3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
4PRZA 1RHQA 4I1PA 4D3XA 1I3OA 2P2CA 3GJRA 2HBZA 2Y0BA 4DCJA 4NBLA 4DCPA 1RHMA 4QUBA 1KMCA 3GJTA 4N5DA 4ZVOA 4ZVUA 2CDRA 2QL5A 1I4OA 1NMEA 1QTNA 4QUEA 2CNOA 3P4UA 3BIJA 3R7BA 1NW9B 4FGUA 2H5JA 4QUHA 1IBCA 4QTYA 2FP3A 2WDPA 3R5JA 4EJFA 1RWOA 1SC4A 3H11B 1RE1A 3ITNA 5IAEA 3UOAB 3UO8B 3DEKA 1RWKA 2FUNB 3D6HA 4QTXA 5IARA 3R7NA 1NMQA 2C2MA 5LU8A 4ZVPA 4HQRA 5IAKA 4NBKA 2XYHA 3V55A 3PCXA 3V4OA 4AWBA 3D6FA 4AWAA 3V6LA 1RHJA 1GQFA 2CNNA 2HBYA 3GJQA 3H11A 3R6GA 3PD0A 3OD5A 4JR0A 2H65A 4QUJA 5IANA 2AR9A 3DEJA 1K86A 1RWMA 2J33A 4IYRA 3KJFA 3IBFA 3DEHA 4N6NA 4AW9A 4FEAA 4PRYA 3H0EA 1CP3A 4ZVQA 4M9RA 5IBRA 3S8EA 3K7EA 4EHKA 2Y1LA 3PD1A 1SC3A 3H1PA 4EHNA 2J31A 2CNKA 5IASA 1PYOA 5JFTA 2H4YA 2XYPA 1GFWA 1BMQA 3H13A 4EHLA 1F9EA 3EDQA 4QUGA 3SIRA 1K88A 3S70A 4PS1A 3R7SA 2H51A 3NR2A 4EHHA 4N7MA 4QU5A 2K7ZA 2QLBA 4EHDA 4QUDA 1SHJA 2DKOA 3KJQA 3SIPA 1RWXA 4QULA 3NS7A 4FDLA 4JB8A 1I51A 1SHLA 4QU0A 2QLFA 4ZVRA 5IC6A 4DCOA 4EHAA 1RWWA 2CNLA 3KJNA 3P45A 4ZVSA 1PAUA 4N6OA 3RJMA 5IBCA 1QDUA 1RWPA 2H5IA 4PS0A 4EHFA 3V6MA 4JJEA 1CVRA 1RWNA 3NKFA 4HVAA 3E4CA 4NOKA 1NMSA 1RHRA 4NBNA 1QX3A 2C1EA 1M72A 1RWVA 2C2KA 4NOLA 2J32A 4FXOA 1ICEA 2XZDA 4N7JA 2C2ZA 1I4EB 4D3YA 4D3ZA 4JR2A 5IAJA 2HBRA 5IC4A 5LU9A 4QUAA 3V3KA 4JR1A 5H0IA 2XYGA 2QLJA 2H48A 3V4LA 2J30A 4LSZA 1RHUA 4QU8A 5I9TA 2C2OA 2CJXA 3DEIA 4NOMA 1JXQA 2CJYA 2FQQA 1F1JA 2NN3C 4NOJA 2H4WA 3EDRA 4JJ8A 3GJSA 5IBPA 5LUAA 5IABA 5I9BA 4N6GA 4JQZA 5IAGA 3R5KA 2H54A 4HQ0A 3IBCA 4QU9A 2QL7A 1RHKA 2HBQA 4QUIA 1SC1A 2XZTA 4ZVTA 4I1RA 4JQYA 3QNWA 4IEFB 5K20A 3R6LA 3D6MA 2QL9A 4JJ7A 5LUBA
chains in the Genus database with same CATH superfamily
4M03A 4PRZA 1AA9A 1ISGA 2Z2ZA 4TTDC 3TLGB 5LP6B 3RTGA 4GZMA 4B6JA 4B9JA 4BNFA 4KAJA 5EWIH 2GZ2A 3OKFA 2IKQA 2ED9A 2AXJA 5IHUL 3ILPA 2YXFA 1IBFA 5D7LA 4DDVA 1K27A 2D54A 3ME0B 5C46F 3P9KA 4H8WC 4YRJA 3PFNA 3WKEA 4MJ7A 2VZVA 1UK6A 1UOEA 4AG4L 3I0ZA 2ZAIA 2WU3A 3SJVB 4RSYA 3CSSA 4WOCA 2FUCA 4KHZA 4DSNA 2HPTA 4L0QA 4F4CA 1ONNA 4X5WA 4RHFA 4DLPA 2R1TB 2CKDA 3BB4A 5DMIH 4Z7OF 1LTHR 1QVOB 1DFIA 3PHIA 2I6TA 3ULUL 1EUQA 4WJG3 3INOA 1NIBA 4PJDF 2YEZB 5ALXA 4WH0A 4PZAA 3M9WA 3HBMA 2YJGA 1RWXA 1NT2A 3MPOA 2BC9A 3QGVA 4PJIE 3HC4H 1YPZE 3FSAA 2H2WA 3VRLF 2VITA 2GCGA 2YJ5A 5IGXH 4RWEA 4C0SA 5JMTA 3G68A 4PB9H 1KAQA 2W42A 2PRSA 2F1JA 3L7OA 1HGXA 4L4XA 1T3LA 1L9PA 2JBAB 4D0RA 3ZZQA 1Y7IA 3FWHA 3QDMB 1LILA 1PGJA 4EPWA 1MHCA 5MERA 4FEIA 4WWOA 4L08A 4EPTA 1SIOA 3SFZA 4XUCA 2RI1A 4NJ9L 1BAGA 1CEQA 1CZLA 3KTAB 4MJ5A 4FOLA 4AMZA 1EFXA 2JSFA 2J5QA 3ITDA 3QE9Y 4LLVB 3X1FA 2BUBA 5FTMA 5LQDA 3K0HA 1O9WA 1ANUA 3I6LD 1LX6A 4JSTA 3TTTA 3E9YA 4KWHA 3RC8A 2C7UA 2CO4A 5CZXC 3PC6A 3KQLA 4NHEA 4RYLA 5LCVH 4OBRA 4WW2B 4CDNA 3I1JA 4WY7L 4C6TB 3VDNB 1G7HB 4G5AA 1FNBA 3DKVA 1Z6QA 3D3WB 2XBZA 4TMPA 4U1SA 5DT2A 1ECCA 2QDKA 3SPHA 1H2XA 5EWJA 3KHSA 2XOEA 2L8AA 4YRFA 4DT1B 3GO1H 2SEBB 2G83A 3K8MA 4NQVB 2GBPA 4AJEA 1LDEA 2VUHB 1IO4C 2UZ0A 2VL5A 1KOFA 1U7UA 3AWIA 1M8FA 3SHWA 1NGXB 2YA0A 1QBMH 4KWIA 1BVNP 3ZKQD 4ZOEA 4LOIA 2NZWA 1AGYA 2C5AA 1QRUA 3DE1X 3SCMC 1FGVH 4H1UA 1D5IL 3FDFA 2UXBB 1VP3A 5KOHA 1ADYA 1Q38A 2G1UA 2I3BA 1FGVL 1I4EB 2R2EB 1DXOA 3BVPA 4B7AA 3U19A 2R0WL 1RZ7L 4DOMA 1YI1A 1QE0A 3P0HA 2NXEA 2H7YA 3OE7D 4OFDA 5DDHA 4PU0A 1PE0A 2IXDA 1GGMA 3ZV7A 3BSHA 4NM4L 1VGEH 5I71C 3SJZA 5JEDA 2EKJA 4AEIL 2KLSA 4WCYL 5HDQL 2H2SD 1C16B 3BGFB 2ZWOA 2VHXA 1KETA 3UPDA 3SVTA 4NZ9A 3JWGA 3E81A 2DQDL 2MPVA 3DFMA 3HJHA 3UCFA 5L88H 2AFIE 1HFJA 3WAGA 1GEEA 1G3IA 4GRLB 3GINA 1R33A 3CSBA 1ZVQA 4PJHB 3AB0B 5K33A 3A36A 4QEZA 3HG5A 5BWLA 3LDUA 4ZMZA 4HJGA 5BQOA 3O9WA 3VXUD 3ZG6A 2RJ3A 1EO8H 1GNTA 2WP0A 2GAZA 2P3OA 3EFDL 5E2VL 3K53A 3NSYA 4EG6A 1XSIA 1ZCBA 3LUGA 5BWMA 3EJQA 4Z7VF 3HVUA 1DR9A 2XE8A 2WYWA 4QKQA 2VKWA 4YDQA 3M3HA 2JQAA 2FNWA 5E0QA 3QUKA 2X4NB 3KOMA 4F4UA 1JWUA 2LW3A 1NR1A 3TYFA 3RSOA 3QFJE 1QOPB 5C08E 1V5EA 4MWFB 1DEXA 1P4JA 2DWYA 4JRYB 2R2BA 1DJLA 3EDEA 3NFRA 1DDTA 4MDHA 1KVSA 4TKMA 3CJJA 4KB5A 3U82B 1DOHA 3CHSA 2HSEA 2AQ3A 2PEZA 1TF7A 3IEPA 5BUQA 4PVMA 1FZMA 5TPWH 2CCWA 4I1UA 4GXFA 1NKOA 4Y5VB 4L0ZA 5LQJA 4H9GA 4HOZA 4CKZA 4IDDA 4KMOA 3T8MA 4OK5A 3QYAA 4F8EA 5EG6C 4APXA 3BSGA 3ZCXA 2WKOF 5BMFL 1G20B 5FW8A 4P23A 2VOTA 1JZJA 3Q01A 2OMVB 1JE1A 4V03A 5F9WB 4Z9XA 4AIOA 3C8HA 1CKEA 2QB5A 4B9CA 3THOA 2GF0A 3KSUA 5KAMA 1AKNA 3FTDA 4RGMB 1X92A 1O5DT 2YICA 3L7DA 1JTTA 2QMQA 2LU4A 1FMJA 3MC0A 2K6ZA 4AT6B 1D6MA 4B53A 3HE7D 3MTXA 2GC4C 2HFGL 4O4IA 5LLSA 2V7PA 3WMGA 4EHHA 1MRDH 3FVRA 1GC1C 4QUDA 3B8EA 3WFZA 3SO3C 5KVQA 1J6UA 1YHZA 3I2HA 2QGCA 4PBRA 4HLEA 3WGJA 4X00A 4IIQB 3QUTA 3OBIA 1IQDB 5DF1A 2LDXA 2IEDA 3ZZMA 1PZGA 2MR6A 1Q0PA 2BSTB 3UHAA 5AHOA 3HKEB 4NO0A 4RSVA 4AYTA 5REQA 3BAKA 1T20B 2AFVA 2XUOA 5F1IA 2FRDC 2MTPA 5C0DA 3QDGB 3IHKA 1N6PA 4N2HA 1A1MB 3O4JA 4TL5A 1C1YA 1DCKA 1WF6A 1QK4A 5SZIA 1J1ZA 1M6UA 4XVSL 1TZBA 3PGCA 4G6FD 4OFYA 3RQSA 1E3MA 5JAOA 2GAIA 3RGVC 1RZUA 3ZCPA 3A4LA 5KOJB 4O2BF 4XFDA 2DU8A 2G70A 5AFSA 1YKFA 2ODPA 1CQPA 3E6FB 2HJFB 3AXHA 3DBLB 4MA4A 4B3HA 4Z49A 3PWUB 3CN9A 4R1TA 4D4JA 2CUMA 2XTLA 2YGQA 2O23A 3D4OA 3PL6B 1TTQB 3FYUC 1LD9B 1U91A 2IS1A 3B8YA 4U6SA 5E8DH 2K0RA 1EK5A 1DVTA 3F96A 1X7YB 1WHPA 3LDBB 2PY6A 2IPTL 1T8PA 1ZVSA 4BO9A 1QEWA 5E5UB 2X2UA 1I4LD 4K2UL 4NTZA 1FFXB 3HCBA 2G4VA 1FZMB 9CGTA 3TD6A 5JFTA 2N0SA 5ETJA 4WZAB 2IJ0C 2ZAYA 2Q8BH 2FA9A 1RYBA 4M7PA 3INRA 3LHKA 5HGDB 3PQCA 1PSKL 2QTVA 5IOPA 4L72A 1XDUA 2BVEA 4YBZA 2PKYX 2J41A 4UHJA 3QWIA 4JFDD 1IN6A 4IK6A 1A0QH 1LE9A 2Z4SA 1AQKH 4OJYA 3MFQA 4PVCA 2BOCA 1VSQA 1PT9A 1VZHA 3L8CA 3CLTD 1ZJZA 5FI5A 2LR4A 3RFTA 5AJZA 4KE8A 2ZKHH 2W37A 3AZPA 8GPBA 3LX8A 4I55A 4HV8B 2ZWYA 4X42A 1Y1LA 5AW9A 1UURA 2C5DC 4WW2F 3O0RL 1R9GA 1ELOA 2BAGA 2PAFA 4LNVA 4GI5A 5JSZA 3TIDB 4KDTA 4BM7A 2X38A 3EHEA 4HAYA 3SKOA 1K2WA 1O94A 2I4MA 4BV2A 4Q9JA 3OBBA 3V6ZA 4MEAA 4PJHE 4KXQA 1TCRA 2Q99A 4XD7D 1Q14A 4XCEB 3DOIA 4G71B 3IIIA 1KXTB 1J9TA 2IOIA 1Z22A 3KR2A 2EH7L 3RWFB 4GSLA 2YPLA 1YCDA 1FP2A 3D3JA 1SHSA 3HPLA 3BFOA 2I1LA 1EE1A 2R56L 2C4UA 2EYTB 3L1OH 1HFEL 5JR3A 5TD4A 3C6EA 1MI5A 4M5YL 1E79A 5E7FA 4YGVA 1XU7A 5JZSA 3MV8D 1NP6A 4AWBA 1F4YL 2G08A 4Z54A 3A1SA 3KJIA 1S3KL 3FPXA 3OT5A 1A7BA 1B90A 2PX5A 5JIMA 4HJXA 3EJUA 5CYPA 4BH8A 4ECEA 1SUSA 1W4ZA 2O0MA 3O41B 4RTPA 3ONVA 2WDZA 4Z7QF 3UMTA 3MV9D 1G5GA 3L9RA 4O1MA 1R8JA 1JDUA 3UMMA 1HKHA 4EENA 3B1TA 1U3JA 3DXAD 4WRLA 1A65A 5AG9A 43CAB 2P8JA 1NMCB 2ZP9A 2RR3A 1EEXB 2I4OA 5HIKA 1KPVA 3TP4A 3MRHA 4E0RA 1HEHC 4RWYH 1ZUWA 2FPKA 4EYSA 4M7OA 4YCLA 1HBJA 3VH3A 3LLVA 3STTA 1FL3A 1BGXT 2J20A 3DUSB 1GZ5A 3BQUA 1RADA 3RWDA 4FKZA 2V7HA 2F59A 3QHZH 2O6LA 3R3XA 4A15A 1YEGH 3I6IA 1HEJC 4UQIM 2J8UA 1FL6B 4PGCA 1IDOA 2H7WA 3HY6A 4CI0B 4DNOA 1IHXA 3HG1B 5L4IA 4D0DA 1VGKB 4R7TA 2AKEA 3EO1A 4URUR 4B7IA 1GLGA 5JS7A 1SUHA 4B80A 2XJLA 1LP9B 3FMOB 1YH3A 4MARA 1W581 2NSHA 3QRWA 4GPEA 5T4FA 2IHTA 4RKFA 5HPYB 5I1KH 2IHVA 2IUYA 3UXEA 4KZEH 2X6CA 4R4FL 1D1QA 5FOVA 4K9NA 1IPFA 3CZ5A 4QVKA 2GNPA 4M60A 1RK7A 4M02A 4L1TA 821PA 4WO4B 4RNCA 3TECE 1OT2A 3WDMA 1BQLL 3CVHA 1Z7YA 1GVIA 2VF2A 3DZIA 3BFVA 4LHUG 3OIFA 5BUCA 4LSTL 3NX4A 3SOBH 2EERA 1Z0ZA 2BY1A 1USZA 4KL8S 2IQIA 5LQMA 3ZDWA 4YB8A 3T8XB 5FGCE 4KOBA 1FP4A 2OK7A 2AJYL 2HMYB 5D4HA 3NUKA 2Z6QA 1OW3B 2C9CA 2J5LB 1UASA 1JEQB 4URYR 2XN9B 4NZFA 2H08A 1UAYA 3TW6A 5J63A 3IA2A 1T5XB 4RDQG 1XCJA 4N82A 4MEJA 5GGTA 1UEMA 3E7FA 1TKWA 4Y7OC 1ZPLA 1UD8A 3GY0A 3Q2OA 5BRQA 4DQVA 1ZA2A 5DLLA 4QUOA 3UT0A 1OIXA 4N5IX 1EBPA 4L15A 1XLTA 3H9SE 3K1AA 4YFLI 3CIOA 3VXTB 3P9QA 4OHKA 4YUZA 1HE4A 1Q90A 2AJ3A 2PS1A 1VE9A 4ODWA 5IQ9A 1YZQA 1JA9A 1ISFA 1DB3A 3C5ZB 2X9YA 4ZTPH 4QPJC 2HJKA 1C9JA 1YMMA 4XASA 3EGEA 3S0PA 5DEFA 2XCQA 1WEKA 4FLHA 3T94A 5K2MA 4D5GA 1G7MA 4GKBA 1C8VB 3GRWA 3NKLA 3IAM1 5IJKC 3V4PL 1JFFA 3MLBA 1RQNA 2EGUA 1DLFH 4LYEA 4DNFA 4UTRA 4XDGA 2W6ID 3MGGA 5IYZA 4LISA 4R98A 4KGZA 3VI3F 2OFQA 1PCSA 3QSYA 4M1GL 4JN1H 2GI0A 2Y5TB 3B7SA 1GXSA 4AF8A 1QQAA 3GOHA 5J1AA 2J67A 1TZ2A 5CT4A 1CXZA 1AKUA 1YUMA 3UIEA 1SBZA 1FRZA 2PUJA 1P31A 4DNQA 1UD5A 3IFPB 3T4YA 1E1CA 3BGWA 4JDEB 1YEKL 1YDWA 4N0PA 1NGXA 2D8MA 3AUVA 3EXAA 4IGAA 1L7BA 1NUHA 3N75A 1VZ3A 1U0RA 3KHQA 3ZW7A 4MBOA 3CE6A 2FWBA 2IHYA 1S5HB 4ICWA 2DBVO 5C9KA 3L41A 5K59F 1ZLSH 4I4LA 1AUVA 4MHHI 1JZDC 4JFPB 4BD4A 2A84A 2IE8A 3IRPX 4QYOA 1TB4A 2KX7A 1TLKA 4O2RA 1EJFA 4R1SA 3QLVA 2L7QA 2SCUB 1ED3B 2XN9D 2RCNA 3WFCH 3DLQR 2VSXA 5KU1A 1QIDA 4G26A 4F60A 4UNRA 4JFDB 2F6RA 2ZVDA 1Z6TA 3NGBB 1RJ9B 1P5HA 2J1ZA 4NZRL 3L08A 5I47A 4XC1L 2WIKA 4DY4A 5T3XH 3EPJA 4BU0A 4KDFA 5SICE 1DMRA 4Q0MA 4QHMA 3E1ZA 1XB2A 2XA2A 1NGQL 5HVFB 5DQ9A 3D4BA 5HDLA 2EFCB 3TBYA 1F0YA 4BZPA 3WLEA 1II4E 5A4IS 4K0OA 2CDGB 1LBIA 4Z5XA 4TV8F 1M5UA 3GMOB 1BAPA 2BXYA 1TEVA 2UVPA 5JZOA 3W2DH 2OHFA 3ILXA 3TJZA 4JXJA 3VKGA 4DMFA 2DCMA 3HSYA 1FYTD 3FZGA 4B9YA 4BFNA 2RAFA 3CXDL 3CNHA 3MGKA 1WG3A 1U3NA 4I1YA 2RGDA 1EIWA 4BFYA 4LPUA 2DM7A 4QOEA 2E87A 4M0KA 2E8ZA 4FHGA 5HOEA 1EHKB 2BGWA 2QUAA 3CN1A 4AIEA 5G5DB 2AJXH 5IUNC 2Q5HA 2CBQA 4Q3OA 2ILVA 4MWFA 2KHAA 3MTRA 1K97A 4QRAA 1RZ8B 3VG9C 3PC8A 4D0NA 2O3SA 1NC2D 4CADA 3ONNA 3ZE9A 2X1HA 2VC2B 1DFBL 5TNXA 2BM1A 2DB8A 1NLBL 3PWPE 1W85A 1H23A 1YPZF 2NY2C 4PJIF 3HBAA 4NIMA 3PNLA 1CQXA 3PV7A 4DLYA 1S3IA 4MQ5A 2CKBH 2JIXB 1Z9LA 2FI1A 3S3BB 3ETNA 4TS1A 2EFYA 4OG2A 3A6ZA 2PO6C 4C2AA 4EI0A 2VAWA 1ZISA 3PTAA 3I4FA 1IB5A 3RBZA 2FLMA 2B08A 4JCWA 5DF0A 5FTJA 4Y98A 1Z75A 4U5XA 1KDOA 2RGNC 1RQPA 2WANA 4FE4A 2VUIB 5CGYD 1P2FA 2OQVA 1W0WB 3MX0B 3KPSD 1PW3A 5CLFA 1FFYA 4GS7B 1T0JB 4IQGA 5B4VA 1Q0XH 1OY1A 2WUVA 1JEAA 2C83A 3HE6A 2ODNA 1X8KA 3EUWA 2RHTA 1G4RA 3I5YA 4TUKH 3DXZA 3N0XA 3LCJA 5F3RA 1C3LA 4UMSA 4NT6B 1L7VC 4Y4FC 4V0KA 4MUMA 4P38A 4IHAA 4BMVA 1OP5H 4AP9A 3QEQA 4TLAA 3HZZA 1G21E 4MV9A 2IV8A 1T2VA 1M9NA 4Q3KA 4M8KA 4L23A 5KZCB 4MVJE 4RKYA 3AYXB 3FTWA 2J8UF 4X54A 3KSBC 3OL2A 4YPGB 4Z8FH 5KKCA 1OAQH 4JG1L 1EHIA 4BL5A 2YEZA 4OV5B 2MJLA 2OEPA 3P0YH 4XMXA 2Q8NA 2K9FB 3DB1A 5IB1B 3HFRA 4GG8B 4Y89A 4TTIA 1GAXA 4NH0A 3WLOA 4CDGA 5CVCA 1LDMA 4PN7A 4HX2A 2JHFA 1QV9A 3WICA 2JIDA 4QGAA 3MS4A 4HB4A 2QZQA 1A2QA 1D0VA 3IO3A 2BWQA 3RGGA 1ND6A 4WFHD 1QKJA 2BFNA 2N3JA 4FD0A 5DHMC 3TQFA 3CLUC 1BDHA 4NS1A 1R3IL 2QSQA 4JKPH 4Q7KA 3CCCA 1SIBE 3BWMA 2CDRA 4Q8BA 2EKBA 4EWLA 1H6CA 4RTKA 3G8DA 4PJAE 1DKUA 4N3CA 1CL7H 4WZ9A 1K5NA 5AKRA 3Q12A 4E3ZA 3IL2A 4HN2A 3CX8A 2ROXA 2WHRA 3GK8H 1OK8A 4K3DH 3SQRA 2M6RA 3PXAA 1MHHA 2H1LM 4FCTA 3D33A 4HUWA 3SYAA 3MWDB 1ZRHA 2N47A 2WJ3A 4BLSA 3OJVC 1N3NB 4BKLA 1ORIA 3D4LA 3BHJA 2JJ1A 4KXFB 1BVZA 1OI3A 1E2ZA 2CEAA 4R3WA 3IJEB 4FSHA 3OB0H 3FSRA 3PCTA 2CDEB 2J8OA 3I32A 3HLAB 1Y5LA 5GQBA 1THAA 2HIAA 3WQRA 4ZQBA 2BNRD 3DC0A 4MA8L 1RVDA 3RWGB 2UKDA 3C7DB 3P4MB 3ELAT 2A0LD 4FFRA 4I55B 3CBGA 4QOSA 1BEEA 3KTFA 2JQMA 3FFOA 1UM9B 5E6ID 4KH2A 1IN1A 2MTAA 3O3NB 1SG9A 2Y6SC 1WXHA 4LY3A 3AVOA 1LNUB 4YO8A 5IFLA 5HJDA 3AYZB 5KSBF 2P4AB 2BSCA 4XTRC 2XR1A 3AKYA 5GTDA 1LRJA 2NY4C 5EF2A 1E9QB 1B4DA 2ZRIA 2UZPA 4R8WL 3HI6L 1MG3C 3OTTA 2EADA 2V9PA 3TBWB 4L7VA 4IM7A 1E0DA 4CM9D 3WXMA 5HIAA 5HYJB 4NRYB 2VITB 4LK2A 3GFBA 5E8EA 4WW2C 1VYHA 5LU8A 3MJ4A 2FMTA 5EGNA 4NCIA 1AF4A 3DX6B 1ES0A 2H6OA 1PY0A 5HKKA 1J12A 2EIEA 3I6SA 4IBQA 4KQKA 4E9YA 1WPQA 1MFUA 5DS8B 5E6RA 2G9NA 4CHGA 5ESAB 4CYMA 5IMSA 4QLOA 3S27A 5G3ZA 4TXHA 3ZQUA 5D9SA 2NU6A 4H4DA 1A7NL 3X1MA 4NBVA 2A6JB 1KYIA 3KSDO 3CNBA 5FO8A 1OH8A 3PE9A 1A88A 3L49A 3MA9H 1RFLA 3VDMA 4DMRA 2RGGA 4ZW8A 1JYXA 3B6SB 2PW1A 1NJSA 3U7IA 5T5FL 3SGEH 1LDYA 1NBQA 3LRPA 1BTOA 4Q9HA 3MV7D 4PLHA 1MHHB 3KYOB 2YQ4A 4Q9DA 1ET5A 1G0DA 1TDJA 4WKGA 4PJXF 3WEXB 2FEEL 1B0GA 1IAIL 5IEKA 1V3KA 4XBPB 2VM3A 4YC2B 3K20A 4BASA 4WCVA 4NZTL 2FB4H 4JKMA 3I1FA 1LGVA 1PJZA 3QRGH 3PQ6A 4Q01A 1IOZA 2VO5A 3T1YB 2XC8A 4O4YL 2VRQA 3FJYA 5E3JA 1KWKA 1Z2PX 4I48B 2H1HA 2I67A 1OA1A 1J5IA 4WBNB 3MMSA 2K8QA 5BNIA 2J3LA 4M8QB 2CVPA 2BEKA 2VNCA 3DMRA 3T9FA 3NCBB 2JRCA 1N0XH 3DZGA 2P44B 2VABA 1LNUA 2ZVQX 3O2VH 2YXDA 2JW5A 2IH4A 4F1SA 1SY6H 4P4LA 1DG1G 2GZ3A 4DAGL 1IEXA 2PUBA 1OTXA 2J9RA 2PX2A 3N9GH 2IY8A 3AI3A 3ZHZA 2AEJA 1TDQA 3HS0C 1IFHL 4LVCA 2DWUA 5K01A 2QJRA 1NMXA 4J3OG 1KJ2B 3M86A 2XVMA 2IGTA 1R6UA 4FTVD 3O93A 2DM2A 3KL5A 1SZCA 1UMDB 3GU3A 1PN3A 1RH8A 3K91A 1T9BA 4KVGA 1ZD9A 4ONFL 2BC4B 3O9WD 3L0PA 5HD8C 3LWNA 2NXYB 3A9SA 3DX6A 2FZEA 4EW3A 4IHOB 5GONF 2BN4A 1RCTE 4RMQA 2ZSKA 1ZD3A 5K0CA 1IBLB 1ESCA 2YDYA 3PPVA 1SVKA 3K0AA 4KIWA 4ITUA 3VH8G 1COBA 3T3PE 4HHAB 3TQQA 4CMEC 2O52A 3U1SH 2LIVA 5I8ZA 5L6YL 4BQPA 2H2AA 2XODA 5IYZB 5L6YH 2Q3HA 1P80A 1B0PA 1I1NA 3K94A 3D3EA 5IZCA 2FYVA 5F88B 1BYPA 3OKKA 3OCJA 5D93B 2F4VB 1KARA 1VPVA 4KRYA 5GHWH 1IZ9A 1UM4L 4X7CC 2X4LA 4G1FA 3FULA 5K3FB 4FMFA 4LBEA 2H31A 2HADA 3VFNB 3PJDA 3REFA 4BS9A 4D0SA 2CHFA 3P2KA 1M9SA 1W49A 3AKDA 2I80A 2OCAA 3EBAA 5KMGB 2PR2A 1AOXA 3E6HB 1W2WB 1EWTA 4E9LA 5B58T 2PL1A 4GQ9H 3AB3A 2LQRA 1A7AA 2VXQA 4AENB 3KETA 1M0EA 5F2EA 1XYGA 3IE4A 4JZKA 4N3AA 1RFDL 4NVRA 3L46A 3IAM6 2VUUA 3G5ZA 5COBA 4V2CB 4H1LH 3T2QA 3RFXA 1G3UA 1ET7A 1C1XB 5HMMA 5DULA 4I9HA 1I32A 4QOIA 1OI7A 1IULA 2RIRA 3O2NA 4HJUA 3MS2A 4OHPA 4AGOA 3WK6A 1NR7A 4KQ1A 1KYOK 2MCFA 2DYKA 4NO3A 4IOFD 4QTIH 2FEMA 2J5KA 1UXWB 3FDZA 3VO2A 2BNRE 2F3QA 3BMOB 4MCZA 4V33A 3RLIA 3MWFA 2IEPA 1GEGA 2RBGA 3MTDA 3LQAH 2BP7A 3EVFA 4XN1A 3PC8C 4KAQH 2FH5B 4XODA 1NYRA 2RHBA 2WKWA 4GM0A 4DYHA 1H9BA 1XZDA 3MAGA 5EJ2A 3OQBA 1YQVH 4I55F 3L1UA 1I1RA 1YI0A 4X5WB 2MQ3A 2ZBUA 5E7JA 3E7PA 4DGYL 3QV1A 5LVEA 3MUHL 4GW5B 2O93L 2UYQA 3RHFA 1TITA 2V7EA 1HEZA 1M0SA 3AR6A 3F62A 4EA7A 3EDYA 4HB3A 4JFSA 5IFKA 4TWZA 2NVUB 4BFOA 3L4WA 1JA1A 5EFIB 1G2PA 3IKCB 3KZ1E 4OFXA 1PL0A 2DY1A 4PS7A 4RGVA 3RNKA 1CGYA 2GM9A 4PHFA 3NCYS 1SG6A 1L5ZA 1EFXB 4YE0A 3CH7A 3DG9A 5C5CA 4XPIB 4DXDA 4CADB 3Q9SA 5D1XB 5C0EB 2D7OA 4CN9A 6CGTA 4TSBL 1ML3A 1VSCA 4BRJA 3IWVA 4IPTA 3ZE1B 1QFWH 1FC0A 5K9ZA 2WD0A 4NFHA 4DLNA 3GARA 4UUPA 1I7LA 1RZ8A 4WI3A 4LT7A 1FC1A 3VVWA 1RFGE 4M5ZH 1K8IB 1KMHB 4EI6B 5JDIA 1S96A 2IX9A 5IVXA 3AXIA 2ZSVA 1AGDA 4KQWA 1RZIB 2IUTA 3CMOL 3WX0A 3QIWA 3RVUC 3OAYH 1QEWB 3VXQA 4MUNA 3STVA 2IWRA 2QPDB 1QDLB 5KVGL 3FSWA 3WIUA 4RKEA 3ZIYA 4KU1A 2W6ZA 5GRJH 1ECLA 5IU6A 4EGFA 3BO8B 4HVTA 3VB8A 1C0LA 1EG2A 5TX7A 4Y2OA 2CFSA 3I76A 5GGQL 1N2SA 4H6WA 2V8OA 2WSBA 3D54D 4DCJA 2E27H 2G1KA 2VSKB 1W0WA 5EIVA 1ADQH 3OMZA 3VUEA 2B7BA 4HFUH 2WBJC 5AQ1A 5L3SA 3HZVB 2SEBA 3GHYA 2IYRA 2WDPA 1H6UA 1WHSB 3DTXB 3P73A 4GFTB 1OKKD 4D74A 1QONA 3L4JA 3M1AA 5KDLA 3LQ2A 3TR0A 1DANU 1VERA 1L7IH 4LVEA 3U44B 1RP7A 1QATA 3P3UA 2QSJA 4LDCA 3W56A 3IBSA 4A16A 4OUDA 4Z7VB 2VWEC 2CJWB 1QS0B 4WO4A 3OM8A 1AGCA 3RRYA 3V4PA 2Y9MB 2PIDA 1RYDA 4AKQA 4BCYA 2QADB 4CVZA 5BVGB 2JPDA 4AJYV 1C8PA 1CJSA 3K8QA 3OGCB 3NIFB 3ZGZA 1NDGB 3VB9A 3BUTA 3TYGH 1W35A 3OPNA 3HEBA 1HYBA 4FYRA 4Y6PA 4GQQA 1F2XK 3FBGA 2OA0A 3LRHA 4PGMA 4HUJA 5KQMA 4NGHH 5D1XD 4RCZA 4TSAL 4PIBA 4KBFA 4OSOA 4QMEA 3TL5A 5J89A 2B15A 3MWJA 1KSRA 3L1HA 4RVHA 3D8SA 2ZTBA 3LH2H 1JDBB 1V41E 5FUQA 3LRSB 1S6NA 2VDOH 1TU2B 2H85A 4FTVB 1T03L 4GRMA 1KIMA 5AJXA 1HT2E 2OHIA 3HWWA 1G6VK 1E96A 4GBGA 4O00A 5CAEB 3WGHA 4X4MA 3KUUA 2YZGA 4OGZA 3ZBMA 3TLYA 4CIDA 1FORH 5EMHA 4DMKA 2C9UA 1QNZL 3KJ4B 3QRLA 3TFBA 1OZHA 4L5CA 4C4XA 4WV1A 3UTSA 1E2PA 4QHNB 2HFKA 1W4RA 3ZN2A 4XXWC 3FUHA 1HL5A 3WJMA 3PCXA 3VJ6B 1JZ2A 4UYQA 4UASA 4TVPD 1L7MA 1G8JA 2GZSA 1FG2B 2EE6A 3MRQA 1QUFA 2V7HB 4MQXC 5LP6F 5DS2A 3CC8A 4G1VA 3HLAA 1QANA 2YOGA 4FS0A 4QA9A 2AVDA 3GYBA 2Y0SA 3QUZC 3MRFA 4RBPH 4MD5A 1JG7A 3R0IA 1MJJA 5I0XA 2QR5A 3D85A 3CDGB 2A67A 1N57A 2I7CA 2Q3JA 2ZIVB 3SM3A 3F7KA 1E8DA 1VMDA 1Z28A 3QR1A 3V8EA 5MFZA 1ZGCA 5CD5D 1R46A 2VSNA 4U9HS 5DZAA 4KO3S 4KX9A 4PJGF 1BYNA 3HN8A 3WB1A 4QSMA 2YC4C 2I7VA 4B73A 3DAHA 2CXQA 4ZIRA 3LD8B 1W0VB 2EXXA 2IV3A 4TULL 2ILTA 3NCYP 2G4CA 1IBMB 4CVXB 4OA8A 4KLNA 2R47A 1WB5A 5DBOA 4ILDA 5I1IH 4N2BA 2HTLC 1V7ML 1PSKH 2F53D 5FGRA 1C9YA 3WKCA 2JCCE 5AZEH 1FQKA 3HVRA 3OVUB 1RHKA 2PZJA 4W4OC 4EE2A 3F5WA 3B5HA 3N43F 2DBLL 2B83A 3CEMA 1WX1A 2WYUA 3C8UA 2Q5QA 3CO0S 1HK6A 4M7ZC 3LY6A 3L8DA 4Q4JA 4LLQB 1GL6A 3KLLA 4QZVA 3CU7A 1KI7A 4OFIA 5MEQA 3UOAB 2QVYX 2HJWA 3FO9B 3WL7A 1MJNA 5JS8A 1P6UA 3ZQKA 3QX7A 1VG1A 5HYJA 2Z8WC 4X2UA 1PKQA 1AO7D 3ZRSA 3KPPA 1S7QA 1H69A 3OTGA 3ZLVA 5C3IA 5IQ7L 4JPSA 4FZEL 4U7WA 3K8LA 4LSPL 4UMEA 4AJHA 2G9RA 4JLPA 2VDLH 2EBUA 1MDTA 4GKVA 5IQ7H 4O2AF 1RQGA 4FGLA 4UFOA 4FYTA 3VWKA 3ARGA 3VGGA 1KJNA 4TTSA 2B14A 3FHQA 2C9ZA 2FW0A 3C5JA 2H2SC 5CZRA 2VHVA 4C88A 4JYBA 3G0CA 1CLZH 3C3YA 3PZRA 3RNQB 1NM9A 4AV4A 3LV3B 4ZSOE 2NNWB 3ZGLA 4FXOA 3P9NA 3HCRA 4AKEA 2ZKHL 3GEWB 1CJBA 5KSAD 2PVPA 1KCUH 4OBEA 4I66A 3RIEA 2IWGA 4HLZH 1WYJA 5FWRA 3CLWA 3MT0A 3HS0A 1DT3A 2RARA 4ZFZB 1ZQ1A 4U05A 3NI2A 4ZEXA 4MZ3A 1U91B 3CVJA 1Y8QA 4IMLB 5EU7C 1KMGA 3K2KA 3H4HA 4JFUA 3WJ7A 1DVSA 3ARWA 1I4WA 4ZUUA 1MQSA 2HT2D 5FUOL 3VXME 4QNMA 4BQ9A 3RPKA 4A0RA 4KWCA 3A24A 1Z7JA 4B3DA 2AF4C 4NV0A 1HDGO 1HDEA 2ADFL 2VXVL 3AUWB 4MRMA 1S3GA 3SXUA 1X1EA 2CH8A 3D06A 1B2RA 1IVTA 1NPUA 3FQWA 4E11A 1Z0DA 1PJ4A 4OGXL 3SSNA 1K7FB 2X5XA 3WJ1A 4KO6A 3D3VA 2GF2A 2GAOA 2GYYA 5LL6P 3N42F 1U3CA 4PRYA 3KZOA 4RAUB 4Q66C 2P8LB 2E56A 4AGQA 1DCTA 1LMIA 3AFLA 5FI0B 4MNQE 1Z4MA 2HWKA 4EB6A 2C4FT 4LE2A 1CNMA 4QXAA 1C7TA 2GN2A 3FCBA 4G9EA 4TKLA 2FO4B 4FNLL 1WSST 5DGDA 4JN2A 3C5EA 4YAEA 2OZKA 4XP9H 2F17A 5DI8A 4OI4A 3ULSA 3DMMC 3W3ZB 4BJ3A 4DR1B 3ZVRA 3TRIA 3C6LA 3HP1A 2G25A 1C9NA 4MINA 5KW9L 2AK3A 4M99A 1MRDL 1CI3M 2D3VA 4Q9RL 4DT2A 5EEVA 4PRIA 3E7WA 3G6JF 5ELIA 4UVHA 4C7OB 4QNPF 4AZ0A 3IEVA 2VPPA 4KR9A 3IESA 3ZL4L 4CWAA 3EOTH 4DQOL 3VZBA 1F58L 4HBCH 2QX7A 1QFOA 1PJCA 1MVUA 1U3ZA 1W6LA 4GMGA 4R8KA 2BGMA 4B2IA 1OZTG 3LIIA 4EI9A 1NY6A 2BELA 1CDJA 4IK7A 2OR9L 1OF2A 3FO2B 3GNLA 1AKPA 4LXQA 1KJ3L 5FK9B 3K2IA 4XPFL 3QQ5A 4RH0A 2O2XA 2GASA 4PCKA 3BQUB 4BO7A 1O7VA 4LU5H 1Q2XA 4YROA 2I26N 1DKRA 3KVVA 1WIOA 1EERB 4QJ3B 5A3ID 3NCWA 2WNGA 3AM5A 3SK0A 3U40A 5DJ0A 1EE9A 5P8WA 1J9EA 1BOOA 2WSSD 2GK4A 3RRBA 5KMGA 4PJ9B 1V3JA 1VHLA 1IY8A 2FG7C 1VHWA 2YGNA 1WEHA 5IC6A 4HKBB 3DQQA 3VU8A 4AMGA 3AREC 4K9LA 3ZS8A 3VFOB 4QGBA 3VWJC 2WSYB 4HUQA 3IQDB 5DEOA 2J0VA 3OIDA 3QMWA 3RLSA 3SXUB 1C7ZA 5E08L 2DHRA 2CWWA 3EC2A 3GEEA 4JQVC 2CMFA 2WT4A 1MJUH 4ZC8A 4U7TB 1EHXA 4NNJA 1R3DA 3TIEA 3CVHB 5F3DA 1KDYA 4NN5C 1ACXA 2AHIA 1P84J 2DM4A 2VWGA 4JRYD 4Q7JB 2VDKB 3E7DA 4DLKA 1TPXC 5AW3A 1I1AB 3LIZL 1CF8L 2GSWA 1KNOB 3BPSA 2PT5A 3JVFC 1V9SA 5JSYA 1KXVA 3RFZA 4AW7A 2BVOA 2VLLB 3ILSA 1LNZA 1KAOA 4Q3EA 2HH9A 1GPOL 4QDZA 3VXNB 1BPLB 4N8UA 4UU7A 3TO4A 4QYAA 5F9AC 1UCBL 1ISMA 1X94A 5CXSA 1Z74A 1P77A 4DKDC 3IGLA 3NAAL 1M56B 2I6SA 4AXWB 5FDWA 5HHOA 3AVXA 4J1QA 5FO2A 3ANSA 1ODJA 4CJ1A 4A2MA 2HBYA 3BFKA 5DNCA 4I1OA 1I9CA 4X7SH 1AHMA 5AOLA 5E2IA 2K8MA 1JR4A 1RL1A 1MFDH 2CNDA 3TBBA 3RIYA 2CMDA 2XDYA 3ARXA 4P4SA 3BXFA 4MCYA 4ZJZA 3Q2VA 4LAQH 3JWDH 3AADB 1GGNA 4CSZA 4N39A 1CU1A 4K40A 1UFQA 2Q7AA 4LCUA 2V2XA 1ADCA 2ZX8A 1V8ZA 4KR3A 4N86A 1T4BA 3AFHA 1HYSC 3VXKA 2IZOA 3ATFA 4XO9A 3ZDYF 3JYNA 1U0OC 2X86A 1FH5L 2D0GA 2G9ZA 2RK6A 4FCHA 1MZYA 1WW8A 4XWGH 3BZEA 2FIKB 4JP8A 2HT4D 2F9FA 2BBSA 2IG2H 1L4FA 1P84K 4U6HA 4H7IA 5HX7A 4CPDA 2P8MB 4JM2A 1T6NA 3BWEA 5FYDA 2C88A 2IUUA 4R4JA 3RIGA 2LE9A 3B3BA 3BL6A 3OC8A 4KPEC 4C43A 1WAPA 4U6VL 4F4HA 3HZVA 3KCQA 2MSDB 3GF8A 4MNQA 2IOMA 4G5ZH 2R69L 1V3MA 2WXHA 2FR4A 2WKSA 4HKBA 2VM9A 4TROA 5JPNC 1GGCH 4F2MA 1TQHA 2ZRHA 2D2XA 4IJ5A 3DARA 4QRQA 4LGSB 2Y0PA 5JOPE 1NASA 3VNYA 2AEQH 2OLJA 3PWPA 3BGFC 2L82A 1JHTB 1CPUA 4IIGA 3F6LA 1KJMA 5F9MA 2BVYA 3PNVA 4LGPB 2YKGA 1F2UA 3MRLA 4WJZA 1N2IA 1F51E 3ENVA 1EXUA 2WXJA 1MNUH 1SXHA 4UHCA 1HH9B 2ZOKB 4JAVC 1YN6A 3Q7TA 1CUBA 4PC7A 1PX2A 2V33A 4OLBA 3RFVA 3OFKA 4RQUA 2OVBA 1K92A 2CJWA 4C08A 1A3RL 3NJMA 4DG9A 1HNGA 2AS5M 3VFSA 1BEZA 5DQ9B 4PHZA 3CSDA 5DLYA 5GGSB 2ZR8A 4IVNA 4IKOA 5I1DA 3NHPA 5T4BA 2FX7L 2XSKA 4GC9A 4EIWA 2ZUVA 5DTRA 1F48A 3NWPA 3B36A 2FWPA 4YIKA 3QNFA 2GO1A 3R8CA 4KSYA 3NCHA 5JIHA 4AB1A 3F9CA 4J6EA 2L42A 3UXYA 2UYLA 4RX1A 4MCYB 2CRIA 2O6FA 3QEQD 4Q9AA 5TQ0A 2OS7A 3QNWA 4HXAL 2IHNA 2E89A 3BWXA 2P9HA 4MWBA 1JMZA 4FQ1H 4OPMA 3L7MA 4NNXB 3TE6A 2WLIA 4Y9TA 3UAGA 3TBKA 4LLVA 3N70A 3E2HB 1KBGH 2DJ5A 4B8WA 4NN6C 3PWVB 5DQDH 1JFVA 5HILA 3S29A 2DH5A 1H6EA 4KGXA 1E2VA 1E2FA 4BVFA 5B8CC 1DIGA 3CFJB 2V9RA 1AGBA 2YUZA 2C2XA 1WFTA 2DQUL 3IQHX 1GS7A 1RK0B 5HGXA 1BMQA 3QORC 3D6VA 5HUQA 4MQ7A 1D4AA 3SY0A 3BIFA 1PU2A 3ZX5A 2WHVA 2WAAA 1Y1UA 5IQMA 2B0SL 5DMIL 2COQA 2UUDK 3SSMA 3RIAK 3W3BA 2VUTA 5B3SB 2Q3EA 4Q4HB 1TEXA 1L7PA 5AR1A 1MW3A 1I1FA 4V0ME 1C08B 4M4PA 2A4CA 3L2LA 1GM5A 1XRJA 1SBBA 4TQ8A 1O1YA 4UU1A 1XKQA 3FK3A 1ZM7A 3GLZA 3P9MB 1MFPA 3PITA 5CHNB 4YHYC 4OI2A 1RQXA 3BWSA 2EFEB 4WERA 5CLTA 4J0QA 4LMAA 1AAJA 1Y81A 1G3MA 2Y92A 2YD0A 1YJDH 1KY3A 3P32A 3WFIA 1G7IB 1PFVA 1ECZA 5MEPB 3MNDA 4JKPL 1XDSA 4XGIA 5KTKA 4LSRH 5AM0A 4FQLH 2AC7A 5F7YC 4YRNA 3OIYA 121PA 2HMAA 3HA0A 4FA6A 4DB4A 1H42A 4KNQA 2BP7B 2GJ6E 4CUKA 1UMDA 5F7OA 3GP3A 4KY1H 3LYAA 3MO1A 3UBGA 9LDBA 1DQSA 4CEHA 5DNWA 1ECGA 1HYSD 1FTYA 2W38A 1XJ0A 3FPGA 3J07A 1Q4NX 4L3EA 2AHRA 3FRPA 2PWEA 1A9BB 1L9NA 4I9NA 1RZ3A 5I51A 4XXCA 1A3QA 3N44F 4CCWA 5BQPA 2Y2VA 4AJLA 5FV1L 4A1RA 1JFQH 2ZIAA 5GM1A 4HAFA 5JR1H 2PNFA 4XSVA 1LEKB 3R7RA 5FECA 1X3LA 2OHOA 4QGSA 5J8OA 4C20A 5DJAB 2VBGA 1KCKA 5KVDL 4DP1X 4NF2A 5IVZB 1JHPA 3K05A 3IMCA 2TMYA 3QU4A 5FYLL 3GAFA 3NGBC 3X13A 1SO8A 4HGPA 2BGLA 1N0WA 2AXNA 2C82A 5I9NA 4E42A 2OGSA 1WUZA 2VOJA 2K1MA 3JTTB 4BHUI 3U4IA 4ZQCB 4YIQA 5JPNA 5IDWA 4Q00A 1BZ8A 4WOKA 1Z32X 5LBSL 1JXJA 4RFNC 4NSNA 2AR0A 5EF1A 2XSZA 3R6LA 1JK9B 2NW3B 2C7VA 3E9EA 4KSCA 2J4DA 1Z0FA 3S7TA 2YD9A 4NEQA 3MPUA 1AKRA 2E75C 2QE6A 4X3OA 1DZBA 3I8XA 3O47A 4G8GE 4J0HA 3Q5EA 3IETA 2PT6A 4FF9A 2WN2A 3FFCD 1PG5A 2F53E 3A9TA 4Q4HA 5BR8B 3D3VB 4G65A 4YSSA 1RC0A 2WSMA 3JWOC 1UBSB 4IDQA 1OTUD 1T1SA 2X9LA 4KK3A 4ZMWA 3MLAA 5IFJA 4DLUA 5C0RL 1YO4A 5K2OA 1W75A 1IC0A 5AHWA 4LCCA 2EINB 5DJ8A 4UQCA 5KUKA 3VR4A 1E9QA 5JW5A 4CI9A 3HG2A 2J8UE 4V1CB 1HDOA 4DC9A 5DCWA 3MMEA 3V4VA 3D51A 3FCSB 5JBQA 2BFDA 5CM9C 1LTKA 4IUCS 1II8B 1BU5A 3DBHB 3RROA 2H59A 4PRBB 2X05A 3BEOA 4O02L 5MHSD 3JZ7A 1Y7VA 4RNRA 1DG9A 1W29A 3EVEA 4NPKA 4D3ZA 3W0WE 3ZWQA 3TVDA 1BIIA 5C3UA 1VE6A 4UEKA 4U5QA 1IK4A 4MQXD 3EOAI 1L0QA 3GR6A 2BBOA 4PYQA 1EZZA 1NVGA 2CHQA 3AL0C 1SKMA 2BFPA 4U6QA 3CF6R 2WT9A 2DPGA 3G8BA 1QFSA 5E0KB 1FW8A 3UEZA 5DUBB 3GMQA 4XVOA 2E46A 4H8WH 2OPBA 3CRZA 4O0LA 5CMAB 2H2HA 4ONFH 1RUKH 3IXAB 3UYOD 4FLEA 3NIFF 5C8JA 3OFNA 4AZWA 3KPSA 1RJYB 4LL1A 3GJEA 2WKOA 3QPVA 5KOIA 2ZSWA 3HZKA 4G3YL 3L6FB 1S8OA 2AZMA 3G2NA 1T8SA 3VWJA 3ZV4A 3VV2A 1SEBA 4XMUA 4RQBA 1INDL 4UINL 3KQQA 3NHLA 4QXTA 1XGYH 2JWYA 3HHEA 4PBXA 4F7WA 1X4YA 3MYZA 4OQQA 1JDAA 4E5XB 1EAQA 5L7XL 4D8PB 5DYNA 2WD8A 4D7BA 2O8FA 1T2CA 4KUZL 4FI3F 4QTHA 4JPWH 3CH1A 4RLFA 1MH9A 2FBJH 5I8OH 4LKXB 4Q14A 2UY7B 3ADDA 3U26A 3ZVMA 2WLNA 4PPYA 4OZIF 4M8UA 3BMWA 3N2YA 5EHQA 2E1RA 3T0EC 1A3LL 5F7KC 2OBLA 1ETJA 1NC2B 2H2DA 5GVSA 4MJ2A 5D1QD 4Q6IB 3S36X 2FN8A 4IILA 3R4CA 3FBWA 3SDYH 2QYHA 3MXVH 5KVFE 1NJ6A 3H4MA 1U2GA 1EVZA 4F3CA 1KBKA 1W73A 4WBNA 3RWEB 2BZGA 4ZYVA 4L51A 2JIXD 1GYPA 3KZMA 4FOOA 1NV9A 2G0AA 3FMFA 2DHDA 3NM4A 1NIPA 4MA1C 4TL4A 3VNZA 4EKIA 3S98A 4N0MA 4U2FA 3PWPD 4PP2B 1TE2A 3ORQA 4TTJA 5HYQB 4OX9B 1AM4D 3INGA 1ZKAA 2VH5R 5HIMA 3OZIA 5EINA 4BMSA 2EDCA 5JH7B 4QDUA 4XX1G 1C9MA 3MTQA 3PC4A 5DRNA 3A11A 2G5BA 2EZ0D 3BKYL 1U9CA 4WSJA 3ZWVA 5H94A 1X5HA 4NP6A 2ZDGA 2D1SA 3KQOA 3QUXB 4LDZA 5IMKB 1ZLDA 1WTLA 5FAXA 3X3FH 2IF7A 1PAMA 3LECA 4K8RH 4DQDA 1MG2C 4NN5B 3RI5F 1XXHE 1QM5A 1JZ4A 2ZRDA 3NAQA 4QC2A 5EHGA 4R1OA 4HLJA 1G6OA 1XQ1A 1QVVA 4ND5A 2CYBA 4WEUD 1EG7A 2UYOA 7GPBA 5DHAA 4BV1A 1GW6A 2O2CA 4W5HA 2BM3A 3IDYB 2OBGA 1ZGBA 4JENA 2QQLL 4F5WA 3VPHA 3GEFA 3HKFA 1XYYA 5K3FA 1X3SA 3I30X 1DRUA 2D06A 3DEIA 3VD1A 4WFKA 2GJSA 4HLQB 2W0LA 5M29A 4N3TA 3P20A 1NLDL 1JVNA 2ICWB 1CUWA 3EFDH 2PS9A 2WQUA 4UUQA 2Q8AH 2C34A 1X6VA 5JT1A 1QMGA 2A73B 3DDUA 4F2MB 4HDQB 4DG5A 4KK9D 1JGLL 3GEMA 1NCDH 3M34A 3R8XA 4FHZA 5L2KA 4HMPA 3DPUA 2JIBA 1Z6AA 1JCVA 4KKLD 4NQVA 4BWWA 2OGWA 4S1WA 3G17A 4M43L 3ICOA 2BM8A 1KEEB 2WICA 4BTEA 4UBDD 4CVXA 2V45A 1ZH8A 3G5TA 5IAOA 3DEJA 3CE1A 4XCNA 4Z18A 3Q2IA 5JO5A 1QXSA 4MHTA 3T2NH 2XQBL 4DV4B 3MJ8B 5IFHL 1ZN9A 3A25A 5EO9A 4RZCA 1GMIA 4J1NA 4WKBA 2FSDA 3TL6A 1KZ9A 3I6KB 3I75A 2OXIA 3ZLQC 2ZYWX 4HJSA 3LO5A 3AVEA 1AQIA 1YMVA 4MOWA 1KH1A 5BOSB 4XLZA 4M88A 4PAOA 1E4XI 1LQUA 1PR0A 4RPLA 4PGJA 5TE6H 1D6SA 2B6HA 3KKLA 3X1YA 5T1MB 4D9RD 3EJYD 1D7CA 2K9UA 1TZGH 4Y16D 4OI9A 2OXTA 4JFRA 3U3RA 3D4ZA 4ZAKD 1I2BA 1WE2A 3HG1D 4M53A 1GZVA 4OVUA 2YXBA 5KTTA 4QAWA 3ENWA 2A1TS 4QOKE 4AZ3B 1EUTA 3GSOA 2NAPA 3PJEA 4KQHA 2K78A 4JFFE 1VFPA 3KQHA 4GINA 2WWGA 3JYOA 2TMGA 1WXDA 1ISPA 4NO5A 2EIJB 2Z6AA 2Q86B 2EIBA 3OLQA 2BINA 1FFPB 1CC3A 3IODA 3L0OA 4QHKI 2O7NA 5IJXA 2HJKB 3UGJA 1HESA 2QX4A 2R29H 1HH6B 4XN8A 1RLWA 1E7QA 4DJJA 5ITBL 4X71A 3DW3X 4N9OB 1JXAA 1OTHA 4AJVA 1WZCA 4UAOB 5K5EA 5KPDA 5HD8D 2Q6LA 1YEHL 2ZSVB 3ARQA 2WZAA 4EM6A 3DEHA 3IE0A 4MV3A 4RFEB 4YDHB 1U8MA 3NORA 4UILH 1DVFC 4OQ4A 5B1YA 3T3DA 3EPKA 2P5EB 4PJ5D 2OV2A 3F71A 2JKIS 5JNUA 3FWYA 5HGHB 2V7GA 1G2QA 1U3GA 3WKML 3I09A 1PAUA 5DGQA 2RGUA 3C5SB 2VPZA 4IEEA 1HKLL 4URFA 2HIGA 5BPFA 4K46A 2BF7A 5EI5A 1AYRA 1LO4H 3EEYA 1EGQA 2Y7NA 2P8SA 1PEYA 5EERA 2HKFL 2ZBFA 2Q5EA 2HHHB 3Q41A 1L9TA 4D3SA 1KEUA 4W9MC 4Q16A 3QVMA 4RX4A 1T2XA 1I5RA 5C08B 4UM9B 3BA6A 1C08A 3PT9A 4OUDB 5DOVA 2JCYA 2WNHA 3VSQA 1WB9A 3VHRA 1SOVA 3LKNA 3ZDYB 1QP1A 3N05A 1YNKH 3C8MA 3H83A 3F5FA 4LYHA 1J48A 5L0QB 1FNFA 2P9ZA 3BXPA 2XCRB 1QQDB 3FHJA 1E43A 4OF4A 4KJPD 4N2DA 3GJ3A 4C6SA 2NY1D 4EZLA 4ZZKA 5AOCA 2J87A 2OILA 4I0PC 1FFNB 3B3IB 5EH1A 4RDHA 5DD5H 1F8FA 3HKCB 4DB2A 3V0IA 3QQNA 1FYXA 1K0UA 3WGTA 4L76A 3V1KA 4DRZA 5KYKA 1NAMB 1Y9EA 4HJEA 4KR0A 4NBUA 3GSOB 1NDGA 4UTXA 3F7LA 1OSPH 3I5UA 4GMXA 1DLJA 3TA3D 1JV2B 1QHEA 2HJVA 1NEUA 3JWJA 5K9KA 4UIKL 2Z3VA 4MMZA 4QRSA 2R87A 5HY9B 4KRFA 2ZITA 4YDLB 4N5LA 1R9JA 3IAGC 3MJ7A 1LJMA 5E3HA 5B1AB 1RKBA 4E42B 3BW9B 2RSLA 4R71A 4W4OA 4M62H 2Z83A 3LT4A 4A0FA 1DHRA 4ATNA 3PQYB 2QTBA 1RQLA 4NU0A 1LDGA 1Q50A 3ZKWA 5F1NB 4W5RA 3LZCA 4N0FA 4Z95H 2WMPB 4JBWA 4E2FA 4FLRA 2QWXA 1MIMH 3BX1A 2DLNA 2FEDD 2XEXA 4WK6A 4ZPVB 3L07A 4G80A 2FUTA 4PHXA 2JJMA 3FUMA 4AMKL 1ARZA 4K6OA 1FYTB 3QUMH 2NG1A 2ID9A 3KKPA 4APQD 2ZD0A 4FB4A 1BEYL 1RURL 2XXJA 2NWQA 4LEBA 1J9ZA 3VR2D 1SOSA 1WB4A 1X7QB 2HN7A 5LWYL 3VXPA 5EUKA 1QFMA 3U2IA 5HVWA 3ILQD 2JIQA 2G2NA 4B5ZA 1FDSA 2AJ8A 3RVUD 2R4SH 3D7PA 3O45B 1JPEA 1MZVA 1CDCA 2F64A 3FNHA 3QZLA 2O6DA 4XZ4A 4IUBS 2Q3AA 3DTNA 3MJEA 4C0HA 1YNLL 4XWOD 5FYKD 4PREB 2XRAH 4OB7A 3H9YA 4P9ML 3QKRB 2FWLB 3EXG1 1F4LA 1Z35A 3R9XA 5FEBA 5EZJB 1GVNB 3IH5A 1U30A 1PMYA 5LBGA 2A7QA 1FFNA 3QXSA 1P0FA 1PX4A 2JJVA 4PS3A 1TTAA 1P7QD 1G5AA 4ZCQA 4FU0A 2XN1A 2VSCA 5E1GA 4ZO6A 3WFDH 4NS0A 3LF1A 5BZZA 5CDTA 5T64A 4PBSA 1SELA 3G5UA 1ORRA 2J6HA 2WV9A 3U4MA 3UKOA 3PRKE 4GR5A 4PICA 3UT5B 1AB5A 2CB9A 4RA6A 3V8MA 1MI5B 4LYJA 4E1VA 2X76A 1H5UA 3B9DA 4Z5RA 3GLHB 2D6FA 2WQZA 3Q6IA 4HDNB 1N7GA 4Y16B 1CDUA 5J9FA 1E4HA 3D09A 4U4BA 3C09C 2FFJA 3VR4H 2ADFH 43CAA 4KHXH 1TPYA 4JY4A 2CNWD 2QLVB 1UKYA 3BE6A 3IEUA 4NWUL 3LVEA 3I9NA 3UBXB 3SAJA 3TZ6A 2DQCL 4ODSH 1P8JA 4MYTA 5KZCD 5ALFA 4G7QB 1XF5A 2IBGA 1ZNWA 4JFFA 1Q7CA 1MFBH 5BV7B 4L0CA 4HZLB 1UH5A 3GRFA 4ZFZA 5EBGA 3WDJA 4HUXA 1NVFA 1ZGLA 2WMDA 3ZY5A 2IRWA 2IYVA 4E4RA 2AN3A 4CU7A 5FW7A 1NMCC 2RI0A 4PR3A 5JISA 4QEDA 2OP1A 2B99A 2CUNA 4RCAA 3WTUA 4UDNA 3I2CL 4BO5A 4BXSV 2CLVA 1RI3A 4L28A 5FJJA 4JKOA 2AAAA 1HK7A 4OJKA 1P5UA 3UK6A 3GLVA 2C3VB 4PAMA 3VXPB 2V6FA 3O4OC 4BNIA 3YASA 2C1OB 4L8SA 4N24A 3X1BA 1W5FA 2WEKA 1K5PA 3KD4A 4NBWA 3A4MA 2YRXA 4LJ7A 2PO6B 3GAZA 3IOBA 3OKMB 3U0PB 1E6CA 2EVHA 4E09A 1VDGA 1XZ0B 3DP9A 2K45A 1NICA 4XGNA 3B2VL 1E2EA 3SC6A 4LMQE 2VTDA 2IGFL 1J9GA 3X1ZA 5F5XA 4OHMA 1SK8A 4IBVA 4HR7A 2BM9A 1G7JB 5JH7A 5HKLA 3ULVH 1UKTA 5HUJA 3ZQWA 4EX6A 2WQXA 1N7MH 2AG1A 3UV7A 3G9QA 3R4VA 1CXIA 2OR9H 3CUEF 1A5AB 3BVNA 4BMNA 2Q49A 4MTCA 4ONHB 3GKWH 3SGDH 1UJTA 3CQFA 1PR6A 3M5DA 1NJ9A 3MZGB 3LIZH 4NQUA 1RK1B 4KTDL 3VC7A 1GG9A 1WZMA 3MV8A 3VM6A 2WXGA 4WI5A 1XK6A 3BSSA 2V0AA 4L3EB 1WU8A 3WV0A 3IP3A 5HFJA 5F21B 3FAXA 5JORA 4N6RB 3LX4A 4MRBA 2N0KA 2K7FA 2O5YL 3D85D 4Z5RB 1T5TA 2PX3A 4GVPA 3IKCA 4DG8A 3DRQA 2HGSA 3ML8A 5CCXA 1PG2A 1ZLWK 3OOEA 3PU6A 3I23A 4G6AC 4IJ3B 1JHZA 3OAWA 2C3UA 1JPNA 1YUHA 4C7OA 1RQ5A 3EYFA 4LCWD 2Z95A 4HB0A 2JBWA 3LC0A 1OF2B 3FO2A 4H8UA 4UNSA 4ALMA 3DVAB 2RGEA 2JCSA 4JYZA 1XG5A 1HOEA 4Z53A 5J2UB 3NA9L 4ON9A 3ZIAD 5JHDE 4F8LA 2ZJ0A 1RWQA 2NO7A 1TIKA 5IBPA 1DBPA 3RM3A 3OMAB 1QLEB 2ZB3A 4F37K 4OIAA 1D5RA 4ZV4A 3UTPD 3T2LA 2HQSA 4Z0TA 4BUZA 4NE9A 3IBEA 1MAJA 3C6MA 3QQPA 1IY9A 1PFKA 5EE5B 3V48A 3SYTA 1UWGL 5HI4D 1HEIA 5AXCA 3QVVA 1NZJA 1EUZA 3MLYL 3WLLA 5TDPA 4M6AA 1YRAA 3VX4A 4F0JA 4LTDA 1UBGA 4ZW6A 1VJRA 2I7XA 4EMSA 4UC0A 1L4GA 3W11C 4M54A 3S7ZA 4NZDA 1OMOA 1EVLA 4X6EB 2H17A 3LVTA 4UHKA 5FWXA 2B4CH 1N8NA 3KHTA 1T7WA 2BVTA 5MHSE 4JEIA 1XMEB 2G80A 1KXHA 4HZAA 1AKJA 1HMYA 1DN0A 4LLUA 3LSTA 3PQ7A 4B3FX 2J0EA 4HQKA 1JNLL 4JLVA 1Z7WA 4OZIE 4ENPA 5J4VA 2FW9A 2DAPA 1G5HA 1JMXA 3GHPA 1ED3A 5F7AA 3ILYA 4IM8A 1P4IH 2VJXA 1QLHA 3VI3B 2VLKA 1K8RA 1KDZA 5ADOH 2ZSAA 2V6BA 3B34A 1LDPH 2QPFA 1JKMA 3BC9A 3NJ4A 4FG4A 4AZ3A 4LLYA 3GHEL 2HLAA 3FUFA 4IIHA 3UC9A 3NTQA 3V5KB 1YQEA 4UM8A 2V17L 4YJ2B 1XD0A 1QKIA 4NAMA 2IXQB 4LDJA 4EA6A 2DQTH 2WWIA 2GSIA 3N5CA 1N5AA 1O5TA 3TQRA 3L4ZA 3W3AA 1JHLH 4GO9A 4DV6B 4GKKB 3Q44A 4GNRA 3NDIA 4WIQA 2ZJ5A 5FDWB 4DIFA 2C9MA 1KY7A 3SXJA 3QENA 1PJLA 2YX1A 4WHCA 1M6EX 3TSZA 1YS4A 2CEKA 2R25B 1IMHC 1VL2A 1LXCA 1BBJA 3AETB 2F55A 2OV1A 1F20A 3WTYA 3UB4A 4RPCA 1QFJA 4A0HA 1BCRB 2BH9A 1BCSB 1R74A 1MFCL 4CU5A 4UPVA 3M2PA 4Y2XA 5DHRA 4E03A 2H3EA 1XTSA 1H2FA 5ICEA 3RS7A 1I6LA 3LUBA 3NHZA 1AIFB 1JERA 4S1DD 2CD9A 1H2YA 2VAXA 4BFUA 1YEFH 4P57A 1N67A 5I4KA 1INEH 3HE7A 2BZSA 5HE8A 3AP1A 1PJ8A 2NMVA 1BVOA 1Y6QA 1ZVSB 3AVWA 1DX4A 4HYTB 3FB7B 5CLHA 4MS3B 4MVJD 1NOIA 1P1KA 3Q0IA 2FR8A 5DASA 4YJDA 3STXA 1CGWA 5BSEA 2E7CA 1PCXA 5JMWA 3TH2T 3DYPA 4HOYA 3QISA 4U3JA 4AENA 3T2OA 1KCSH 4B45A 2I3DA 3QKWA 2JCGA 1H9DA 5JECA 5EF3A 1CK0H 1VLXA 5TGBB 3PS9A 3IRUA 4RH4A 4F2EA 4PJ7E 4F8YA 2V74B 3HXMA 4D4MA 2G3YA 2YKLH 1E0AA 5DD0L 3PEVA 1LZLA 4JJOA 1Q9LA 4E5VA 3QDJD 1KWGA 5ICSA 5CN2A 4F5EA 3HR4A 1XL0A 3QE5A 4MGKR 2I4RA 4FZRA 3RSGA 1QSFE 3F7QA 1BXGA 1T36B 5E2UL 3NM6B 4DFDA 3AL2A 2GSDA 1Q77A 4N0CD 1DE4A 1EM8B 2IU4A 2AABL 5JHHB 1J2YA 1YB5A 4TGLA 4MVJG 2FJHB 4C7KA 1HH9A 2CJUH 4MW2A 4OI1A 2XMBA 4LLQA 2P4HX 4C4RA 1JD7A 3RUAA 3N39C 1CETA 3AY3A 4AWAA 2WMOB 3TESA 3GJQA 3NJLA 1YMME 2FGZA 4MA0A 4QARA 2Z2XA 4A2FA 4FGWA 4MMZB 1PKQB 4BVLA 1XRSB 2XWDA 1AD2A 4IHKA 1GKKA 3ZW8A 3FTPA 1WVGA 4L27A 3IUYA 3CHYA 5LCVA 4YRDA 3R9WA 1SBTA 5B4MC 3Q3GA 5AW1B 1WZNA 1KYOJ 2R23A 3EA0A 4AS3A 2J4FA 2NY0C 4J0KA 1T0BA 1JPST 2ZWIA 3U9TA 4F11A 3I4CA 2AJVL 5AVYB 3CLKA 2GYSA 1ZVNA 1V4VA 1U0BB 1U4SA 3EHDA 3QKTA 5F2OA 4RGMC 4RQQA 2GWRA 1QUNB 2XU9A 3M1LA 4FD2A 5J9PA 1UUFA 5EOVA 1FCJA 1TCBA 1AGPA 3PGDB 3FU6A 4CV1A 5D87A 4JRYA 4G6ML 4W7SA 3FH7A 3IFNH 1MAML 1NJ1A 1FFTB 2FSVA 2ARWA 1DTWB 2X0IA 3JZFA 3NHRA 2PXXA 3LYLA 4N0FB 4ONGH 2OTWB 2P3QA 2FOXA 1MJ7L 3W7BA 3NZHL 4BB6A 4LPXA 4LHZA 4PVDA 1U1CA 2O1XA 1FNNA 4MRAA 1NJ5A 3QFJA 3NSXA 4HMCA 1ZS8A 2EU8A 3SGDI 1YGPA 5C09A 4ZHQF 1APBA 2Q21A 2Y0EA 4OP2A 2GIMA 4E22A 2X7XA 4LQFL 4N28A 4OGWA 4RVCA 5KJ1A 3OIVA 1SLVA 2AN1A 2FYTA 3B12A 1ZV2A 2D2CC 4XX0B 3OETA 3AEKB 3L18A 4OM7A 1IN5A 2X13A 2M1KA 1GOHA 2BD0A 2YTZA 3O4GA 4FYVA 1EU1A 1TVBA 2EDLA 2SICE 3I9JA 3DJSA 4PZDA 3ZQJA 1RCFA 2XAAA 4B46A 1ODUA 3P0YL 2Y4SA 1CBVH 2HA2A 4UNUA 4O4IB 1W47A 4POOA 3F8TA 3IP9A 2YD3A 2AJSH 4TL8A 4FW9A 4Y2NA 1QX3A 3OEYA 2CR6A 4YRZA 2YFKA 4BZQA 4X97A 3CAFA 2VHEA 3U4BH 5HP4A 5EMLA 3P3YA 1URPA 2GM5A 4Z6AT 3KBPA 3WTBA 4GKAA 2O8DB 1OP4A 1J5PA 2IYEA 3ICCA 4G8JA 5EP2A 3HKEA 1SY6L 6PAZA 5D6CA 5F1PA 3TAHA 1IZ0A 1EH5A 5B2EA 1YG9A 4G3YH 1YDEA 3BUYB 1S78C 2FVYA 3EF1A 4U9UA 5I1CL 5F1IB 4W4NA 2D0IA 1P1ZA 2OMWB 4Z86A 3ZE8A 4G6AD 3CUTA 1QBKC 2XWBA 3LKVA 4XWKA 1PWZA 2F5BH 5GRJL 3DBRB 3K1YA 1BE8A 1CK0L 2P65A 5FIUA 4G43A 4Z78B 1MVUB 4J3BA 1GJWA 5GGQH 3G59A 3SKXA 3KYKH 2AL7A 1KI8A 4GKJB 1T2QL 2YMOA 1HG0A 1K8YB 2GDZA 4FFNA 1RKRA 2I3GA 4RVBA 4GRWB 3S48A 5DRWA 4FTWA 2QT0A 3QVAA 2Z7WA 3MOQA 4JEHA 1QV7A 2R0QC 2PKXA 3WMPA 2QYSA 3WN5C 1XTLA 4MUKA 5G3YA 4ZC1A 4OVVA 1AD9B 4ZX5A 1JGUL 4ELMA 4A2QA 4EY7A 3HNSH 1YEWA 1M6HA 4LXXA 1QD0A 4LZNA 3ZJAA 1IJFA 2APSA 1F8TH 4XGQA 4URXR 4RTSA 3DE4X 3TK1A 1N1GA 4LFHG 4X7MA 1XJ5A 2EXWD 5IOPB 3P3TA 3SWWA 4I0PD 3FL7A 3W5HA 1K6QL 1Z6JT 4DABA 2UU9B 3WO4B 1B0GB 3FO1B 2Z3WA 2E5FA 2DMCA 1E2HA 3KVDD 3PFGA 4C30A 3U7WL 1TC1A 1TVHA 1QLEL 5AI8A 5KWVA 4ASUA 3D8RA 4JLRA 3ANXA 4CU2A 3A9CA 2VT2A 3QUZA 1TUEA 4WI1A 4JOSA 3IDGB 1MRCH 5LP1A 2EUXA 5LUBA 3AROA 3GLIA 3ROLB 4DJFC 4HEMA 2ZXEB 5IMOB 2ODIA 1Q20A 4ZALA 2VLMD 4EG8A 5AI9A 2QPEB 3OJEA 2VLLA 2IV9A 4BINA 2F68X 2WLHA 3DGCR 2BT4A 4R9NA 5HI3C 3CY6A 1RU9L 1W1UA 3T41A 1XD2A 3EPRA 1CRQA 5K6TA 3BJMA 3D69A 4G9FE 4Q4JB 3GIZH 2BC4A 1AGRA 5ICZB 4D46A 2JK1A 1CICB 1DVZA 1MPXA 3DX8A 1UR5A 2NY0B 1GTSA 1ICTA 5TIIA 3V52H 1DUZB 5IH7A 1W6RA 2WXLA 5BV2P 3C3JA 2CNKA 4ZK6A 2Q6KA 1S9DA 3BP4B 4HJ1A 3KPRA 1UYWL 4YALA 2OMUA 5AVQA 1HHJA 2OMWA 3PA6A 2HA1A 3NBYC 4P4SB 1OZUA 3B20A 4KY2A 2AVGA 3JQ8A 4HQFA 1KYWA 1JBJA 4PYRA 2NP6A 3UMNA 4F97A 1EHNA 3L6EA 4FQ7A 3L92A 4CBPA 3GSNB 3GFSA 5JASA 3BQNB 1JFQL 2CK0L 3GMQB 2XHEA 5AW5A 4CM4A 1FJXA 1MELA 1NTOA 1PZCA 1BA3A 4FABH 1J0DA 2R1VA 2YBGA 2W4IA 2FPIB 3V8QA 2GAAA 1HJCA 1OLOA 2IYPA 1SPDA 5AAMA 3KELA 5DGRA 3N76A 1H2ZA 2QORA 3B37A 3BRSA 2B3DA 4H88L 4EF4A 5GJSH 2Y7LA 2J0UB 2Q45A 4FN5A 4K9JA 4TUOA 1YBAA 1HYHA 4UMGA 5TDPB 3N8DA 1KI1A 2ODWA 3H1ZA 3QEQE 1UMKA 2GHRA 1UBMS 1IYZA 1JBQA 1I2CA 3LNTA 2YN4A 3CM0A 3DL0A 1QC5A 5JHDA 1BW8A 3TVMA 1VLJA 1MC8A 3CUYA 4GXUM 3DV0B 4WXHA 3PIQA 3KVYA 4XOEA 1PZBA 5DWQA 4ZUWB 2WBJA 4Y1AD 3AITA 4OJNA 2XB6A 1NW4A 4JRYE 4AE0A 1FZOB 4DKFL 5F0JB 1DPGA 5DWUH 1SCDA 3Q8WA 4K6MA 5AL8A 3D0KA 3ZWMA 1B93A 2OPCA 3STHA 1G0YR 3U25A 3ZBQA 4MR9B 4XCVA 4OFWA 2GT9B 1C3XA 1GADO 3IT3A 5T6BA 2RAVA 3H0TA 2E3JA 1EB8A 3ZTJG 2GHQA 1DVYA 1JIUA 1OZGA 3D8NA 4X9BA 3M0EA 1T3TA 2W65B 2BRRL 2DPLA 4LVUA 1RC1A 1G7RA 4B6GA 1QR6A 1X1TA 4ZW3A 5FQNA 4NPAA 2NYKA 3RS3A 3NV9A 2BSQA 3QQXA 3WNMA 4BLRA 1GG2A 4XTCS 1RVFH 3C6SB 2NVUA 1ETZB 4R7XA 2YAOA 5JWRA 3X0DA 2OZNA 2UVEA 3DZFA 3C39A 1YT5A 4OXNA 4BEVA 1SA0B 2NZXA 2C2GA 1U9IC 3F7OA 3R1GH 4QLBA 2B1HL 5AVQB 1XF1A 2JFGA 1DJZA 4PRIB 1H3FA 3LEXA 4TL6A 5I1GH 4ER3A 1QWSA 5AJTA 4GSDL 4OLUL 4QRTA 2GAZB 1UM4H 2CZGA 2PVCA 5JZ7D 2WHPA 1KZHA 2FXVA 4AM0A 4NV3A 2YY5A 3FTUA 3W05A 1Y6KR 2BLFA 3RTDA 4OHOA 4QPCA 4PJDB 5TS2A 4GW1A 5L7XH 1ZQ9A 5ARCA 3OY2A 5I0ZA 4CM4B 2AXWA 2VZUA 2WCSA 2ROYA 4WV1C 5D2LB 5IJZA 2PV0A 1K3FA 1RXLA 5FWYA 3PUVA 3SR0A 2YJ3A 4TLDA 1WSAA 2YNMA 3HYNA 3OG6B 4XP1H 4HG4J 1P2GA 5ABPA 1U21A 2X8JB 2I85A 3E38A 3MN8A 3J7HA 1NYQA 4JJZA 1Z4KA 1D3AA 3I53A 3W6NA 3IGAA 1UPFA 3BHIA 5D71H 2PA0A 3P0JA 5C86A 3CB4A 4WZBB 3SDYL 4TUOB 3R3ZA 1EB9A 1ODCA 3QWRA 4L57A 4UXJA 1MFEH 3BSZA 2V7WA 4ARSA 4JFEA 3R4DA 2EICA 2C96A 1BMWA 2WE7A 3QX3A 3NUZA 2H18A 1YOBA 2W2LD 4A03A 2UZ3A 4Z4IA 3DVIA 1QR1B 5K4HA 2KPWA 2EKQA 4JNXA 5BN1A 1NCAH 2H4WA 4KQ3L 2QG4A 2HIHA 3II6X 3DTXA 4HRXA 4DQLA 3MJ8A 4M1OA 2IODA 3HVDA 4ELME 3IDSA 4P48A 3ACCA 5HVNA 2FY8A 3MRNB 1XTQA 2BJVA 4X6XA 4DUGD 9ATCA 3TBVB 4YMGA 4LCBA 3RBXA 4B40A 4YN3A 3CVIH 4OQ1A 5D6DA 1TT7A 3V00A 3KAQA 1D2AA 2QLLA 1YBFA 5LGJA 3NWJA 3KPYA 4ZMOA 4MUXA 4KJXA 2OYRA 3R9IA 1NQVA 3F49S 2C8JA 2BSSB 1M6OA 3NBZC 5AQEA 3BXXA 2B9BA 4HV4A 4ZW7A 1DQLL 3EZ8A 1COWA 5LN4A 3BF8A 4MJIB 4WTWA 4JO4H 2WWXA 4MCIA 2EDDA 1KORA 3UTTA 5KJCA 2GY5A 2Z31D 4NPHA 3V8RA 1UBOS 3A22A 1L5YA 3T5WA 3VPGA 1GU0A 4JDTH 1Y4ZA 2MIZA 5DBFA 2XX1A 3N74A 4JE4B 1LO2H 4KXBA 2RC5A 3D0RA 1SMAA 1C4XA 1NGPL 2GJZB 2VLIA 3BZ4A 1YL6A 1LO4L 3S36L 5FWNA 1JQAA 2R48A 2J08A 3R3JA 3DX1A 4D42A 3F8WA 3N0AA 3H87A 3SYRA 4DCVA 4E9QA 1J09A 3GJ5A 4F38A 1DTWA 1IAQA 2VUKA 1NW7A 1G38A 4JC8A 3B70A 3UZEC 1MX9A 1QCDA 1NFRA 5D1XC 4WCDA 1N59B 4RIIA 4C4KT 4IVPA 4JYPA 5LGHL 2ZPKL 2HA5A 3SJCA 1B14A 2JLZA 2JIXA 4YIQB 1GIGH 5DUMH 1R9MA 3UAJA 3O6FC 5J6SA 4PLZA 1XGRB 1M05A 1T1XB 4NP4L 1EBUA 1YJCA 1MW9X 2BRRH 3QF4B 3EXEA 3EQ2A 4MQ4A 1SXBA 4A8TA 2AXPA 1T0MB 5H37G 4M7LT 4M5YH 2G67A 3JD0A 5TEVA 4ZIRB 4X6DB 2PT9A 3MRFB 1O57A 3DVGB 4M48H 2AQQA 5HKKD 4L48A 4ZK8A 1GH7A 1DEOA 3G0DA 4TV9F 2WHXA 4NBYB 5C08A 1GQRA 3FHCB 4YT5A 1R6VA 4WU5B 1KFAL 4GRAA 1T4WA 2UVFA 4RA9B 3O83A 5BSTA 2YJNA 1WBXB 3IMGA 4ODBD 2H0AA 3E61A 4F9PA 1HHIA 1OPRA 3VAYA 3THYB 1PWYE 5FWXB 3U4DA 1EVUA 1NR5A 3O2DH 2CDAA 2VN4A 1PLGL 5LBSA 5C2JB 3HXOA 4JFZL 4YWJA 5C0BA 4PGFA 1BXVA 3EPPA 5EJAA 3FU9A 4DSAA 3FPCA 3P96A 2B16A 1ZH0A 1YJAA 4X5QA 3MOAH 1TU0A 3QPQC 4GEIA 1GGCL 3T65B 1QGYA 2CCJA 3W2FA 2V6GA 4XLLA 4BH7A 3GXIA 1KK3A 1BMGA 3R5TA 1V1MA 2OD2A 1XDBA 5FQOA 4UNPA 4RDQF 4KK6D 1JR6A 5TF4A 4UUBA 4DPKA 3A6BH 4X62B 5TMEA 4C4YA 2E5LB 1NWHA 1B6SA 2KQNA 1L5SA 4TMXA 1HAUA 4QXRA 5KVFH 1P0PA 3MJWA 5HJ2A 5C0NC 1S2EA 2IG2L 1P4HA 1SUAA 3GO1L 4QJ5A 5G4LA 4DEUA 3VR3D 4C4PA 4N3NA 4M5TA 4C04A 4MRPA 2DUMA 2WXOA 1OI2A 1SOKA 3GC6A 2X4TA 4DP0X 3KTOA 3SDAA 4CW7A 2HJ9A 2Q3DA 3DJZA 1FVDA 4DMUB 4FHJA 3NJ8A 3VR5D 2AJYH 4JHAH 4AV5A 4KYIB 4K94L 5C1DA 5GPRA 2XB8A 5CJ5A 2WVVA 3GDHA 2EFDB 2FDRA 2EATA 1VIWA 2ZJFA 2XT0A 4WLVA 4X45A 2ZOUA 4B81A 3IYLW 3H42L 1R10A 2XZQL 4L2IA 5B1JA 1JALA 5FFOA 2B78A 3U7RA 4MWEA 2BEUA 3GZTB 3OSUA 4QFDA 1AXRA 2BZ0A 4NZUH 5MENE 1GKLA 4NXSA 3WP1B 1U3HD 2UUAB 1TO4A 4BXVA 4W1RA 1K6EA 3HO8A 4TRRA 3PYCA 4MA3B 5NULA 4NFBA 3CH8A 2VWPA 4YXLL 5JDCC 2OZLA 3ZE0B 3FT1A 2Y6VA 4ZO4A 3IRVA 2PMEA 3QIBB 3PNWA 4P7JA 2OL3L 1KN4L 2QQ0A 1TKRA 1FNLA 2Q2EB 2REBA 3MGAA 3DE6X 2XOXA 2ENUA 1Z88A 4EVIA 5DR5H 4BP3A 2OWEA 5F98A 3DYOA 1KYVA 4MQFA 3B1KA 2R8SH 3GLUA 5CEZH 1VFNA 1OSPL 4PLJC 4KNUA 3O45A 5ICZA 5GRUH 3PGMA 5A7FA 4XMPH 5TMPA 5DI8B 1B76A 3HPJB 1ZK4A 2EBFX 4DDHA 2QGEA 2CMKA 3T65A 1M1YB 3JYQA 4D9CA 3U3XA 1Y3IA 5HJEA 2XNAA 1R4ZA 3DO5A 4IKIA 5DC2A 2JLLA 4JPVL 2Z31A 2CBOA 1GT6A 1GQ2A 2HA7A 3QKRA 721PA 3H0EA 4BB9A 4K5PA 1N70A 1U9KA 1GGYA 4P2AA 2Q62A 4JMLA 4NMMA 4KAFA 4EBBA 5INTA 3A26A 5SWSB 4F27A 3U2SB 1RTTA 3MB8A 4M1QA 3ET4A 3VXTA 1GG5A 3VGAB 3AFIA 1NATA 3NVMB 2XA8H 5JJIA 2ZJ2A 4DPLA 5F8QC 1XMVA 3B7YA 4ZOAA 1L5QA 2KPOA 4YO7A 5CNJA 3WA6A 2C2ZA 3SVZA 4E7OA 4PJFE 5B3JA 4YSPA 3ZGYA 2DERA 2VNIA 2EIDA 1R5JA 1X5IA 2HQRA 1NFDA 2VDPL 1L7EA 2WKPA 3KD2A 4PPQA 1E3LA 4BB5A 3OICA 1KLUB 3B3JA 3RADC 5KYXB 4L85A 1IBGL 4NAJA 3HGMA 5AW7B 1QACA 2P9TA 1CJVC 5JNWA 4OD2A 4AK1A 4I3FA 4X0KA 2V7XA 2WF5A 5ANRB 3ZRCC 1KEPA 4QQKA 1P1VA 1JXFA 5E8PB 3GPCA 1Y18A 4F7EB 2HSDA 2P9CA 4ZVUA 1TCCA 3WYBA 4DBLC 4ZYTA 4XE0A 2NW3A 4A23A 2ED6A 3W5AA 3LRTA 1BO6A 4MZ2A 1YVEI 3LUDA 3SQLA 2YHSA 5FOQA 3ZYIA 3ET9F 4FQLL 1W8DA 2PH7A 4QRBA 2V5UA 4PCSA 1S7SB 5E9DA 2VXBA 2JI3A 2Y1KA 2HQBA 2ECFA 5JCJD 2V1UA 1ZN8A 5B38B 3BKML 1RJZB 3K9GA 3BGMA 5KAPA 4H6VA 4LOHA 3TA3A 4Z1MD 1NV8A 2F7PA 3I9KA 2PO6A 3FCTA 4MWGA 3GSXB 1W87A 1OGJA 1VKNA 4POUB 4WHMA 4TTGA 3UB3A 3HA7A 2E9GA 3FB6B 4WWKC 3B1VA 3VQLA 2AOUA 2NO0A 2DKUA 2EDXA 4K3EH 3QPDA 1HQKA 5HPMB 5HYJE 4UAOC 2I7OA 2JLPA 4NOKA 3ANYB 3AHFA 3EARA 4PIMA 5FYKE 1T6BX 3HKZA 3G0GA 2Y06L 4XYLA 3UTDA 4NERA 2V2WA 1MWAH 5KVDH 4NO0D 3ARZA 5BQXA 3GRRA 1M1ZA 4W9CC 3MQIA 1DAFA 1AGFA 1QTQA 4MV7A 1U8KA 3JYPA 3IJRA 4AN0A 2MR5A 3WV4A 4DO6A 1NBYA 4H0IA 1UQRA 4PWKA 3ZC3A 4MRRA 3ZHYA 1TO2E 4AQ1B 3K0AB 2NGRA 4DNLA 1NSNL 3E35A 3MLUH 4YUVA 2NLOA 1NNEA 1ZGHA 1PHPA 3OURA 4ZGGA 1M2GA 5CAEA 1ADGA 5I71B 1HL3A 1LQTA 2FRDA 2O1EA 4AKTA 3UWSA 2Z35A 3BCDA 2BTEA 4I2XB 5HYEA 1OB5A 5FWYB 3KTDA 2WINA 4R6UA 1GPDG 4UZEA 4PC6A 4XIGS 1J2TA 3T3PF 4O51B 1D5ZB 5DLEA 3AKEA 4KXZH 1ZKMA 4ZCPA 5DGCA 1XR9B 1ZD5A 4FEAA 4L5JA 1ND0A 4FJYA 3UYLA 5HVGB 4JHBA 3BZEB 3BWBA 4AO6A 4XNMB 1XCPA 4JI0B 2OAP1 4NC1E 2M26A 1GR7A 4JT4A 3K2QA 2W2PA 2YHUA 3MLXH 2POCA 1KJZA 2ZR9A 2LCQA 1UPCA 3E53A 1MHEA 3ADKA 3WD5H 3IXMA 2W2KA 5BRPA 3PRZA 1G9NH 1HS6A 3ROQA 4Y88A 3HK2A 5GS0H 2JKTM 3PXDA 1U28A 3IDNB 1JKIA 1BWQA 3L4BC 2BL4A 5IAJA 3S2FA 2IE0A 2P9QA 4L0YA 3ZU4A 1TT5B 4X6EA 3NANA 2FUEA 1H0DA 3EUFA 5KVGE 3SBPA 1JPGB 4F1ZA 4ZVMA 3JYCA 2XVZA 4F3FB 4HWSA 1NKGA 1QZZA 2FKNA 5CCEA 1QA9B 4HYQA 1CFSB 2JFCA 2DUUA 1CRWG 1OQAA 1SR8A 1U8JA 5H4YA 3B2PA 3JQGA 2JANA 3ECUA 4DARA 3QX9A 4RD0A 1HDMB 1OLSB