3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
2XYHA 2QLJA 2CNLA 2J30A 3EDRA 1IBCA 2CNKA 2P2CA 2XZTA 4NOKA 1K88A 4QTXA 4EHKA 2QL5A 3GJTA 4QU8A 3DEIA 4I1PA 1PAUA 3DEKA 2C2OA 1I51A 5LU9A 1RWKA 4AW9A 3DEHA 2J31A 4N6OA 4IYRA 4QUIA 2HBRA 5LUBA 1GFWA 1PYOA 2H65A 4LSZA 1QDUA 4JQZA 4DCJA 1NMQA 1BMQA 3PD1A 3QNWA 4JJ8A 5IAKA 2CNOA 4ZVRA 2H48A 3V55A 4QUAA 5IC4A 4N7JA 4JB8A 4N6GA 1CP3A 5IABA 2QLFA 4QTYA 4PRZA 2AR9A 5H0IA 2WDPA 1RWVA 4EHFA 5IAGA 1ICEA 4QUHA 4EHLA 2HBYA 4ZVUA 4FGUA 4PRYA 4NBKA 4D3YA 4NBLA 4FXOA 1RHKA 1RHRA 3UO8B 2Y1LA 3E4CA 5IBPA 4JQYA 1M72A 3K7EA 3H13A 5I9BA 3V6LA 3V4LA 1RHQA 3GJQA 4DCOA 1GQFA 4M9RA 4QUDA 4EHNA 1SC4A 4ZVQA 4N5DA 4JJEA 1QTNA 4JR2A 4QU0A 2H5IA 1KMCA 4N6NA 5IAEA 5IASA 4NBNA 3OD5A 3DEJA 2FUNB 2H4YA 1F9EA 2H4WA 2J32A 4D3XA 3BIJA 4EJFA 3GJRA 2QLBA 4DCPA 2HBZA 3D6FA 1I4EB 3UOAB 5IARA 3NKFA 2H5JA 4AWBA 3PCXA 1NMEA 4NOMA 1NW9B 3D6HA 3R7NA 4HVAA 4PS1A 1NMSA 5IANA 2C1EA 1RE1A 2DKOA 2CDRA 4NOJA 2NN3C 4PS0A 4ZVPA 2FQQA 1JXQA 2CJXA 2XYGA 1I4OA 3R7SA 3V6MA 2FP3A 5IBRA 3KJQA 2QL9A 4HQRA 3NR2A 2K7ZA 4ZVOA 1CVRA 4D3ZA 3KJNA 2Y0BA 2CJYA 3V4OA 5IAJA 1SC1A 3IBCA 4JR1A 4QULA 5IBCA 4NOLA 2C2MA 4N7MA 2XZDA 5I9TA 1RWWA 1I3OA 3S70A 3R6LA 4EHDA 1SHLA 5LU8A 2QL7A 4QU5A 4ZVTA 3R6GA 3PD0A 4EHAA 2H51A 4EHHA 1RHMA 3GJSA 3RJMA 3R5JA 1RWPA 3R7BA 2C2ZA 4HQ0A 3S8EA 3H0EA 3IBFA 4ZVSA 1SC3A 2CNNA 1RHUA 2C2KA 4QU9A 1K86A 3KJFA 4QUEA 4QUJA 5JFTA 3SIPA 4I1RA 5IC6A 2XYPA 1RWXA 3P45A 3EDQA 1QX3A 2HBQA 2J33A 4FEAA 1RWOA 1SHJA 1RWMA 3D6MA 3NS7A 4FDLA 4QUBA 1RWNA 3H1PA 4JR0A 3ITNA 3P4UA 3SIRA 3H11A 5LUAA 1F1JA 4QUGA 4AWAA 3V3KA 3H11B 5K20A 4JJ7A 3R5KA 1RHJA 2H54A 4IEFB
chains in the Genus database with same CATH superfamily
5FI0B 1V3LA 2IEIA 4YMLA 3SWWA 4DQOL 4C20A 2H7WA 3VFUB 4WCYL 1FS4A 2K3TA 3TNMB 1PU2A 4IBWA 2P8JA 2HI0A 1K9TA 3BERA 3QEMA 3SDCC 5EOTB 2R4QA 2ZM6B 3TVMB 4B7IA 2R1YA 2B0SH 4ZODA 2F6AA 4F9FA 3HZYB 1RZJH 5F7EH 2J09A 5K0NA 4TXLA 3Q8MA 3QNXB 2FFQA 2QB5A 4HCGA 1Q1QA 4QELA 4BU0A 2YAFA 1KOAA 5JAZA 1XQ4A 2PH1A 2AEPL 4IK7A 3RUGB 5IN4A 2KLHA 4PC3A 4L8DA 1LPBB 4PJXE 1U8TA 4ZPVA 3ZGYA 3UGQA 3VFTB 1JXQA 3BE5A 3KSBC 2VDQL 5FI1B 1G7LB 2J07A 2EDOA 2IPTH 2EF0A 4PSKA 1VKXB 2XZAL 3LW7A 1C4KA 1KB5L 1UZAA 5K93A 2F1RA 5TK2A 3ETSA 2P62A 2C2BA 2EYRB 4P2OC 1Q77A 3A9UA 1YRAA 2BVEA 4QDZA 1JMZA 2QUIA 3TJPA 3GTNA 4F4UA 3TW6A 3H05A 3SYKA 2IYUA 16PKA 5AVOA 3ANXA 4JHWL 3L41A 3PDUA 3I6KB 3VFOA 1NR7A 2VLRB 3QRWA 4FOPA 3FOLB 2JCCB 1Y6RA 4GPIB 4YRNA 2I85A 5GJBA 1OAKA 2E0IA 2G1AA 3AEUB 2QM8A 2C4MA 3CQ9A 4X5PA 2DB8A 3AO0B 4AG3A 4S1VA 4B6QA 5E2WH 3B3QA 1EM8A 4UDTA 1IQPA 4ZU1X 2FPMA 3SJVA 2IW3A 3L4SO 3TPCA 1VRVA 3GXNA 4DF3A 4HZAA 1BHQ1 2YFKA 2KH2B 1JXMA 1Q7EA 3S2UA 3AM5A 4ZKEA 4PYLA 3KR9A 3W3AD 4XNXH 1P62B 3KWXA 4ABVA 3FRIA 4ORGB 1BQKA 2E5EA 2OTCA 1S9WA 5BXQC 1CURA 3LDBC 1TMGE 4OLZL 1TEVA 5DPMA 3K5WA 4N01A 2FWOA 2CG9X 3K8OE 3QCUH 3JX9A 1ONQA 5BNZA 4P2QE 3N3EA 1OKEA 5AVQA 3MM4A 1A8ZA 2X8JA 3H1TA 5IB3A 4ZV4A 1EO8H 2UV8A 3MV8A 4L50A 4E0RA 1LD9A 1ZA6A 3S28A 3L0BA 3W1WA 1E9VA 4YXFA 2VJAA 2VBIA 3U44B 1N9GA 4YRLA 1GPNA 5HVHB 4UMEA 5BN3A 3ZU2A 4PYNA 5BSEA 3W2DH 4RMTA 4NM4L 5H59A 3LZFL 1I6WA 2GARA 3ZKWA 3D4IA 3IDIB 5GJSH 1W8OA 5DP2A 3SB3A 2TECE 4Z78B 2Y7OA 3V3TA 4FRWA 4HK4A 2QSTA 3T9FA 4CMJA 5KS9A 1V9CA 3QELB 3LZQA 3TWCH 3V2HA 1GJWA 1HL8A 5C0BD 5HCNA 2VQ1A 4Z0PA 4JO3H 3OIGA 4OD3H 3IJSA 1P81A 4DR4B 4BNDA 3KPJA 4KRPB 1EPUA 3RVUD 3EJPA 2A5UA 2WWOA 3RL2A 3SPVB 2G3XA 3VU0A 4CKQA 4HC1A 4FD2A 1F0LA 2EDKA 1GGHA 3HBMA 2VHCA 3DO5A 4ZIRB 2D4FA 2A38A 3REVB 2LV4A 3V52L 1UINA 4WK2B 1JE6A 1JZDC 5DJXA 2POCA 3PKZA 2BSQA 1AU9A 3AEYA 3I9AA 1OE2A 2N3JA 1A2BA 4DC9A 3RU2A 1KMHA 1I7QB 5DNEA 4MLPA 1UC9A 3HBFA 1UA6L 1HT1E 4J3FA 2QTAA 4K0RA 4UM9A 2E5WA 5CIPB 2ENPA 1IM5A 1BJ1J 1U0BB 2YCBA 2VRAA 1Q1BA 4LESA 5HI4D 3MRQB 5F0MB 3UBXG 4QRQB 2WGXA 2CE2X 2DQUH 3IMUA 3JCZA 1L7QA 1CK0L 1E65A 2K4MA 5HKOA 4ZV9A 2F7PA 3AQYA 2SKEA 1K72A 3KGUA 4ZMAT 4OT1L 1HNZB 2FUTA 3ZE0E 5ALHA 2VMEA 1AGCA 1SHSA 5DXWA 3OPMA 2P91A 5DMXA 2CO6B 1AO7A 1SF5A 3WIAA 1YGPA 3VPGA 4RY8A 3RVXD 4HJJH 4WW2C 3AI7A 4OIBA 1EHAA 3BJMA 1DLFL 5AW7A 1SBTA 2J25A 3O84A 4J12A 1OYYA 3WKAA 1ZHBA 3K4DA 3SHVA 4C6TB 3KLBA 4B75A 1CFBA 2ZB8A 3CHPA 4A7UA 1FJHA 1D9XA 1T2CA 3L1OH 4TMTA 1J0HA 3U4MA 4MKFA 3QO0A 4ZEWA 1Z22A 4OZGE 2W88A 3VR0A 2W5PA 1QRNB 5JMOA 3A9VA 4EA6A 3HHPA 3VDAA 3GI1A 3R8QA 4WUVA 3ZTJH 2OE2A 1YDWA 1LYQA 4W82A 3L95B 2NOYA 1H0DA 5JXAL 5DFVC 5LBVA 3LL4A 4GQAA 4K6FA 5MHSE 4B0MB 1NMEA 2ODHA 3FTCA 3RTEA 1Z25A 3IODA 3DHYA 4J1UA 3W5IA 4A1FA 2V7UA 3W5BA 1XRRA 3C5SA 3VXME 3APFA 3X3GL 3TRKA 4TV3A 4ZAYA 3L2OB 4OCNC 2OVBA 5LQRA 5JTTA 3K0AA 3BMNA 2XIJA 2IZZA 2HJLA 3FNQA 3FPGA 1Y4SA 2WJ7A 4HH1A 1XB8A 1VLMA 5KHAA 3ZWYA 2AI0H 3EH1A 4DCQA 4Z23A 3LBNA 1TLFA 3TLXA 4N5LA 3TCLB 2FBRA 4G81A 3GHBH 4ABUA 3D6VA 2XVYA 3CLFL 3UFXB 1S2EA 1QZ3A 4WSOA 3RIGA 1RM5A 1SO8A 5LAPA 3VVWA 3RTGA 4X6DA 4Y2JA 5TQ0H 2H8KA 2QL5A 3VFRB 3I2JA 4JBWA 3HV2A 1SURA 5A04A 1TC2A 1P1CA 3EQ8A 4QDXA 1JUDA 3AT1A 3MLAA 4JP1A 4X1KA 1A8QA 2E7CA 4Z8FH 3UACA 2GK7A 4D98A 5DI8A 2NZ9D 4PLTA 3J8F7 1O6BA 4OCRL 1OTSC 3O38A 1WG3A 2VZSA 1XEWY 4EHNA 4NN5C 1PHRA 4F7TB 2ZZUT 2MSLA 4S10A 3BB1A 3PHLA 2DS4A 4DP7X 2N1KA 5LKRA 3GJRA 3ZY2A 2WZQA 1Y6FA 1R3HA 1WO8A 1EQAA 1F3DJ 1JSYA 2HWZL 3FMGH 1NPJA 3NN8B 3M1OA 2ZROA 3NSCA 3E6HB 1F4XH 5AEAA 3TA3A 2HTLC 3PNPA 2JKNA 5DD5L 1R5VB 3GLGE 2D5IA 4Y2SA 1D4AA 4NQDB 3AUTA 3ZWWA 2V2TB 1MABA 4R7GA 4RMWA 2C7PA 3DO4A 2WYIA 3L5OA 5JUEL 4ABYA 3NRFA 4G8FB 3PXGA 2X4UB 3OCWA 4ZTOL 2R86A 3C4JA 1ZV9A 4X24A 2GCIA 3PDGA 4HDCA 43C9B 4N49A 2OXHB 4TV9A 4X4YB 3V4PB 1TVKA 1G6RA 4HAOA 1QZZA 3L93A 1I36A 1XDDA 3ZZQA 2PW2A 1A5BB 1TZGL 3FTWA 2OCLA 1L7TL 2QRMA 5MFPA 1ESCA 4KXWA 2DLTA 4EB8A 4CCSA 3P30H 1Y7IA 1JU3A 4HEPA 3S3PA 5FW8A 3AF6A 1NGPL 4M2LA 4QTUB 4NAQA 3KQSA 5KBPA 3EC7A 3UXMA 2YMLA 4KQGA 4D9GA 5FAAA 1QSFD 3H1GA 1XJQA 4XIGS 2VT6A 3KXDA 4NEHB 3COZA 4BJ1A 5JC8A 3R9XA 4EZJA 1NXPA 4V0NA 3KVRA 2VJCA 1H5UA 5CJQL 4BU1A 2NQCA 1H3PL 1I24A 3LSYA 3EH3B 4ALJA 5LPNA 1DQKA 2P52A 4ZMOA 4PFQA 5LXTB 2HREA 2IPOA 4QOKE 4PLYA 2X58A 4X9YA 1APBA 5HW0A 4ZUUA 4G8EB 2XD9A 5T3YA 2ZUQC 4QULA 3MPUA 1RCYA 3MUOA 4MA0A 2QG6A 4MV1A 3ZW3A 4BXOB 2Z2JA 4S1PA 1MKYA 3ABRB 1KXVA 4PGJA 4KROC 4JPIA 1ZQ1A 4O2LA 1TEHA 1GCYA 3GCGA 4JT2A 1M3JA 3AF1A 1RMQA 4CU7A 4LJ7A 5E1MA 4JNXA 2OYPA 3HCRA 4KBPA 4UT7H 2V8BA 1DC3A 1FRGH 2B1GA 1FG2B 2IDFA 4E5SA 4TOIA 1QF6A 2NSYA 3S2CA 3E9QA 4EKXA 4K6OA 1IBZA 2E89A 2B4CL 2ZR0A 5J6HA 3G9QA 4Y9FA 4UTBH 4FNOA 4JK0D 1OW0A 5E8PA 2Q6VA 1YS2X 4QLRA 5FYLH 3H4MA 4AMVA 2BP8A 1L9QA 5CDYA 1GOFA 3JQFA 1EAQA 3IAM6 3P11L 3L7FB 4D41A 3WDLA 4B8ZA 4LCJA 3BQUA 1IHYA 4N2OA 1IAII 1L8OA 4Q0XH 4YLCA 3IULA 5E2VH 1TIBA 4PS4L 2QLBA 1P1ZB 5LWQA 1Q50A 2C29D 3UNXA 4XNUH 4S1NA 4F24A 1YK1A 4EZLA 1DV2A 5FKPB 2ZXGA 3LBAA 3B2NA 4EFLA 2WIAA 3M5CA 4NI5A 2NX2A 2Q0QA 4P83A 4RE5A 3KOZA 4LSQL 3DURA 2F54E 3T7CA 3A67L 3OQIA 1JPTH 2VJQA 2M2DA 2R48A 2WSIA 2D9QB 4I87A 4RQQB 4P46D 2ECKA 1N9PA 3SDDA 2VSCA 4JRFA 2FX9L 4LLWA 3P5BA 1F6AA 3GF4A 3H9UA 3SQDA 4MA3A 5FFNA 1ZWIA 2FQGA 1EJ8A 2NY6B 5JDCC 2P8LB 3CF6R 1A27A 1JE0A 4I48B 4GH5A 4JBNA 4OHUA 4RAUA 4AVKA 2FVNA 3RUHA 3KSAC 4J0GA 5LXVA 4G5HA 3CWGA 3JD0A 2GUOA 1W72A 5F76A 4UINH 5DGXA 3QFTA 3GB9A 4QUIA 2VL5A 4WVFA 2QW0X 3M8OL 3T09A 3F7VB 1EFXA 4URKA 3V48A 2BELA 5IJZA 3VM7A 5GRWA 3Q8LA 3HKZA 1GPYA 2WJPA 1BU5A 2F8MA 1C3JA 3IIEA 4Z2YA 3SKNB 4HJEA 2D3TA 3CPSA 4GAJL 1PDOA 2BFVL 2FR1A 4RTKA 1ZTXL 5I1DA 4N87A 2PW1A 2FBJL 3WGMA 3I6QA 1AVAA 3AGVA 4JFVA 4GLRH 1GTZA 1OTYA 5DZJA 1EP9A 4BAUA 1N0WA 4QXMA 4OH2A 5A4MS 4GSLA 4EI6B 5I0XA 4WBNB 2GFBA 2PX8A 2HKIA 1PT8A 4QBTA 3FAWA 2RI0A 3ZV6A 4WY2A 4JJ6A 2OCFD 4KP7A 5G40A 2JELL 4JGIA 1VJ1A 3FROA 2YGVA 4ZXBA 3ZYZA 4JG1L 1THAA 3RS0A 3CXUA 4P54A 2O1SA 4Q05A 1ZGZA 3B13B 2WWYA 1FLNA 1U2YA 4G5GA 4JEMA 1PR4A 1RXEA 5HGBB 2IANA 4JVUA 4WNQB 1Z5ZA 3HBNA 5L4LA 4K7PH 1GQSA 2DM6A 2PUAA 3H5LA 2AF3C 2QBYA 1HH4A 5CK5A 3ZHFA 2PUGA 1Z16A 1H0RA 3B1YA 3RREA 1I7LA 2NY5C 4OYLA 4FGSA 4OXYA 5FOTA 2A73B 4KIGA 2FO4B 4W4OC 1TD1A 1Z83A 3KCQA 4NKOA 3KCPA 3G0DA 1HZZC 3BZEB 3BWUF 1YZ3A 3ZL1A 2ZK7A 3GRCA 1N0IA 4PLJD 2G07A 4KDEA 1QHGA 3O0RH 1RCUA 3BPOC 2G70A 4EUFA 1HH6A 5HZMA 4YGXB 4IFEA 4GQZA 2YWEA 3LLUA 4M87A 2CHZA 1WHPA 3WOVA 1JHDA 5IIEA 3STLA 5EMJA 3GGWB 3TT3L 1DWOA 4W93A 2VR6A 2OB1A 1OTUD 4PZCA 1NBAA 4XC3L 1KPUB 3DG9A 2FQQA 1FUUA 3QR1A 3OF2A 3O6FB 1DYZA 3TNLA 5GGYA 5GISL 3T9AA 4BFCA 2WTNA 3ULUC 2YBEA 2QJWA 1PR2A 2NXJA 3ETNA 4BFXA 4DIEA 5BNXD 1KAHA 3P54A 5J0BA 4EQ2A 2DBYA 3WRYA 1R0KA 1ZLDA 4XNYL 1QIFA 2VUYA 3GLIA 4X94A 2JHPA 3FC8A 2BGLA 1XZIA 3NPMA 2AD5A 4FONA 1G7QB 4UHJA 3GX1A 2WYWA 1T2JA 1ONPA 3S6CA 2RKWA 3T6WA 5B1KA 3O75A 1NMYA 2ATIA 3BMVA 5B1AB 3OHXB 3BLKA 4EA9A 4X98B 4M8NE 5F44A 2X28A 4FG4A 1GG9A 2E86A 1CZHA 3BWAA 1QGAA 4IH1A 1DQNA 4P0DA 5TVKA 1AGDB 1SXGA 3W9EA 1E5LA 5JASA 3LIUA 2EDEA 3JQAD 2IEYA 4W1QA 4D0BA 5EINA 2CM5A 3V55A 3IPLA 3RVTC 4O02L 3WYEA 3PXHA 3EXLA 5DZSA 4X8OA 1HFWA 1SBHA 1BWWA 5EO9A 4L95C 4G80B 2YINC 1MWAH 4B3XA 3WS3B 2Q49A 4PC7A 3O9MA 3IMTA 1RDFA 4D8YA 1P91A 1IEBB 2OV6A 2ZYWX 4TMFA 1S7CA 3K2QA 3IXMA 5E56A 4S1SL 4J75A 2PLWA 2XVMA 2I7VA 1R5JA 4TZ0A 2ALWA 3F5DA 5FCUL 2HTKC 5GZOD 5AVXA 4N0UB 2NNFA 2C0PA 3QORC 4P59H 3LZDA 1DIGA 1IBKB 5BWCA 1H3UA 5KKCA 1OPRA 5DM60 3QNZA 1RRMA 4FILA 4IGKA 1SCUB 5DHQA 4HEHA 2Z31B 2E5FA 4KPHL 3OAWA 4PAQA 3PPSA 4ONEA 1GZ3A 3KRTA 1R0AL 4K07A 3KBBA 4GMXA 3OMIB 2H1VA 1J90A 4MAYC 5TQ0B 1SY7A 3CLRD 2C5GA 1E0KA 1SVSA 5K3CA 2KQMA 4AZ8B 3FFCE 2HBRA 2DKMA 2H6EA 4Z7QE 1G87A 3CN7A 1EZ1A 3O0DA 3P9CA 2G2PA 3DLPX 1KQOA 1NXSA 2C82A 1SF3A 1GPOL 1YB1A 2P9TA 3LNTA 3NC4A 4KMOA 4JUDX 1LW6E 4BVEA 1UEYA 4FNGA 1QPKA 4IHOB 5BRJA 4GXVL 2HQOA 3VNZA 3MGCA 2QGEA 3NEJA 1CLOL 4U1KA 1C1DA 2AR0A 4N40A 1KN4L 1I3MA 1SXBA 3IPXA 1A6UH 1UUSA 3V2UA 1R4NA 3BPNC 3HDVA 2D1FA 2O4CA 2GETA 3L1KA 5IFAL 3KKZA 2Q46A 4XODA 4YHPA 1W6UA 3RY4A 2DTML 3Q9NA 1YNTA 3VJKA 4Y89A 1L5NA 1JJUA 4I5BB 1GQRA 3G8YA 1W49A 1OQAA 1KMQA 5CLWA 2V9ZA 1F2TA 1IOLA 1MSPA 4A38A 3CPLB 1ET7A 3D69A 4NWIA 3R5HA 1ES0A 3X1BA 2IAMC 4EG3A 4NO5B 1N70A 1Z6AA 2V4UA 1ZCAA 3FQUA 5JPMC 3MTGA 2D31B 1HLDA 2C9DA 2ZKHH 4JFHD 3MA7B 4HBCL 1A47A 1Z17A 3CKMA 1P5VA 4KU1A 4M7LT 3TIXB 4O4HF 2DPMA 4KXCA 2WMDA 3KYAA 1PX3A 4XH9B 5IMKA 1IM9B 1YKFA 3OPVA 3WL3A 5D5MB 3F7LA 4LECA 4BLOA 3Q0IA 3IEAA 3W5UA 1RJDA 3EEQA 3AY4A 4J4PC 5EQJB 1SG9A 3TJHC 4LXQA 1KJMA 5JNWA 5E6IA 1VF5C 1ZHKB 1UM4L 1HDRA 3NOQA 2FD6L 2AJYH 3WWEA 3LPDA 2HFFA 3PFCA 4KZCA 3RVVC 2OS7A 4YQYA 5DJZA 3HLYA 4WKPA 2D59A 4Z99A 2QKIB 4L3VA 3F49S 3GJQA 1Y63A 1MREL 2ADJA 4U1SB 2ATKB 1HLPA 2Q07A 4NRYB 5A6MA 4UTRA 4MR9B 2NY0B 2VXVH 1P5ZB 4HPOH 1IC5H 3UJBA 3B89A 1G1KA 3BMOB 1AJ7H 5EU4A 5DLPA 1Z2PX 1LX7A 3BZWA 3E9MA 2HPOA 3KZVA 2NY7L 1NSYA 2V7QA 4KXNA 2E9WA 5EGNA 3JQDA 5JQ6H 3MTQA 3NJHA 4H7VA 4U1NA 1MNAA 2XTJB 3USCS 5JPNA 2OAQ1 4YNBA 1WUYA 4K7FA 1UH2A 1VJCA 3DTVD 4C78A 4IDJH 4LYEA 4YRZA 1RJZA 2O7QA 1XXHB 1IJBA 9GPBA 4G7SB 4ESHA 3STVA 1UATA 3U3OA 3H11A 1NJFA 3B9EA 4BLSA 3AGWA 1PYWA 4BZ1A 2HU2A 5H3LA 2V55B 1BWPA 1SXJA 1NCJA 4H4EA 3NONA 4DG8A 1KZ1A 2NQDA 1LBTA 2UYOA 1D5MB 3JALB 3TL5A 2HYIC 3MFGB 4JO2H 1HEYA 2EFGA 4JLSA 2CNZA 2JWYA 1G20B 2QX7A 4DMUB 3UF0A 1U3JA 1IK6A 1F4HA 4WKZB 4YSCA 4R5HA 3WICA 2IZ1A 2JVKA 4U1GC 3WK9A 6YASA 3OB8A 3AI2A 3T54A 2QPUA 2CK3A 1QX1A 3LKPB 5I9BA 4TLKA 4K9EL 4AYEC 3JV4A 4NYLB 1PL8A 4WFJA 5IKOA 4ZCLA 1TU2B 3RVRA 2VO5A 1SPXA 1JKFA 2QGNA 1FNCA 3M3DA 3NACH 1ENZA 4FHGA 3NRCA 1T1YA 1Y3AA 3UHAA 4FD0A 3G2LA 3T1HB 4QRRA 4U00A 2UUAB 2BJHA 2X3AA 3GRBA 4HKJA 3QFRA 4NQEB 3OU6A 3NJLA 3U25A 1XGQA 4FJ6A 4FNTA 4JFPB 3UAJD 3ULVD 1ZUNB 1N64L 3RFXA 4HBQA 3NDBB 3GUCA 4LDOB 3BTUA 5IM4F 3ORYA 3S2ZA 5IZCA 1HQ4B 3A9WA 5JSYA 1G6OA 2YD3A 4FNMA 2G25A 3T95A 3MRHB 2E3VA 1A1OB 1GQQA 1OE0A 5HSGA 5IVXA 4UHCA 1DJLA 4BVHA 1ZDQA 2QN8A 3PGDA 4ANXA 2VQUA 5C3LD 3PFFA 3CTMA 4BB6A 4G0QA 3GJTA 3I5AA 1D5XA 4NCJA 5E2UH 3WFDH 3PPVA 4R40A 3WMWA 2XG5B 1ZW6A 1NZJA 3SYMA 3WS7A 1C29B 5DFTA 1N26A 5E1QA 4WZAA 3UV6A 1R8SA 2O5CA 1W6RA 1DKOA 3GLEA 4GT0A 3KM0A 2XCMC 4PVLA 3O31A 2JCBA 2RHDA 4IWXA 4YHLL 3BW9B 1U3HD 8ABPA 4YR6B 5KJRH 3S37H 1W7AA 4PJ7A 3DV6A 4Q12A 1OB1A 3L17A 3Q11A 1XGUA 1EFTA 4M1EA 3O8DA 3MPOA 4P0QB 1U3GA 4KU4A 4GS7B 4YUWA 4XX1G 3NP7A 4RIEA 1RVDA 1KGYE 4OBXA 1PZDA 3FONA 3VPFA 2ZBDA 1U95B 2OCYC 4QT4A 4MXWL 2R68A 3GZPA 3NYIA 2QL9A 1CX9B 2BGKA 1C30A 1IC4L 2IQIA 4CXMA 3IMSA 5LXGL 2J9FA 3TZLA 3AVUA 4F8JA 2D3JA 1FTSA 3AZOA 4EHHA 4KJPC 1LP9A 5GGTH 4OP3A 1I1HA 3AHJA 3OECA 3V4VH 4AJKA 4PI2A 3UMRA 4GRLB 4MX7A 2FLVA 2F00A 1CY6A 1YFJA 3ZTNL 2OWEA 3RC3A 2VSKB 4ETIA 3REFA 4PWFA 3DYIA 3I1FA 1J0ZA 3H7BA 2DHDA 1B3RA 2FW9A 2YJTD 4JFZH 3U7QB 1A7UA 1I01A 1KENH 1ASQA 3Q3VA 3K6FA 3ASWA 1K85A 2CNKA 3G88A 4NFSA 1TB4A 2HLFD 3FUJA 2BGJA 2Y9RT 2IPXA 1HKFA 3S1AB 1KMMA 4CETA 3R09A 1DEXA 4BLUA 1JDJA 4RA9A 2O6PA 2VDKB 1ULUA 1R5WA 2YHIA 5D71L 4EVNA 3NP3A 2VF4X 1QATA 1AZVA 1ZL0A 5BO0D 4NIMA 1YFLA 2XN2A 2ITCA 1AB6A 4RZUA 4JVNA 3KPVA 1U41A 4WGKA 5DC2A 3QZNA 3I50H 4OGXH 3WRXC 1UZLA 1UPUA 2AMFA 2FHSA 4KQ6A 5D1QE 2OFOA 4B47A 2IU0A 3L1IA 1OAZL 4XPHH 4TPRH 3WNBA 1QUNA 2V5SA 3ABZA 3WK5A 1FNDA 5F0JB 3OAZK 7FABH 3B9AA 3MLTA 1I9IH 4JFDE 1AO3A 4J3SA 1ZBDA 2YVLA 2PD4A 1IAOA 4LCWE 2R6CA 1JYWA 2YZMA 4X9XA 1WMEA 5EUOA 1BZ7A 2XTLA 1Q0ZA 3TE7A 2K9UA 2AQKA 2PCLA 1DP4A 2ADFA 4PBRA 4HDIB 3MWFA 5FOQA 3EOTL 3MCTA 4M49A 2XZPA 1A9VA 2O3RA 4HGWA 3LBFA 5IC6A 4F56A 3QHPA 2D0IA 3MN1A 2Q45A 1P9NA 3CHYA 3G6DL 5BO1H 2XD4A 8FABA 3DQPA 2NU9A 4LQFH 4LY9A 2UWEB 5LJIA 1QO0A 3KELA 2P8PA 1JZEA 2EZTA 3UICA 2I7OA 3B51X 5ADHA 1T0NB 3LD8C 2OZKA 3GP5A 4JHBA 1S4IA 3BE4A 4DUVA 2JGAA 4L5YA 5G0UA 2ZX9A 4ODUA 5EU3B 2WRZA 4YDSA 3CXHK 1VXRA 1IDOA 3G5ZA 2HPVA 3KZMA 2IXQB 3SBRA 2Y3IA 2QJOA 5CX4A 3WLPA 3QK0A 1JG7A 1EE2A 5EFIB 4CVXA 1INLA 4H8QA 1OJLA 4S35A 3N2YA 3AILA 2J41A 1MWAB 2OZEA 3EYWA 3HA5A 1IRAY 2NP6A 3LNHA 1ZHLB 4YZWA 2M98A 3SF8A 2C8NA 3STZA 2JFOA 2PZBA 2YZ1A 4P9HL 1DBMH 3R40A 1P4JA 1SAYA 3BT0A 4Q1BA 4K9OA 1AMYA 3GSRB 4DPRA 5K5EA 5L8KB 1JAXA 1BKDR 5B7GA 2W8ZA 2ZOKA 1AUVA 3WXBA 1P5JA 1E1QD 3PL1A 3E3QE 4HQRA 3KFLA 4X7TB 3L8ZA 2P5SA 2BOCB 1DGQA 4IRMA 4ROSA 3EGXB 1XK7A 4W9NC 2ZKYA 1D4FA 2VISB 4NN7C 3L9WA 1U1IA 1DAHA 2ROXA 4WUKH 2PCPB 3HC0A 3FVVA 4MB2A 3WUWA 3FRHA 2V17L 3ENKA 4YFVA 5IHUL 3DTUB 4K1XA 2J6WA 4I4TB 1DJXA 3IVAA 3GLHE 4LSGA 4ZC8A 5BUQA 5LUMA 1CUUA 3IN2A 3WFBH 5ERYA 5I30L 1ML3A 3RODA 4D0SA 2VP4A 4OFYA 3KMDA 1GN8A 3CLKA 4X2UA 2EJWA 1S9XB 3C60A 5DH9A 4LASH 1E7YA 4MAMA 3TEXA 1ZN9A 3GEHA 3GZNA 2JLAA 3MRSA 2HQRA 4G9FB 1GVHA 2BPBA 2BE9A 3MCAA 3U26A 3BIBX 2JFBA 3FB4A 3D50A 3FOWA 5L2KE 3W0WA 3WLJA 2DIJA 3DO8A 5KVFE 1BVNT 2P3SA 4NNXB 4HD9A 1AVTA 1K9VF 1AP2B 3RDTD 4NARA 2EE6A 1CYWA 4JFEB 3EISA 2JFCA 2FKNA 2YHSA 1YEDB 1YRQA 2NXYC 1ZMBA 4FG6C 5AOVA 1ACYL 4W68A 4FXKC 4APQB 4W5NA 5FO2A 3S35L 1TAHA 3PNSA 4AM0A 3HG1A 1XGRB 5JARA 3ZTWA 5BRZD 3VSUA 5A2JH 4XR8C 2N1TE 4OUUA 4DV3B 1SU7A 4PWKA 2J5WA 4L8LA 5ESVB 1MAVA 3I6SA 4F60A 3A4EA 2C42A 4KSYA 3UTZB 5AK4A 2PXHA 1ZOXA 4EHAA 4Y2XA 4A0QA 4J28A 4M6MH 5ANME 1VE5A 4HY3A 5KI6A 3FETA 3OOYA 3OPZL 4L4VD 2G71A 2IYFA 4A66A 4P5TA 4DOHE 3ZGIA 1J12A 1U9ZA 2DMBA 1J2UA 3HVJA 1BDHA 2FHPA 1T36A 1EXHA 5E4FA 1DQMH 3NHKA 3DEKA 4KKLD 3UGXA 5IDYA 4FT4A 1ISPA 1AD0A 3DZ8A 3MBED 4FG2A 4L85A 4YV2A 4LHYA 3MINB 3EXG1 2HRQA 5MP6H 3H8SA 4MRPA 1Z2AA 3TCTA 3GHYA 4H8WH 3HC3H 4Y5XB 1FDWA 1GPWB 3CN1A 4RZQA 3TGWA 3G23A 1F8TH 4BLQA 1HE5A 1UOPA 3H65A 4JHZA 4X5WB 1TJYA 1FJXA 1YQEA 2BMDA 1P5UC 2OAGA 3RJDA 1DC5A 1XCPA 5IYZA 1TIPA 1XTSA 5IP5A 1OREA 1MH9A 3M82A 3G2NA 5KOJB 3IS0X 1VB3A 3BGOS 4Y30A 4OHXA 2C9UA 1EM6A 3SYQA 2QHLA 1HHGA 3B6IA 3IOCA 3V7YA 2HEIA 2D2XA 1WCQA 3VXPA 2AI2A 3CC1A 4X0KB 2CLRB 3DOHA 4K6HA 1RZ7H 3G9AB 4WI5A 1RU3A 4NUJA 2XKBA 1I32A 2P40A 2WXMA 2G3MA 1DJGA 4AN4A 2HCBA 3RSGA 1PT7A 3AW8A 1A7NH 1N8NA 4GSKA 5KSBE 4O2CA 1E5VA 4PHHA 2P5EE 1TQCB 3ESPA 3OT1A 1TEGA 1OALA 1EEZB 3TX6A 5EJ6A 3THYB 4HL6A 1NJSA 1HYSC 4JU9A 1DQDH 4Q3OA 3W4IA 3MOBH 3SZMA 3UJPA 3FAXA 1LDMA 3ZL4L 3P0JA 2AS0A 3MYZA 4OM1H 3VISA 4BO4A 2QTTA 5EN2B 3KQLA 1CR9H 1ABFA 3QF7A 3DOSB 3VR1A 4O5LL 3WN6A 4PG4A 1Y3HA 3UENA 2KKQA 2BGGA 1E1RA 4JDPA 1JTPA 2YZ2A 3SOPA 3IIMA 1W8NA 1P7WA 1KIUB 1X5XA 5G1PA 4B6RA 2P6MA 5TH2A 1W48A 3PQFA 3F2VA 3GSQB 3U7GA 3BL8A 1KEEA 1XGPA 2AJCA 3A6DA 3WXVL 3GRVA 3RTCA 3FBGA 1N3NA 1NBZB 1V7CA 1SUBA 4LLDB 3L01A 1L4BA 4DKTA 2XB2A 2HXSA 4BH8A 3LB6C 1FXSA 4MLDA 1N7ML 4RFOH 4GXFA 4XCNB 2G06A 5B3JC 2WQSA 2HSZA 1ZD5A 1YK0A 3W2GA 2GBUA 3RVMA 1S46A 2GOYA 4N4YB 2VCEA 5F9JA 3UN1A 1AGEB 1ESNA 3DGEC 5U9CA 1YVEI 1DQLH 4MD0A 2AJVH 2VE6B 5HHOE 3PXAA 5K39A 1G5TA 2GD1O 2XWJB 1DLHA 4DV4B 4FOLA 3ZZ0A 3B3FA 2QT1A 2XWQA 3CPHA 3O2JA 1GDTA 1KQPA 1HDOA 2MSNA 4YP0A 3UFBA 3AINA 3N7AA 1MQSA 4RQTA 4MMXC 2X7JA 5IM5A 3L8HA 3QVKA 2E7HA 3TCXB 2AG1A 1E8YA 1WTLA 2GEFA 4OEHA 3IR6A 5JWOA 2QSYA 3B7YA 4TSKA 2WOBA 5MEOA 2XVGA 2NOAA 1RYEA 1KBGL 4A3SA 4KVNL 3GB7B 5AW6B 4NOKA 2Q87A 3TJZA 5F1IB 5H94B 1E4VA 1F8UA 3Q9QA 1D07A 4TWZA 2G08A 1ZK5A 2GCPA 1Y8AA 5I9LA 3FR7A 2GSWA 2IBZY 4FFZA 4PEEA 4O2BA 2Z2KA 3BUQA 3F7PC 2IPAB 3RNQB 4I88A 3TMKA 1A0OA 3BKCL 2LVEA 1IAIL 5C7YA 3U0WH 1U8KB 3G17A 2C3OA 2QNRA 1AFVH 4KDFA 2ADGA 1QFWI 3U3MA 3EZ7A 2ENJA 1KPRB 4TSAL 1HT6A 4RLQA 2J5BA 1BIIB 3CQQA 3CUPB 1UXIA 1BLIA 3QJHA 2JV6A 3FZNA 2AMYA 3DAFA 4B4DA 5EPOA 3LY5A 1P1IA 4GQ9H 2R9HD 1O9GA 4TVKA 1EK5A 4AM0Q 1V2HE 4WXRA 4L2YA 4OFVA 5JHDE 1XTUA 4D9QD 4MJID 4MKRA 1BX0A 4NONA 1NVWQ 5IR1B 3RVQA 4DCMA 1CLVA 5D7SL 4YAGA 5FYKL 2Q8BH 4HS6A 3V4VB 2BSBA 1OB2A 3ZRSA 1I0LA 3DEYX 1FL6A 3TNFA 3V8RA 2JFQA 4M1DH 4GPAA 2VZLA 2OL3H 1WB6A 1WCV1 2MR5A 1MORA 3DHPA 3L3GA 5IJ0A 4Z0BL 3HB9A 1LGYA 3O6VA 4FQIH 1WQ3A 3BKJL 4L7VA 1GLVA 3S7GA 1SBQA 3R5XA 1LEGB 2OBBA 4PU0A 3K9CA 4TYPA 1MUJA 3T71A 3W3AA 1TMCB 1O0VA 1E9SA 2ZPTX 1QYGL 3V1YA 2VR7A 2YKLL 4QF1A 3TX2A 1AZWA 4OSUL 2FZ5A 1EBPA 3PX3A 4AICA 5IROD 4FCVA 4OHFA 3J7AC 4RVHA 1DAIA 3DUWA 2C83A 1E3FA 3OHMB 2F9FA 2UVDA 1YN7B 3VSEA 1NMBH 1ZJBA 3Q88A 3HDGA 1T91A 1HL3A 3SBPA 2HRBA 1M4KA 2FJFB 5LAXA 2IVZA 4FQ8A 1GGBH 3M4NA 2OM6A 1XX6A 1B6TA 1RXWA 1MJ7L 1DO2A 4J2QA 1XZQA 5D6DC 5DD6B 3SEZA 4FNLH 4X1IA 1OLUB 5F89A 1ECPA 1R4MA 4KX9A 5E4TA 1KWKA 1OH5A 5HILA 2RJNA 3VDCA 3PVCA 4OAOA 1GM5A 1Y3BE 4YX2L 3ZE1F 3ZH9B 1S7QA 1A4RA 3CFEA 2ZSWA 3NDJA 4BMSA 3ADOA 5C0BA 3SQOL 4A6EA 3HLKA 1P69B 4DGWC 2E55A 4NL4H 1YF3A 3O3MB 2XOKD 3V7NA 1M1XB 2PNDA 2X8WA 5BQFA 5EZSA 2WB2A 1L7BA 1NKTA 4E41D 2F7IA 4U8GA 1N5YL 1V41E 3U4QB 2J2ZA 1W88B 2QGDA 4K73A 1FZOA 1K8DA 3ZWDA 1S7SA 5B6PA 4XQEA 1YUKB 2ROQA 5H4GA 2QQ5A 1LRJA 1B8VA 4P4SB 3ROXA 1FHGA 5HYQB 5IJVB 4IILA 4DKFH 3VGPA 4MWGA 1H94A 1R3KA 4JYPA 4JANB 3D18A 1JG6A 2F1HA 1ZAYA 5DJCB 3PUKA 2LTAA 2CXHA 4B7XA 2DT8A 5ILGA 3HR6A 1FP7A 3IQZA 3MUEA 1YMHB 3N1PC 3UTTE 2E37A 4TNVF 5C7XH 1RHQA 2R8EA 4ZVQA 2O8BB 4R8VA 4B4UA 1IBSA 4D0RA 2CBOA 3QQ3A 1X80A 3EH2A 2V9RA 4IIUA 3PIDA 1A9YA 3GSOB 5J9FA 1HHHB 4CM6A 2G9VA 2WYZA 3NJVA 2J5KA 3VFMA 4FFWD 3VPAA 4Y19D 4AIZB 4RSYA 4AQ8C 3KUDA 3W77A 3D7RA 1LV8A 3L2LA 4U5QA 1TJHH 1N2IA 1LK3L 3VGHA 1P18A 3R7DA 4BO7A 5EZJB 4ECAA 3HG3A 4BNLA 1MFBL 3KPMA 3VCLA 2I8CA 3E8XA 5I4CA 3BAEH 3QIUD 2Z6FA 5L9DL 5FKAB 4RETB 1DLIA 3O47A 3ARBB 3I6LD 6REQA 5FWYB 4OI8A 2Y0DA 1WBXB 2CK0L 2QX4A 3C5ZD 4WA7A 3TFQA 4NCAA 3ONFA 4RU1A 4A2FA 2EIXA 2UUCB 2XEDA 2DOCA 2YBRA 2IYNA 4WWOA 1LO4H 3LQAH 1KYUA 4XCYB 5DMGC 4MASA 5B58C 5LGKA 2FPWA 4BO6A 5EHGA 1FO0A 4EJ2A 1PL7A 1GGTA 5JORA 4LSZA 3O6LH 5AOBA 1A1MB 4H1UA 4K55A 2QEQA 5KBKA 1VXOA 3JAKA 4AX4A 3PPWA 4BKUA 2BOVA 1N32B 1U0LA 1HSBB 3BEVA 1S3IA 2EJTA 3L0YA 3ZZMA 1TTQB 1DN2A 4FABH 1IXRC 3KV1A 5EP4A 4Q4CA 3IT1A 4B33A 4OFIA 3QUXB 4PJIA 4QBHA 4URXR 4C4ZA 1OW3B 4N1CA 1ZGLM 3GLFE 4E9LA 1ZKMA 2FP4A 3QBJA 3HBPA 4RUKA 1LDSA 1U7XA 2YKGA 1QKZL 2GZSA 1MEXL 4MQEA 3K2UL 1V26A 4JYZA 1MJUH 4MS6A 2GM5A 2I4IA 1B0IA 2PLRA 1LK0A 3GXDA 4J3NA 4QUOA 5ICZA 2TSYB 4Q3EA 3VTKA 1OAKL 1QBML 4OQPA 4JI1B 2V3DA 1GL4B 5KVVA 1YDEA 2FRXA 2PMFA 4JGUA 4NIKB 3PQEA 2JFVA 4TS9A 5B58T 1DL5A 4ZOCA 2X1WL 5JAPA 3PAYA 1X4YA 1MVLA 3S96A 3CFKB 4TRPL 4IUCS 1T80A 1L8AA 2EZ0C 5E00B 3G6AA 1TE2A 5CCHE 3QJTB 4WTWA 1QEWA 4BLWA 2CIKB 3FBWA 1TTTA 1NM5C 4NZ8A 1O6TA 7PCYA 2R4SL 3J7HA 4RMVA 1JEAA 5AO9A 2A5DA 2O30A 3VG9B 1E8MA 3EZXA 4NKIL 1L9MA 4R4BB 2EG9A 1YZFA 2GBPA 2ERJC 4TQIA 2Y72A 4DGIL 2YD0A 2MEJB 4AUNA 3FKJA 1E94E 4KAFA 2B5OA 4Q4EA 4JVOA 5DU7A 2X0KA 3OJMB 4D3XA 2R79A 3NZHH 5FGBA 3H5OA 2IOIA 2OKMA 3HGMA 3QA9A 4LJSA 4U6TA 4HEMA 4OHBA 2G6TA 4M93B 4H7IA 4CTKA 1K2WA 2EAEA 3CH5A 1G16A 4LKOA 3ZI0A 3U6XS 5KN5B 2XSZA 1UA7A 4RH0A 4DREA 4OB6A 2WY3B 2DXIA 2LAGB 1OXKB 5A3QA 2Y0EA 5B4MD 1QIGA 1S3GA 1XRPA 3PYXA 1M75A 3L7MA 2NY2D 1RIHL 4G0NA 3UK1A 4P3XA 1NUDA 4Z3TA 4CG1A 3KH3A 4OHRA 1KXHA 3HHSA 4ENEC 5DK2B 1ULZA 5EULV 5BOZG 1VSUA 4B45A 3EAKA 1K0UA 1QGZA 2BP3A 3C8ZA 3BLBA 3SQMA 1WC7B 3HKCA 2BRRL 3CH1B 4CL2A 3BSGA 3T1TA 2VP0A 3IQHX 3S34L 3UATA 5JO9A 3ZY3A 2FNAA 3VYWA 4ZI5A 4F6LA 4WH0A 1T3SA 1FE8A 2CCWA 4H4NA 1ZC3A 1ZN2A 1D5IL 2UYCA 1FFWA 1Q1PA 2AZAA 5JZ7D 3ENEA 2O0LA 4HC1L 1EVKA 3UZQB 4Z3GA 5KWJA 1EFRD 2YRXA 3Q2LA 2J5LB 2ZXQA 4WSGA 2Z8VC 4GRDA 1NFDE 5JXGA 4E1AA 1GO2A 4HDNA 3U4KA 2IFGA 1M8PA 2FW1A 3D7MA 1GG2A 4DWOA 4B6PA 3KLLA 3S8YA 1IUNA 4LXGA 2AHOA 1I9JH 1D1SA 5ER9A 1J8YF 1Z5PA 4DUPA 2O23A 4BJ6A 3OLIA 1NN3A 3DBIA 3PA6A 4XOUA 4JBSA 4OKIA 3WJMB 3GDFA 4HQ6A 5F9OH 3ZE7A 1JPGA 2LPMA 1MX1A 4B0MM 2V7BA 3ZHCA 4HULB 3QDJE 5ADOL 5TJWK 1EXGA 3EGIA 4U2KA 3BGFC 3LT4A 1TEFA 4Y1SA 2VFAA 2KSQA 4DGVL 4B9CA 3JSAA 1SUSA 1EDHA 1NCDL 2FF7A 2RJMA 3CEPB 2ANBA 4JLKA 3EO0A 3CNOA 1W0CA 3RSZA 4U1JA 1UBKS 4B76A 2ITEA 3HE7A 2BBOA 1K8QA 4JL2A 1JLMA 4XWKA 1PL6A 3CZMA 5IT2L 1WZ2A 1VP3A 3TSYA 3K8MA 2B30A 4PYOA 1NGYB 2FE4A 1L5VA 2BEVA 4PJBF 1JSCA 2VSOA 3N0VA 5EE1A 1LV7A 4WXHA 2P4QA 3OQRA 2Z92B 2P2ZA 4GZ5A 1JWMA 4WWKD 2WVAA 3SZKC 1AYRA 2H2AA 2L7JA 4UULA 2BSDA 1FH5H 2EYSA 4DTCA 3KPQB 3U4AA 4PQRA 4UM8A 4HKBB 3FDFA 4CSTA 5I0WA 1MG3C 3QIBA 4HATA 1U6AL 5KAMA 4Y5YA 2CIIA 2BGIA 2HWWA 2Q1WA 3BGWA 2AFIE 2FB4L 1PYOA 2HLPA 3E3OA 3ZVRA 4JE0A 1NAMA 1UEMA 4HCIA 4LP8A 1TFRA 2DX7A 1SBSL 2JGNA 2CL5A 4TKMA 4TSRA 3AV3A 5C46F 4JQXA 2V2XB 2EADA 1WHSB 1DT3A 4YY3B 3FT3A 5JNLA 5E6UA 1PR6A 1V5GA 3K2EA 5ACMA 1KSRA 1WPQA 2WZBA 1JV5A 3DZJA 2CPCA 2DOKA 4AECA 5M04A 3DIDA 3SCMB 1ZNWA 5LP6A 2ONJA 2VR4A 4HDKA 4PPFA 4MHHI 4P46A 4ANFA 2B1IA 4H25A 1O58A 1DEEB 3IAXA 4G0XA 1HT2E 3SQOA 5FRDA 1IN7A 3LLSA 3KPRE 3O8BA 1JZJA 1LDNA 3UGJA 2C2MA 2IG2L 2P5WD 1CDGA 1WMFA 4K5QA 5JAIA 2BPOA 3G6KA 5CF3A 3DDHA 4ML3A 3N9IA 2OL3B 3MROB 4U4IA 2IIVA 2XODA 4R51A 1VLXA 3DONA 1V43A 1Q0HA 4ZP1A 1EIZA 3ENNA 1N77A 1Y18B 1GL9B 4QYIB 2XQ0A 5KMGB 4FS0A 3H6AA 3WJ2A 2A9FA 1IAMA 4HWSA 1GC1L 4MS1A 5TF4A 4B9PA 4X5XB 2QVTA 4OQZA 5CEZH 2IYAA 2HA6A 4ELMB 1K4CA 3V0VA 1YPZB 1YV9A 3JQ9C 4JOQA 4LOLA 1Y1DA 5C18A 3QULB 1VB5A 4FHDA 1HE4A 1T3LA 4IRSC 1TUEA 3GN1A 5EF3A 5DQ9B 4BQ6A 4NZUL 2OMXA 1SVBA 4IX9A 4X6CB 1ZIXA 3VFNA 1WZKA 5SWQB 4DSNA 3E6FB 2YY5A 2H4EA 3HZMB 3BHMA 3OKPA 1S7XB 5IUCA 3IVKA 5EC2B 5DNCA 4HDSA 5AIAA 3UK6A 4XBEL 3WLKX 1ET8A 3B9PA 1Y9JA 5IMSA 4EELA 4YYEA 3OT5A 4B2PA 3VGAB 4DQAA 1MCWW 1DXYA 1AACA 1OE1A 1RAGA 2R0ZL 4BINA 3IKLA 5CDFE 5AHKA 1OH6A 3K9WA 5F7NC 1L9RA 3C2AH 3RPIA 3MWEB 1PVHA 4F3KA 2WQ8A 4FYQA 3PU7A 2QYSA 4ZDIA 5AMXA 4FR0A 2R2GA 3RBZA 3VYNA 3VYUB 4M02A 2P90A 4ER5A 4NNOA 1BVLA 4XXHA 1BE6A 2IZOA 5KQPA 5K8LA 3JVUA 4JKMA 4MGKR 2CLOB 3V0DA 1G6RL 4IXTA 3DMMD 2XR1A 4DZ8B 4OAWB 1ZAKA 3AU9A 5WRFA 1CLZH 2ZIWB 1Z0SA 1NNI1 3SE3A 4N2IA 1BDJA 5HJEA 4NMLA 4PGCB 3PSAA 3D09A 4EQZA 2SCUB 4Y4FB 3DEIA 2ONZA 3P26A 2V7EA 1JF6A 4RV5A 4DZRA 2WO2B 1UKTA 1ZD1A 4LGCA 5ERGB 2EE9A 4H77A 2GN0A 3K1DA 2GXQA 3EG9B 4YXKH 1TFUA 2NYZA 3ULUE 1IBRA 3WTTA 5I73B 2ZB7A 2R00A 4HZUA 3NKVA 3K4QA 1KB9K 3QQPA 4JPWH 1MBZA 1QS0B 1E8WA 2CMGA 4KV5E 2OCKA 3ZCXA 5EN4A 3KJXA 3LLCA 1RSZA 3ND5A 3QP9A 1BVKA 1ZLEA 3OUUA 1VDGA 4UCFA 3OM9A 1ZH4A 2Y69B 1L4HA 2ESVB 3RFZA 4BNKA 2BNRD 4JX0A 1G43A 1U8JB 2P6PA 1IGCH 1KYIA 1MFZA 4B31A 3DX9A 5AXBA 1M34B 4WTXA 4PGAA 2R97A 3SFVA 4EWLA 4BO8A 3H5NA 2CYBA 3HG2A 1P44A 4BVGA 1W0WA 1T6BX 4JY7A 4JW3A 1Q0SA 2JVUA 3AXIA 3KHKA 3D5OF 3RVLA 4GD3Q 4R26L 2XKAA 1AHNA 4M9QA 3BDYH 5CGQB 3II1A 4MRMB 5IVIA 4ZREA 5E8EA 1R0WA 3SR3A 1YO4A 1NQBA 4CC1A 4OKNA 4KIUA 2ZE8A 1C1YA 5CVDA 2XYQA 3HU1A 3C3AA 1CGUA 1PW5A 3JQAA 1DKMA 5CCEA 1WBZA 1XZAA 3JWOC 5FF9A 3QYPA 3II3A 1I7RB 3FQWB 1F6DA 2J7KA 3L0OA 2ZTSA 2ZUDA 3UAYA 2ICEA 3BH8B 2XWBA 3OPYB 3B1UA 2GF0A 2C94A 2QRGA 1A9OA 4L5CA 2AXFA 1OZFA 1AQYA 3OOHA 3GNTA 2A7BA 3AMKA 5D55A 4JQIL 1DVFC 4NO0D 4DRXA 2BKVA 4UMGA 1OX5A 1DKLA 4HGRA 1ZGLB 3PB3A 3B83A 5GZOA 3Q4GA 1PZEA 4UEWA 4XEUA 5CFLA 3CF4G 3GBMH 1YNKL 2TMDA 2SODB 4AJNA 2ECOA 2WTMA 3BT2H 3SU8A 5C8DA 5EZIL 4D8PA 1Y7PA 4BA8A 2JAHA 2DAPA 2ZNXA 5DEFB 1D2CA 4K9KA 1C0IA 5GS1B 4P3DA 5C07B 1CC3A 3KB6A 1R8QA 3E9UA 2ILVA 2CZNA 4KK8C 5L40A 1KJIA 1BX2A 5FUVA 2QZ4A 4B3FX 621PA 1QP1A 2FWJA 1E9AA 3GGCA 4MYCA 1P9MC 5SWSD 5FUWA 4PJGB 4CDGA 5EA2A 5ABDE 2FLBT 1MELA 2QMHA 5KJ6A 1LVGA 5CJXA 4P23D 3TPUB 3BEWA 1FSZA 1GRQA 1H3WM 3ZDZF 1D2OA 3DCYA 3PD7A 3SE8L 5IB2B 4XPAL 4D8TA 1W72L 5FUOL 4B82A 1W5EA 4TMPA 1JI0A 2WY2D 2UZYB 4LK4A 1RIFA 2FSFA 4DNQA 4YP7A 1SVIA 1AV6A 1TVEA 3QQ5A 2QPAA 4J4BA 2F48A 3AJ7A 4ND7A 5D6NA 4MZDA 2F08A 4YWHA 2C4TA 1BQ5A 4U1IB 4C7MA 2EEDA 4YIHA 4QE3A 2RALA 3SPJA 2C3VB 1NW8A 4GL4A 4A37A 2VAPA 2CLSA 5ES4B 1HL9A 5ENVA 3WYFA 2AX3A 2WAYA 2JAQA 2ZZKA 5BS0B 3QRGL 4WI1A 5AVJA 4NWTL 1F9EA 3OJ0A 1OARL 2PNJA 1KAQA 4KDWA 5KANI 3RIXA 1FIEA 3TSCA 1UPXA 4ZFOA 1ZU5A 5HKKD 5CINH 3OKDB 1PG0A 3GFGA 4PQEA 2FUCA 4M1MA 3VI3B 2LZ0A 4ZDKA 2ISCA 5ALKA 1MX9A 4XLTA 2MNUA 2HA5A 1H1LB 1I1AD 3BN9D 1T24A 4MXDA 4YN3A 4GX5A 1IXYA 2ZBUA 2O1XA 4W9CC 3CX2A 5DWQA 3WGYA 4FFYA 1D6SA 1XMQB 1IZ9A 2WD7B 3NT0A 1WVIA 1WU7A 3PGJA 3DMGA 3RRJA 3ITDA 1PEDA 1MO2A 4PY2A 4J16A 3WHIA 3GRYA 3VXSD 2OYSA 4IU3A 3IVXA 2LE9A 3E81A 1GHFH 4P49A 5ANRB 2IGFH 1ZLVK 3FKSA 1R3DA 2JI7A 1NLBL 2UX6A 3MKKA 2NX5D 4DEVA 2PCXA 4KLAA 4GSDH 1DWPA 2QM3A 2WUVA 4OZ4A 3HBQA 3M7FB 4P1ZA 1P6WA 2H4HA 1ARZA 5FA4A 3I6ZA 1BJMA 2XPYA 3TN0C 3FYDA 4HOZA 5HE9A 2XY1A 3PDWA 4XCVA 4JFYB 5NLLA 4KNTA 5B8CC 2FSHA 1T8WA 3F78A 1HTWA 4YHNB 1X94A 2AJUL 1TCBA 3K1TA 3F7YB 5EU5B 3OD5A 5FYDA 3UIYA 5ILTH 4FYVA 4HK0A 1A6ZB 2A1UA 4LIQE 4N2LA 2X2OA 1JEQA 4IOMA 3SM3A 2PO6C 4QPZA 2XRZA 2FL5A 3QWNA 3M5PA 3HYLA 5JLAA 4CV1A 3DTVA 1K06A 1DJSA 4JCOA 4LGSB 1RYFA 4EI0A 5CT9A 4ASUA 2I87A 2Y36L 5LP1A 3BYYA 5HFAA 3N7TA 1P1JA 3MRPB 3RX8A 4IDFA 5FNVA 5A6VA 5BVHA 2RKOA 5H9VA 5DDHB 2C5BA 1PFCA 4M03A 1FL3A 1XTRA 5JISA 4PC1A 4Y2DD 3QDGB 4C56E 2VMFA 3R7RA 3CRVA 2AN9A 3JV7A 4L08A 3B2MA 3M6WA 2R6ZA 1LVEA 2IIJA 3WLRA 4BNUA 4EN2A 5IKXA 1VFAB 4ENWA 3W06A 3AG3B 3QWBA 1G19A 1SPDA 3LKOB 4NQCB 2QWXA 4MRAA 4AWAA 1M7UA 4MRSA 2JA1A 1KY5A 2XZQL 3EH4B 1T1WA 3INNA 3RC9A 1NTRA 1QYCA 3DR3A 4NJ9L 3MFFB 2O7VA 2IY8A 1CPUA 3RHWF 3G6JA 2QSJA 1N4XH 1E7WA 2A9NH 4CCYA 5J4LA 3K6RA 2VWHA 5HGDA 3CUTA 1FFPB 2A4ZA 1I8IB 1ACLA 4JNKA 2H32H 2NNRA 2PV0A 3IC5A 4CTJA 3GJ4A 4YRRA 3IRUA 3Q7SA 2E4UA 4KKPA 1R16A 2DJMA 3GXPA 2WZ6A 4FFBA 2VJNA 4HW6A 5IG2A 5K4GA 3NJRA 3LL7A 1UOQA 3RWCA 3HUJA 4H6XA 2EKDA 5CD3B 5KS9F 2I3GA 4FKZA 1AO0A 2HJWA 1BWSA 3TGXA 3MRMB 1Y6MR 1CP2A 1YI0A 2M6LA 1R7RA 2VSDA 1AI1L 3G49A 2CVHA 4ZAWA 3B5GA 2YPKB 4R5TA 3VSDA 2EGGA 1SBNE 4UUJA 3A6KA 3UTQB 3ZGLA 3MJTA 2JL1A 5EU7C 2IHYA 3I9OA 2XIBA 2QENA 2QL7A 1CGWA 4IOSD 4WOBA 2WSYB 2VSFA 4BNJA 2ED9A 1EVEA 1VHPA 3OU2A 2EW2A 3RKUA 5KVDH 4JYMA 2IPNA 4F8PA 1CYEA 1ZP6A 4QIRA 2O5NA 7GPBA 5DO2C 4Y2UA 1PQUA 3BFQG 4GRWF 1G7MB 1O6GA 1D8AA 4IQGA 2YPVL 3PWPB 4JFQA 5GIRB 4BFBD 2RONA 3AUXA 4OV5A 1RP1A 2PM8A 1WKBA 5JNYA 3A26A 4X8HA 2Q7NA 2ZAOA 3WDIA 1YJCA 3O2NA 4AJIA 3TK1A 4N3CA 1HKLH 1LXCA 1AKJB 3WO4B 4U2EA 3QNYA 3CDGA 3CUVA 3QUKA 4XKJA 1XGZA 1R5NA 3GWGA 1UBTS 4HWBA 3ZRCC 3S8GB 4PE5B 1A3CA 1QP4A 1HUQA 2TRSB 3DLBA 1MIMH 4H08A 2E46A 2WA1A 3O8XD 2GEQA 2PX0A 2SKDA 1QFWL 2X8LA 5DDIP 2E27H 3Q10A 1XSOA 5FA8A 5EJ4A 1VE7A 1JBJA 3WB1A 4Q00A 1AQKH 4DGQA 3S3BB 3K81A 2XHEA 3C16C 2OLEA 3OZUA 5H37A 4ILEA 2X3CA 4QXTA 1E3EA 4GC5A 1V05A 4MNGA 821PA 1T21B 2R84A 1E4JA 1OK0A 4UU7A 1CY8A 3AI3A 2YJNA 4I4CA 2QVYX 3ZKND 3I53A 2PSFA 4H9GA 2YSTA 3HWRA 1QGUA 4XMTA 4ZS6C 4M8UA 3URKA 5BR1A 3PFHA 2WB4A 1BHGA 2Q76B 5JQGB 2BX5A 4U6VH 2GCNA 4PYRA 1NVTA 4F96A 4B09A 5L4IA 2IH8A 4L1HA 4EZEA 4P2RE 1EXUB 2ZT9C 2EJBA 2H1CA 3MJ8B 3ZT7A 3V6ZB 3DI3B 3GMPB 4I7EA 2AD1A 5H5JA 2HAEA 5GZ6A 3GMMB 1LWJA 5FNZA 3IFPA 3SKVA 4CTNA 4RVFA 3GXFA 3UX9B 1ZT4A 1CS4C 1N5IA 4JQIA 4HBGA 5JJLA 1GOHA 3A4AA 2C9MA 5L7YA 5KVSA 3TZVB 4P9ML 2IDJA 4Q3DA 4EA8A 1SZJG 3PTAA 2AV1B 1SYVB 3GMQA 2NZUG 1AKMA 5L3QA 3AAZA 5IK2A 4YUEL 4RTSA 2F61A 2E7LA 3IFNH 1Q0YH 3VDMA 4BWUA 1EAYA 4ONFH 4H26B 3VXNB 3V0AC 1E2GA 1Z2NX 4C01A 4PZLA 1KU6A 3EAGA 5AUMB 1QIKA 4TVOA 3WGQA 3NSJA 3ODGA 4Y2NA 4LLYA 2VL4A 3QJFB 2YXFA 4XNZC 4Z2AA 5B30A 1XEFA 4BQRA 3IDOA 3V0JA 1VDZA 3KEQA 2C5FA 3AUVA 3FFTA 1XZ8A 5AM4A 4RHEA 2YIJA 2BOLA 1E9CA 2QZPA 1ZM3A 4ND5A 2ZCKL 1IEVA 1FAKT 5CK4A 5T4FA 2JGKA 3WIBA 2Q50A 4NPHA 2JH3A 3O5AA 2CUIA 3QUBA 4BE5A 3QUMA 3MHTA 1A9PA 3SDXA 1IN8A 3KJFA 1ADGA 4BV1A 3NIDF 5EKDA 2VW7A 2QJFA 4BZ1L 3K4ZA 1N2CB 2CZQA 1H5BB 2I55A 4EZIA 1KVSA 3OTQA 4GPEA 4JM2A 2AVFA 3P0HA 4X4MA 3LC0A 3PQ7A 3ARZA 3FT2A 4P4KC 4W6ZA 3OOWA 3O3EA 3ZY7A 3HZVA 1AQUA 1RM3A 1P3JA 3HDYA 3A1TA 2W4IA 1M3SA 2V6JA 1SYSA 5TEVA 3LP8A 3PHCA 4TN9A 5EBMB 2VPYA 4JJFA 1A6WH 4PRBA 4LF7B 3LH9A 5C0CE 5AM0A 3A36A 4WUUD 5BMVF 3UT5A 5I8PA 1ZAGA 1KHHA 3QJYA 4JFUA 5LOVB 2CHWA 4OGQC 1E1QA 1J10A 1XQ6A 1NUFA 4BUGA 2ZXBA 1J42A 2R7LA 3A21A 4Y4KD 3O4LB 4LFHG 3RWGA 5IVDA 2YC1B 4MQLA 2XV0A 1P4HA 3DDOA 2GI7A 4LLVB 1NCCL 2F1AA 1XJWA 4LCCC 3JWPA 2X4RB 4CQMD 1G1OA 1M1YE 2XOXA 3AFIA 5H8WA 4PCUA 1G5GA 3FXIC 2OECA 3M70A 1P1HA 5FB8B 5I75B 3N1QC 3HC7A 1UODA 5FHQA 4FZ8H 3FBKA 4HP5A 1PQWA 4DFIA 3AKZA 3PREA 4P48A 3LT2A 1H3NA 5BR4A 1NDQA 2HCTA 2GS9A 1YUBA 3DSNB 3RY5A 3Q2KA 3Q5OA 5AT1A 1URLA 1UAGA 3AESA 4FYPA 1BDBA 4ZYWA 5CZRA 5EEZA 5B39B 3ITNA 3WP1B 3DFMA 1E5BA 2OULB 2VDNL 1KCVL 2VDKH 1BD3A 1CBUA 3TBCA 3PWUA 3KLHD 2OYKA 3MV9B 3A2NA 3H16A 1XIWD 3U1SH 2BFBA 4YCDA 3STWA 4YL4A 2V6IA 3UBGA 3TFKD 3CZ4A 3MLSL 2F5BH 2OXGA 1PZ3A 3H3BC 1XF4B 3TIDA 2AQQA 3VJLA 3V10A 4F8YA 1W44A 1V1RB 4TVSA 3CEHA 4OJEH 2XFGB 4LKCA 3U7FB 4I9FA 5EXXA 1HLGA 4ALAC 1XMXA 4QWWC 5BRZA 3H2BA 1GYQA 3H6KA 5AVRA 1EFVA 2PCJA 4LXTA 3HZ3A 3ROPA 4F3TA 1JQEA 3D81A 2FQWA 2J8UA 1PGNA 3K3PA 1AGNA 1IEAA 5SWZE 5FI5A 4LVOC 2QV0A 4FHFA 3SR0A 4B32A 1FVDA 2C4KA 4ZU3A 4YJDA 2UX7A 2GJZB 2Y07H 2DQHH 3OZ7A 2P3QA 3MWYW 1H2RS 2QL6A 4JR9H 1VKHA 2YC2C 1BN6A 5C0AD 2ZX8A 3V7AE 5IXSA 1A8IA 2PTHA 4HK3N 1XAGA 2BSAA 3KYBA 1HXMA 4RXTA 4L4VA 4Z7NF 4AP6A 1NRXA 1MQ9A 4P36A 3RV3A 1XMOB 5K3BA 1UD6A 3ZN6A 2JK1A 4MVJD 2FATL 3QG6B 3NJXA 1FIGL 1E6WA 1XQWA 1Z2DA 3AQ4A 3D4NA 1GHTA 4UZEA 3SEAA 4F6RB 3QI9D 1U5AA 1V3QE 1WE5A 5EZOL 4PLHA 1XNGA 4ZUTB 4HUUA 1XZKA 1KI1A 2EEBA 1FVCB 1XROA 1Z5LB 2QTBA 5GSRB 5JIPA 1GPKA 5HHME 4CRPA 1TK2A 4DVGA 1PQYA 4JUTA 4IVRA 1JR3E 4F9TA 4PWIA 2DDQL 2IDSA 5T1KA 4Z0HO 2WYVA 2J4WH 2NU8A 4N5ED 1HXYB 3M1YA 4UIKL 2HUHA 2XQIA 3FO1A 2J1KA 3FF8A 1GGNA 3TNNA 4FQ1H 2XAAA 4RDCA 2PZJA 2NY4D 1YU9A 5DNYB 4HMDA 3EARA 1DL7L 4GMKA 2QNIA 4JKPL 2NR6C 2PRYA 2Y1AA 4AW4A 2AC2A 4IU2A 1E6KA 4EGCB 2QN7A 5IUJC 1ODFA 3UH1A 4XP9L 2GTWB 2Q2NA 1P80A 4RYLA 4OFPA 5D7EA 1GU0A 1GQFA 2HYMA 2X86A 2QQLH 5E2JA 2IZ5A 4M8RA 3DIFA 4IVQA 3OJWA 1UB5B 3FWYA 2AZMA 5CNHA 2XV2A 1DANT 1ZLVH 5K8UA 1IVSA 2YASA 4GLJA 2ZJBA 2WYUA 3CA8A 4GUAA 2HF2A 2VLJE 1JSRA 2GSDA 5DM2A 5T1JA 4PZUA 3AERA 4ONGL 1G66A 3KJ6L 5JO0A 2CBXA 3GNML 4XE5B 2FOIA 3H55A 3NH7H 2JD0A 4MVCA 5CYOA 2H9GB 1UXJA 2ADFL 4RNRA 4F2DA 1VL8A 5EOQL 3W5HA 1OQOA 3GVXA 1GZQA 4DN4L 4U0RB 1TMOA 2VXYA 1KCLA 5K6AA 3QDAA 3QS3A 3TIEA 2YPVA 4MJLA 1MLCB 3JD1A 2EKSA 4KK5D 1SC6A 5ENWA 1N5LA 1WEHA 3RS4A 1B16A 5B3JE 3T06B 3TCKA 4FN5A 2ODBA 2PP7A 3TPFA 4XFDA 1W36B 3TASA 3ONNA 1VE6A 1PYGA 4OBBA 4QHUA 2UKDA 3QJXA 3RVWD 4CF5A 3FOZA 3D34A 4NHUA 1KZGB 5K0ZA 1C9YA 2B98A 1AGFB 3AONB 3CRRA 5T3ZD 4QREA 2K1MA 3WMGA 1G9MC 3UMFA 4C3ZA 5A4AA 2X3FA 1E1YA 3L9RB 5F3BB 2H32B 2WKSA 5LNGA 1R3JA 1HDMA 2OMBA 3HLAB 5DYOB 2AG5A 5I0DA 2Q4OA 2XUPA 2HBYA 4FXOA 5PCYA 3IUYA 3CLEL 4HGYA 3HR7A 4MQXD 4NENA 5ISZB 4M21A 4AUUA 1NN0A 4XO3A 1UMDB 2QKSA 1PKOA 3RWEB 3VMOA 2DQJL 1IGJB 4Q2ZB 2DH6A 4PHCA 1T9HA 1BM3L 3HFJA 1X70A 4UKDA 2QIOA 5CLJA 1EDZA 1GKYA 2FO1A 3CWQA 3V5DB 2B2NA 4ZEMA 4IG4A 3DXXA 3L5WB 1LNUA 3UEQA 1NIPA 3M9LA 1U0EA 3AHGA 4YK4B 3HC4H 3RTAA 5B21A 1OTHA 1R18A 3MWDA 3BD6A 1RT9A 2P0YA 1NLFA 4R9RA 3ESAA 1UWLA 1JYNA 3E9NA 1ADBA 1K4DB 3CPUA 5FTKA 4MUGA 4QVGA 1GZHB 5JMWA 3D4ZA 1WAAE 2QT9A 4JY5H 1HHKA 4PYIA 3ZNQA 1MNNA 3KE8A 2NW2A 5FDWB 4QHTA 2HT4D 1C8BA 4QPPA 3K4PA 2BSCA 1Y3CE 2OHJA 1VJTA 1Z34A 2ZIUB 4RTPA 2WXFA 5TE7L 3CU5A 4U4BA 4KTGA 3SDAB 1ZLSL 3TOPA 1G9XA 1V3UA 2PGLA 4BJLA 3OLDA 5DLMH 3JYOA 1ZD4A 1X7WB 2W81C 4H1LA 2O0MA 1QFYA 3QYFA 4NV0A 2QI9C 5IOPA 3FQYA 4UV7H 2FJUB 4BUHA 3QUQA 1ICIA 4AZVA 1NL0L 3D3VE 4DP1X 4R4JA 2B0JA 1XVIA 1M71A 3V6OA 1ADQA 1JNYA 2J21A 5FLEX 3FTEA 1XD2A 5DK3A 3E8MA 4XI5D 1NW9B 3DWEX 4Q4HB 3ZHZA 2HJFB 1OHQA 3AYZB 4YO8A 2QSCL 1L6IA 1UENA 2XX3A 1SR8A 4PJ8B 3C98A 2RC6A 4XYMA 2DBLH 3EIUA 5DEGB 2XE8A 4ESVA 4I08A 4ONOA 4YDIH 5D7LD 2X6UA 5H83A 1KLUA 1JGTA 4ZD3H 5EDSA 4YBLC 2J12B 1RR6A 3GTTA 1NVVR 3MEQA 3EPJA 3N44F 3U3ZA 1XCJA 2CXRA 2I24N 3CEJA 2XITA 1U33A 1T66C 4GMDA 1I8AA 3DE6X 1JZ2A 5JAOA 1PVDA 1MHEB 1S96A 2VZEA 5E1BA 1TZ8A 3AIIA 5IROA 2ZOSA 2XTSA 5DYWA 3A31A 3B6SB 2AH5A 3SFTA 2I9PA 3LLMA 5KYWB 2PZGA 3WKBA 3MRIA 3HCCA 5KJ7E 4HNAA 5CP7A 5EZPA 4WN3A 2WDZA 4RF3A 5KG9A 3BPSA 2Y2YA 1T89C 2BS8A 4PIRF 3M6IA 2H00A 3OB0K 5DI3A 3RI3A 1Y07A 1TKWA 3TRJA 1CEQA 5C6TL 2OORA 3VUEA 1RURH 3KPSB 4F2ME 4COKA 2DKNA 3V1LA 3KD2A 3TKAA 4G4GA 3DBXB 3ZJ5A 4RS3A 2CCLA 3VI4E 1FIUA 1RJYB 1BNCA 3I0NA 3ETLA 2AJZB 3VR6H 4GBGA 4BDVB 3FAKA 2CMHA 2WPNA 4Q18A 4HLUC 3IEPA 2HRPL 2YJLA 1C1XA 2V7WA 1CRLA 4CMHA 2BIFA 4A63A 5L7WA 3PGA1 2XOKA 4AS2A 2QTEA 4KVFA 4QOJA 5DTQA 4BFOA 1KCBA 3WIIL 4E41A 1L5FA 3C5WP 4PREA 4IOKA 1I6LA 2DQMA 5ICCA 2AXWA 2VIIA 5JA8B 2FU5C 4BCBA 3I73A 5DRXA 4I1RA 3L8QA 2VJYA 1INQA 4XD7A 2GUYA 5HGAA 2QUBA 2B4YA 4R1PA 1HSAB 3VB8A 1DXOA 4AQ1A 5K3FA 1LXMA 4Y16C 4Q14A 3GD7A 1TRKA 4WV3A 5C5DA 2OI9C 3GMOA 2VCHA 4JJ7A 4TMZA 4D9RD 3PJNA 4RELA 2G36A 3BT7A 5AXCA 3ORHA 1MF2H 1H8SA 3RBSA 3UTPD 4NE7A 2RGRA 1Q14A 3MGOB 2F53E 1YNTF 4XAKD 4FF9A 4WLFA 3COOA 3DJTA 2BFNA 4MV4A 1C08B 4GX1A 3V1NA 5HHTA 2HVKB 5EPMB 3T0EC 2AMUA 4LAFA 1ZWKA 4FFWA 4Y19A 5EU6B 3ARGD 4X1YB 2HNBA 3F8SA 5KB3A 3SKMA 5JDSB 4DESA 1N6NA 2G0AA 1A5SB 4JO1L 1YH3A 2FWIA 3HSYA 4H27A 3QFJB 4HX1A 2FPIA 1UXMA 4Q4JB 1TF7A 2DD8H 1D5ZA 3OI7A 3B6EA 3HBAA 2C3GA 3QIUA 3HR5B 3C08H 1ZJYA 2Y8EA 3R0MA 2DERA 3WZLA 4HU8A 4WOCA 2IH5A 2DWEA 4ADGA 4OHVA 3L05A 3Q3IA 4ND6A 3IAS1 2H18A 3D3WB 3U6RA 3PFQA 3EWSA 1Y9EA 1JH9A 5EB9A 2KBFA 2HJGA 4P3CH 1GR1A 3RRZA 3RYFB 1TZIA 3NP4A 1WZUA 5JALA 2PCFA 4PW0A 3X11B 1QGOA 1CHDA 1FZKA 3MJVA 1XEXB 2BMJA 3F5MA 3W2HA 1IG3A 3WGJA 2REQB 4Y7OC 5ARBA 3FWPA 4C2AA 3SGJA 4ZNEE 4NDMA 3ABQB 3ZNPA 5ITBL 1JKJA 1QRDA 3OLYA 4ID3A 1JT2A 2CXTA 4LSVH 3TW4A 2O14A 4AP9A 4FFZL 4XAQA 3R75A 1TPYA 2HKFL 4HYTA 3UB3A 5E0QA 4OYHA 4MSWB 4AT6A 1WZIA 2BLNA 1AR1C 3MACL 1MUUA 1HX0A 1YYCA 3NXKA 3NNSA 4HADA 3SXPA 4KPUB 4GKNB 1MJ8H 4ZMXA 4IDCA 5EG6C 1QVOA 4KWUA 4AYMC 3P4NB 1YN6B 1SEBB 3D3KA 1QNFA 4HX2A 3FDWA 1N8KA 3AF4A 3B1XA 5TGBB 2GAFA 2V98A 2LHAA 4MYWB 5DSTA 1C9DB 3B2QA 3R20A 3F5WB 3UMYA 2IK8A 2KHZA 1WXQA 3ROLA 3NABH 4J1QA 5GGSA 3CX8A 5KVMC 1HDZA 5DVKA 4FDMA 3R77A 3PEYA 1DWUA 1RQPA 3W7BA 2A9VA 2OLJA 4Q8BA 3EZFA 4CYMA 2Y99A 1G6HA 4C2TA 2C58A 3AWFA 1T6NA 1YCGA 5E99L 1GA1A 5EESA 3VHXB 3MTBA 4AYXA 2OX5B 3ECQA 4KWHA 3V97A 3EJTA 5LNK1 3HCDA 2GBLC 3CZLA 2QPDB 5JAQA 1P2UA 4RGMB 1HQKA 1KCKA 5I3ZA 1NW6A 1L4GA 5HVNA 4MWZA 4FYMA 4IICA 1RLJA 1X8LA 2OCIA 5CT8A 3HMQA 3QH3B 1ZR4A 4LRYA 1R9FA 4JSRA 2VUUA 5EFOA 4XP4L 2JATA 2E4XA 3FTQA 3KT8A 1MRNA 1NUSA 3LAFA 1WWBX 4E88A 4B41A 1Q0XL 2VW4A 3EZJB 4Y3UA 2EVWX 1YAHA 1MQ8B 2I9LA 3QVMA 5LZ7A 4CT5A 3N06B 4REOA 4CU6A 1B93A 7AT1A 2CXOA 1EVTC 1RK0B 2XUZA 2VK8A 1CFMA 1DQZA 1M8KA 4KAQL 1QV7A 2C8VA 5DRWA 3P2EA 4WCYH 4PV9B 4ARAA 1H6CA 3CSSA 3I5YA 2VDOL 2ZKIA 1NJGA 3NAAL 5IVXF 2OV8A 3ISWA 4ORZC 4DCPA 2KUTA 3QEQA 2VPQA 3HXMA 3KDSE 5JHLL 5BVJB 4G5AA 1UADA 4ZJYA 4LYYA 4MR8A 2AWNA 2XHNA 3LOQA 3PHBE 1V47A 2N47A 3RROA 3R24A 4LN1A 2I76A 3ZDZB 1O57A 3GG9A 3FMVA 3P5SA 4MUJA 5L2JA 4RA6A 3L2MA 4M8IA 1OK8A 1R0XA 4YRJA 2YDXA 3TM5A 3EIWA 1KB5H 3B9DA 4BUZA 3FSAA 4PG9A 2MCG1 5LUAA 1RQRA 4JHWH 1WXWA 1ZVSB 1Y0LA 2AK2A 2QLJA 4M37A 3CLTC 2ENQA 1FSGA 4B1FA 3MUFA 4LJ8A 4DSTA 5IKPA 3GRAA 4YRGA 2YV2A 5EKTA 3VR3A 2R60A 2PZFA 3WDKA 1FNSA 3BWDD 3D08A 1IM3A 5IK3A 4OSEA 1UACL 3SBDA 1ATZA 1ORWA 3LEVL 1Y80A 1UFQA 1AZNA 2WM3A 1YC5A 4A0RA 4KKRA 1X5KA 4I19A 1A6PA 4YRBA 3BP7A 3A58B 1BPVA 1X7TA 1MA0A 2EW8A 3ZR5A 4RIGA 2O5ZH 3GFQA 3NKFA 1FVHA 3I61A 1GUFA 3L46A 4KO2S 3WA6A 1OAAA 4QCIB 4HGZA 4V3CA 2W90A 4PJAA 4ZPJA 3QE9Y 3SHTA 2OT3B 1N9ZA 2XC8A 2AC4A 3PHQB 5HJ3A 4RJJA 3RIEA 2UXTA 4LMQE 4PJ9C 1ZGBA 1QQBA 3P0VL 5G2OA 3C8HA 4K3JH 3UBFA 4XBGB 2XLLA 1PT9A 3R6WA 1ND5A 3R7QA 2QQEA 3GOHA 1W5TA 4WWKA 5KAQF 3DBHB 1D7OA 421PA 1Z3GH 3DVNB 5FTNA 2CAKA 3FQXB 1BHJA 2RSLA 4GYWA 5DN6A 3LIZA 1NBQA 5BVPL 2OSVA 1J00A 3WB0A 2Z7ZA 4L3AA 4WBSA 1XHLA 5A4DA 1EFQA 1UK9A 1JVLA 1Z68A 3DE1X 1NYQA 3UCFA 5E4EB 3VTAA 1LQSR 2E56A 3SE7A 4YAIA 1FO0L 3AL3A 3PFNA 5AM5A 4NM4H 3CQPA 3K16A 2WBJD 1BXAA 4PPQA 3BZFB 5LFAA 4ZVNA 1JBKA 2HK8A 3MGKA 3ADDA 2OYRA 5HZKA 2BERA 1ZCBA 4DAOA 1XMEB 2P24B 3DTDA 3I01A 2VWQA 3Q5YA 5DCYA 3WI9A 3ZYOA 2CLIB 4H1HA 4GG6F 1CB7A 1EAPB 2JI6A 1JHTB 3S5ZA 3GSUB 3QDMD 4GW4A 3D1MC 3IDYC 4F4CA 4D8OA 3LKSB 3ESUF 2G7ZA 4BJ3A 1M2VB 2JTYA 4DVBA 4XWOD 1DBQA 2KLBA 5HFNA 5IEKB 3VGGA 2X2HA 5JADA 4KXQA 4TQEL 1F97A 3LCYA 5D4QA 2YYSA 5G0TA 3DJSA 5B39G 4ZQKA 4P8RA 4WQMA 1HRDA 5C0DA 1RYMA 2VLMD 1KE1A 4QFBA 4UHHA 4NQQA 3TW0A 2F8IA 4P2GA 3SKUD 1X5LA 2OSLB 3KNZA 2V6HA 3QPQC 3HGQA 4FNPA 3TXYA 2WZPD 1PL0A 3HN6A 3EN0A 4KG7A 1HRKA 1L5GB 1ODJA 1LJLA 3OZBA 4ZN6A 3H1PA 4AVJA 1MFUA 3SYPA 1O3YA 1JDTA 2EIHA 4YH1A 3BPLC 2FFBA 1CD5A 4XAWL 1FFCA 1YONA 2W07B 1FDTA 3FN4A 4QRHA 3F04A 3L6FB 5C35A 2GIYA 4DUGD 2GFQA 1M2OB 1XTPA 4GT7A 3FHJA 5TDNB 3LKRA 2ABWA 3TQIA 4AKSA 3BUYA 2B7DT 3MT9A 1HM5A 1TTCA 1AXRA 2OFPA 4CUZA 4F5CE 3TKLA 3FY4A 3K72A 1DAFA 1P73A 2GSMB 4L9SA 4M1QA 2R7NA 2GASA 1P4AA 1A4JB 1KXQE 5DJ2B 2DWXA 3VJ6B 4ZALA 2GO1A 1J05A 3V8NA 3GFVA 1VE9A 3ZK0A 1GGYA 2C1PB 4AL4A 3F6RA 2HMTA 4ALKA 2W6JD 3UC2A 2BC9A 3OT4A 3C09C 3OB0H 2I62A 2F1BA 5IEJA 2VP5A 1VDMA 3WKYA 5HUQA 3KXIA 4W5QA 5JNVA 1YY8A 2LFEA 3NWOA 4BFSA 1YOVB 4XASA 3V6FB 5TLSA 4GRWB 4R3WA 1FX0A 4FNRA 4NTZA 3HZRA 5FHRA 4JL1A 1MCRA 2P5UA 4IHJF 1FE8L 2VXBA 2ZR8A 4DADA 4D4GA 5BO5A 1GCAA 3UAFA 1ZINA 3S7TA 1Q91A 4LGPB 4TTJA 1NDGB 3D6MA 2B94A 3AKEA 4UUPA 3DGGA 2IHUA 3RTQD 4RFLA 2UDPA 3AITA 1F6LL 1N3YA 4HN2A 2EDDA 2IF0A 4NMMA 2NY1B 3TB6A 4DIMA 1N5AB 3EVGA 4R2GB 2ZUTA 3INOA 2PSSA 3LZNA 1VYHA 3NCJL 4QXVA 2A0LC 1KRHA 1N2SA 3CLFH 5E8DL 2AERT 3FPEA 4EQ6A 1KEPA 1CR1A 2HWUA 1Y1PA 2BNRA 1IB0A 1S9VA 1UKZA 3VH1A 1EJOH 2DQDL 4MZ2A 4LF3A 3AUFA 2ZI7A 1D04A 4EDHA 2R1WA 1CWUA 3G79A 2CHQA 5EMNA 4Q9QL 4FVTA 4YEFA 3T8YA 3UMMA 2JJ1D 3B1TA 1QGYA 2WWIA 4GBXD 2FTKE 4OCRH 4PPYA 4DQXA 3F12B 2WILA 4XVCA 3CCFA 5AK3A 3JWNG 3UB4A 2CV0A 3OMLA 2OMYB 1KO4A 3QJRB 1GS8A 1Z2OX 3C24A 1DQTA 3QQXA 5KSVA 1XHHA 3TSWA 3NOXA 1U3ZA 4A1OA 5E2BA 3HFML 3U3KA 4LSPH 3Q13A 2AJTA 2B1OA 5KUTA 3RGGA 4DVJA 2AABL 1OU0A 5DD5H 3ZU8A 3HKDB 1Q84A 1ED3A 4ZO7A 1YQWA 1XUOA 3KYDB 4P7JA 2LXNA 5IYZF 1HV8A 1G18A 5HM8A 1BIHA 1T7YA 1UJCA 1PUIA 2Z0BA 3JAWB 1NI3A 3IDXL 1VKJA 5F7DB 5JUEH 3V5HA 2XGOA 3E15A 3BWSA 1X7QB 1OIWA 1Y9ZA 1NAML 2BEUB 1SXZA 4G6AD 1L6XA 3EDJA 1RD6A 4MD5B 3KUUA 1GYCA 4IJ3C 2DVMA 3TYXA 1AURA 4ZEOA 3IGAB 5ICXB 2VLKB 5LQJA 3F2LA 1TNNA 4Z6AT 2W0LA 5H0IA 3V8EA 1OZHA 4P92A 3U9WA 1QO3B 5AG8A 1SJVA 3PT5A 3EK2A 3Q3JB 4KLCA 5JHLA 2BVOB 3RRXA 1CNEA 5KOVC 4MMZA 3DJZA 2OQ2A 2IX3A 3B34A 2ZICA 4BGEA 1MFAL 1DKRA 1NGPH 3I6YA 3LY8A 4O51A 3GDHA 5SZHB 4HCRL 4EPSA 4PZAA 5EFZA 3MC1A 3EFEA 5SWSA 3WLNA 1E3WA 1V54B 3L9YA 4P23A 2BM9A 1WCIA 4X63A 2OYLA 4H3KB 1X5AA 3NTRA 4Y5VA 3P9RA 4DO6A 2BMEA 4BFFA 3AUUA 3WTSA 2R65A 1TVBA 1DZ3A 2OHGA 3E82A 1NG9A 1RI4A 3GMLA 3ZDWA 1M1SA 2BSTA 4Y1AB 2XHZA 5EO0A 5JAMA 2X6QA 1W9HA 1XMSA 3H83A 5TGZA 3QUGA 4DK3A 4GG1A 4KO6