3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
1KMCA 3R6GA 4LSZA 5I9BA 3EDRA 5H0IA 4JJ8A 2QLBA 5IABA 4QULA 4ZVUA 2XZTA 4JR1A 4EHFA 4QUAA 2J32A 3P4UA 3PD0A 4NBLA 1GQFA 5IAJA 4QTXA 1SHLA 1F1JA 1NMEA 1I3OA 2C2ZA 2FUNB 5IAGA 4EHKA 4ZVPA 4NBNA 1RHMA 2C2KA 3BIJA 4N7JA 4AW9A 1RWMA 5IBPA 4NOLA 4JR0A 2C2MA 1ICEA 2H51A 3OD5A 4D3XA 4QTYA 3H1PA 3DEKA 2H4WA 3NS7A 1RWPA 4HQ0A 2XZDA 3GJRA 2H65A 2H5IA 3IBCA 3P45A 3S8EA 1RWKA 4JQYA 3E4CA 3UOAB 4PS1A 4EHNA 5LU9A 1QDUA 4AWBA 2HBZA 3V6LA 2Y0BA 4D3ZA 4DCPA 1I51A 4NBKA 4JJEA 2WDPA 3V55A 4N6NA 1RWXA 5IC6A 3H11A 4DCJA 4PRYA 3IBFA 4PRZA 4N5DA 3S70A 1JXQA 3ITNA 2CJXA 1QTNA 3GJSA 1RE1A 4EJFA 3DEJA 1RHRA 2FP3A 1RHUA 4NOMA 2QLFA 4M9RA 3V4LA 1BMQA 2HBRA 3D6MA 4QUBA 2H48A 3V6MA 3H13A 4EHAA 1PYOA 4HVAA 4DCOA 5IASA 5IARA 1RHQA 1SC1A 2CNNA 3KJQA 3NKFA 5IAKA 1PAUA 3R7BA 4D3YA 4ZVQA 3UO8B 1RHKA 4I1PA 4QUDA 3EDQA 4N6GA 4FXOA 3V3KA 1F9EA 3R5JA 2QLJA 2CDRA 2QL5A 2CNKA 1RWWA 2C2OA 1RHJA 1CVRA 1NMSA 2J33A 3RJMA 2CNOA 2NN3C 2Y1LA 1I4EB 4NOJA 2J30A 4JB8A 2QL9A 2QL7A 4QU9A 3KJNA 1SHJA 4EHDA 1QX3A 4QUEA 4N6OA 3V4OA 5JFTA 4N7MA 2C1EA 1SC3A 2XYHA 5IBRA 1RWOA 5IBCA 4ZVSA 3K7EA 5IC4A 2H5JA 4EHHA 2H54A 3R5KA 4JR2A 1NW9B 2P2CA 4ZVTA 3H11B 3PD1A 5LUAA 4QUIA 2AR9A 3PCXA 4QUHA 1NMQA 2HBQA 4HQRA 4I1RA 4IYRA 4PS0A 1IBCA 3D6FA 2CNLA 3D6HA 1CP3A 4AWAA 2K7ZA 4QUJA 5LU8A 3GJQA 4JQZA 1K86A 3QNWA 2J31A 1K88A 2XYPA 3R6LA 5K20A 3H0EA 4IEFB 4ZVOA 2HBYA 1I4OA 3SIPA 3GJTA 3NR2A 4ZVRA 2FQQA 4JJ7A 5LUBA 3SIRA 3KJFA 1GFWA 2XYGA 2CJYA 2H4YA 1RWNA 4FGUA 4QU5A 3DEHA 5I9TA 4QUGA 3R7NA 1SC4A 4FDLA 4QU8A 3DEIA 4QU0A 1RWVA 4EHLA 4FEAA 4NOKA 5IAEA 3R7SA 2DKOA 1M72A 5IANA
chains in the Genus database with same CATH superfamily
1PWEA 5D2LA 4X20A 1YVEI 4L0PB 5I7EA 3O8DA 3QG7H 1ATZA 1S1CA 2G9UA 4LOIA 2NQDA 2RH4A 3V7AE 4XMKL 1MJJB 2V0CA 4RQBA 3D0VB 4LSSL 3BWXA 4XH2A 3K8MA 3QFJE 4PJ5A 1T26A 4HQKA 3AHGA 4ZYXA 1V7CA 3MERA 3NM4A 3C5WP 3TEXA 3TVDA 4AKIA 2VSCA 3VVBA 3QO0A 1GXSA 3K4ZA 5D2LE 4UHEA 1MZYA 3KWWA 2KWIA 3USCS 2FBJL 1WG8A 5C9KA 2IPAB 3D25B 4FMDB 2DYSB 1QFOA 4JRLA 4NN7B 4OCSH 4KB5A 1YJ8A 1UZUA 4QRSA 5D3MB 3R77A 5L7YA 3WYCA 2VLRB 5F9DC 3JQFA 1G9ML 3KJNA 4U1RA 4LCBA 4XN9A 1DAGA 4MLSA 2EKJA 4B95C 2A86A 3B9QA 4WESA 1EJ6A 4J1SA 3VI4B 3GW8A 3NLLA 5D96C 2VP6A 3IP8A 2WMYA 2V7GA 3SZUA 4JT8A 1KQOA 1GZQB 2W2VA 4X7TB 3TLGB 1I7QB 3R9WA 3GMMA 4O4HB 1AY1H 4R8WH 2JD0A 3WNDA 5AXCA 3EFDH 5CJXA 2OOSA 4HQ6A 4ADSG 4X5OA 3A24A 4L3EB 3RABA 2VABA 1XSJA 1XDDA 1K4CB 4GUPA 5FV2A 2WKWA 2YOFA 2WHQA 1CUSA 2PP7A 4D44A 3IJ8A 2FGJA 3R1GH 4EB6A 5C0NC 2C4KA 2OORA 3QDGA 5L88H 5EO1B 2CXRA 5LMZA 4YSRA 2CJFA 4N5ED 4GRMA 1BFKA 1GITA 3IGKA 3V97A 2PVCA 4EMBA 4JGNA 1I51A 1TXKA 5KBLA 1Y4DE 3J8F7 3M17B 1G7PA 2YY5A 3G9VA 1MJUL 3DCNA 4ZUSB 1ZA3A 3FB7B 1DUYA 4EKEA 4RQQB 4D98A 1SHXA 3KKMA 1IJKA 1T9ZA 5L51A 5AW6A 1RBQA 1C1XA 4ALLA 5B1HA 3X2FA 5G1OA 1CRWG 1PL6A 3BXPA 3LYUA 1CGUA 4QAWA 2JK1A 3REGA 3ULUD 4GKAA 3DNFA 1V16B 2OCDA 2PGDA 1F86A 2XUDA 4JUAA 3AF2A 3T1NA 5F89B 2Z8WC 3HEAA 2BBSA 4DOMA 1XZAA 2Y36L 2Q5HA 1NZFA 5IHLB 1HDXA 3AOEA 4RADA 5M3BA 3IAUA 3APFA 3ZZ1A 4LF3B 3AFGA 4APQC 2ZE6A 1WXWA 4IJ6A 1U2GA 2VIIA 2A9NL 2GZSA 3RDTA 5T33L 4L18A 4KN8A 5B4UA 3VOAA 4GBXB 2PRJA 4JI5B 3GH3A 3JVUA 2ZYUX 1WMSA 1N8TA 2QQKH 4M87A 3I72A 5DMHA 1VRWA 2GO1A 1QHHB 3SBEA 2X4UB 4LU5H 5IFJA 2F08A 3AY2A 2C3VB 3LS4L 4FFBA 4CM4A 4Q1EA 5T1LA 5F76A 8GPBA 3FFAA 2BFCB 3RHFA 3L3BA 4U2YA 3RPKA 2Q6KA 3JTEA 2QL1A 3G5ZA 2ZPAA 1Y3FE 4DERA 2OMZB 1VEOA 3EFOB 1U95A 1LPOA 4F2FA 3E9NA 3OAAD 5KVEL 4NUMA 2Z6VA 5EMNA 4LS3A 3WN5B 3GLRA 4LJRA 1CLZL 4GAFB 4DUWA 2FF5A 1N6RA 4JFFD 4UAUA 5H3CA 3LRMA 3O0RH 3S88H 3W9BA 4K2UL 2OK7A 2IHUA 4JGGA 2P7TA 2PT6A 4JI0B 1Z63A 5G5DA 8ABPA 4Z7UA 2AMJA 4A7PA 3VW3L 1XT6A 4ISBA 5FD8A 5M34A 4X1YA 3FFBA 3BIKB 4KTDH 4L23A 1NCTA 4EJ2A 3PIIA 3SHFA 2EP6A 4UF7C 1TAHA 2RK6A 3DX1A 4PY8J 1GGMA 1T91A 3ESDA 1GNVA 1KFKB 2DR3A 2F7IA 3CN1A 2BFDB 2IYQA 3BPSA 1CFQB 3ELBA 3NBNA 4IRSD 4D0DA 4NKQB 4EN3B 4IZHA 4QDTA 4R98A 5JSYA 3SQDA 5BSHA 3T0FA 1O95D 1U8FO 3MTRA 2HMSA 4S0SD 521PA 3CH7A 1GTMA 4E9WA 5IMSA 4JYMA 4KY1H 2RB4A 1E3WB 3WGVA 4QA9A 1RVFH 1ZLVH 1UBFA 1H2BA 1H8OA 5AVQA 1IG0A 2XNDD 3SKOB 4ZN6A 1U5CA 2Y7LA 4WK6A 3LPMA 3ESNA 2BKEA 5EIEA 4KR7A 4E41D 1AD9A 4JK0D 1JQEA 3K2BA 3VMMA 2R23A 4RVGA 2A7QA 1KEGH 3T52A 2D1RA 2ZJSH 2JBAA 2E9IA 4DMGA 2BEKA 4MXDA 5PAZA 4ZQBA 1FORH 3BJZA 2QLYA 4CW1B 1MAHA 3TOZA 4MB6A 1G5AA 5IEHA 4B6GA 1UBHS 4AZTA 2B20A 3NCEB 2WG2A 3LVRE 5J6HA 5I17B 4Y4KB 1KMHA 3A0OA 3H18A 3CO0S 6PAZA 3AKDA 4CRWB 5DS8B 3MTEA 2R6HA 4P8QA 2MPAL 1XALA 4OATA 1WAAF 3RUGA 3DWTA 3PPSA 1KI6A 3HO1A 2KUTA 4HXAL 3FRPB 4OCXL 3H1ZA 4LAQH 1OUMA 3CUPB 1EXUA 2DPMA 3GLSA 2DUNA 4YQYA 3OQIB 5AQ1A 5JO5B 5F70A 4IJ3B 2P68A 3F6SA 4NFHA 2DTDA 3BN3A 4E5VA 2DF3A 1Z68A 4UNIA 1GPOL 4QYWA 3DVGA 3WIIH 4D4JA 2WJAA 2E1PA 2RHGB 2J85A 4HUKB 3U7FB 2ZIFA 3UROR 4N41A 4A2FA 1KXTB 4WXEA 5IBTL 1JRHH 2BHLA 2WEKA 3RUGF 1VE3A 3O9WB 1F2XK 2JVIA 3W2IA 1ETZB 4YA6A 5J11C 4AQEB 1A98A 1PWHA 4H8QA 1FP5A 5ILGA 3M07A 3ICOA 4XBGB 1SM3L 2CYBA 4JKKA 1H2YA 5IDWA 3WZ2A 1HG0A 4RMSA 3OBBA 1LO2H 1CJCA 1FUUA 3OAUL 3GY0A 4JENA 1WIPA 3UK1A 2ZD0A 4FRWA 3W39A 4J03A 3UC2A 4GX2A 3O3CA 1UK6A 2N1BA 3MC0A 3MUZ1 1NJ5A 1CK0L 1J00A 3I2IA 3IJYA 1RQGA 2XV6B 2XITA 4CMCA 4NFYA 1EXDA 2EFEB 4NZPA 3ZTYA 3JQ9A 1MWOA 1W6RA 3ZT7A 4GO1A 3C24A 1X0XA 1ENOA 1GRNA 2M6SA 3UWDA 3X1BA 3WISA 4ZO8A 5A4MS 1JIXA 4ZMRA 3HFFA 3T0XA 4XMPL 4BVEA 3O4HA 1KGUA 4LZZA 3OL2A 3P20A 3P9PA 4WKBA 1V7NL 4G8FA 1NVMB 3SZGA 3V8NA 2WE7A 1U8MB 4PZDA 1JIQA 1AF4A 5SX5K 1R0BA 4IIZA 5AKSA 4NQEB 1RI5A 3ILQD 2YCBA 4E5UA 2FCRA 4UUMA 4JJ8A 4XPTH 1VFUA 2B3IA 3ZD7A 3CLWA 1G60A 4TQEH 4U1SB 2DBQA 4N26A 5I1GL 5AHKA 3A0RB 1X1AA 3IBYA 4WVRA 4JFQA 2ZX5A 2NU7A 3N5AA 3QEUB 3VQ1C 4L0CA 1E42A 1U7ZA 2J1YA 1E58A 2BFFA 2GJZB 3BGMA 1XNHA 3P9RA 4IDOA 4JCCA 3SCZA 4U6XA 4KZDH 1BFSA 2OR9L 3V8OA 5EEXA 1M2JA 2D2XA 3V4LA 3BAEL 1X39A 1XNGA 1HDEA 4X7PA 2BHTA 3KLBA 1EBBA 4UILL 5SWZA 4WA8A 1AI1H 1UPUA 5EVJA 2MHAA 3TR6A 5JLJA 4MNTA 3DETD 3WB2A 1HEJC 1UWGL 5AUPB 1KYDA 2XDHA 3R6WA 4KHTH 3CW8X 4HX5A 5U4QA 4O51B 4ELMB 3RTDA 3CTMA 3KC2A 4AU1A 4N0EA 1SVWA 2Z65C 1VRVA 1SC3A 1XF4B 3HCPA 5JS8A 5JJCA 1MCBA 1U8LA 3CH6A 2IP2A 2BSQA 4FQ2H 4UCWA 2OZ4H 1VLXA 2OTUA 4MKGA 5AW5B 4XDGA 1D03A 3T7IA 2YJNA 2QTTA 1V3KA 1ZHNA 5MEPB 4GAAA 4WWKD 2ZSHA 1G17A 2ZJAA 3GMDA 1N9KA 4IRJB 2HA6A 5E2UH 5FEUA 1U2DC 1TEVA 5CD5D 4DBZA 2Q2LA 2A1IA 4HT1H 3MTGA 4W9MC 5KB3A 2Z31A 4L3ED 4NKDA 1JGTA 1N78A 1GT91 3TUZC 5EUKA 2YD8A 3WN6A 2PKRA 3KDMA 2EIZB 3O7WA 2A2QT 5C3UA 1K8IA 4HLEA 1PJRA 1OM3L 2IWEA 1C1EH 3K81A 4WZBA 1KLFB 4IL5A 1A6ZB 4S0HA 2W88A 1PKEA 1KCVH 5HJ3A 4QLWA 3CF2A 3BRQA 3HVJA 1V96A 1N5OX 2NW2A 4TYNA 1QFZA 4N0FB 2V7PA 1SLUA 1I3RA 4DZZA 2HW8A 1E3WA 2FLBT 4ZQGA 5CVUA 5HW0A 4Y7DA 2XWJB 3CZGA 4QXVA 1TEXA 4BFGA 3E9QA 2Y93A 4C2TA 1CERA 4ADIA 4YJ2A 4L8SB 5D71L 5CVCA 1PYWB 4ZMBA 4OMUA 5GZ1A 3WTUA 4MXVF 4FYHA 4FNUA 1EFXB 3S2FA 4JDPA 3WWOA 2WN2A 3CZRA 2PMFA 3QGVA 3W39B 4PPYA 1DDIA 1L7MA 4YHNA 1WF3A 3IEPA 2BFDA 5L6YH 1SCNE 1W1UA 1G8YA 4GKBA 4KKXB 4J4PC 3TIDA 5J57B 5H02A 1JPSL 3WHE1 4ODUB 2LGNA 2B25A 1BVNP 1FFDA 4H1UA 1PVOA 1S5HB 1QAOA 2W4MA 3HFJA 3NDBB 1E7VA 5JMRA 1EU1A 2YOAA 1W94A 1R3HA 4HCGA 2XYPA 3PUYA 3SZMA 5K2MA 4HWBH 3THML 3PWPB 2D2IA 2JJ2A 4OFXA 4E1BA 2A5JA 1J0JA 4ZAKA 3D1MC 1BOOA 4Z3EA 3FO9B 2H1PL 2XTJB 3WDHA 4Y4KD 2ZXGA 2HVKB 3LXRA 2FQDA 2W6NA 1P1HA 2NNFA 1FDIA 3A67H 5HYQA 4JHZA 3BPLC 1E6LA 4XZ4A 1NMEA 3IELA 1FQKA 1I7UB 2JLZA 1DQRA 4NIYE 3HIZA 2ZTLA 4HNRA 4DIEA 5KUTA 4Z4IA 1XH0A 4J0IA 4LK2A 2H65A 3D33A 2A38A 3MJ4A 3ESZA 3DQQA 2KBFA 4BQCA 4U7PB 1JK8A 3PWKA 5B7EA 4TM8A 5HZHA 2ID4A 1J8RA 2ZS8A 5BOJA 3BEDA 1F8XA 4MCMA 3EGWA 4FQHA 4E94A 4RLSA 2CMDA 5DGIA 3HKEB 5EC8A 3CU1A 1Z36A 4IDCA 5FI1B 2W38A 5A7GA 1MHPH 2DPYA 2YKGA 4HIHB 5ID0B 5D7LB 4Y4KA 2FFQA 3PPXA 1QWUA 2EFHB 2BZGA 4K7JA 4L5JA 4F21A 4H8WL 4XIGS 1Y6NR 1TVKA 3BL6A 4ILDA 2GBUA 3CEHA 1AQLA 1KZGB 3BKCH 4B73A 1Q2XA 4Z3KA 1FL5B 1OARH 3NESA 3GNLA 1LO5A 4N0YL 1A1MB 3A21A 4L1DA 5EZLB 3MFGB 2A1TR 3CZEA 5DLPA 1OH8A 4M4PA 4BJ3A 1D1PA 4AMVA 3QEQA 1YUBA 1GA6A 3BN9C 4FIDA 3NJHA 2BY3A 5C8YB 1ZH6A 4QX6A 2GESA 4UMDA 4XCYB 4B3XA 2CKBH 3IXAB 2CO7B 1ORSA 4L3CA 4JFEA 1S7GA 1NQXA 4UCFA 1VSUA 4LPSA 4MIKA 3D8MA 1F4WH 2WWWA 5AHWA 2CC2A 3H8NA 5HGJA 1E2ZA 1F8YA 4JPWL 3WYRA 2FSHA 5E99H 1VPWA 1UCBL 2AFIB 2QGBA 3LZFL 3OR6A 2VDPH 3QXDA 3DM9B 2DMBA 2NXZC 1NT2A 4G1FA 1CGXA 2ZRKA 2F74B 2EP8A 3L6EA 1B73A 2KLHA 4BE7B 1VKOA 3MNVB 3HZYA 2IV2X 2E27H 3JVGC 1F90L 2DLGA 5B1BB 3O95A 3WLMA 4HZ1A 1YPZB 3ID6C 2VZ0A 4GRMB 2F8VA 4TT3A 2EC8A 1XJWA 1GZPA 2NO6A 3E6HA 4QRUB 1TZAA 4H60A 4PHZA 2XT0A 1ZJYA 4IGAA 3WBKA 4QY8A 1F0NA 4LHUB 4J2TA 5DHEA 1ZT1B 1MREH 2OEPA 1BW9A 4UMSA 2OPCA 2F8MA 5JECA 2W65B 4LBEA 2JAQA 1ZCZA 3KT6A 2ATKA 3ZDXF 2C1XA 2I6FA 3NALA 1E1QA 4HDSA 2ZG2A 4EIZC 3MT7A 1C08A 4BNIA 1ACYL 2C5FA 3ZCQA 5B7FA 4IDHA 4X0KA 1ZONA 2VAXA 3CLEH 4WWKA 2AK2A 1IQWL 2P49B 1DKOA 5KQGA 4KMTL 1SEBA 2VLLB 1RSZA 5DK0B 1KF9B 2ZSIA 1FA4A 4IDQA 2L7QA 5IN4A 2Z4SA 5BN3A 2NTSP 2ZX6A 3BTOA 1JPUA 2RI0A 4IUDS 3TMYA 3E23A 3BT2L 4FFZL 3AKYA 3WL3A 2A4ZA 3STWA 4OXYA 1WMBA 3DUUA 4H8UA 2YZ8A 4NO5B 4P57A 3FUNA 5B3JE 3E48A 5JOQA 1AR1C 1MLDA 3AS3A 1KZQA 1NCJA 4YLBA 4RABA 2NUAA 3CFQA 1Z17A 2C8NA 3SCMA 3QJQB 3Q6FA 2H92A 1SEBB 1M8GA 1E20A 1SOUA 5IMKA 1IAKB 4HUVB 3IFOA 2C4TA 1K9VF 5DX1A 1AOZA 2Y2VA 1I0ZA 2J08A 2J8HA 3ARVA 1A6WL 1MJJA 5J1SC 2DR0A 2ZWSA 1Z3RA 1YJ5A 5EU7C 4BK5C 3NAAH 4OLWL 1RAMA 3HN6A 4X83A 5F7MC 1G9MC 1ZESA 1IONA 3W34A 4BV9A 2BFVL 2PIDA 2IGTA 4E4TA 5DEFB 4OZIA 4QOIA 2NXNA 1SVCP 1ZT7A 5JZ9A 4LF6B 1LD9B 5GRZA 4X84A 1F18A 3H9CA 3E6HB 4INJA 1M67A 6ABPA 4PZPA 5FYLL 2O57A 1Z4OA 4W9RA 3DO3A 3FRUB 5GISH 1YC7A 2Z58A 4F2DA 1IT9H 1L7XA 3KYCB 3CDFA 3VJ6A 4IBOA 3CLEL 5DEFA 4DO5A 1YVDA 5E6IA 1E89A 2OS7A 1JDNA 3H99A 3SU8A 2I9TA 4XC1H 2ALJA 1IFGA 5M7QA 5LM3A 1A9XB 4ABQA 3FZEA 4X1IB 2EQAA 2IIPA 1LDPL 1X9UA 4U1LB 3QQ3A 2Y0CA 4KFTA 5J23A 2QEJA 2QGDA 4U00A 1FGNH 3ILXA 3DOUA 5BSFA 5JSUA 3WQHA 3FSRA 4YBLC 3FRHA 3W5CA 4MQXC 3QF4B 3OSKA 1CBUA 3QDME 4LSGA 5FA3B 4JQYA 1YNLL 4H7JA 5ID1B 4RD3A 3ARGA 4UZFA 1ET7A 1H0DB 4CDMA 3MWJA 4XX5A 3F7PC 3K80A 3ZYIA 4PJBB 3E9RA 4HK4A 5IXJA 2MYPA 2DIAA 4Y9UA 5KTRA 1AQJA 4BAZA 2DYPB 1DFIA 1Q9KB 2GEQA 1RJLB 3HCVA 1W2WB 4HWZB 1EDQA 2PFGA 2O2GA 3P0YH 4DLUA 5K3SA 4ZDIA 1J7JA 2VLLA 1Z88A 4UBIA 5JH7F 2J7LA 4L2LA 4Z7OE 4AFNA 4PRDA 3P4LA 3M9WA 4QBGB 2G9QA 4EEXA 4XD2A 5DFVC 2Y8EA 4JR9H 1DUZB 2BWJA 3RWJA 4DIFA 1TKWA 3HC3L 4Q1BA 2UDPA 3N28A 4RENA 1BWWA 1ZIPA 4P08A 1SXCA 1P1BA 1EAOA 1EG2A 4Q7JB 1MX1A 3C0KA 1N6QL 4NC1C 2YOCA 3BH4A 2P6PA 2AKYA 1VMKA 2FPWA 1K6JA 1JQKA 3MSXA 4FJ1A 4PJ9A 3C45A 3ROGA 5H0IA 1HXMB 1KBPA 4TZ0A 5I7SA 4XN4A 3ER8A 4AM0B 2W4IA 1WFUA 5I7FA 1V8BA 3C8UA 4MCZA 4XO9A 1A9EA 2ZJBA 1E5QA 3BH8A 3VXRD 4FGMA 4RDBA 3MWDB 1YL6A 1ZH8A 1VI2A 2FGZA 3X2QB 4HAUA 3ZWYA 4D9CA 3V5HB 2D5LA 3NAGA 4JKWA 2E9BA 3O81A 3QIWA 4PYLA 1ZJBA 5JJBA 3T3EA 2F2TA 4L4TA 1MJ8L 1Y9AA 1WU7A 3KSDO 2CXQA 3CDZB 4LECA 1YZQA 4FHDA 1OX6A 1O95A 3ESXA 2VLJD 3FQTA 1J18A 4OHFA 1ZVSA 5J13C 3JZMA 3UTQA 1MLBA 3D8UA 3OZEA 1UAYA 3NTRA 5JQ6H 1RM5A 2QJDA 4U7MA 2F4VB 1J8YF 2CLMB 2WB1A 2HI0A 1BKSB 3E3LA 4PQEA 2WZCA 2LDBA 1RZJC 2ZKLA 1CICD 4NZZA 2F15A 1MH1A 4F3FA 2V5MA 3ARFA 1XZEA 3HKCA 3ABQB 4ZYYA 4Z7VF 3WU1A 5CEXA 5KSAB 1A82A 2JI8A 5HOQA 1R3KB 1F4HA 3ZKNC 3C08L 3PR1A 4II2A 5D86A 1A9YA 2CD7A 2R7NA 4Q9RL 4MX7B 2I6SA 1KC1A 4M4RA 1J20A 3U39A 1HX7A 3WFBH 4J7XA 3WLWC 3BE8A 3FTVA 4UARA 1KBQA 1SIWA 4Y5YA 3F5WB 1A88A 4D7AA 2ZQKA 1R17A 1DG9A 3VKWA 2W6CX 4XIFA 2JJYA 5FL7D 1VJTA 1LV8A 2EHJA 1OAQH 2ATVA 4U7DA 1QQ6A 2ORIA 4RMQA 3EYUL 1IAVA 2GYWA 2ZJ2A 1I53A 5DJ2A 2AEMA 3L7BA 2C2MA 2G5PA 1LJLA 1QD0A 1CLYL 1F8UA 5LDGA 2ATKB 2YS7A 4KTEH 1G9NC 1O0CA 3GGDA 4EELA 5T1LD 2YJ4A 2F54B 3M8OL 4OFBA 1Z39A 4F9GA 2MQCA 3GMOB 2HCBA 3VM7A 3ILPB 1L8XA 3H0TB 5E9AA 4A9AA 5C0BE 3HC3H 4OFIA 4AX4A 4NN5B 1UM8A 3LRTA 5KYUB 1J49A 4LRNH 4U2ZA 2ECKA 1AO7D 3QNZB 1WB5A 3RSZA 3PY9A 1FBNA 4KKBD 3WRXA 3REFA 1LSUA 1LSOA 4JMPA 2P4AB 4EBQH 4YCCA 3RDTD 2EBFX 3UTSB 3VPAA 3QEKA 1G21A 1NPNA 5KYYA 4M0DA 4DCVA 1FRZA 4PRPB 4CCSA 1KACB 3K32A 1A1NA 3TZCA 1HCYA 2PVPA 1KFEB 5L0QB 4UTBA 5JSQA 3BUPA 2FNAA 1W72B 3HDJA 3S2SA 3DXZA 1OAOA 4S1SH 2HMYB 3WBBA 4EDWH 1WD9A 3KWXA 2I8CA 2HT3C 1UT9A 3KYMA 2Y1XA 4ZSOA 4AJWA 5MP6H 4PNEA 4JY5H 3CIOA 2Y1WA 4KH1A 1FVDA 3S68A 3WD5L 4QXPA 2DQFB 5SICE 3VWKB 1BJTA 1R16A 2ZJ0A 4IGBD 1XO1A 5JQIB 4A37A 3TZQA 1U3NA 3HLKA 4QULA 4PJ9B 1OAZL 5IBLC 2B7DT 4XNZB 2I60L 5CB4B 2RGRA 1U2GC 1PBNA 2W0MA 3WYBA 4FZ3A 1QZTA 5EI5A 4LE2A 2QTEA 4YO8A 1VERA 5DEOA 3V1LA 1Q0SA 4ACPA 3HN3A 2DMGA 3X1EA 4CMEA 2DDQH 3K4QA 1DVZA 4LU5L 1E0DA 3VAYA 2FB9A 4PJCE 3FTXA 3PDHA 1MIMH 4WKOA 3O2WH 1ADGA 3DGDA 1Q3KA 2AE1A 3BXEA 3QU9A 3LHFA 4GIBA 1OH6A 3WIFB 2G5TA 3FK3A 5F44A 4U0KA 3P9XA 4PB0L 3AR9A 2XXMB 4ZI5A 2HFKA 1OLXB 3EIWA 3BULA 5E8EB 4B09A 2PV7A 4K15A 2JCYA 4TVKA 4CKEA 3O4JA 3KYOA 5KS9A 7ADHA 1V7NH 4KV5E 1GJUA 2JASA 2RAMA 3P4YA 3OIFA 5HVGB 1FP1D 1KOJA 3ORFA 4MJHA 3GJEB 4AMGA 2ERYA 5AW2B 1UT6A 4M9PA 5DYGA 2JAWA 1C8PA 1COZA 4HNSA 3ATDA 5IGXL 1YUNA 1HK6A 3BD7A 3CSFA 3NGBC 2K3TA 4LLVB 1FPMA 2DYKA 5DD3H 2H3EA 43CAA 4AGOA 3HRZA 3GAZA 2GAZB 3I50L 3ROLB 4ZTPL 3VA7A 4R2IA 1ACJA 2NOAA 1ZKDA 2F1JA 1OB1A 2WTAA 1TZKA 4C89A 3ARBC 4YNYB 2VRBA 2EEBA 3JZYA 3PUUA 3KTAA 1H4TA 4CRPA 3IE9A 2J3HA 1O9WA 3WP0A 3IETA 3S8EA 4E2XA 3I23A 3Q6NA 3WIHA 2I71A 4DQOH 3TR5A 1FWXA 3GYRA 5CCHE 5BVJB 3PABB 4QRIA 3U0TA 1JHRA 1UM5L 3RVMA 3BCSA 2ZWKA 3CPLA 3KJQA 4QGAA 2ROYA 4Y6PA 1MRFH 3H56A 3VD2A 1KSJA 2NXEA 3SN6A 4EJMA 4FFRA 3H9HA 2AQHA 2PETA 3BTUA 3QQ9C 4GRAA 2QLJA 4X7RA 4NOBA 4B6OA 1HESA 1ZK9A 2ZNXA 5AM5A 2OXEA 4CEHB 5LGYA 1NDMA 2F62A 2VH1A 4B4OA 4FG4A 2A0YA 4HN2A 4PO8A 2WU4A 1ZAGA 2PJZA 2QD2A 1BX1A 2C2XA 3ZO0A 3L6OO 4RRPG 1L8LA 2PZEA 2G3YA 2QQNH 4BZ1A 1K8ZB 1YUKB 1RPTA 4R1PA 1JNXX 2C99A 3WKEA 2C7RA 1K2VN 2OECA 3LA6A 3Q6FB 4HMCA 4JPSA 4RF2A 4B87A 3AXTA 3IXQA 5MHTA 2E7MA 4XB8A 1SOAA 2Z43A 3W3AA 1NHGA 3AF1A 4QDKA 2V7BA 3DC2A 2XJKA 3HRPA 1H3WM 1A3CA 2AGVA 1A77A 4QU8A 3GQFA 3KYMB 5BV0A 2BKLA 2Q8AL 1XAIA 3L0IB 4HSAC 3JWOL 3NHFA 4FZEL 4PSKA 2YAMA 3MCZA 2VRQA 1XWFA 5GS3A 4L9LB 3QVXA 1Q3HA 2K78A 5IT9A 4KLZA 5TQ2H 2XWBB 4OKDA 2QQQA 2YJ6A 4GT0A 5MERB 5AVJA 3N2KB 2AE2A 5DJZA 2PQ6A 3T5MA 1U94A 2Y27A 3K1TA 1B6GA 2HBZA 2BH0A 1OCWH 1CQWA 1BGVA 2G0TA 4X5WB 3GWZA 5EIHA 1R24A 2E74C 2O8VA 1GL4B 4N5DA 1FIGL 2FSDA 4R96B 3TM4A 2OMVB 3DDWA 2H2IA 2N47A 5AM0A 2WD8A 1QFYA 4GG6A 2P5PA 4XVTH 3IQGX 2H1OA 3IJ9A 3PP4L 2R1YB 3Q3CA 3DMMA 5T1KA 1E4YA 1UYWH 1CBVL 4LHUA 3PDCA 3FUJA 1J8HA 3VFVB 3IJSA 2JGNA 5FX3A 4XBPA 4JLOA 2P5TB 4NZNA 1T1YB 4HDKA 1QFSA 2A5UA 3LY9A 3ZUGA 4RMHA 1GTRA 5JNYB 3M89A 2A94A 3WFDH 3KYOB 3T6KA 4DFIA 5KBMA 4YSQA 1Z5OA 4JFHD 1Z4NA 3EX7C 2PWBA 4BJ5A 1CLEA 4R51A 3MIZA 3LUJA 2GJPA 1Q1AA 2BTEA 2N46A 2W07B 3E2HC 3VFPA 5JW4Q 3BEVA 1DQPA 4AC2A 1UPBA 3EFBA 1SC4A 1D2RA 1CJVC 5J4LA 2H07A 2QVGA 3QPQC 5DNEA 4I88A 2G75B 1RXYA 3UPAA 4UTAH 2PWGA 2IOHA 3U30C 2J4FA 4I5DA 1RSFA 2OCGA 4UE3S 1IGFL 2WSDA 1O03A 4HS3A 5J63A 3FUHA 2QKSA 3GHPA 3F7VB 3WNJA 4FE4A 1KJMA 3LN9A 3E3MA 4UT6A 2PFKA 4E5YA 3RG2A 2ZSWB 2CBMA 4LP8A 1RZVA 2EJCA 2WQ6A 2FUTA 1QO0A 2Y7SA 2YVLA 4KAJA 3QEMA 2XNAA 4HAFA 2BTQA 1H65A 1KCRL 4E88A 1QGUB 2XSZA 3GG2A 4AP6A 3OX8B 2DJ5A 5DQDL 4MGYR 1OTSD 4CC4C 3CMMA 3MJ7B 2VN7A 5ULLA 3CWQA 2ES4A 3HG1E 5HUHA 2QRHA 2ZOWA 4NU8X 3QTTA 4M7WA 3WIBA 4GSXA 2X10A 3WLIA 5B2FA 5DJAB 2H29A 1ZRNA 4JJIA 1SNRA 4BXOB 2DN7A 2O30A 5C0AA 5BMVF 4A8PA 4LRQA 4XGZB 1SJEA 2BI4A 4NOFA 5BVHB 4Y98A 3MWDA 4DHEA 3EFEA 3NASA 3UMTA 3EOAA 3RE1A 1NBME 3OKNB 1TVMA 3KUKA 4HP8A 4QDXA 3SHTA 3K0KA 1NRIA 2L7JA 5G2OA 4PJIE 3N9GL 4X60A 5MFPA 3WRWA 4CVUA 2CUHA 1YLBB 2I5YH 5B6PA 3R0VA 4G84A 3H1BA 9LDTA 4LRTB 2PGIA 1X7XB 1PZGA 3V8EA 3MOAL 3KYBA 4OHKA 4Y2TA 1W85B 1OXYA 5DEJA 3ZJAA 3US9A 4DM7A 4M49A 1HYRC 1WS7A 1EDDA 2MKLC 4UTAL 4HATA 4WZAA 4U7HA 4XFKA 5CT9A 2E85A 4ONGL 3WYDA 1TENA 3AQDA 1AU9A 2EE9A 2QBYB 3L4KA 1RU9L 4LEEA 3DARA 5ANMA 1TETL 2E3VA 4IIJB 4ZXBC 3KLDA 3MXWL 3BH7A 2BMVA 4PZYA 5K6TA 1RJLA 3O11B 3KGUA 4QXGL 1R6DA 2IT1A 5ALEA 4NKRA 5JIIA 2C83A 2IELA 4EHAA 1IWPB 3FPKA 1AO7B 4NBRA 2Q0SA 3I3DA 1LWNA 4HC1A 4OQZA 1ORQB 3ENQA 3V3KA 4LYEA 2ZYIA 2JIOA 4QECA 3V5DA 4XC3L 1G8KA 1YC5A 3JALA 4B6EA 4P2OA 3T0ED 3RY5A 5DHVA 1NEZA 2VLKD 3HI1A 3CDCA 5EUOE 3U4QB 5KN5B 1VGEH 1ID8A 3H04A 2V6HA 4BIKA 9LDBA 5E9DA 1BA2A 3NK3A 1H05A 1X3LA 1RVDA 4DLXA 2W0FB 4OB5H 5CIQA 1AGCA 4XO5A 3HA7A 4WTXA 4X1IA 4O4JA 4QFCA 3AF6A 4C57C 4Z3IA 4K9MA 3Q2VA 1V16A 1G7MB 3CCCA 2JJ1D 5CVDA 5K45A 5D2LB 1H8EA 3PIQB 1DIOB 3VNSA 4JY7A 1Z4MA 4KR3A 5J8OA 4ZTBA 1IATA 4ODVH 4A38A 3GMSA 5DV9A 4Q9QH 3AFMA 4G41A 4C3OB 1TGVA 5E7FA 4A6YB 2Y2UA 1X5HA 2CXUA 3BMWA 2FMKA 1T5TA 1QYRA 3IM1A 4I50F 5JDCA 4MQ5A 4BWGA 2I6QA 1RXIA 2IOMA 5LLTA 1CI5A 3BRCA 3P0VH 1PDOA 2YD5A 2B1OA 1YS4A 1QGZA 2HHCA 3ZHUA 4URFA 4POZC 4A5OA 3AUAA 5KREA 2XVKA 4MUNA 3Q10A 4Q6IB 2IPTH 2EVHA 5DCUA 3GPEA 3MNZA 2WVJA 1RWQA 1OD9A 3QEJA 1K72A 2X6TA 3H9ZA 1GL3A 3R5JA 1Q1GA 2AXPA 4NQZA 1OI3A 2CVHA 4IQ0A 1P7QA 2WVVB 3FCSA 1PDKA 1SRQA 1A8PA 4C04A 2NY3D 1WVGA 2XOXA 2IJ0C 5H81A 1Q95A 4K9LA 1JZDC 1GZVA 4OV6B 2XWQA 3OQHA 3FVWA 3H4IA 1S9YA 1GL7A 1NVFA 1KULA 4RHCA 4XGZA 5TDNB 5AVZB 2VUOA 1U8JA 1EX7A 4DSAA 4MMXB 2PX8A 3WELA 5DBIA 3I6LE 2VSKB 3JTMA 1VE1A 4RQUA 1OLZA 3GA0A 4O0LA 3WGKA 4FFLA 4IOLA 5IFHH 3QQ4B 5J5AA 2HVBA 3FH8A 5HI3C 1ZT4A 1Z33A 4C05A 3LKSB 3HVNA 3PHQB 3VR4A 1L8QA 2NLJA 1FUIA 4LI3X 3BZWA 5BW6B 3CCBA 4MD0B 1F14A 3RWDA 1CGVA 2PWFA 5EHNA 1XD2A 5IVDA 2NUTB 3ESUF 1UR5A 3QH3A 5AFSA 1PT9A 4CMHA 4LTMA 3TFBA 3JTBA 5JJLA 2RBGA 1NMAH 4NBSA 2G6TA 5I8EB 4MB2A 2H2FA 4KBYA 2GJ9A 5KU1A 2IH1A 5KSUA 4CKVX 4WEBL 3CB4A 3CXUA 4FYJA 5FNZA 3WG9A 5F6HJ 4CDRA 2B3RA 1BXAA 4NVRA 2AC4A 2V5TA 3EGDB 3IKVA 1OSEA 1AHKA 3VJ6B 3KPNB 3RQ3A 5EIXA 2P4SA 5FUMA 5C0CD 4TNFA 4HLZG 3OIUA 4L0YA 1VACA 4GP5B 4PC6A 2OO5A 4RCVA 1ZICA 2XNCA 3E7JA 2VR4A 3F2LA 4U3XA 4QUHA 1UZGA 4ZCIA 3HB0A 4B5LA 3F4KA 1J1XL 3JZDA 1MC4A 5KHAA 5DFTA 3ANYB 2VJYA 3ARZA 3RLIA 1U8IA 1QTQA 2ACVA 1FCGA 2EG9A 5K39A 4X98B 3EUWA 4GOKA 5D5MF 4XXWC 3GNMH 3QI7A 5JQGB 2GN0A 4JLRB 1L4EA 2ZYHA 2HA5A 1QTSA 4RIHA 3DPDA 4NO3B 3ECSA 1UFUA 5C1MB 1Y6RA 1IRXA 2IKQA 3C2SA 3QY9A 4A26A 3ZQWA 5F6IC 3VOTA 1ZE3H 3JQ6A 3GKWH 4JHWL 1AXEA 4KRYA 4MITA 2A35A 1NNLA 1E2JA 2C2ZA 3BK1A 3PPYA 3WLBB 3QUSA 1RZIA 3NHWA 1GUAA 1GKOA 3JWDH 3S8YA 4IM7A 1T9HA 4NAJA 1CGTA 1ICIA 3OKKB 1AZZC 3D3EA 3OKDB 2P80D 3HBZA 5G55A 1WCBB 2IIQA 2P26A 1FSFA 3TBBA 3HBPA 4QKQA 2VRAA 1IBYA 3LIPA 1G5IA 5A7BA 3QRFM 5D7LA 3P1VA 5J6SA 1I6WA 5CLXA 4HIHA 1RUKH 2JKSA 1YCFA 4UPEA 3PE6A 3ONFA 2F3PA 4L3EE 5JYMA 4WFGD 2XUFA 3OOWA 4FDVA 4LGPB 4WJ5A 4L8BB 5BORA 3E7XA 3V2GA 3A2MA 3RCBA 3G59A 3JXEA 4QOFA 3TE7A 1QP4A 3GRUA 3N6YA 3IQIX 1OGIA 3IMFA 2C5EA 2TMDA 2HF9A 1MSPA 1N2XA 4AO8A 2IH4A 4FS0A 4RPKA 1OFVA 2QD1A 1CULC 2P9QA 3FUIA 5T1MB 4JY4A 4QNPE 2DTEA 5DCCA 2IV7A 1LK3L 4J0KA 4RW0A 3U4CA 3D39B 5BW5A 4UOZA 1HF3A 2QXUA 1UWXH 4JFHE 1PK7A 2FG6C 4MRSA 1W8IA 2SKDA 1X7ZB 5F1PA 4C76A 2GCPA 1H8ED 2M83A 2CMGA 5LN1A 1ES0B 1BXGB 4M7ZB 4NBYB 1A4AA 4F9FA 1IZZA 2A9JA 1Z4IA 3ZGXA 5AI4A 3CXHK 5KVGL 1KTIA 3WDMA 5F9HA 4WW0A 2V7WA 3RC7A 4YPJA 4AQ7A 5BSGA 3M3HA 1QYCA 1D09A 1FL6B 1WH0A 1W36B 4LZLA 4D9NA 3KTAB 4DV4B 2G30A 4LRXA 4MW0A 1FIEA 3WA7A 3ES6A 2W9DL 5JJ5A 5LWHA 4RANA 4YHOL 2TSBA 3HMXL 2WO2B 4CCYB 2YAEA 4G1BA 2HJVA 3V7NA 4AY5A 1M1UA 2VSOA 2QPUA 5IN5A 3A6ZA 3CFJA 1S2OA 1D1QA 3GDWA 2DLCX 3UJPA 1TLLA 1AQDB 3WFIA 4Q39A 5IQOA 3I6ZA 2ZK7A 5BOVA 5A5GA 1ACZA 1JPVA 3BQUD 4F96A 5B7GA 2GN1A 1YI8A 1EAYA 2C1OA 2C2OA 1SOMA 1E5TA 4Z7QE 1GZUA 2YD1A 4NZMA 3L2OB 1L0XA 3U5ZB 1NVBA 4MKHA 3DL2A 4LLDB 5D93B 4MX8A 4O02L 5B8CC 4UHBA 5D7SH 4C8XA 3JWPA 2OFQA 3OZTA 4RFOL 5FA6A 3SNHA 3S55A 2YMTA 3CFDA 2YICA 4ISCA 4UNNA 4DSTA 1EAPB 3NN8A 2ISSD 1AXRA 4XRCA 2B1JA 4MNGB 3FY4A 1CW2B 1NM9A 3K4PA 5F7ZA 2L2QA 1IEHA 2OAP1 5IM4A 5LGKA 5ECWA 4RBNA 1UMCA 2BONA 1AS3A 5L2JB 1KMHB 2Y06H 2IEZA 4F1KA 3QPVA 3WRYA 2HH0H 4JUTA 1PZDA 3M1OA 2G04A 1GGVA 2RBEA 2FJFA 1WXHA 1H1LB 1D5XB 2X0UA 1OIXA 2VZLA 5KVGH 2FRDC 3GBSA 2Y1CA 3ZDCA 2H2GA 3BWUC 4EN3C 4C29A 3HGMA 5F3BA 3QNMA 1DCLA 3THXB 1MOEA 5KS9F 1JXQA 5JQGA 4LCCB 3WO4C 3PRJA 4XAKD 2G06A 3C5SB 5CNKA 5C7OO 3B1WA 4AKGA 1QU2A 1L7AA 4RXMA 4A91A 4G0OA 4L4TB 4D82A 2KDYA 1DTUA 2X53A 1Q1JL 4NQCE 1THTA 1OD7A 1LRLA 4NXKA 5IR1A 5EWIL 2ZIGA 3TZLA 4EZBA 4A7TA 3QUXD 1WHSA 4IXMA 1V3LA 1RBZA 2XSZD 3A4MA 4MA1B 5DSTA 1ZIDA 3KTOA 4XQGA 4JEIA 2VG8A 4QQ8A 2CO4A 3Q9QA 4AITA 4OKVB 2ZJOA 3CA8A 5KDOA 1NFDB 2AV7A 1W46A 1SG6A 4IGIA 5IZCC 2JBWA 1ZA2A 4BZ1H 4PGBA 3GGOA 2CUZA 1SD1A 4YHIA 1F48A 3R6LA 3LQQA 3VKHA 5E8OA 5IW1A 4K6HA 3B13B 4KE9A 4ER6A 4FNLL 3PX2A 4P4RA 4ASUD 4HEQA 3FUMA 5KNCD 1LWRA 3AREA 2FR0A 3NEYA 2ZSVB 5C1OA 2FJGB 4ZYKB 1LK5A 3KQHA 3FU5A 5KAQF 1EMDA 3U6BA 4MINA 1ZEJA 3HHMA 2FOIA 2OB1A 4GMSH 4LHVA 4D9LH 4RZSA 4ZDKA 4CFZA 1PGRB 4ZCMA 1R24B 3IJPA 2EILB 5BPFA 2YCLA 5EMYA 4WK0B 1MHHB 4ETIA 2VUTA 4HK3J 3H42B 3ZG6A 1G8GA 3SC2A 4OLUL 3TNNA 1K6XA 3O0LA 3LB6C 5C0FA 4FCAA 4KH0A 2B7LA 1U3WA 5AZ2H 5LBSL 5ITBL 3COWA 1NKVA 3RIKA 4IKJA 1QH8A 3MLRL 4QFBA 4Y2HA 4KHTL 2WAXA 3MCAA 3QJSB 2LZ0A 1FN4A 3ML9A 5EORH 4LEOA 3FFCD 2OM6A 3ZGOA 1YDGA 3S1AA 1NMCC 1PIWA 2Z64C 2Z83A 1U9CA 5L6LB 1XA0A 4RMJA 1W2GA 2FFBA 1WCWA 1Y81A 3QQXA 3I42A 1KYUA 4OAPA 1COWA 3IBTA 5B53A 3I6KA 1AUPA 3NUGA 5EJ5A 2IEPA 1Y8QA 2PYFA 4N24A 2HLAB 4V3CA 5LNGA 5FYKL 1AK1A 4DR1B 2AEJA 3D85B 1Y0LB 5C8XA 3BKWA 4IRJC 4LKCA 1YRBA 1BP3B 3RSOA 5A4IS 2OL3L 2VNCA 2C03A 1KTJA 4TUOB 1G1YA 3PXJA 1Q12A 1Z6AA 2G3ZA 4PG2C 1NCHA 2I29A 2J8ZA 3C5VA 4MZ3A 3QFJB 4POYA 4DNXA 1IVYA 3RUGB 2QTHA 4AUMA 4G97A 4PD4J 3LPWA 3RRZA 2AN3A 2CMRL 1GS7A 1Y42X 2DLNA 1A5AB 1BBJB 1C9NA 4FC6A 2F74A 1L3WA 1KYVA 2Q0HA 3S70A 2P5WD 2IJGX 2WMNB 3OQ6A 5I7HA 2SEBB 1XRMA 1SLVA 3QP9A 4XCXA 2IOFA 4BWUA 1B00A 2DZEA 5AR1A 3DX2A 4FFVD 3SDAA 3TO5A 4RZKA 5EC1B 1BFVL 2WIFA 2V7QA 2C29D 4JZNB 4AENA 1YS9A 4PW9A 1IMOA 2BIQA 3I09A 2VLRE 4QNNA 2EERA 1S2IA 1E2IA 1TM2A 5C8YA 3S5ZA 3LTNC 2QRNA 3GFUA 4H8WC 1XD2B 2SKEA 2NNAB 1XGZA 5FWRA 2C20A 1GL9B 4W9DC 4DN4H 2CRMA 1W19A 1KENL 3J2PA 4CW7A 2GN4A 1BHO1 3V0JA 3U3OA 1WBDA 4RZQA 1CJKC 1R6AA 2EDDA 1S8DA 5K51A 1WAEA 4HIPA 4PUBL 3OKEB 4UMGA 3ZXUB 3P5SA 3KKPA 1E2NA 2IBZX 4PS3A 2APSA 2GAIA 1UJ2A 3F7NA 4PRBA 2WVHA 4EX6A 3M1BA 1CUGA 2V03A 3FFCE 2IH9A 1I4WA 3NWJA 1XTLA 2VH5H 2IPLA 2VWQA 5I16B 3TN0A 3QSYA 2L82A 5SY9A 3SC2B 4FYMA 5ECJE 2QX8A 4WIQA 2R7AA 1G7QA 4UTCA 1J21A 2N3ZA 2CO2A 2AW2A 4L8WB 5IVZB 1JAEA 4XNUL 4UCQA 4BQOA 2QUHA 1DG3A 2WRZA 1HFUA 3ZUNC 1BW9B 4W9IC 3DEJA 1FYTD 2XV0A 1PO7A 4XLTA 4GSDL 2YA0A 1IVLA 4QRUA 2Q10A 4WVFA 4OH2A 3W4IA 1WKVA 2Q4TA 5DRYA 3P9YA 1BREA 1KLGB 4OKSA 1VAHA 3Q8LA 4AQZA 2QYOA 3MT9A 3D18A 4QY8B 4XUCA 5IDYA 4HVCA 2HPHA 5FTWA 3VRJB 1HZZA 1JEYA 1CFSB 1CB4A 3GP3A 1XJ5A 5A4AA 4UNPA 4J3OF 4TTVA 3U0TB 4R1TA 4L9SA 1ADQH 3NZHH 1OCOB 1DBMH 5DS8A 5DI9A 3CBJB 2ZSDA 4X6CE 1HZHH 1XXLA 1IM3D 4NQDD 4PRPA 2JHAA 1BYNA 3C8DA 3F04A 4WZ6A 3DSRA 3C3YA 3R7AA 3AB7A 2VHUA 4NEGA 3EXEA 1G9NH 3G3EA 4P33A 3NCYP 5ALIA 3U1SL 4CGTA 3F78A 1Q6ZA 5DM0A 1FL9A 4WHTB 1XR8A 1P9LA 1GM5A 3UGUA 1IBKB 5DM60 1GC1H 5CEYA 3N7UA 4HJJH 5K8JB 1O6VA 4HF7A 1AZTA 1OROA 5JRJA 1A4JA 4E5MA 3FLMA 5E2IA 4HH9A 3ULVC 2WQZA 2FEXA 2Z8YA 1D6MA 3OXRA 1HINL 1TJXA 1KIRB 3N41F 3RWGA 2ZBQA 3AVXA 1AO7A 3ZR4B 3WTVA 1VIYA 3SKMA 2V97A 3BERA 4XCFL 2VR9A 5FYLH 5DDHB 4EDXB 1H6DA 1I9IL 3RJ9A 2PLFA 3L7FA 2Z31B 4MH0R 4FXGA 4BP1A 1DKQA 1C7ZA 3L06A 4F06A 3RIYA 4L8YA 2Y2YA 4AIOA 3Q7PA 1TUBA 1KEWA 2B77A 1HKHA 1TITA 5IC4A 2N1TE 3S98A 3I6LD 2VF2A 1JDVA 1LGYA 3GUUA 4JO3H 4XAWL 3D12B 4KCGA 2D3JA 4B4KA 1C12B 2V4ZA 4M7JH 4FE7A 5ALLA 3HB5X 3SZRA 2EFYA 2DJUA 7PCYA 4DIOA 5ISMA 1I8IB 3TOVA 3DYOA 3PNQA 4LKOA 4B9CA 4P4RB 3STLB 2Q6IA 4L51A 4ID9A 1S9VB 1TIKA 2WOOA 2X2UA 2FCAA 4JIGA 1EPFA 3GFQA 4UNRA 2QSZA 4AYFB 1Z9SB 5IB4B 2Y9MB 2M98A 3UJIH 5AYUH 2VNSA 3EDMA 5I7OA 4FFWD 4BHTA 2G4GA 3FZQA 3S7GA 1FE8A 3X3HA 4KPHL 2VT3A 3P27A 4PIPA 4FNGA 1O9GA 4M1QA 3TIDB 2FWOB 1YL7A 1BVZA 4PRNB 1XZ0B 3EZ8A 2DQSA 2Q3ZA 4OQDA 5TPZD 4QOKB 3ZWOA 3F58H 1S5HA 4XNMA 5MGNA 4HGMA 3TA4D 3QEBZ 3AITA 3T09A 3M5WA 1T1WA 1KC5L 5J06A 4N0MA 2DL2A 3GXFA 1MKFA 3QIBC 4AO6A 4N65A 3EHBC 3VOBA 5T5FA 4HY3A 3KLLA 4L4TD 1GXSB 1DZ0A 4N6GA 4RVOA 2SCUA 3UOGA 3QDJB 3RFRA 2JI9A 2XBUA 4Q6BA 2VLIA 4NM4L 1MO4A 2XY4A 3LT5A 1BZQK 5LFAA 4J0QA 3DX3A 1JEEA 1WXEA 2WPNA 3KT8A 3U1SH 1L1RA 1L4YA 4WJKB 5LG1A 1D5XA 2X5PA 1KP9A 3ASVA 4HG4K 2X4NB 1EAQA 2OR7A 2FWSA 3UPCA 2BGMA 2RG1A 1S3FA 4YRLA 3SDXA 2AQQA 1P8JA 5K8TA 2VW7A 3G89A 3TX6A 1TK3A 3A6KA 4MJ4A 4OLYL 1EZLA 3L79A 5SV2A 5E5RB 2I3ZA 3MO1B 3KDMB 4X6CB 5T64A 5TY0A 2XQYK 5DRZA 2WJ5A 1ZGHA 2XLCA 3H65A 7REQA 1G98A 1D07A 3H9SD 5IJ9A 1QUNA 5DMKA 3ZKXB 4DWWA 1O89A 2ZXDA 3WOVA 2ZAMA 3S96B 4OK5A 4DEWA 5DP1A 3P2KA 2JIXD 4XYGA 5TPWH 2PNJA 5EERA 5GZNA 2IHZA 1F2DA 4YJZL 4ZQFA 1RULL 3MV01 3OKFA 3MELA 3FZUC 2BM3A 5IUJC 2H52A 5LQCA 1ZD9A 4REQB 3BCHA 4TPRH 1VGKA 3MCUA 2B8OT 1JR3A 2DBLH 1ZK3A 1GZQA 7GPBA 1K4DA 2N7AA 5D7NA 2YRWA 2VN6A 2VYNA 4GI6A 4JT9A 5JDSA 1W76A 3WS6A 2R2CA 1XRRA 2O6LA 4R2GB 2VXTL 1A2QA 5JMOA 1OGSA 2IS6A 2FPIB 1URZA 3D4LA 4OA8A 5KX5A 5B3NA 2R60A 4JVWA 3BAWA 2VJNA 3HSYA 1J99A 3BLBA 4JLJA 4OHCA 4U1SA 3MV8A 3W57A 3TTUA 3AR4A 2DM2A 3KXDA 1LO0H 1TW3A 3HPJA 1FYXA 3U1VA 2C3WA 5LN4A 1ONSA 2QJTA 3LRSA 2ZIUB 3IAXA 4DILA 1F17A 1FTQA 5I8EA 4OYRA 4FLRA 1G8SA 2WZAA 3ES9A 3HZKB 1TNNA 2A84A 2YUIA 5KEZA 3LXUX 8ADHA 3BB3A 3VGAC 4AQYB 1U9YA 3K8OE 3ZWNA 1UBNA 4ZZ0A 1UQSB 1E4EA 4JDEA 3I50H 1ZS9A 2ZKWA 5ISZA 4GC5A 2HO4A 4U6SA 3NT4A 3L07A 1MJ7H 3K8LA 2Q5EA 3LKBA 5IC6A 3CC8A 5DD5H 2W71A 3DOJA 1CUUA 4LO9A 2LLLA 1HQYE 3GTNA 2JI7A 3WQSB 5FHBL 3QVMA 4TMTA 1CS0A 3SJCA 1NMXA 4U39A 5EYPA 2WVUA 4KGDA 2G1JA 3E35A 2NX5E 2AFRA 5MI0C 5J2UF 1YWGO 2VF8A 2ZP0T 3PWZA 5DM4A 5EL0A 3B3BA 4RGNB 5JPNA 5DVPA 2EW1A 2VP3A 4GEIA 4J1UB 1EDBA 3ULSB 5D1HA 3W5JA 1RJGA 2XE4A 1D7AA 3C60B 1BD4A 3QU5A 4IBLT 4TKLA 3ZCXA 4PS4H 4PWYA 2DWOA 4IOFC 5HRCA 5JPMA 1FAIH 3Q98A 2BJWA 2VSNA 3ANXA 3CEMA 2OMKA 1K4DB 1HE4A 3AGWA 4EKJA 3VGPA 2ERXA 4M6OH 3WAKA 5HP5A 1RZKL 2HJRA 2P9BA 2PP9A 2D73A 2WXFA 1HKFA 2RKOA 1CIUA 4CHTA 2D74A 3OF5A 3AHDA 1H1DA 4P2RA 5EC1A 3IGFA 1XD9A 2OCJA 3O5AA 1TJ4A 3L8CA 3IVGA 2BZ7A 3WADA 3U1QA 3DC0A 1U91B 1OT4A 1NA5A 3GB7A 5C0ND 3ZDEA 3WIHL 3DE0X 4LZAA 1K3UB 1C81A 1FX0B 3WTYA 5AVKA 4LNHA 2XN9B 2NY2B 3BAYA 3NOVA 1R6TA 4G2TA 4OD2B 4JB9H 4JPKL 3INYA 4XMLH 2XGGA 3FRUA 1E1QD 4FUQA 2BFWA 4XOEA 1KELH 5FIUA 1QFWI 4TL8A 4PZLA 5IHUL 5IXYA 1U04A 1OVZA 3P3SA 1WNTA 5JD4A 1DBIA 1QDEA 3USES 2ZIXB 1XCXA 1MCOH 3W2EA 3MWEB 2GFHA 2VDJA 2WHPB 4FABH 1OI4A 1R3KA 2WWMC 3PFHA 3KZOA 3G1TA 1P9RA 2PGJA 4LSVL 1L0PA 5DBHX 4URWR 5CURA 4Y7OC 5HVFB 3TSCA 5DTFB 1XMOB 2XVXA 3Q3IA 3EDEA 1T1SA 1U2TA 4YP9A 3RO7A 4CPDA 3ESQA 5F12A 1MJFA 5IVIA 4F2GA 5DUML 3I04A 1NAIA 4YR6B 4ORZC 3Q5TA 1FGNL 3ZY6A 5AVYB 3ZU6A 3QY0A 5KN5A 3UZEA 4D0DB 4EN3A 3W81A 1UD5A 4Z9AA 4YJ2F 3VGHA 2OQJA 5EOQH 2IP4A 5GRXG 4OJTA 3P3RA 4MQEA 3H97A 3IHKA 1YOVA 3KB2A 1Z8DA 3FNKA 5CK5A 4BLWA 5BOZG 1BFTA 2RJNA 4KU1A 3BFVA 4ZW3A 2ACWA 3GS7A 5KW9L 1G5GA 1W44A 4UT9H 4HEHA 4EDWL 3ITDA 5DNDA 2GEKA 3HE6B 3QHZL 3SYCA 3GZPA 1GFIA 1C5BH 3UBHA 4NPYB 3B60A 2PZAA 1HXMA 3ABZA 4WI4A 2X4QB 4JKPL 4KY2A 4XWYA 1JYSA 3GPLA 3LXBA 5EBMB 1AKYA 4PRIB 1DJLA 3PT5A 5E4EC 1G8PA 3HABA 3HY3A 3ELYA 4QYXA 3IE1A 4DY6A 1BRTA 2FF7A 1HFKA 3ABOB 5P8WA 3H6AA 1C9SA 5JATA 3I84A 1NQTA 1L7OA 3LTVA 4Y2RA 1VRCA 3NFYA 2B9BA 3T0EC 1V3VA 3KXFA 1QSGA 4UINL 3RZCA 3DTTA 4A6DA 1ZNXA 2AUNA 2CVZA 4CM4B 4XE5B 5H94A 4AKHA 4B3JA 5IKEA 1OA0A 1PD1A 1YNSA 2NY4B 4CT0A 1ZWLA 5GAJA 3QUKA 3UGXA 2YWZA 3QVJA 1LO3H 2RIRA 3S37X 2R1WA 4G6JL 4FFBB 2ZRNA 4NV3A 4MNGE 4WV1B 4LLQA 3SKMB 3P30H 1UIRA 2WJHA 4ND2A 1LEGA 3RGVA 4N3TA 4TVPE 3IPLA 4ADJA 2GC4C 5GRVK 4PY8I 3GBML 4A7SA 3LAWA 1NFQA 1DVRA 4QHNA 1RAAA 1YUHB 5FA3A 2R29A 3T3MB 3ZX4A 4OBXA 3ERXA 3QUXC 4P07A 3NH6A 4IOSD 1CL7L 4D42A 4L4VD 4QATA 4HGZA 1A72A 4F7WA 2DQTH 5L3QB 2QIPA 3AINA 2A73A 4ZT5A 2IC5A 4YQEA 3MACH 4Y19A 4B2PA 4MSWA 2GI0A 2YARA 3HBJA 2IEIA 5E1OA 3G9XA 1KIAA 5MEQA 1BAPA 2GB4A 4IDPA 3LQ2A 4AF6A 1UTDA 4L4TE 1IXSB 4P2QE 4PFJA 4C58B 5M04A 4QOHA 1XYYA 1PFUA 5K3CA 5CJPA 3LXXA 1VZGA 5JUEL 5LP6A 3RI5K 2I4RA 4I9XA 3EGSB 2Z98A 4RGOL 2P3SA 3H2IA 3AI2A 4Z7VB 4D9QE 4GR5A 3B56A 5HHVH 3NCMA 2HH0L 1ZBDA 5IT5A 1ZUWA 4ZFOL 5HDQL 4EY8A 2Z5LA 3UZQB 2ZIVB 3EUUA 2VEOA 1JXMA 2NTVA 1J39A 3LYRA 2GPYA 1KCRH 3V6OC 4O6VA 2HFJA 3N2EA 1NEUA 3UATA 4P2OC 2YWYA 5E2VH 4FTVE 2X8BA 5JHDA 3BRWA 1CR4A 3QFDA 1X7YA 1INQB 5LR6A 4Q14A 2ARJA 4QGBA 3BVWA 2NXWA 3SQLA 3L84A 2CK0L 4HLQB 1YSOA 5DJCA 3WDKA 3QEUA 5J4HA 1JV2B 1TJPB 5JPNB 4FI7A 1KGWA 4NKMA 5C07A 5I5MA 2BNQB 3ZLQC 1BEEA 8FABB 2W6JD 1B6TA 1FYFA 3UBMA 1CD0A 4ODHL 2K0RA 1MDAA 4WEOA 4LX8A 1PZBA 4Y19E 2IXBA 2DI7A 3PQYB 4X8MA 4NCC2 4MMXC 2Q99A 3OMIB 2WD7B 4I48B 4HSGA 3QYMA 1AP2B 4MICA 4XH2B 2EDNA 3HI6H 1ML0A 3FOMA 4H1TA 5BWNA 3NMUF 1NQOA 3UUGA 2CJSA 3OVMA 3A11A 4N8VB 3TE6A 3PXAA 2M6RA 5GV7A 4Q56A 1J11A 3HL4A 3GQBB 5J0BA 4RMWA 3NRJA 3ZE6A 4XB2A 4E0RA 1IBHA 5ECYA 3P4XA 5E9QA 1UWLA 2O5VA 4R2KA 4EM6A 4DJFC 5JE8A 4XLZA 4HYTA 3ONDA 3F67A 3MA0A 3SE9H 2HA7A 1E9OA 1BYUA 3IAS1 1HJCA 4JBYA 3ZTNL 5BRZD 1XN1A 4U6YB 4UQ3A 1E3TA 3RIEA 2J6EA 5AB1A 4J3JA 4HWEH 4DPAX 5EIWA 1C14A 4KVZA 2K4WA 3N40F 3B7GA 3GLEA 2EKBA 5KZCD 5I23A 5DWPA 4HNUA 5HPOA 1U98A 1FFNB 5AVRB 5BMFL 1XZLA 1HZZC 4OM1H 1DL7H 4DLAA 2IZ1A 2PX2A 4I4CA 5EKSA 2R0QC 4K7FA 3S37H 5D1XB 3L02A 4E4RA 3TJRA 3KHTA 5TGBA 3SZ6A 2H0PA 1VFPA 3ADDA 2XMRA 3DC7A 4A73A 4Y4FC 1A9TA 1HA3A 3EPHA 1LEHA 4NO3A 1U0QA 4GLBA 4AN1A 1QSED 2DBJA 2OSLA 3CQ9A 1QLRA 3P0RA 5AOLA 2NT3A 2PD3A 3INTA 1VIDA 4OIFA 5CLGA 3UMSA 4EW2A 2VC2L 43C9B 4OFKA 4FHFA 4O63O 4L8FA 2VZOA 2D7JA 3I92A 2H3KA 4B2YA 4IHOA 5EIAA 2VSMB 1DHRA 4I5FA 2VT0A 4LT7A 1ISPA 4ZV9A 1A14L 1XGRA 4YO0B 2ADFH 2CHDA 3FVVA 4KUGA 4X8JA 1QG3A 2BSAA 5L95A 3IVRA 5JDCC 2WV7A 5C5CA 3N0XA 1LWOA 2XY1A 4ODBD 4IINA 1JA0A 3SDCC 3CDGB 4WU7A 3KPSE 2Q3XA 1NW4A 5MGBA 5FDWA 1JZ5A 3M45A 1TEHA 4X0NA 5T3XD 3KZCA 1NOAA 3OMXA 3OPZL 5GIOE 3KPUA 1Z9MA 1MAMH 4RCAA 25C8L 3IKMB 3N75A 3T7SA 2WK2A 2FUCA 2LXNA 5FYKU 1JZGA 3LOWA 2O8EB 1FDOA 4JO2L 2DFNA 4FQLL 1XLWA 3EYQC 4HWOA 3GJXC 3DKPA 4QASA 2VDLH 1J8HE 3N6RA 1GZSA 4CMHB 2R56H 3RVJA 3IMEA 1SB8A 4OZ4A 3H6GA 1HDOA 4IHBA 1YMMA 3DGCR 1AP2A 4AK9A 1CFVL 2EBWA 4OUDA 3JR3A 3QOXA 3U37A 1E2BA 4ZODA 4ZPVA 1XF5B 1UMKA 1Y7LA 1CXHA 4CYMA 1RIUH 5JMOC 2YV1A 4QRPD 3JVGA 4BSWB 3MLEA 3RBXA 1UWVA 1TQ2A 3VSAA 2H3NB 1EHIA 2A6DB 3VD4A 1F2TA 4AVHA 4LQDA 1XA3A 1B90A 2C3GA 3AW9A 3V33A 5ACZB 3IIMA 4BX8A 4UOJA 3LCJA 4QXOA 3I3OA 4R0LC 4OBWA 1E5CA 4IRSA 1X2EA 3EZYA 3FWNA 1P4LB 2CFIA 2WLZA 2FJGA 3FI0A 4U3JA 2BFPA 3FCAA 2F54A 1N4AA 3U36A 3EJSA 4QYSA 4NO2A 3NONA 5E08L 5B39G 4ZI2A 4O4YH 3PUKA 1AXSB 3V4VA 4GKNA 3IDFA 2XPGB 2M6LA 2AXGA 3DDOA 3JYOA 3TZVB 5E6YA 1KLFA 5SWSA 3RNKA 4P3OA 3EXAA 4E5SA 1UWEH 2Z04A 4YX9A 5ALWA 3ME5A 3QVTA 3PJEA 4Z9KB 5FB3A 4MR9A 4HX1A 4LHJB 10MHA 1V43A 2EO7A 4P5SA 2XBLA 3PQFA 1R33A 3ZU4A 1E27B 2AUMA 5CJ5A 4U6VH 1Y8RB 4FUTA 1UMCB 1VFOA 3ARUA 5IULC 2CLZA 1FG2B 2V2XB 2V7NA 3CNQS 4AUKA 2WIIB 1PY9A 2Q2QA 4BH8B 1EAPA 3NN8B 4LQLA 2D7NA 2FJUB 4A6YL 5L6YL 4NUJB 5KC9A 3U46B 4EI5B 5FHQA 2JF0A 1VJSA 2GZ1A 4GYJA 3MJ7A 3DE6X 4NZTL 3DHYA 4PAWA 3LD8B 4Y1SA 5J5EA 4WWNA 2XNAB 3S35H 3VNBA 2V98A 3CFUA 4LBAA 1ZI8A 3KHOA 3F9RA 2W22A 4ETQA 2HVKA 2CXTA 5LDUA 3FSZA 2HQOA 2DT8A 1OW3B 5CA1A 3VI3A 5C0RH 2R2AA 4P36A 5JU6A 3AACA 4YHML 1QANA 1XMJA 2L7UA 1RAGA 3SE4C 3WBDA 2ZVJA 3MRXA 1BC5A 1WICA 1NCCH 4WW1B 3CVJA 4XP6L 3L0OA 3VD9A 1D8AA 3FYUB 1C1XB 2BGNA 1JQLB 2JCSA 2ZR0A 5ED4A 5E2TH 1C8QA 1SKQA 1G3IA 2EEFA 4JXKA 1JZIA 1X8LA 3FCUB 3O6FA 4MV3A 3DXXA 3RTBA 1AQYA 4G6KL 5F7UA 4XXHA 2NNRA 4GOJA 5E94A 1E40A 4K8RC 4GX1A 3LT1A 3O3AB 3ENWA 3OF2A 4EEKA 2RH5A 3UYLA 2LU4A 2FX8H 2O93L 2XA8L 5GGVH 4IK7A 5KYVA 1P5RA 4C87A 2VF5X 4FDWA 3IAQA 4NCBA 5EBMA 3GPCA 2BCKB 1ESZA 1N6NA 3B2PA 1E28A 3VR6A 4WDRA 4DR2B 2HMIC 3WB9A 4AVIA 1RZ7L 3RIHA 3EZ9A 1F11B 2C3HA 3RX9A 3DI3B 5DHYA 4MS1B 5JCZA 3F7OA 1D9ZA 3HMXA 1P1ZB 1QH1A 3EGXA 4I0CC 1ZIYA 1DQJB 3TQTA 4WLNA 4XIYA 4PSDA 3TR0A 1CUFA 3N9IA 2CHFA 2CE2X 5D7KE 2GOYA 2IP1A 1VPDA 3LKDA 3ZZNA 1MNUH 1W5FA 4PF1A 1N3LA 4GLRH 5KS2A 4HMDA 2C9ZA 4QC2A 3JBG7 4PJDA 4AYWA 3VNYA 4IV5A 4TN9A 2PMZA 2VVTA 4WKZA 1FDRA 3L9BA 3S2ZA 4HZUA 1UB5B 1IAQA 4O2AB 5EUQB 5KAMA 4CE6A 3GMLA 3SYPA 2YLKA 1BXGA 1YMVA 3GEBA 4MD5B 3FCXA 3WRXC 2EGHA 1S7TA 1XV5A 1XCJA 4TSCH 3PB3A 2JJWA 4E5DA 4WHYH 2PK3A 2CO3A 4L0MA 3D43A 4D3ZA 4TUYF 5JZVA 3MS2A 4PLHA 2RGEA 3EO1A 5FKPA 1FUEA 4PLWA 4ZOLB 2ZSWA 2QQLL 5GV8A 3O6LH 4K2HA 2QP9X 1JWSB 4DM4A 3HBLA 3BKML 3VFTA 1BWRA 1A7UA 4E21A 4JQIH 1AV6A 1IHDA 1V95A 1SBZA 4BELD 5EZJB 4L5FH 3HNSL 1MRCH 5E8DH 1XEWX 5CNMA 4XP9L 1DCEA 4YAIA 3JUYA 2R11A 1UOEA 5FXMA 1WV7T 4WNQA 3GBDA 4ODXA 2WBJA 4BD4A 1VMEA 1ZJZA 4QGSA 3TCTA 4RH4A 4LRUA 4PHTA 1RZRD 1FL3A 2H2HA 1F3DH 3ETDA 4IH4A 4LDAA 4OPMA 3AUJB 2J6CA 1GZ6A 1XGRB 3P4MA 2Q4DA 3X1JA 4WFJA 4EYKA 1PEWA 5JA9A 5FLYA 3DOSA 5LBGA 3PQ6A 5DNYB 5I1GH 3BP4A 3KQYA 3CHYA 3U49A 3LZOA 4P0TA 3THOA 1QEWB 3ARBB 3IRUA 4N0QA 3ENVA 5DJ0A 1T3FA 3VXPA 3QCTH 1YKGA 1VJCA 2Q7YA 3O92A 3RX7A 3W8FA 4JGMA 5I7VA 5CHNA 3VXOA 4XNBA 1V71A 4QO1B 5HQJA 1OBHA 3SQBB 3SYKA 2Y5TB 3H0KA 2M32A 1WAAE 3MUNA 3GT3A 4M7LT 2D7TH 4YXKH 1YQUA 2XZQL 4G37A 4X71A 1TQUA 3F46A 4OSUL 3NZEA 5JSHA 2WK1A 5J11B 4NM8H 4CG1A 2Z57A 1QLHA 3TVMC 2VMDA 3OWRA 2O05A 4Y2JA 1SU7A 2IHNA 1K27A 4KX9A 3RU2A 2HCRA 4MR8B 2XB4A 1H5UA 4G80A 5ESVA 5B4TA 3GNSA 4ZPVB 2Q5IA 4NNJA 2W0KA 2VQTA 1AUOA 2IDCA 1KU6A 5L3RA 2FSIA 1E5LA 4JLKA 1K97A 4K5OA 4X6UA 1FU4A 5T4FA 1WS8A 2PJRA 1CYGA 3L6RA 3N1MC 2HTLC 1D4OA 1JK9A 4CG3A 4PSUA 1L9TA 1G7HA 4KBPA 3IAM6 3AADB 4OZGE 2XTNA 5LKRA 4DFHA 3BGFC 2AXHA 1MVOA 4MI9A 4MYSA 1Q92A 3FT4A 1JYXA 4P4KD 4XMTA 5L8LB 3FVQA 3FN3A 2YFKA 1JFTA 4H25B 1NXXA 4KK9C 3UWOA 4ZTZB 4DH2A 2OYKA 2C58A 1Z0AA 1RIHL 3F6LA 4BLQA 5HDQA 1V8OA 5B57C 2YWHA 4LEBA 2BJHA 1VFAA 5GJTL 2B1IA 3A25A 1IQDB 1SR8A 3HUFA 2I1QA 3PGCB 4YNBA 3C6LD 3HCFA 4O33A 4Q19A 4QQFA 5BWMA 3BVVA 3U3KA 3ZNNA 2I55A 3WP1B 1U2SA 4ALAC 2CK3A 2V96A 1OA1A 4D41A 2FPIA 3CVIL 2RDMA 3IBFA 5BUCA 3RVLA 4FN0A 1QBBA 2EEDA 4CU8A 4MRRA 3OX2A 1G41A 1AG9A 5DHMC 3QXJA 4XX0A 2HB0A 2JFFA 5I1LB 4ZQEA 2P2YA 5TE4H 3D5OF 3EUAA 4X6EA 1D5RA 4ERSL 5EJ8A 4E9XA 3FKSA 2HFTA 4QRPB 4MKRA 4HNTA 2V7HA 4WSJA 3EJCA 4Z7WE 3ZDBA 3NBFA 5ITZA 2E86A 3MBEA 4TMFA 1FNGA 1A1MA 5D1QC 3HBQA 1XZDA 1FO0H 3WWCA 3W9EA 3DDFA 3AX6A 1EZ1A 3NBUA 1WTGT 1C7SA 5KVEH 3QUTA 1MPXA 2AD1A 4F8QA 3O3OB 5GZOA 2GD2A 1CXKA 4GO8A 1RADA 2HWWA 5I9TA 1OK8A 3C48A 3GBVA 1R8YA 2EF1A 1J5IA 4WV3A 3RKSA 3GMNA 3DBRA 2MKWA 3DGEC 1WZ1L 3L9RB 1ZC3A 1GTZA 2XEDA 4F1WA 2OC4A 3OJXA 4FB5A 2UWEB 3GB9A 1SM4A 4IY1A 2P9TA 4KMSA 2FQXA 1CGSL 2XNKA 1QK4A 1BVNT 1RHMA 2AKEA 3WK9A 4IIQA 1TAGA 5FQOA 1L4GA 3LZLA 3DPBA 1RJ9A 3BMNA 1YHPA 4KPEC 3MG9A 3R4DA 3JYCA 3OU6A 3UMCA 1QMPA 4DLSA 1ZLDA 4X61A 2XUOA 3U36B 3LQKA 2IOOA 3EVGA 1KBOA 5ALPA 2HYIC 1V4NA 4WCVA 4IW4C 1KTRL 2GD0A 4CI9A 2TSYB 4KJQC 2E5LB 4M3NA 1VP9A 3D6TB 1SKUA 1HYQA 3RY6A 2R69H 4UT9A 3FO9A 3AGPA 1SMOA 2RHTA 3LXMA 2P8SA 3UJ7A 4DUXA 2DLFL 4ICXA 2TS1A 2DFTA 4Q89A 4PJCB 4JC5A 3S1LA 3BKCL 1FL6A 2RCNA 4JQIL 3BVUA 4HQNA 1CRZA 3O75A 4G25A 1B41A 3UENA 1S3SA 5DJ8B 4CMIB 3AF3A 3DXAE 3O8XB 4F7MA 1P4HA 3NNSA 5IROD 3VRHA 4FGKA 2NDGA 1MFMA 2AN1A 4PTUA 1Q9WA 5F1NB 2XZLA 3HR5B 1AGPA 3HUTA 5AHXA 2Z35B 4PV7A 3R44A 4RHEA 2IC2A 2KDGA 1A5FL 4IJKA 1IB0A 5D6OA 4R2LA 4IJWA 3MKKA 2GASA 3BHBB 4W7IA 1WGVA 4H25A 1V3TA 4TOYL 1B0UA 1GJWA 1U9JA 1UBKS 4MS3B 5BQPA 3SDDA 3L8MA 3QE4A 2QKYA 4P54A 3VYPA 3LKNB 2P9CA 4G6FB 3DHUA 1L7TL 2O8EA 4PB0H 4PI0A 3DJTA 4FNPA 4X6FB 1MJ8H 3QF7A 3VO9A 1A1SA 1KDVA 421PA 2IOQA 3VFRA 4TKUA 3TIEA 1JKIA 3TV3L 1JF5A 3E2IA 2GZ3A 3WSVA 1E27A 2E4TA 1TK9A 3BCFA 5DEGB 3NH9A 4U7TB 1O08A 2WQSA 2YPVH 4YRSA 2AFHB 3LY5A 2P8LA 3ZE7A 3DVAB 1YDPA 5EP3A 3PGDA 2A1WH 2PR9A 3D09A 3TLJA 1CRQA 4E2OA 4FBGA 1ZNQO 3NJKA 3RBZA 1E2EA 3IS0X 3NJXA 1J1XH 2A78A 1YMQA 4AMZA 4B3EA 4C08A 4HHAB 4AGQA 1HI6B 5CILL 3K91A 3SZOA 4JVOA 4BIMA 3RFZC 4OGWA 5EZOL 5JOPD 3T6ZA 2AH5A 2CMKA 2X5OA 4LVOA 1KDZA 3PJGA 3P54A 4Z77A 5DLMH 4X6DF 3FA2A 2CBPA 2HK8A 35C8H 4QTHA 4JO8A 2G2RA 4GINA 4MNHA 3A9RA 5GGRB 3X12B 4ABTA 5FUZL 2PU7A 1YMMD 1ZHBA 4CMIA 4QL3A 1A9XA 3K9GA 2EXTA 1JIUA 5TMPA 2C2KA 3GCGA 3SHVA 1AR1B 4XB7A 4XSHA 4JLDA 1IGTA 4NMLA 4XUGB 4PQYA 1EANA 3CHRA 3MV7D 1VFAB 1WA1X 3ARWA 3PA6A 2YD7A 1FFCA 3MUEA 1VJ0A 2O5NA 4TYMA 2P9RA 4NNXB 4Y4FB 3UEQA 3BVTA 2J3EA 3V8QA 3SDSA 1F38A 3D25A 3DO4A 2P4QA 2OKGA 2GUOA 2X77A 2DUWA 4OQTL 3NFNB 4RIRB 1SUCA 2UAGA 1TU4A 5T1KB 1R1CA 1SIBE 1MRDL 2TYSB 3WLKX 3QDMB 3MINA 4JPQA 3OZDA 3ZXAC 1E2VA 1CJMA 2F8IA 3MV7B 1U2DA 4DHWA 2X5XA 1AQ8A 4KNQA 2CAKA 5I45A 1XCPA 3N43F 3GWGA 3L3KA 3SJVD 3SO3C 1I1NA 1IJ9A 2HBQA 1VLHA 1UBOS 2DRIA 1YZNA 5DZAA 1DQNA 2HQBA 1NYTA 3QUZB 1ZGLM 4MGZR 1VKNA 2RHEA 4R5XA 1BG6A 2H3HA 3SIXA 4J0GA 4QAJA 5AG9A 4Q52A 4L5YA 4N5HX 1UQRA 2NO1A 1I1YA 3EYSH 4NP4L 1OGYA 1JGVL 4R4FL 4OHOA 1T1XA 2RHLA 3QPXH 1M8FA 5LXTA 3MCKA 3MRNB 1KAOA 1OO2A 4WFFE 2BSCA 1JRHI 2AGJL 5KX5F 1QG6A 3NZHL 4YGVB 4LXQA 3B9RA 3KPQB 1XHFA 3STUA 4IDEA 3JWNE 1JAIA 3CNKA 4H26B 3EPKA 4PC7A 1DRJA 2Z4QB 2X2EA 5MI0B 1S2EA 4DW2L 4OLWH 3NIGE 1KGSA 1EP1B 1X8KA 2JIDA 1XCMA 1E1NA 3E70C 2V45A 4HD5A 4J3OH 3JRXA 3X17A 3A10A 3LWNA 4GPBA 3V1MA 3PDJA 1OAAA 3IVKB 2D0IA 1HSAA 5EOCL 5AZEH 2JQMA 1ND5A 1DDOA 3V0HA 4EA7A 1JYEA 3VXME 3DVGB 5JDIC 2FH5B 3R3XA 3JD0A 1WFTA 1G9EA 4KJZA 1U2QA 3GO4A 2ZUEA 1A6WH 3BSWA 4QHPA 4V1CI 3BWZA 3UTOA 3VZQA 3ARBA 1QIMA 5DBEX 5C2UB 4JVMA 1XKQA 1GDTA 4GF5A 1T7ZA 4ORGA 3MTAA 3CD4A 3HRZC 2QORA 2ZCJA 2DEXX 1W59A 4OL0A 2K1MA 3KQNA 1SKMA 2HJLA 2GILA 4OKVA 1PVDA 2V58A 3VXSE 5AW7B 3M9LA 4XD7D 4NJAL 4O58L 5AVXA 4E2FA 2OMYB 5AIBA 1SBYA 2A0WA 5KSYA 1CSEE 4GX5A 1JJAA 3FPCA 1LQ2A 3RRNA 1X74A 4JUSA 2O19A 5FCSH 1IY8A 1XQWA 3HE7C 1HNXB 4LCIL 3A04A 5C07D 5E6IC 3UCFA 1LF5A 3WMPA 3QWQB 3QEQB 3ME0A 1L5GA 4EHNA 4JL5A 4YXWD 3QJTB 4KJQD 4L15A 3ZIAA 2V3FA 3ULVD 1A4KA 1T13A 3QXCA 4DKAA 4UNUA 3BQUC 5E7JA 4HD8A 1CEQA 4X9YA 4ZFGL 2D0PB 3VGBA 1DBKH 1U3GA 3UICA 2YAFA 3KPQA 3A3KA 3M8OH 4WY7H 1FF5A 1USWA 2AAAA 5CDTA 2E2WA 3ANTA 4PBDA 3TQOA 2AG1A 3G5AA 3D2LA 1YNLH 4TQGA 2FYYA 2A9VA 1Z37A 4IDLA 4Y2LA 4IGFA 3O4LD 2E7LC 1ZL2A 5EOTB 2DKFA 3BA6A 1PJ2A 4MUBA 3O6FC 5CA1F 3U31A 2DHCA 2ZYWX 3COSA 4MV1A 3PEEA 4QUEA 4LSPH 1DQJA 3WXVL 1VB3A 3QUGA 2QDKA 1E0KA 5HIAA 1XI2A 2P5YA 3JWEA 3JQEA 2YXWA 2F68X 3MRMA 2Y4NA 2PCPA 1SFDA 1UP6A 1N1MA 5BN3B 3RS8A 4UAHA 4FIZA 2Z2ZA 3PL6C 4H7VA 1HFJA 2YPVL 2Z9DA 5T3XE 4OHXA 4F4UA 4NU0A 4DDUA 2AK4A 3HG0A 1KEEA 5E6RA 1GCOA 3VJLA 3EBPA 1E2QA 2XQ0A 3FJ1A 4LZWA 1CU4H 2AFNA 4GKNB 1HLDA 4RCYA 4KMQA 1N34B 5HGAB 4FGUA 5JEDA 4J8PA 1QVRA 2CIKB 1C0IA 1W4AA 1KI4A 2XLBA 3TYGH 1NC4D 3BRGC 4J5VA 5AVTB 5LLDA 3RJOA 2AK4B 1WSBA 4YDSA 3HEMA 1EK2A 1POWA 1GGCL 1ITZA 1WBZA 1U2RA 2WFZA 3DBXB 3P5BA 5EMJA 1Z18A 1OSYA 4GZLA 4LXIA 1OT5A 2DQTL 3HAEA 5M2QA 4APQB 4FT2A 5K0NA 5DJAA 2VE6B 1HNGA 4LLWA 5K69A 4RV5A 4AG6A 1RWBA 5LMUB 2VH2A 1XR9B 3ZH9B 1YEIH 2D0DA 2WIJA 3DFMA 4PGAA 4H1LG 1MREL 1FYHB 1J1IA 4JBHA 5CZVH 5GGQL 4DVJA 1IY0A 3GLDA 2ZXCA 3PNWB 4OB7A 4OR1A 4D97A 3HA2A 5E6UB 4M0UA 1FNBA 4WLOA 4AG4L 1M56B 2IALB 1JR3E 3QZWB 4HAOA 4EY6A 5EP2A 3GMPA 5IVNA 2R3SA 3PITA 3ULVE 2EGGA 1EO8L 4N2GA 4FFMA 1CJYA 2VNKA 1ESMA 1FZKA 1PT8A 4FD0A 1ZISA 5HUQA 1I5RA 3CXDH 4A8HA 1TQSA 1BA3A 5GADl 5ILQA 4TXHA 3EY9A 2B5IC 4IIGA 3RZCD 3PWPE 4QTUB 4FFWC 4KMRA 2MCFA 5IJ9B 1NWOA 2PEYA 1X77A 4R5HA 1YB7A 3CVHL 4GNKB 1YNTB 2P3YA 4YRBA 5DULA 2O8DA 1JHYA 3NK4A 3ZZSA 3S9DB 1ZXQA 3BAZA 2IFTA 4D7BA 5KYTA 5SWSE 4K8RD 4WO0A 2X1WL 4L4YA 4C78A 5GRWA 1QR1A 1L3BA 3QEHA 4JY6B 1GTSA 3LOQA 5TH2B 3RJQB 4E3ZA 1SEPA 3LRPA 3IAHA 1YKFA 1LXMA 4Z7UB 2LABA 3MLYH 2PGLA 4DRXA 2V9QA 1EH9A 1DJSA 1DQLL 1O94C 1XZKA 3ETNA 4P3YA 4N03A 4M7LL 4UBLA 1ANUA 3WHKA 1D1TA 5ALXA 1UCTA 1C0KA 5BS0A 3NDJA 1ZIBA 1JKJB 1XAHA 3VZSA 4ZMSA 3SGDI 2NNCA 5AUMB 3C3MA 1X5AA 1YA6A 3VJKA 2YSTA 2R7MA 3IX7A 4CEIB 1F3JA 1QLRB 1UGKA 2GPTA 4CIWA 2BLFA 1OPXA 2EIXA 4JB2A 5D93C 2C57A 2X86A 2Y07L 4PPGA 5CSBA 5D1XE 3TLCA 2B1HH 4EMSA 4B17A 5TGBB 4KK5D 3LNGA 4EXKA 1DUZA 1PL3A 3E8MA 4IKOA 1HSZA 1VA5A 2KBGA 4F33A 1BHQ1 1E6WA 1A6VL 4CCYA 4ISVA 2O3RA 4FFYH 1PQZA 5I8CB 5FIEA 1WMEA 4CKCA 3VNQA 4YBRA