA 4ZZ0A 2ZUYA 3BQUC 1C8BA 4JQXA 4W5QA 2ZJYA 2H0FA 3E61A 3WGUB 3F12A 1TCUA 2HRCA 1YEGH 3I23A 1PZAA 2QLYA 3QLUC 3SNKA 4AULA 3TVMB 3BWAB 4EPWA 4YPOA 3T54A 4NF2A 2B1GA 3DC2A 3C6LC 2EH7H 4MTLA 2XQYK 2IPXA 1J0DA 1Z3GL 4WESB 4R4FL 3OU2A 3HPJB 2ORWA 4CC4C 1MIOA 1KTLA 2QAIA 4ZPVA 1Q3KA 2FSVA 2EEBA 4PZYA 1UZ8B 4M37A 1T0BA 4QNNA 3UGEA 2WVHA 4XGZA 1KBGL 3VXUD 3ZXYA 5DNAA 1SEVA 1XWWA 2QG9A 1MCPH 2QSQA 3W57A 1S2LA 2O6PA 3TKLA 4HQOA 2VVTA 3N5KA 4ERSL 4FI6A 4Y9CA 5B8CA 1GSHA 4QPDA 5E1GA 3C4VA 5HBRA 2JXMB 3A47A 3T8VA 5EN3A 2PUHA 5BQFA 4RHUA 3CLKA 1SA0B 3D05A 4ZX4A 4DF3A 4LMQE 3UBXI 1BDIA 1W59A 4CFYA 1NMXA 4PGZA 3PJSB 5GADl 1EFHA 3WLNA 4WF7A 5ETUB 3WFBL 3DXYA 3L7BA 3IELA 1OD9A 4O1MA 1J4AA 5DC9B 3H8NA 5IJ0A 1UKAA 3NJVA 1YBMA 1XP5A 2J59A 3U4CA 4RVHA 2FPGA 4OXRA 4FABL 1GZ6A 2FPPB 1N8KA 1TPYA 3RJ5A 1RZPA 2IVFC 2NO7A 3MWLA 5T3XL 5FA3B 3B2VH 2WLHA 5D1ZA 3CU1A 5AUQA 2EEAA 4GIAA 4JOQA 3RWD