3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
b'GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
1ICEA 5IAEA 4NBLA 1I51A 3K7EA 1NMEA 2J30A 5IAJA 4NOJA 3KJNA 4EHKA 3IBFA 2NN3C 1BMQA 2CJXA 2J33A 4NOKA 2C2MA 2Y1LA 4JB8A 4JQZA 4NBKA 3KJFA 2AR9A 3OD5A 1RHUA 1RWNA 4EHLA 3SIRA 2H5JA 3S8EA 3H0EA 3R6GA 4N6OA 4I1RA 5IASA 1RHQA 3PD0A 4ZVUA 1QX3A 4N6NA 1SC4A 2XZDA 4D3XA 3BIJA 2FQQA 4N7MA 1PAUA 1RWMA 5IABA 2CNKA 2HBZA 4N6GA 4JR1A 5LUBA 1NMSA 4AW9A 3GJTA 1KMCA 3DEKA 2K7ZA 1CVRA 2FP3A 5H0IA 4HQ0A 3EDRA 3IBCA 3GJRA 5IAKA 5IARA 2QL9A 1F9EA 1GFWA 4DCOA 4JR0A 5IBCA 2H54A 1QDUA 3KJQA 4N5DA 1CP3A 3V6MA 2QLFA 4JJ8A 4PRYA 3QNWA 4QUJA 2HBYA 2DKOA 4N7JA 5IC6A 2J31A 3R7NA 3UO8B 4QUDA 3EDQA 5IBPA 3DEIA 4I1PA 2C2ZA 4ZVOA 4FDLA 4EHNA 2HBQA 3V3KA 4ZVSA 4QUAA 3D6FA 4QU9A 4DCPA 4QUBA 4PS0A 4DCJA 2H5IA 4EJFA 1NW9B 3GJQA 3H11B 3P45A 4QUHA 2H65A 1RWKA 4QTYA 4JR2A 4IEFB 2CDRA 3R7BA 4AWBA 2WDPA 5JFTA 4EHAA 3H1PA 5LU8A 4FGUA 2XYPA 2CNOA 2Y0BA 2J32A 4FEAA 3DEHA 2H4WA 2QLJA 3V6LA 1M72A 3PD1A 2FUNB 4PRZA 1I3OA 3V4OA 3E4CA 5I9TA 1K86A 2CNLA 2XYHA 3DEJA 3H11A 2P2CA 1QTNA 3PCXA 3R5KA 4NBNA 4QU8A 4LSZA 4JJ7A 5IC4A 5IBRA 5K20A 3D6HA 1SC1A 1I4EB 3H13A 4EHFA 4HVAA 4NOMA 4QU5A 3S70A 1NMQA 4EHDA 4JQYA 3R6LA 1GQFA 1JXQA 2QL7A 3R5JA 2QLBA 4QTXA 2XZTA 3NKFA 4QULA 4AWAA 5IAGA 1RHRA 4FXOA 4QU0A 4M9RA 3RJMA 4JJEA 3V4LA 1RWWA 1RWOA 2C2OA 3ITNA 4HQRA 2H4YA 3V55A 5LU9A 2H48A 4ZVRA 4NOLA 4QUEA 1RWXA 2QL5A 4D3YA 1K88A 1RWPA 4ZVPA 2XYGA 3SIPA 5LUAA 1SHLA 4ZVQA 4QUGA 1RHKA 2C2KA 3D6MA 1RWVA 2CNNA 1SC3A 4ZVTA 1RE1A 2HBRA 4D3ZA 1RHMA 1I4OA 1SHJA 2H51A 1IBCA 3GJSA 3NR2A 3R7SA 1PYOA 2C1EA 4IYRA 5IANA 4QUIA 1F1JA 4EHHA 5I9BA 3NS7A 3P4UA 4PS1A 3UOAB 2CJYA 1RHJA
chains in the Genus database with same CATH superfamily
2NOAA 3TSZA 4KQWA 1MFDH 4GYWA 1WO8A 1VJRA 1X8KA 3DO5A 1CUXA 3P9PA 2W6NA 1E4WL 4DLSA 1L5ZA 4UVHA 5G41A 4CE6A 1L4BA 4BJ1A 1HYRC 3KFXA 4FKEA 2CZCA 1WRBA 4CLRB 3FK3A 4R4BB 4MWZA 1BVOA 2WG2A 1CS0A 4R97C 4BNWA 3ARBA 1ZUNB 1USIA 3SJZA 5JAPA 1ZQ1A 2BZCA 1TO2E 3DXXA 3K8KA 3V3KA 4A39A 2VM9A 5T3ZH 4GAGH 3BFJA 2B59A 5E8PB 4U6VL 3NALA 4Y6GB 4OUDA 2HJKA 1T3GA 5B53A 1NIPA 2WNIA 3QVWA 3UB3A 1R8XA 1GM5A 2ZXBA 3L8DA 3QWRD 3PR2B 2XQVA 4BDVA 1G8GA 4BMZA 4IRUB 2DMBA 2VJNA 4NCKA 1YR2A 2PSJA 3FTPA 2IUUA 3MBEC 1ZU5A 1CY0A 4Q9BA 3ETHA 2BEWB 1DVFC 5C37A 4KQ6A 4JK0D 2HJFA 1KCLA 3I58A 3BE1H 3OB8A 2QRUA 4YVUA 1X9LA 2WQZA 3VXQB 4HXAH 1GS7A 3GKZA 2X19A 3NOIA 2D31B 2NLJA 5DHVH 2Q3CA 2O0HA 3BGSA 4GPIB 3ZX4A 1JWLA 4GH7B 3BCFA 3MFGB 2BBTA 4W8OA 1S7VB 5LM3A 2XN9D 1SO8A 2PWBA 5CLWA 1AANA 4U1JA 3DFUA 1U8MB 2VO1A 2WF5A 3BHBB 3BWCA 1SJEA 3P20A 1UCTA 3GPIA 2AUTA 3GS4A 4WZAA 4IQHA 2R1WA 3ZYCA 4P2OB 3VXNB 1NE2A 3NK4A 3L0BA 2IBGA 5AW7B 3DH0A 4PJAB 4BNHA 3VH8A 2PR4L 2VLRB 2NY4C 3SDYL 4FYJA 1C8VB 3V4SA 1Y5MA 1Z2PX 5JEEA 4JQCA 2JBWA 2F7IA 3FQTB 4PZUA 2J1WA 1DJZA 2A6IA 1YFLA 2L0XA 2FAXA 4NO2A 1QO3B 3CIOA 1F58L 1R18A 2C5GA 1A9ZA 4OXNA 3EC7A 3O2DH 5IQLA 4HAUA 1SKBA 1RXIA 4YHNA 5BZWA 1E6CA 4M37A 2OMWB 2CLVB 4GI9A 5JZSA 2ZJ1A 4KROD 1OAXL 3ZCXA 2ZI3A 2GF0A 1WMAA 4PAZA 5EU5A 2PIDA 1BAFH 4MRMA 1JH8A 1KS9A 3UEQA 1UFGA 1W72H 5J7CC 1HQDA 1EVZA 1H93A 1OTUD 3DMRA 4HIIA 3BP7B 1SEQH 3CHPA 2NW2B 3DROB 4FXOA 3BDXA 4IV0A 4NM4L 4IMKA 5TPWB 1HYHA 1JLSA 4OAQA 5FBZA 3HOGA 3QMPA 1RQNA 3CF2A 4KHPB 2W9EL 4PV1C 5L88L 4W9DC 1TSHA 3OWRA 3NP9A 1EM8A 4ZNEE 3LXUX 3RGWS 5CCDA 1AB6A 4B9AA 1OARH 5T57A 2JGJA 2IQ9H 3EG9B 4XCFH 4JAVC 5JW4Q 1EJFA 1T0NA 4MJ5A 3I09A 2R0QC 1QIHA 3C24A 4LSVH 2Q9CA 2EE6A 5GZND 1TD1A 3FWPA 2V4UA 1U3ZA 4DIUA 5FPPA 2O23A 2X7JA 4EQ2A 1SEBA 4G3YL 2CDFA 2O0LA 3WGUB 3EPKA 1SOVA 1ICTA 3TEWA 4UVIA 5FORA 4ME6A 4ARCA 2EUVA 5L8LB 4G5SA 3FUJA 1K4KA 3UPUA 3DVSX 1R0SA 3SBQA 2XLCA 1AD9B 1J0CA 5B1YA 2GVNA 3DI2B 3NN8B 3EGWA 2P42B 2QLFA 3H3PL 2IEGA 5J23A 4H0NA 3B3QA 5JPMA 2ZNWA 4A55A 4P54A 4IHBA 3HEMA 1OY1A 4K1XA 1RK0B 2V7QA 1F0KA 3D25B 2IEYA 3LTEA 1N8ZB 3L0IB 5G1PA 5FKAB 1XZQA 4QGBA 2ZPTX 1DQPA 4N0MA 3BXHA 5AOIA 3HI6A 2SICE 1G7TA 1NMBH 2VUKA 5A40E 1XL0A 2XYHA 3V7WA 4WAFA 4GG8A 3GKWH 1FZMA 1P4AA 5EKTA 1RZRD 2HLPA 3CWQA 4JLOA 1PE0A 3HYSA 3CFNA 3VKWA 1YQTA 4DFIA 3C75A 1EDHA 1T1ZA 2JQAA 1LDNA 2H4YA 3PIQB 1GVHA 2ZULA 3BVNB 3RWDA 1Z2EA 4JP1A 3W2GA 1CL7L 1R0YA 2PH5A 4WLCA 1PJRA 2JJ2D 1Y6FA 3LRTA 1UJ6A 1EFPB 1JGUH 5J59A 4BKOA 4Q9QH 1IBHA 2O5YH 5F9MA 4HUVB 4IUDS 1S78C 5KNDA 1UYWL 4Y1AA 2I76A 3EPHA 2F61A 3AHCA 3L3GA 3HCVA 2EDOA 3QCVH 1XD0A 2X9VA 3WN5B 2H32A 1O6CA 2EKSB 3QWNA 2DWOA 5BRZB 3TT3L 3K6FA 3EY4A 1AOXA 3AGPA 4N2FA 4D9MA 3UF0A 3CC8A 1R5IB 5I8PA 5M95B 4GLRI 2DW5A 5EZJB 2RHEA 1JAHA 1R9NA 3M88A 2B20A 4UFNA 1FZQA 3GMPB 3UAWA 1RR6A 3W8EA 2FBJH 2VPXA 2V9ZA 1OGAA 3BB1A 3SR3A 4A0QA 3U7FB 2QADC 2FFQA 2YFKA 3QXDA 2VTVA 3ZS9A 2J6HA 2PDAA 1S2NA 1NEZA 4JS7A 4XN9A 4XD2A 1GGIH 1RSFA 3BQUD 1PK7A 1DAKA 3HKBB 2XRYA 5D5MA 1VZ2A 3LJ3A 4EN2A 4O2RA 1LDPH 1SOAA 1KEMH 1MIOB 2J6EA 1QOKA 4HUUB 1SAYA 4OBEA 5GZOD 3IESA 2WA1A 3M5CA 5KDOA 4KV5F 4P46C 3ZU5A 2OYCA 2CMHA 3C5ZD 4MROA 3AVPA 3ODGA 1QVWA 1LEKB 1QH1A 1GAFL 3KUKA 3KVOA 3WGQA 4N9OB 1M2KA 2NMVA 4LXFA 5GSVB 5L3SA 1U7PA 3LUFA 1PHPA 4Z8YA 4ZYKB 4HRVA 1YEWA 1O6GA 1CICA 4BQQA 3K30A 3ZHXA 4ZV4A 4XYMA 2OO5C 3DGGB 2D5LA 4OCMC 1QUNA 4BRUA 4W9NA 4HDMB 3PDGA 1BWSA 5EHFA 3V10A 1U2EA 5JD3A 2X13A 13PKA 4AJPA 4XVSL 1AKEA 5CZVH 1R34A 3IFNH 1N5RA 3US1A 2X89D 1HTTA 4L8DB 3L40A 3NUKA 4ELMA 3OM0A 3SDAB 5FA3A 2CRZA 1PBTA 1YEHL 1KDPA 1GTNA 2WK1A 3GLFE 2VHUA 3QQ3A 2WB1A 3H9BA 4FN0A 1UCFA 3QCUH 5ELLA 4U3HA 1Y8AA 3V6MA 3V8CA 1T5IA 5IC6A 1R37A 2MPAH 1DVYA 3VNBA 4AM0B 1UFOA 3NHRA 4YR7A 4MVWA 4MD4A 5IDYA 3BRDA 1BDIA 4FF9A 2OM6A 4QUHA 2WAAA 4DXAA 1IL1B 4N3NA 4XW2A 3L45A 4NF2A 4BIKA 4DKJA 2OGUA 4BDTA 4NP4L 3FTVA 3H9UA 5LCVA 4BWYA 1IZ9A 1PJQA 4NOMA 1T29A 3AUAA 1W75A 4JOSA 4Z4EA 3HYTA 4TQUS 1MLCA 4ABVA 3W8DA 2FJFB 4I85A 4V3CA 4XH2B 2AEFA 2ATXA 1SM3L 5L2KB 1XLUA 4EG3A 1W4AA 4OZIA 2JAQA 1MLBB 2R8XA 5A9SB 3MRJA 5EA2A 3A6JA 4D9GA 4QYIB 4WPGA 4OU5A 3DYBA 4M53A 3QQNA 5C0CA 3PABB 4AZSA 3KOZA 3G5XA 1RJLA 5E08H 2C8NA 4A6YA 4LHZA 1QSZA 4K5PA 4TVPH 3ETJA 3OAYH 2PKDA 2Y5EA 3JYLA 1SNRA 1OZTG 2XV1A 4JGUA 4UT7L 4GO6B 1WPRA 3OAZK 2FOXA 2XTNA 3BSWA 3LXCA 1VSTA 1GN8A 2XTJC 5AVVA 5ESRA 1WVIA 1U5BB 3KWLA 1WO2A 4Y0NA 3WR5A 4NLHA 1AKYA 4I5BB 3O3MB 3OX4A 3WLOA 1S4QA 1MG2C 2QZ9A 1W5SA 1P45A 2Q86A 1TQSA 4ZYWA 4CKCA 5AXCA 1IIKA 3QDGB 1MI5D 3MG9A 4RSMA 4AVKA 5I1JH 4NK4A 4KE9A 3EN0A 3GZKA 1WHSA 1WH0A 3WZ2A 1ZIXA 3LKSA 2SHKA 1OT2A 1L7IH 5I1GH 3I4CA 5L9DH 2OTUA 2IYAA 1GGYA 4EUPH 1P2GA 2GF2A 3F46A 4WEQA 3Q72A 1YR7A 1UDXA 1L5LA 2M8XA 3U1QA 3VO9A 4HD8A 2IT1A 4I55F 2FR8C 5HYSA 3LUAA 3L9BA 4KY2A 5DVKA 5TNXA 5T3XE 1T83A 5I26A 1O77A 5H2BB 3CMMA 4ACBA 3VI3F 1PUIA 1Q6ZA 3SNKA 1C7IA 4RHFA 2MMCA 4B6JA 2C59A 3PHOB 1NYRA 3IHKA 3LGAA 1YA5A 3NIGB 3GSUB 3D6AA 1VCIA 3VO1A 1A7JA 1XZLA 1NI3A 3H8NA 2QTFA 1QR1A 3KB1A 4XVTL 2H9GB 3V4RA 3DSFL 1CD9B 3E5HA 2VJCA 4LI3X 2FZLA 4M0KA 2VDRH 3TWCL 3V8VA 1QFYA 4X0EA 3GP3A 1PT7A 1RAHA 1AQUA 5IC5A 2ORYA 3UBFA 4TM7A 2HJLA 2DQGH 4DB4A 4KIJA 5DEZA 4KMRA 5J11C 3QP9A 3D51A 3ZY6A 2IPOA 4FG4A 1G291 2IOMA 1CQYA 4UNUA 2VHEA 3SVTA 4FMDB 4W5JA 2PM8A 4RWZA 1PAZA 2PU5A 4YQYA 3BVUA 1Q50A 4M6AA 2ZRDA 3S0JA 3KNBA 1IGJB 3TBSA 4A2LA 4GG6A 2W2KB 5HD8D 4PWZA 3I52A 1R9GA 4K46A 2IZOA 8ATCA 4X5XA 3V0GA 5TX7A 3EADA 1U3CA 4G0XA 4QXWA 5C32A 3LQKA 4MIYA 3BIAX 2YA2A 5JAZA 5JCXA 1UQSA 2HVJA 1HI6B 3WEMA 5JHDA 3IN2A 4JFWA 2IY8A 4CUKA 3EGIA 5HVHB 1WW3A 1Y1LA 1DIBA 1IWPB 3GN2A 3QM1A 4EABA 4B33A 2IWGA 1MFUA 4DP4X 4GIAA 3V1YA 5B1JA 3MSXA 2IWHA 1KPUB 1KBOA 4X7RA 5ESXA 3UKOA 1NC4B 3CU7A 2WSKA 4KV9A 2YKLL 1W581 4CEJA 1G1YA 2YA1A 4P35A 1P0CA 5EMMA 4RH0A 2P49B 3SOBH 3S5JA 2W88A 1OB1A 1U0SY 4PXAA 3D0LB 3VRJA 4L0ZA 4CMEC 3SDCC 1CFMA 3KDSE 3GSWB 5AESA 1UWEL 2EGUA 4GZLA 5DXFA 5BRPA 3WTSA 1NFDE 4TL5A 3SSAA 3MRDB 2AMYA 2J09A 2FRDA 2HH9A 3PWLA 4EDWH 5C0DB 2XMGA 5JJCA 5DI8A 2KBGA 2XPGA 5T5FH 5DLDA 1T0MB 5LXGH 4DW2L 2JLWA 5TQ0L 1NURA 1MVUA 2EFJA 3GEEA 3RU2A 1EPUA 5KSVA 4HHAA 4X4MA 3MFFB 4C4RA 3FZNA 2GUYA 4KRPC 4NAVA 1IK6A 1JHTB 4MQEB 4EJ0A 4TOIA 4AQ1A 5EIHA 3ZRFC 3NBZC 3VDAA 2RIKA 2C7VA 1YMMB 2Q7NA 3D50A 2WVGA 1Z6QA 3GRYA 5LAXB 4R84A 2HTEA 2VRAA 5I3CA 4TPRL 1QNIA 4AGQA 2FUG1 1ZY2A 4ZCIA 4S1NA 2Y1FA 4TS6A 1YZQA 3P11L 2C2WA 1T25A 4NQVB 1L7AA 1WP4A 1K63A 3F7VB 2OYRA 4NYMR 4L8YA 1E6LA 3D3WB 5FAKA 1RURL 2BNRA 2HQBA 3NC1C 3NX4A 5FF6B 1EXUB 3S1LA 1TD9A 3DEFA 1EXMA 1AIZA 2OMVA 2HG5B 2CHVA 4U2ZA 2P4UA 3J27A 1ZM7A 4HZ1A 2B34A 3IP6A 4BJ3A 1EZUA 1TMYA 3I6GB 4OF8A 1B6DA 3MMEB 1WF6A 1FFCA 3M6UA 4B9EA 3PI6A 3BD9A 4GMSL 1DBRA 3NM5A 3VU2A 1TZGL 5K9JH 3ARFA 3WFBL 4L5FL 4I18B 3HXPA 1FDRA 3ARSA 3LZDA 1KJ8A 3UTSA 3GZNB 1GGBL 3U13A 4H4NA 1HOCB 1YASA 5BO5A 5ARBA 4QHNA 1YZYA 3OB0H 2A9AA 3RVXD 1JLMA 1NHGA 1IG3A 3HFSA 3GTNA 1AA9A 3ARGA 1E7YA 4N3UA 4JY6B 1ZO8A 2H9IA 2GUWA 3A0OA 4W7SA 4RAHA 4OCXL 4KK5C 4R8RA 3QIUA 1ODKA 4ZIRA 1DG9A 3KR9A 2RHDA 4Z8FH 1R5JA 1H22A 2QNIA 1SBZA 2P9BA 2Q6KA 3AF4A 5HVFB 2KJQA 4XQ0A 3EFOB 3THXA 3SXUB 4ZVKA 4M87A 2YPLE 3GIVA 1MAUA 2VKQA 2DTXA 2UXTA 3NCYS 2YZGA 3DE5X 1T4MA 2AQKA 2C34A 3H13A 1W44A 1O7JA 4ZT3A 4GYBA 5BSKA 3GJEA 5CGZA 4JFEB 4JT4A 4B3FX 5DDHB 5CJOL 2YDYA 2Q5OA 4J6RH 1MHPA 1P4SA 5IHXA 3L8MA 4WFGD 4RAUA 2D0PB 4A0SA 1QJCA 2IYZA 5TE6L 1UFQA 1BRMA 2JJMA 3NPMA 3CXHJ 2JHGA 4Q4JB 4YR6A 4ZJ9A 4M9SA 1CL7I 4Q89A 1W6LA 1KOGA 2VUHB 5TGZA 5KNDD 4B4WA 5LPNA 1QHXA 1BCSA 2AXHA 2IELA 4Y8VA 4EYOA 2HFFA 1ZA3B 1MW9X 3QARA 4DJDC 5J4HA 3U9UA 4TS1A 4C6HA 5AVXB 3HYLA 2GNOA 2EKPA 2R7EA 3WEBA 1SCIA 2AZ4A 1NWHA 3ETGA 2JFCA 1U31A 2LIPA 3TOXA 4B50A 1EFKA 5IJXA 1X2BA 4BPBA 1U7DA 3ONDA 2QI9F 2WWIA 1B3BA 3BPCB 1OGAD 3UT5A 1B4JL 4LCUB 3BN9C 1ZHLA 1LK3L 2J1KA 3NBAA 3SPXA 4OJTA 3OZXA 2XG5B 4K88A 3W4KA 1G0OA 3KVPA 3D9QX 3RIXA 4PAOA 2DFNA 4H8WC 3AY3A 1WXWA 3JYOA 1Z0UA 2REBA 3UWOA 4D9HA 1Y1TA 1IN8A 1ECLA 3PPWA 1R00A 2AJBA 3ZJVA 4B7IA 1FMFA 3KS0H 2ZXCA 3GJFH 1HL3A 2VYFA 5DJAA 3TSCA 4P9MH 3APCA 3UJIL 1EHNA 1MC8A 3BFWA 1OW3B 4NUGL 2XJ9A 4EJ6A 5AWFC 4MS6A 1YMQA 1TJIH 1NM5A 2E49A 4J0DA 1MHCB 2R8RA 3ENQA 5AOCA 4UUJB 1JPGA 5GGRY 1ADYA 3KSBC 2WJWA 4E4YA 3VV3A 4DPKA 5I8OH 1KY4A 3JALA 4YUYA 4WHCA 4CADB 6TAAA 3OKDB 3B2QA 1JN6B 4TL6A 4E2XA 5DUPL 3AFMA 2BAGA 2W9XA 3BGOS 1V7NH 1U3HA 4YRRA 3Q88A 2VL5A 3HUFA 1FL6A 2K9FB 2HO5A 2POCA 4F91B 4BQOA 4NNXA 3MNVA 4CKBB 1ECFA 5IMKB 1HHKA 2E4VA 2A1UB 3F58L 1D6JA 1UP4A 3T8YA 3UH0A 3I2GA 2CLLB 3HS3A 3PDOA 1B3RA 4HA1A 1AQ8A 5JRJA 5L7TA 2VUUA 1V9CA 2OL4A 2J0UA 1L9OA 3W5NA 3NIDE 1ZPUA 4DEYA 1DUZB 2GTWA 1XF2A 3ZNNA 3A6DA 3MJEA 4QGYA 3R4CA 4M6WB 1AK9A 2HWWA 3BIBX 3MKGA 6YASA 2CVOA 2O8VA 1J22A 3K9GA 4HS4A 4HMDA 3I62A 2P5WB 1J8VA 3LKOA 4NJAH 4MV1A 3Q6IA 1ZH0A 3TFKD 4BNJA 2P35A 1MKFA 2C1XA 3NKVA 1GY8A 2R751 1A5TA 4GOND 5DK0A 1UCBL 3D18A 4BE7B 1QQDA 1I8KA 1MFCL 2OSWA 5C0CD 1EZLA 2RJMA 4CU7A 1E1RA 3DZ8A 3UJNA 3ZEAA 2QQLH 1TKWB 1Q0LA 3DX9A 1QYXA 5EQJB 5TIIA 4ZMQA 2CJPA 2FK7A 1CIPA 3SBWA 2F48A 1J20A 2BFFA 3DUWA 2WG1A 1ZLWK 3DVLA 1L3NA 4MMZA 1ZJYA 5EE0A 4YRKA 1O95C 4RFNC 5DO2C 3TNYA 3UTTE 1LF5A 3A10A 5GGTL 6PFKA 1QLRB 2V45A 5AVQA 4HNGA 5D86A 1QIDA 1ODLA 1JT9A 4W70A 4X7FC 5DM4A 4HS6B 4KYUA 5L4SA 4L50A 4HWTA 4HX1A 1XLTA 3CZMA 4GVLA 4Z78B 1CI3M 1NR1A 4X3CA 3U25A 3K31A 2NXWA 4AJ9A 3D39A 5C34B 3O9VA 4Q0XH 1M6UA 4RD0A 5DR5L 4MLSA 2RIPA 3WDSA 4BLTA 3VJ6B 4V1CB 3ABQB 1F00I 2NU7A 4KRMB 1YE5A 3B43A 3TBYA 1VBNA 3ZKNC 4JQIH 2XGSA 3FSVA 4I0PC 2CY0A 4G9BA 1Q94A 3SYOA 3EOZA 4HUNB 1GU1A 1FP7A 3RSOA 1AFVH 1PG7H 5MDHA 1RP7A 4RIHA 4M7LH 1TLLA 1AKJA 3CSDA 3KSMA 2HRLA 5C0AE 1USUA 5K4AA 3TXXA 3B89A 1J0YA 3QDHA 1XPRA 5DBOA 4LVEA 3UG4A 2FPPB 4M0FA 1INEH 5DD1H 3WDJA 4RF5A 4Y9GA 4LXYA 4AVHA 2NZXA 1XGRB 2C77A 2WU8A 5HK9A 3LEXB 3GGPA 4BFBD 2D3NA 3O2WH 3LBYA 2P2GA 3FH7A 2XHNA 4Z0BL 5DRXB 3B1JA 4A66A 4IU3B 1DRJA 2NG1A 5A16B 3SGDI 3O8XC 4PRIA 3IJ7A 1TQBB 5D1ZA 2OBGA 3LYRA 3RWIA 1QWHA 2CA4A 3U0TA 1J07A 4MUYA 5F1IA 1HX7A 3G5TA 1IBDA 2BDUA 3NJ4A 3AF3A 1U93B 2GB2A 5B39A 2YUWA 1CKEA 2J87A 3V2HA 2B61A 3CX3A 4I9XA 4R8LA 3NFRA 2W22A 3VI3B 4O0MA 3WWZA 2P91A 3BXNA 2X86A 3B37A 3ROXA 5CHEA 1KDVA 1NLBL 2OM5A 3IU3A 1YDWA 2DWEA 4QI3A 1H4VB 1PFYA 3OPXA 5MN4A 2DKOA 2XNJA 4B35A 5DSCB 3BMCB 4MUFA 4MBRA 3MMZA 3HB0A 2H5IA 3C6BA 1ZSNA 1ZUHA 1QC5A 4Z3DA 3SJVE 4PP2A 5HTOA 5IFHL 2DDQH 4CPDA 4WJZA 4F7KA 2FKAA 2R1TB 2FHPA 4GAEA 3MRCA 4WQOA 4ILKA 2ZYRA 5JHDD 3LFHA 3T3ME 4A27A 4I5FA 4TRPL 4LP8A 4AE1A 3UMRA 3ZXIA 3GMNB 4N8PA 4XP9H 3HZKB 2ZT6A 3UAJD 5JHMA 1G7IA 1MD9A 4J0QA 4FFNA 3NMEA 4GSQA 3W0WB 3R3ZA 4FFVC 1CGXA 3OMNB 5CNHA 3DZJA 4BKLA 1B0GB 4ODSL 1KCVL 4YCCA 4PV9B 3VXME 2P62A 4JRLA 4GR4A 1FHNA 3X0DA 2WVVB 4FNTA 5DSTA 1P5UA 4XYBA 1G5RA 2AHIA 2GABA 5FA4B 4NMXB 3IDMB 5CYGA 3BL8A 1FNGB 3P0HA 1U8LA 4E5KA 1YY9D 4HR7A 2CALA 4M0UA 1JNNH 4EZLA 1BS9A 3QHZH 1HFEL 3ILPB 2RG7A 1ZTXL 1BMDA 5EU6A 3U4AA 5JZOA 2XBUA 4XUGB 3GVPA 4FG0A 4U2BA 3IGLA 5H59A 5DUML 4F7PB 4ZFZA 1H6FA 1DZ3A 4M8KA 2JGLA 2IFTA 4GLFA 1P2UA 2ZXEB 2VSYA 3ETLA 2P45B 5I6OA 1PNDA 3UV7A 4UVGA 1JZ8A 3RIFF 1P5HA 4OB7A 2OS7A 5ARCA 2ZCHL 5HIIA 5DYYA 2VZ0A 1A7OH 2APFA 4QTUB 2DX7A 4M3KB 4LCCB 1NCBH 5DRNA 1E8MA 4BZPA 1F4YH 1OAOC 5KTNA 4DFDA 1GPKA 2FPXA 2ZB7A 3WJAA 1H23A 5DEGB 1KZ1A 3OJEA 4M3JA 4C3ZA 1U2CA 2XT9A 1IVTA 1YNLL 2ZRKA 3IURA 4UEWA 2RHCA 5I76A 3TCXA 1WBZA 2IBTA 1JLHA 3KM2A 1CUIA 4Z3KA 3WGGA 2YV1A 2BNRD 1EAPA 2IGFH 3RVVC 3AR7A 3CQPA 2WRZA 5C2BL 1E3EA 3QVMA 3P9RA 4D7BA 3TNNA 5JPDA 1OPRA 2CLEB 2QMHA 2FJUA 3WEXB 4XJSA 1KPHA 3NCJH 1G8MA 4OX9B 1Q0HA 1Q0RA 1IG0A 4K05A 1SVOA 3ARFD 3MRRB 5CSGA 2WYZA 4LWOA 1TUGA 3DHYA 3UK7A 3TU6A 1Z7GA 4DGSA 2DBLH 4KLNA 4PJCF 3UTSD 4DKEL 4ECNA 4OGZA 1JIIA 3PUUA 2BOVA 3H17A 3ZKMC 1N3NA 4YWGL 3KR1A 4OK6A 3R0NA 3ARGD 1KIRB 1N6NA 2WWTA 5JJLA 3WZLA 2YKKA 4S1RL 1DZIA 1KGSA 3BFKA 3C5XA 4JKMA 4AJ2A 3X1ZA 3ADPA 1Y8ZA 5F9HA 3QIUD 1H85A 2HA5A 2B1HH 3A37A 4JDTL 2VNAA 3IAFA 3HC3L 1U4OA 3MV8A 4NJEA 4DCJA 5DXAA 4YHIA 1Q20A 4NZUL 2CRMA 3AQYA 5F7XA 1VADA 3L1IA 5ICSA 3C5WP 2CKMA 3LUHA 3K35A 5AUNB 2ED6A 5G4KA 5F7EL 1GUZA 4MQSB 3DPDA 5IC4A 3IRCA 3RFZC 4WKZB 3VFRB 3B48A 4JUCA 4XO4A 4HJ1A 1RIVL 1GNTA 4HD9A 3DAGA 1PT9A 4U8HA 3VACA 1D8TA 3DOJA 3MUZ1 1AQIA 1PYDA 4YJGB 3M33A 3FCBA 4W9EC 3FQNA 1W46A 1AHKA 4E2WA 1PT8A 2XYGA 3WAKA 1T3TA 2I2AA 4Q0MA 2EINB 4JFHE 3VM6A 3JWOL 2JKJA 3MROA 1ZI6A 4K5LA 3FG9A 4RA6B 5A3SA 721PA 2D0GA 4UZEA 3W3AA 3M83A 5EJMA 2ENJA 1FFEA 5KX5A 5EY5B 1WXGA 4AOFA 4JG9A 5GGUB 4R1NA 4DQUA 3OF5A 2VLKA 5DMGC 2XACC 1Z29A 4NDZA 3FROA 4O2CB 2QQEA 2OHXA 1U8TA 1KYYA 1P0PA 3N91A 1I1YA 2OJEA 4MJ6A 4J1TC 3EW7A 3AREB 1NUFA 3DLHA 3HYRA 4FFYH 1E43A 1F1BA 2ZAMA 4Q66C 1FE8H 4WU5A 3D7PA 2C7FA 3IFSA 3ZJYA 1M67A 3IFOA 3EF4A 3AKYA 3T0EE 3WSWA 1W0WB 2VAAA 3WL8A 3AG4B 3DMGA 4FQLL 4ZZ0A 3HCNA 2BW0A 1WAPA 3TE7A 4QRIA 4YSQA 1ND0A 4U33A 1NNUA 4IIJB 1XZHA 2AG6A 2X1OA 4XZUB 4ONGH 1KGYE 4LLDA 4MYCA 2CVHA 2RDMA 4JM2A 1IOVA 3VFTB 2HSWA 3EVEA 2BP8A 5KAQF 5IVIA 3B2EA 4BHUI 2N7SA 4U3JB 1X7QB 4U31A 3GMOA 5ECDA 4MVBD 2A6DA 4S2EA 4LZZA 1CDBA 1Y48E 2QN3A 5DO9A 1ZVNA 1E2IA 3ZJTA 5EC1B 3A06A 2HLFC 5CEJA 3QU5A 1RW4A 1WKCA 1VG1A 1BWWA 4V0OA 2CNZA 4WUKL 3FCCA 3JYNA 3FTGA 4PLNC 3V5HA 4JFFA 5C8YF 1UL1X 5GTDA 3LSOA 5MENE 3FCYA 3S2YA 4KWTA 4U3SB 2JE8A 1AZWA 1ETUA 3KLAA 3KPSB 3TJPA 1IQPA 5D5PA 1MZYA 3UAVA 1S3IA 3SYCA 3K92A 4YAQA 1RT9A 1YZUA 4KTVE 1U3HD 3GAAA 4XHJD 2N3ZA 1AN9A 5I9QB 3L46A 2B35A 3Q44A 3ZHOA 4DA9A 4YECA 2DWDB 3MGOA 2APXA 1L4MA 1A3RH 2HLAA 1G7SA 3QO0A 1GNQA 4QPZA 4OM1H 3U2QA 2L7QA 3J07A 1W72B 1S1CA 1KPVA 1JHDA 5EP4A 4N5DA 3BVDB 2R6HA 1DBVO 1BEEA 4PSVA 3ETSA 3H9HA 3HI5L 2QZ4A 2QRQA 1FSKC 3H5NA 1ZITA 2CBMA 2OCXA 5CDFA 3ELAT 2H26B 2XRZA 4AUEA 3Q8EA 4KAAA 2OV3A 3BKCL 4JIMA 1UMKA 1ZDSA 4XB2A 1TF5A 2VDOB 3VI4F 4LBZA 1KSRA 3L7JA 5BSTA 2Y66A 4US2R 2Z4TA 1L5KA 4DLWA 3KYJB 1W15A 4GW3A 1GOHA 3L79A 1KCUL 2CXGA 1D3AA 1JNLL 4QPCA 1E2LA 2XWJA 4PG2A 3A6ZA 4M62H 1XBRA 3IRPX 4FOMA 4J3WA 3CZEA 2RGCA 1AO3A 3VW3H 3BKJL 1N2JA 1W52X 3F64A 4JDVB 5JCOA 5K0GA 4B5KA 1AQHA 4RJJA 3VRLE 2N46A 3GJ5A 1E1CB 3IFPB 1ZRNA 1E1RD 3E0QA 2CHQA 1FSPA 4G7VL 1FGNL 3VH1A 1J5EB 1XV5A 5CVCA 2JELH 4IBQA 3RK1A 4TLSA 4HG4J 2VAJA 3U6XS 4IGKA 3ISTA 2VISA 1MBZA 2CMRL 1ISSA 1EYZA 4YBHA 4BJHB 1M0SA 1HYSC 4KACA 4Y9UA 2WN3A 3MCUA 1SBCA 4BINA 3ELYA 3W39A 5GM2A 1G63A 5FYJD 1PTJA 4GP9A 4BGDA 4DLTA 4ZOBA 1LX6A 1E0AA 1A7UA 1KA9H 2RH4A 2PUVA 2EE0A 3ML9A 1W2HA 3TNJA 1EBAA 1UM6L 3FOMB 4F5ZA 1KZYA 1Y33E 3IRVA 2HV8A 5JFGA 2FEDD 3D39D 4CEIA 3PUYA 2PMFA 1FEZA 2R4TA 2NY7H 2Y25A 3RKDC 1RJ9B 3AUSA 1BHJA 4EYQA 3KD4A 4F24A 1MJFA 4BO2A 5F3BB 5AAMA 1WZKA 1XXHE 1SIOA 3QO1B 1HMYA 4QYOB 3L9RA 3VWJB 1HN1A 1O2DA 2CFRA 4ZMSA 3DTYA 3UKJA 2I8AA 3G8CA 1AKJD 3UUWA 5KYGA 4JRWA 1IZJA 2YAHA 5B3NA 1FIGL 1RZ8B 1Y7VA 1HXHA 4JKNA 1NE7A 4S04A 1P1ZA 5AJXA 3WNJA 1FSSA 3F3KA 2BFDA 3BFPA 1XUOA 2BW5A 3QK0A 5EUOF 3R5FA 1FNNA 1NQAO 2V7EA 3D31A 4OF3A 1FUKA 1YRHA 4F8JA 4Y5XC 2X2HA 4NCBA 3HCAA 3L7LA 2OKMA 4PWJA 3FKSA 1RYEA 4PRID 1MH5B 1Z17A 4IRJB 2VJMB 2FQXA 4XPFL 4NBTA 3QWOA 2D7DA 4CGTA 3HS0C 5HHTA 3F97A 1KI6A 1IJBA 3A3YA 2G5BA 5GJBA 4U6YA 4HAVA 3LDBC 4Z3TA 4TKVB 1G8PA 2CCLA 4JH0A 4RFEA 3MCLL 1XAGA 1FW8A 3VFWA 1IOLA 3EC1A 3LG2A 5MI0B 3WRYA 3HXTA 3QIWA 3PG5A 2XDYA 4LSGA 3PI7A 5EQTA 1KAOA 2QUBA 3IDZA 3D4CA 4LAFA 4JRYE 2R4RL 1BN6A 3L8CA 3UACA 1J39A 3LA6A 4LGSB 4ENPA 1Q0UA 3T1VA 3WLIA 2EFGA 2EEXA 5AR1A 4KU4A 4AN0A 1UJMA 5CBPA 3WHLA 4UB0H 4MAYC 2JK1A 4YHOH 3EVNA 1KRWA 3TYXA 4DSUA 3N0PB 1G8JA 4Z86A 4K3JL 1AD0A 1YL5A 1DXOA 5TK4A 3QORA 1M2EA 4UQAA 4XXDB 3Q2KA 4QOKB 2A9ML 2P2YA 3V1LA 3HCEA 4HJGB 3UHFA 1J7KA 1IM8A 1FRFS 4G0PA 2DQEL 3R7LA 2XMBA 4KREA 5E2BA 3H7LA 5AB2A 4NJ9H 3H1GA 1JIUA 3AMKA 3AQDA 3ENEA 5GPBA 3JARA 3I42A 2GTIA 1XR8B 2GFBB 4NZNA 5ALCH 2JJYA 1WMEA 4I1SA 3UJJH 3NWPA 4CI9A 1Y1RA 4R8MA 4UTRA 3GT3A 3MRPA 5TQ2H 2F3TA 5ER6A 1JGEA 3CMOL 1VA4A 1Y3IA 4ZVTA 4E68A 1BZEA 1YEFH 1NAIA 3SIKA 2R8EA 4GE3A 4FTVE 4Z3IA 4AO7A 2WJ3A 1YYLL 4KB5A 1MCDA 2Y7MA 3QXVA 3PFGA 5EU6D 3QIAA 3R0ZA 3HMWL 3BSFA 3H2HA 4BLRA 3TO4B 1FS5A 3KYBA 2ZSWB 3Q6GH 1C1XB 2HPOA 2XI4A 2R8PA 2EWWA 1OI4A 2ABWA 3RAJH 4FZEL 2QTVA 4M4RB 4PYIA 2ENQA 4INPA 2ZSFA 3NIWA 2WQVA 1SVLA 4MRNA 4WNJA 1JFSA 5T3XL 4M6OH 2QVFB 3TJEH 2O2XA 4KMMA 1O08A 4R1SA 3KV1A 4ATWA 4X7MA 2BONA 4KWUA 1VEOA 2VB5A 3S7ZA 10MHA 2RG1A 3CGTA 2CXOA 1ADBA 2UXGA 3HNVH 4Y2OB 5E6IA 2GC7C 2GMWA 4Q9KA 5K20A 3H1ZA 4FCHA 9MHTA 4WVFA 1NBZA 4HQQH 1TA9A 2BF4A 4B43A 1QI5A 4K9DA 1DLHA 4CM4B 4R1MA 3BVWA 3GXPA 1NASA 4HXGA 4K3GA 2IADB 4RJ2A 2IX9A 3DA8A 4TXNA 3B2VL 4HAGA 1M0WA 1W8DA 1XGPB 2AI2A 4EKJA 2H1LA 4GI2A 3O2VL 4XQ9A 5IGXL 4TPKA 3S4SB 3SE3C 4BBPA 1PGRB 1NUUA 5DMJB 2P5SA 1DSSG 3T0FA 2ATAA 2XXAB 4ZAXA 4KO8A 1C8KA 3QJGA 4KVZA 3DXAE 2CXNA 2PWPA 5A7EA 3VNZA 4A04A 1RQ7A 3MLBA 1KDYA 3NVAA 1IEHA 2YWDA 3TW6A 1P7ZA 2Z4RA 1MCEA 3MINA 4UDOA 1KIMA 2D7NA 1U1DA 4A92A 1JX6A 5KVGH 1Q2XA 3EUEA 4B0PA 1HFUA 1P5ZB 3OG4B 4PYJA 1T0JB 3V80A 3GBSA 1HZZA 1Z4QA 3BYYA 3O8BA 1X6VA 1CUVA 1ODTC 2JNWA 2DFVA 2FI1A 5LQRA 3MV8D 5LQKA 1E9QB 4MBOA 2FPGB 3GJ7A 1QIJA 2BC4A 3FTUA 3MLRH 3OQ3B 4AQAB 2GEBA 4EDFA 3CFBA 1OIXA 1EP3B 4RLQA 4OYRA 4QWWD 2WBWB 1W30A 3CCHB 1UAYA 2APTA 2B4QA 4WEOA 4Y18A 3I28A 1ONBA 3W2DL 4KXFB 1NCHA 4PJCB 5D71L 3ZBUA 3IUPA 1R4MB 4P86A 1UK9A 4NWUL 4HS8L 2C03A 2VDRB 4IUCS 4ZAVA 1A1VA 1WBXA 3GLTA 5IVXA 4XH9B 1MJJB 5TFSL 1AZVA 2OT3B 1F3DJ 2AWOA 1DN0B 4NSKB 2BM3A 3L84A 2VZ9A 4HDIB 1T8RA 3B9AA 4BQRA 3GJ0A 1SVWA 3ROLB 1MCKA 3KEGA 3PGDB 2C2KA 2Y1CA 4OFVA 4PJEF 3IJSB 4MOWA 4H25B 2OCBA 2OFFA 2CVPA 2Z8YA 2YN5A 2WQXA 4LRNH 3W3AD 5ITVA 5K8CA 3H6GA 5E2IA 1I5OA 3CU5A 4LPKA 2Y1OA 2H4FA 5D93B 4JZJA 4WWID 1S9KC 3ZZ0A 5KNCA 4FEGA 3OZCA 4UTAA 2VLKD 3QA3E 1YNKH 3ET9F 4RESB 3QFJB 3W57A 1O97D 5JW4N 1HEZB 3ZLQC 4AN4A 1IQ0A 2A83B 1M5RA 5CO1A 2GI0A 4RPLA 1QGUB 2ITDA 2X0EA 2VRCA 4Q3OA 3QUKB 3PSAA 1KMGA 2RKBA 3QQ5A 4B4UA 1E6JH 2MEJB 4JJ8A 4ZT1A 4DREA 1BA9A 3LMJH 3A6LA 3CSPA 3WNIA 3HDTA 4JLVA 2LCIA 2AD1A 3CLRD 1FC0A 4I87A 4TSCH 1OOEA 3EIOA 2VDPH 2QX8A 4KQ9A 2ACVA 2X2JA 2RCSH 4EG6A 4JM2D 2HRGA 4KDTA 1XDTT 3R6TA 5DDIP 5CK4A 3LXRA 1AS6A 3GTVA 3O0RH 3QE3A 5CDGA 1V5FA 2HSEA 1JP7A 1N59A 4ZI8A 5KPJA 3DMTC 5EO9A 4XVJL 5TK2A 3HB3D 3TBTB 3VSDA 4U9HS 4JGNA 5CPFA 2BIOA 2IHJA 1PBYA 3QUXC 3RJMA 4AP5A 2GZSA 3SHVA 4CM1A 5JSFA 1NNSA 2P9ZA 3DMPA 2JFPA 3DLBA 5A5VA 5HM6A 4WERA 3FQXA 1U90A 3G1WA 1YKGA 1KG0B 1QK4A 3ZE2F 1P7HL 2BZDA 4HZUA 1Q9WA 2GJZB 3T15A 4K6MA 3FPXA 5FYDA 4JFFD 3DDCA 4MP8A 5LD2C 4BASA 3BTSA 2CIIA 5B37A 2IRWA 1DC7A 2XZCH 1TZIA 1M7IB 2Y4SA 3O8LA 4N82A 4NHCL 4G7QB 2XG4A 1CD0A 1UXOA 1CRWG 2QS9A 2J4WH 5TR9A 1ZGJA 3NP3A 1DAPA 2PMBA 4L23A 2ICES 4FILA 4ON9A 4HBCL 4RIGA 4QXUL 2DULA 1TO6A 1HEYA 3B6MA 1MMFB 4ER6A 2E4AA 3TIIA 4UTBH 2XEXA 3ZGXA 3T0XA 4PW0A 3ZQXA 4WASA 1QLHA 5A7HA 3WLNA 4D45A 1UC8A 2IQAA 4GRLA 2HK9A 3KEQA 3K1YA 4ROTA 4GR5A 2V3FA 5D7HA 5L3VA 1E6OH 4NS0A 2ZKIA 5C8YB 2P65A 1Q0QA 3CXDL 4FTDA 5I4BA 2JI7A 4WW1B 2BEVA 5T1KA 5BQPA 1V39A 2RK4A 3VNVA 4NP9A 2GT1A 4Q00A 4GS7C 3EYOA 1NXOA 1F4HA 4AZ8B 4E5MA 1NTRA 3QEGL 3Q11A 4L4VE 1LY1A 4M7ZB 5EDXA 1H5BB 4U1SB 1ROWA 2E7DA 1UZ6E 3H5OA 4DRZA 4ND5A 5DP1A 4NQUA 2IUFA 1FVEA 2CYAA 3NA9H 3HYNA 1OXUA 2Q8NA 1E4EA 4CDRA 3RF7A 4ID3A 1S7TA 2OL3H 4QOGA 4BUJA 4OGWA 3UYRH 5EO0B 4W8GA 1T04A 1GPJA 1M2VB 3R3SA 1FH5L 1XGYH 2AS0A 3AI1A 4AB1A 2FJHB 4Y1RB 4B7LA 4NBKA 1YQXA 4O8ZA 4RDHA 3CVWA 2Y3AA 1AS2A 3SC6A 3PFIA 1E9VA 3D1MC 3QJVB 3BD8A 4CTKA 4CG1A 5JZ7C 2HT4D 1QF9A 3OZ7A 4KO4S 3O6LH 2FEJA 4ENWA 5IARA 2ZVQX 3X44A 3PITA 1XWFA 4UHEA 3SLRA 1MCPH 5IOPB 3AGQA 2IZ6A 1Y7TA 3BGFC 2PBLA 1VGVA 1DT3A 3C4JA 3K2UL 1UPTA 3GCXA 2GHTA 1C7JA 1TO5A 2L17A 2JIQA 3UWKA 3LAFA 1TCCA 1QZTA 2CO6B 1VDMA 4N6RB 4P3CL 1DSFL 3VZBA 1Z3CA 1T89C 3ND7A 4M8QB 1LJ8A 4GEGA 4W68A 4JFXB 1CBUA 5LDHA 5DM70 2HGZA 2N42A 2DQFB 4NKOB 4PG7A 3HLYA 1FOEB 3QE2A 2Y5TB 1O9ZA 3VFMB 2ZBUA 1A6UL 2HFJA 1DBJL 3REQB 4LVHC 1DMSA 1JDCA 1AH2A 5A4DA 3GBPA 2QU7A 5JIKA 5CH5A 3M3PA 2WUEA 3BWAA 2JJQA 1A7RL 4PBWD 5DQJA 3IH5A 4N28A 5DJCB 4CMIB 3FKSD 3HHMA 4FXGA 3N2ZB 2VWEE 4M4PA 1I9JH 1NNI1 3DM5A 1LHZA 3STWA 2YWEA 3U1TA 3DSRA 5T8KC 4DERA 4J6IA 5CB4B 2W8ZA 1OXKB 2VMJA 1OVMA 3N41B 4LJRA 1KC1A 3PHCA 3GSNL 1RSZA 2V37A 3DVAA 3NHBA 3QLUA 4JJHA 1GARA 1BU5A 4JN1H 3SHFA 3RSSA 4F46A 2EC9T 2ZUEA 3NJFA 4RDQG 4KVAA 3QIWD 3A4IA 4F06A 5C52B 5T5NF 5EIEA 4D0RA 5G5DB 3E70C 3BD3A 5FO9B 5DHAA 5DYTA 1KCWA 4FMCB 3O8DA 1K0FA 2DOKA 4GLBA 1HDXA 2HXSA 2VPTA 2UZYA 2G72A 3FQWB 3GJFB 3A1WA 1VJGA 4J2TA 1HQRB 4MJIA 1T3ZA 3AESA 3M5WA 3AXLB 2HWZL 3UWMA 3MV9B 4RANA 1YBVA 4Q12A 3CB4A 5KG9A 1TYRA 1LE5A 3ZTYA 4PGCA 2ZDHA 3C5ZA 3NQKA 4LGMA 1OV6A 1QE3A 4ZTOH 1NCTA 3JVEA 2JRCA 4UD2A 3VX3A 4TRJA 3V9CA 1P4RA 3ULSB 5JY1A 3OR6B 5D6CB 4PLJD 4E5XG 1DQSA 4G8IB 2D03H 1HYBA 3RKRA 4QREA 1RK1B 2EBFX 1N9ZA 4FZ8H 4PR5B 2P7IA 1QSVA 1M8GA 1MCQA 4E5XB 3NUQA 4WZBB 1DV1A 3L3IA 1EEYA 5LG6A 8GPBA 4LVUA 2WMDA 2MSDB 4KN6A 2GHIA 5EZYA 3GFBA 4NAUA 2E74C 1SEPA 3NO4A 5H16A 3F2LA 1AV7A 1KI1A 2XJ4A 1G20A 4IYRA 4MDRA 4CMGA 5A3QA 2EBHX 3IT3A 4GMHA 4QJ5B 1U8KA 1LWNA 1LRLA 4MSWB 2VHQA 2KH2B 3T3HA 4A6YL 3A21A 4NKMB 1R0WA 3DOSB 1SZNA 1Z4PX 4NIMA 2QPOA 4TN9A 2J8ZA 2JZOA 3D07A 3JWOC 4ZHSA 2MSCB 2J88H 1HPLA 1P1VA 3VH4A 3T4EA 2BSRB 4I2XB 2QUZA 1KEZA 3S3BB 4CDGC 2C3YA 3O03A 4QG7A 1YGPA 5D6DA 3QLTA 1FNAA 4LLWA 1YH3A 1IGCL 4G5FA 3SE9H 2C2ZA 1A8JH 2WG0A 4MR9B 1X1AA 3VZRA 3UA3A 3W6OA 2DPLA 1VGKB 2O26U 1DDHB 1UZLA 3T2QA 4HX5A 1LI5A 5EHIA 3PVCA 3ZU6A 4S0XA 3L4WA 5K1VA 4ALIA 4HNAA 3IELA 3MV7B 3DNKA 1ZGLA 5E6ID 2CKBL 3LT1A 3KXFB 1APBA 1HT3A 2CLCX 2HEIA 4NN6B 3FSZA 2J9YB 4X99B 2OZEA 4F3NA 3T2NL 3QYCA 1M6WA 1ZVJA 3D81A 5GV8A 4ZT4A 1J7VR 4F27A 4PHGA 4FCCA 3B9RA 3E03A 2OMBA 2EP8A 3SPVB 4LZWA 1IEXA 2BSBA 3MLXH 1DDOA 2D3JA 1JK8A 4LOUC 3DECA 2KB0A 2UX7A 5JHHB 2VXQL 5FWQA 3OVMA 3QY0A 1Z33A 4ZAKD 4DCTA 3QNYA 4H8WL 2H3NA 2PCPA 3ZUCA 1E5XA 5E1DA 5TDNB 2FNAA 3SHOA 1WOYA 4M38A 2E6PA 3HKDA 4DANA 1OM3L 2R86A 3DL0A 4LHEA 2LDBA 4JFVA 3N2KA 2WUCL 2R9HD 5KYXA 1LJUA 2AMVA 2IIBA 1MI5A 3T61A 3RS4A 4L8SB 4KN5A 3CX2A 4OXQA 1GA6A 3E9QA 1JZSA 1CJMA 2G7MC 3WKPA 1NC2A 3KQUA 3IEUA 4JGIA 1NBVH 1G55A 3EXAA 5FNZA 2CNYA 4F9PA 2MYPA 1NJFA 2PZBA 5AI0A 1KGDA 4ZQCB 4JO2L 3BXXA 3ND9A 4R0LB 2Y77A 5EF2A 4Q7KA 2Z93B 3VG0H 2QT6A 5I0YA 2VHWA 2V74B 3LC0A 4ZXBB 5GZNC 1X5YA 1ULSA 1FYTD 5AL8A 5AOJA 2QHXA 2NY5C 3N8GA 2ICCA 1U9JA 5C7XH 2E1RA 4XC3H 1WHOA 3M0EA 1AQKL 2YYYA 1E2ZA 1MG5A 1S5IL 4LCBA 2OFQA 4KTTE 4PUBH 1KEUA 2W6JA 3WRVA 4KZEL 3BHJA 2PT9A 5HJGA 4XWAA 5GRWA 3SDDB 4M1TA 1RHRA 2P6PA 2DYKA 3WQHA 3QHFH 5FF9A 3MRFA 5TMDA 3E7FA 2DQUH 3BP6A 2SODB 1FTYA 2W5UA 2H0JA 3EWNA 4N8UA 4OGGA 1L5GB 3ESZA 4D5GA 2QJWA 2UY6A 5DBFA 1ZD1A 2EUZA 3DBRA 2PUFA 4LBVA 5GINE 2COVD 3ZT7A 4GWLA 3ND6A 4KXMA 1KIUA 4ZAZA 3BD4A 4Y2UA 1HFKA 4GQIA 2EYSB 3OMIB 1KIAA 5KNCD 1DFGA 3BE4A 5GS0H 4DESA 5ADWA 3ULVC 1NCCL 2HX1A 3QS2A 4G37A 1V41E 4F9FA 4TKMA 3NGXA 3D6GA 1T9DA 1U8CB 5FBKA 1J0KA 1JIVA 1B15A 4OGFA 4QJ3B 4BX0A 2VRCD 5KWEA 4A0GA 1S2IA 1GUBA 3MMSA 2BS71 4PI0A 4D0CA 3GRWL 2OMKA 4YCLA 1WIWA 3PXUA 2CFTA 3VYVA 3QGMA 3WV5A 3QRFM 1JSXA 4K87A 4X41A 2YIDA 1JDUA 3ZXXA 4LAQL 1JG4A 1EK0A 1T4DA 3ANYB 1MAWA 1Y3BE 3GXOA 3P94A 3RIEA 5FUYA 3CFDB 1UJCA 3HW7A 2PYEA 1POXA 4Q9RH 1PJ3A 1AGNA 2IV9A 4L3CA 4MVJP 3MUY1 3L07A 4ZPXA 2RB5A 2I66A 3EWSA 3O9MA 4R7GA 3R3UA 3D85D 3PP3K 4RAVB 1QG3A 4UU9A 2H41A 1NKVA 5FWXB 4PCSA 5DWUH 4D6XA 1BSVA 3BS4A 5DW3A 2LNDA 5BMVF 3CZKA 2FD6H 3GWZA 1CD8A 2BIHA 1PJBA 1Q38A 2IUTA 5C7OO 1JQEA 5LDSA 5BSGA 3IIKA 2X2IA 3O7MA 4FQ2H 3SQBB 4E4RA 3WNQA 2UUAB 3MBKA 4NCAA 1IFRA 4XP5L 3QU9A 3NR2A 2IXGA 4JP8A 4KPFC 1RHFA 2Q1WA 4H7JA 2XN9E 3O4OC 5DHMC 1YJ8A 3T5PA 2DERA 1OV4A 3HR6A 2WWRA 3UZVA 2IF2A 5EZQA 2CR0A 1CUDA 1E58A 3EQ7A 4YC7A 2AMGA 3PS6A 3L5IA 3CRRA 4ABYA 4Z6AT 1A97A 3WJ1A 3KPLB 5HE9A 5IG7A 3AVOA 4GRLD 3T4YB 3A04A 5L7YA 3C8ZA 4HFJA 3ZE2B 2RHHA 3PU6A 4UD6A 1AR1D 4HFUH 1I8UA 2AJXL 3QNFA 1WA0X 2ERJB 3QXUA 3KZNA 3AUTA 5TGBA 4CDMA 1A9VA 2XCSB 4BE4A 2OZKA 4WW2F 1HL8A 1SBSL 2AOUA 2CXTA 3FFCE 4K0KB 1H3EA 4N2GA 4R2GB 1UWLA 2X8AA 5T1KD 2I55A 2EHJA 1JZ4A 2X5XA 1R75A 1G7HA 3FLMA 4GSXA 3L3JB 2FZVA 1UGNA 2UY7A 1TLMA 2IHYA 4B84A 1Z08A 4CLHA 3ZHSA 3JWPA 5AVZA 3L0DA 3U80A 3GRGA 4O2EA 5I1AA 3UN1A 3FSJX 2KKQA 1A2YB 3VGAB 3VRHA 4NO3B 4FHDA 1BVRA 3ECAA 1LUAA 1Q2UA 4HOZA 2AEPH 5DWPA 5KN5B 5FYLH 3KJEA 1VIAA 4LN1A 3M45A 3DBVO 3MRMB 3RDPA 4JJIA 1II9A 3DOIA 2NT3A 3N40F 5C0IB 1JWBB 4OGLA 1HXYB 3OPVA 2GRUA 5HXMA 5DZVA 4KQ1A 2N1KA 4H15A 4ND4A 4GNKB 3TT1H 2ZYWX 3BN3A 3IAHA 2C29D 2H4XA 4UNRA 2YW9A 3S8EA 3ML8A 3TR5A 3IPLA 3G6WA 3BXGA 1YF3A 3MRKA 4G1UC 4Z1MA 5FCSH 5LNDA 3BP4A 2F1JA 3SMVA 1AXSB 5GQSA 4AURA 9ABPA 3AWDA 3OHXC 4XAQA 4HJJL 4MVJD 4XNUL 1I10A 3QKSB 1E0SA 4R7XA 3HRPA 1N10A 2XF8A 1GH7A 4BNFA 2ZG1A 3U1PA 1MELA 2ZTUA 4DQLA 4MD0A 5KPDA 4RCVA 1HO3A 2WM0A 4QHMA 4DARA 4KFZC 4AC9A 3PL6B 1EGAA 4V38A 3LQZA 4XNMB 1RM4A 4IJUA 1AMOA 1XCPA 4ZPJA 3AUFA 2PLAA 4KQJA 1K7CA 5G0TA 1IUNA 2BHUA 2DIBA 4C05A 4L1KA 4IIHA 3TCNA 4F8TA 1GPYA 1LU9A 3PWVA 2AYZA 3G04A 3HN7A 1LBIA 3QQ4B 4RGNB 5E4EC 2BFOA 5ENVA 1BXGA 4PLTA 1MP0A 4URUR 2ZJSH 1YMHA 3T0GA 5I9NA 5JHLH 2AFHA 3O6KL 2Q5QA 2KZ1B 1ORQB 1ZGLP 3ULVE 2D4AA 3E1ZA 1XNRB 1CV2A 3PIDA 2B4CL 3P1JA 3KZCA 5DD0H 1TIKA 4A8TA 2GBCA 2EFCB 5HZGA 4M8NE 4UWQB 2I8CA 5HJ7A 3QUAA 2BGKA 3RL2A 3VU0A 5KSAC 4XJTA 3CUTA 4LJLA 4OI8A 2ZZNA 4LT7A 4YMGA 4D56A 1ET5A 2ACKA 1LXMA 3Q8WA 1TVKA 3AXIA 3RIAF 3MAGA 1SD2A 3OOWA 3ULUH 3ZXAC 1U1GA 4RJLA 2VPIA 4U6SA 5GP1A 3ZLUA 2GSIB 4JPVH 1AKNA 5GGRA 2QV0A 4MJID 3BRGC 2FPSA 1YRBA 1LNUB 4P32A 1E5YA 2BOCB 2X87A 2PYFB 2YYAA 2ZG3A 4PRHA 2VK2A 1G94A 2WQRA 5C0FA 1SXAA 3G3EA 3NV9A 1ED3A 4RY0A 4G5OA 4M7KL 3E8UH 4GUPB 1WUKS 3IAUA 2ARJQ 5HFAA 4N8DA 4REQB 4ZS7H 4R7DB 2VLJA 4XI5C 4DIMA 3DPIA 2VXTH 4JFUA 3QZOA 4FFZA 1R4NB 1CU4H 2X70B 4HT1L 3ARBC 4D9RD 3NAAL 5JMOC 3V6OA 4O2BB 2A73B 3GGGA 3QMWA 1VMAA 1G38A 4F4UA 1Z9OA 2EACA 1U7HA 4M43H 5IUKC 1IHUA 4UTZA 4OZGE 5D87A 3DHVA 1EUDA 3U9SA 2JFFA 1QG4A 3ZDWA 43CAA 5GHWL 3WMQA 1M6HA 2X3BA 1EVYA 2D2VA 2P79A 1VHQA 3Q05A 1TFRA 2QGBA 5BZXA 3TQCA 1U04A 4ZFFB 2WVTA 4YP7A 1D2EA 1R64A 1XRRA 1BJTA 2ICWA 1L1FA 5IFLA 5L8VA 1A7NH 4G70B 4NKDA 1NAML 5LBSL 3CV3A 3RZWA 1LNQA 3ZV5A 2Y1LA 4UHBA 4E9SA 5IULC 5JQGA 3KFLA 3QF4B 2ZOOA 5CZXD 2V4LA 4X9YA 3WNVA 5AWNH 3ADKA 3JV4B 4X7TA 3W9DA 2JKYA 2IVZA 1E2KA 4ERXA 2Z2IA 1P4UA 1G0DA 4BFTA 3FT2A 1ZLDA 5ANRB 5KSPA 1WIUA 1BXUA 3M1BA 5L3QA 3N59A 2OXCA 1VB5A 5F96H 3FN0L 1DEOA 1IATA 2NSYA 4KXZI 3IF1A 5BYBA 5C7ZA 2BIFA 5ILOA 2ZEJA 1MABA 2ZVPX 4JM4L 2E5WA 4E0BA 4QOFA 4FW9A 1SKYB 2ZRNA 5E4YA 1G17A 5DD6B 4US0R 4KKBC 5HHVL 1H6AA 4QQKA 4AQZA 4BO4A 2Z08A 1PYWB 4MUHA 3A67L 5EINA 1RJZA 1GR7A 4JRXB 1WSAA 3GSQB 2C61A 4QTHB 1A8HA 1SHZA 1F3DH 1M74A 4MJXA 1DJNA 4L4JA 4Z4HA 1N2CB 4LPXA 4HDOB 4CRWB 1J0XO 1I4DD 3DJZA 2DCUA 5BN5B 3NFSL 4UAHA 3QUMB 4ZW8A 2Z3VA 3FWHA 2PUQT 4OTXL 4HYYA 3JQOB 5D96B 5JR1L 4N24A 1V35A 3KEMA 3E9MA 3DWIA 1N6LA 3QWFA 2DIJA 2ZJ4A 2R0WL 1DEAA 1V11A 2X9LA 1UR5A 4OGXH 1N0LA 2AC7A 1NTDA 3F05A 1DUIA 2ZI6A 3PX7A 3FHEA 4LARH 1M2JA 4CU5A 1K3UB 3MM4A 4Y98A 5GVRA 3LLUA 2YGOA 2BNQB 4WVRA 1DUYA 4BUHA 1BYPA 1VI5A 4TTQA 3AUVA 3FHCB 1G3UA 4NCC1 4IJ5A 1QI3A 3W5VA 2C4WA 2VUOA 4Q7EA 4UM9A 1J9EA 2QMZA 1BXVA 2B1GA 4PHZA 1NC2D 3W90A 1BX2A 1I7RA 3G79A 1J24A 5JYCA 1D7AA 3RHZA 4QHLB 1XD9A 2ZCJA 5DNVA 4RRPG 5BZZA 1U9KA 1IQWH 3ME5A 5LYJF 1C5CH 4XTRC 3G8BA 3DJRA 3E18A 3Q0EA 3PWTA 4Q2ZB 1MEEA 3CF6R 5CCKL 1PF3A 1WD8A 3I05A 3KJ6H 5JLJA 4JR2A 4CIWA 5ALUA 3AY0A 1M76A 2OSVA 5CJXA 2XCRB 4JYMA 2X58A 3AEXA 1AGYA 4R54A 1XCWA 1CUHA 2W6JD 2ZB8A 5ABDE 2PLTA 5JPMC 5CU5A 1M33A 1JMZA 1KTDA 3S1AB 4J6EA 4FINA 5E6UB 5TQVA 1IN1A 4IIBA 2AV6A 4A8JA 4ENZA 3FN4A 3LMKA 5BOZG 3QFRA 2UZ0A 4NENB 1DQMH 1UB6B 4GPZA 5I71C 2K4AA 5EBLB 1KHHA 1RHKA 1HDMA 2H2PD 1Z8DA 1B88A 3OSZA 1HEUA 2F17A 1O94A 2J3EA 4GWKA 5ADHA 4V11A 1HWWA 2PPFA 3F83A 1M2FA 4LJAA 1TM3E 1HDRA 4CN9A 3RQSA 4ZXPA 1LS6A 3D54D 4L4UA 2VR4A 3UZUA 4HDSA 1G9NH 5KW9H 2C4NA 4TTJA 4OJFL 2EDQA 4MA8H 2AX3A 3OZRA 2QZZA 3N2NA 2TMKA 1OIOA 1YO6A 3KGUA 1IM9B 3DEKA 3U7YH 3M7IA 4HEA6 1VL0A 1JCKA 2K87A 4KJXA 2YD5A 1NF2A 1QGED 1KZGB 2C8LA 1A8PA 2HM7A 1N1MA 1DFHA 1B42A 4RENA 4BQPA 3G5MA 1MAKA 2DH2A 5DMIL 2PYED 1P73A 4F6RA 1BGXL 3IMEA 1GTSA 3L6RA 3O3NB 4BKTC 5LC1A 4BCCA 3UAJA 1GY2A 1G9HA 5TQ2B 3BRFA 1YPZA 4TMFA 5LMUB 4FX5A 1RJYB 3JT2A 4LF3B 1WSWA 4YJ2A 1EAQA 5F1KC 2BMAA 2HMWA 2DP4E 1NCDL 1RFDH 2HIAA 5EL0A 2RAFA 3GH3A 4Y3UA 1EE1A 4H7EA 1PDKB 2ODIA 3N1FC 3EDEA 2J44A 2G3XA 3V4UL 1OA0A 3SEQA 3HUJA 2EKQA 3DUFA 5ALTA 2F8IA 5LU9A 2YHIB 2H57A 2GCOB 3W5UA 2O8BB 2X2YA 4PTTB 4IKJA 4F3FA 3QVSA 4JA2A 1KPRB 3ZWBA 1GHTA 2JLXA 5IB2B 3UMMA 3PQYA 3II2A 3X3FL 5JS7A 3TB4A 1V4VA 3ZX5A 3L95A 3TFBA 3QRBA 3GH1A 4DPBX 1BGVA 2X4DA 3JV0A 4M5TA 1H0DA 1K08A 1PJTA 5ITBH 4MV9A 1BDMA 4WZAE 4Q4AA 2A94A 4S05A 1BIIA 1P17A 1FNHA 2ZRJA 4JE0A 1LSOA 2ZYUX 1G7PB 1CICC 1AGFB 2NXZB 1GHFL 1NMSA 1VERA 5A6LA 3C70A 3GCZA 1WCWA 2CK3D 3EVDA 1JYFA 3LF2A 4B4VA 3HABA 4D4MA 2HUEA 3RL1A 3K91A 2V7WA 1K98A 3O95A 3SYKA 1AT1A 4JSTA 2X5NA 2ERCA 1CLZH 1TT5A 3DDZX 5CFQA 1EI9A 2WIJA 2SNIE 1VZIA 5J6GA 4J4HA 3X3GH 1I3MA 1W1WA 4IXDA 4AUUA 5I30H 1E2DA 1QZ3A 5M2QA 3ERCA 1RPTA 2QYOA 3B1ZA 1FRZA 5FV4A 1IEQA 3M5DA 4J75A 2JKLA 1WZNA 1MRCL 1EG7A 2DLEA 2VQ1A 1DBAL 4OCRH 1IE5A 3P9NA 5EMHA 2YMPA 3QJRB 3S37X 3HHRB 1RKBA 4R90L 2WWVD 3RAPR 1WA1X 3O6FA 2Z8ZA 4XBEH 3H9JA 5DTJA 5DRZA 5AICA 1M1YB 1QSFA 2R4SL 4P8QA 2ZT9C 1RPUA 1X0XA 1VL5A 5LMCA 1XIWA 1JXKA 3ZGHA 2UXFA 4G42A 2V55B 4BIIA 2JCWA 2PMZA 4P4NA 4L37A 3CEAA 2DQJL 1C81A 4Z1MD 2ARJB 1XDGA 1HINH 1BQHA 5E1HB 1FW6A 2J25A 4BVLA 4DMHA 4EFDA 3ADCA 2X9QA 4D43A 5AO9A 5IKOA 3DIDA 3AYXB 3QE4A 5DJZA 2JGIA 4LQFH 1KYOJ 2QVCA 3G5ZB 4YHPB 1P3Y1 1WEKA 4D0SA 3LWZA 2NUAB 4KTGA 1T6BY 1JNJA 1TU0A 5J2UF 4YSUA 1XRMA 5E6RB 4B7AA 2HHHB 2ZAYA 5K05A 1CRQA 3NRPA 2FUTA 3GB7B 1LBEA 3KKZA 1DBIA 5KQLA 1ZRMA 3CH1A 3QR2A 4CNIB 2QRZA 2ZJZA 3H9SB 4H77A 3NDPA 1T0OA 4DF3A 4JBHA 4K0RA 3GLEA 3PYCA 4E2FA 1AGCB 2VXUL 4I5EA 5EIBD 1XRQA 1Q9KA 4ZP1A 5HR5A 1NEUA 1MENA 3DW1X 3GT4A 2OENG 2VIRA 4KV7A 1MDTA 1Y80A 3U49A 4G7YH 1QVOB 5GS1B 3DFIA 1E9CA 3SYNA 4B27A 3PJNA 2R1XB 1CZ8L 1O0BA 3HRIA 2JD1A 5HI3D 4PO3X 3BVXA 3IAS1 3L0ZA 4UDTA 4WFGE 4R8WH 4P83A 4AG5A 4EMZA 5ITWA 1SR8A 5EESA 3H9EO 4A1RA 1P18A 4EY8A 5CITA 1T83C 2HCTA 3F67A 1CT8B 2H1FA 4Y1AE 2FLBT 3HCCA 4B7UA 5KOJA 5ISMA 3N70A 5KWIA 1WR8A 2WTXA 2E85A 4WKBA 3QQ9D 2WUWE 5K8VA 4LZKA 1GZHB 1X7HA 4RDIA 1K8DB 2E9GA 3ABZA 4RULA 2NGRA 1B0UA 5E1MA 3P9CA 4V3BA 3E9NA 1ONOA 4EYKA 1NPUA 3JYPA 2AJUH 2C7UA 5DYOA 3DF9A 1TJGL 2JIOA 3IP9A 4PRHD 5SWSA 3O82A 1XCJA 5FDFA 1OGAE 4YK4C 4KK6C 2O5RA 1NT4A 1CFVL 3DMDA 2UVQA 1FORH 1MB0A 3EJWA 3C5JB 4NPKA 3KH4A 2G2RA 3I2JA 2PUCA 2VLJD 1I9EA 2Q8AH 4JFDA 4X85A 5D5ME 2YVKA 3OCYA 1TIBA 4JFZL 3K3PA 3V7NA 1ZGZA 4NJOA 3IJHB 3VQLA 2GBAA 4MDFA 1HSAB 1JTOA 2FN9A 5ISZB 1EX1A 3WB1A 4YMVA 7FABL 1W93A 1SF3A 2QSQA 3GVXA 1ZINA 4WXHA 4HRAA 1QPPA 1ECYA 3N5AA 4GAYA 3U0WH 3CEMA 3I9LA 4JJEA 4UREA 1XVLA 3RCBA 4UT6L 1A64A 3WWOA 5FO1A 3WBJA 3G0BA 1T8WA 3IXMA 5LIRA 2DYPB 1U91A 2QM3A 4B3XA 3R24A 4MGHA 4NMLA 1BVLA 4CKYA 2JIBA 3QUCA 3AFLA 4XA8A 2JJSA 2BSCA 2OKGA 5AW8B 2WF6A 3IDQA 3Q40A 2BVTA 4R2MA 1RAIA 4OAWA 3BXEA 3O4RA 1FXUA 1PLGL 3HE6A 4AEHL 4IF6A 4BFSA 3GK8H 3S48A 3IBFA 3FHTA 2D7PA 2VDLL 1G8SA 1THGA 3UWDA 4BMCA 3TRIA 4U1HA 4PLKD 2RONA 4A2HA 3FCOA 2ZP9A 3PWJA 2NT1A 4ZG1A 4BVFA 2AF3C 5IZCC 3UC0H 4O02L 3WGOA 1NGWB 1X80B 4CUJA 4ELME 2NTJA 3NCYP 3WEOA 2P2LA 4E31A 4GBJA 2NXJA 2QUKA 1H8LA 2W9LA 1OQXA 3OCVA 5D7LB 5M29A 1O3YA 3AVWA 3B9QA 4RNRB 4FP8L 1IIIA 1FSZA 5DCLA 1F12A 1ZY9A 3HY4A 4X6DA 1J8KA 4K9SA 2IXDA 4M1KA 1UBJS 5JNRA 2X3CA 4TNEA 4NOFA 2GPNA 5GSRB 2DMKA 1LVHA 1MFEL 4A2GA 3D12B 5F1NB 1G1MA 4EVRA 4JNKA 3U4KA 3N7TA 4HADA 4UBDD 2FRDC 4ADIA 2W4IA 5LNGA 2ZIVB 4B0MM 3MNZA 3T5MA 3RX8A 4EKEA 2XWZA 3GEDA 4W93A 3FTYA 1JFVA 1UINA 5BUSA 2B9AA 1LFDB 2VN8A 3DTVB 1WBYA 4L9DA 4HFWA 2J12B 4YL9A 4YO7A 5FOBA 4YEEA 2H18A 1I3GH 1T0BA 1I1OA 2C2HA 1T8PA 3FPAA 2XUGA 2H6OA 3FMOB 3LX8A 3RVLA 4Z0HO 3FE2A 4EHIA 1SHJA 3THWA 4P22A 4YAWA 2VUIB 3HXQA 4POOA 1TYEB 3H04A 2W6PA 2QPSA 4H2DA 1INLA 1C9SA 2IEPA 2D2IA 2O7RA 1XAIA 4UM9D 1XPUA 4CNQA 1E9FA 3E2HB 4MJLA 4JRFA 4YRDA 1RV6X 3F71A 4IJWA 1R24A 3U7AA 1WSST 2WBJA 3DUHA 3L7IA 1FFTB 1H8HD 3L5HA 2XDAA 1EANA 3MCWA 2IOYA 1YS4A 3NSJA 1F60A 3CHYA 1C5DA 4P5KA 4XR9A 4PVMA 4DV3B 2BFVL 2NQ2C 3N87A 1MJHA 3RY6A 4MKRA 1YT5A 5I17B 2ANBA 1U9ZA 1YOVB 2MINB 3NU1A 4JJZA 5LKNA 3ULUF 2AEIT 1CDJA 2QV7A 4M48H 2O0KA 4ELDA 1U92B 3GNML 4FQPA 3TI9A 3UBXG 1ZKAA 3AYZB 2MCMA 4PRZA 1XHEA 1BW9B 2DM3A 3CZLA 3NDYE 4AF6A 3M81A 1HEJC 2YRFA 4PG9B 1FNEA 5I5RA 3MOBL 1IEBA 3GD7A 3UBXB 3TPUA 4RE5A 1NMZA 2OAQ1 2UUDH 3F98A 4W9GC 3D7RA 2VJBA 2VDMH 5LYJB 5C0ND 4CC1A 3UJCA 3OIFA 4I55B 3HMXH 5C3MA 4WTXA 3QBTA 1AG6A 2J5QA 2ZXDA 1O94D 3FUKA 2HUPA 2PP9A 4PCTA 4PXYA 2R6FA 3TGWA 1D0VA 2BKUA 3EFFA 3HE7B 1XDUA 3WMFA 1MHEB 3KKQA 3DC2A 2OG2A 4AENB 4PJ5B 2WWNA 1E4KC 3UGXA 4M5ZL 5FPIA 2Q0SA 5FA6A 2QR3A 4IBWA 1LSUA 3FONB 1KVUA 1GUDA 5CT6A 1I1AB 2IH9A 1TTQB 1CVRA 1FK8A 1X7GA 4EIWA 1YVRA 5FUZH 2GT9A 3KZ1E 3RB8A 5FBRB 4IIQA 4G41A 1CQXA 1BYIA 1CZNA 1YL7A 2FSVA 5D4IA 1BW8A 1M1XB 5AYUL 3H5LA 3BKXA 3T0EC 4GG6E 2BDNL 1U99A 1W36B 3ROOB 5I6XB 3R8XA 4HPYH 1SLXA 5ALIA 1GYPA 1KV3A 1T5LA 4EHAA 1J0BA 4OZFH 2ZTHA 5DHDA 4XD7A 3AR8A 4ZCLA 4FFSA 3O81A 3F7NA 3L8YA 4MDHA 3U7HB 4GM0A 4ZT7A 4UOZA 2M26A 5JHDE 5JA9A 5F71A 3VZCA 2O6FA 3S7GA 3FVRA 3IKVA 1GC1C 1I6MA 4KR6A 4EI0A 2CBXA 3V0IA 4XDGA 1DKQA 3ZTJG 2VJOA 1EWQA 3ZHNA 2XX1A 3TIEB 4PYHA 5IKCB 1A9SA 4RPCA 4KGVA 3PQYD 5LL6P 1QJ4A 1GQSA 4F0JA 5LWYL 1M6VB 4H7IA 5J3HD 2XW6A 5K1NA 2ZUVA 4AKPA 5DHXB 1CGSH 2NZ9C 4EGQA 3HS8A 3LC7O 3KYKH 4F6CA 1OE3A 2JCYA 1FF9A 4MVBC 5DZJA 4I1RA 4TX1A 2GHQA 1Q3HA 1NM5C 3TEMA 2B4CC 3G0HA 1JKJA 4J76A 4XQEA 4HS3B 3MTDA 3RA7L 4IGBB 1CBJA 2E4ZA 3VXOA 2HN7B 4EBBA 5F0PB 1NOIA 2ZUDA 3L49A 1Z36A 2P75A 3UJ6A 4WWKB 1DAOA 1RMQA 1T7XA 2IOHA 4QDTA 3FNRA 1BG6A 3THYA 4JBXA 4OZHA 4M93B 2C4HA 1WPGA 1KFCB 3IEPA 3FF7A 4POZD 5HY9A 3R44A 3I75A 3IQEA 3WE1A 2IKSA 3II1A 1BS1A 5H4ZA 4AY0A 4X4ME 3TC9A 2HDNB 1U6JA 1OX6A 1BOGA 5EJAA 2IU0A 3SKNA 4ZUSB 3SJUA 1RI8A 3CIFA 3E3QE 1XFAA 4QU8A 2HF8A 2HA6A 3PY9A 3BGMB 1P4IH 3TH2T 3EDYA 5D7IA 1HJBC 1X1TA 3FAKA 3L77A 3HPLB 1T9KA 5IP4A 5L4NA 1WCBB 1KC3A 3O6FD 4AIEA 3M6FA 1QSFD 1N92A 3G6AB 3HZVA 2E76C 3Q8AA 2BNRE 1YS6A 3RNOA 4IJ6A 3ORJA 4PS7A 4P93A 4NO0D 3EVBA 1XIWD 2ZZMA 1J1IA 4XX1G 1E79A 1DARA 3LDHA 4V2BA 1LQTA 3QPAA 1O9VA 3L7YA 4L8CB 1NLMA 4KQGA 2K3TA 3ENKA 3GT0A 3NJNA 5J2TA 4V39A 1GU0A 1EXWA 4Z3JA 1DKPA 2ID8A 3HKEB 3VJRA 2EARA 2YHAA 4EJSC 3SQLA 2MWMA 1NLZA 2OMEA 4F80A 4NFYA 3S3JA 4BFXA 1EINA 1T5XB 2V6JA 1OCZB 2WXJA 1VFAA 3V5DA 3OE7A 3ZY3A 3FNFA 4QWWA 3DRQA 4D44A 2PAAA 4Q6BA 1ETZB 3GM0A 2WSMA 5DEOA 1Z7EA 4NNPL 3CX5J 3HXKA 2B4RO 1KJ2L 4FQ1L 4NKRA 2PE5A 4Z4QA 1ZK3A 4OBRA 2NTVA 2GVYA 2VLLB 3P77B 5A0FA 3KYDB 3GSXA 5THKA 2G9VA 2X0JA 2PUTA 5CB6A 3T6QC 4ARIA 2FWAA 1X5HA 3QHPA 1FFSA 1MNUL 4JPQA 1TUBA 3UNXA 2EYRB 1CE8B 3HWRA 1OGIA 4L5IA 2IPNA 3GEGA 1XLTC 3GZJA 4PYOA 5GJWC 2VTEA 4GOMD 2FEDC 3SOPA 3KZKA 1TOAA 5J2UB 2OTCA 3LLVA 2C04A 2CLSA 3HR7A 3E22A 4MNGB 3GP5A 4HN4B 4NI5A 5F51A 3ARRA 5CINL 1TEXA 3CSUA 3PNPA 2C42A 4K3EH 1USVA 5AK3A 3C8KA 5LXTF 1R4ZA 1A66A 1GA1A 3JWDH 3ZKXC 4K8RH 1TK2A 3JWNH 4PS1A 1Z3RA 2E7CA 3BD5A 1TQWA 4TQEL 2OPBA 3MIZA 4L8BB 4JCCA 3V1UA 1XP5A 1H1DA 5KVEH 3ROZA 1D04A 2A1WH 4JHVA 4D9FA 1INQB 3WXVL 4WY7H 5KSBF 2FSGA 4P3XA 4JVUA 3QVGA 3VXUB 3HV2A 3EPPA 1WT5C 3U4BH 2ZRFA 3FLAA 2EJTA 1VE9A 4DL9A 4URTB 2NY2B 4IKIA 1XCXA 4OKSA 5D1ZC 5DHVB 5IDQA 2OP1A 5SWSD 3U5TA 3WN6A 1GRVA 4X9HA 2G80A 3WGHA 1V1JA 3HE3A 3FHQA 4JO5A 5C1BA 1NVXQ 1NG9A 3MR9A 4JFDD 5EKSA 3HPJB 3ANNA 3MRQB 3BSZA 2IHNA 3WZMA 1Z34A 2YN3A 2VT2A 1RCYA 3TCLA 5FUQA 1PX8A 3HNTH 4EDXB 1ZJ6A 5D7SH 3PV6B 1WC7B 1YRKA 3FM9A 1C4WA 4I0CC 3RFCA 1UIMA 3WL4A 4FLFA 4DUGA 5EJ5A 1MR3F 2I6FA 2DD8L 1JUFA 5K0NA 3LZRA 4UBIA 3A4YA 3GU3A 5C35A 1X5MA 5J57B 1C3JA 4X8XA 2BFEB 2EECA 4KRYA 2NY5L 1KNOB 1RXCA 4HVCA 4U5XA 5B58C 3HE6D 5DWVA 2WHVA 4CW1B 4HUWA 3OMWA 4R8SA 4C56A 5ADPL 1PDOA 1IZ0A 3FYUA 2OCLA 4LYJA 1KAHA 3AONB 4LVNB 1HQ4B 1TQ8A 2IYNA 5F9OL 4M55A 4L8VA 4MIOA 5K0ZA 1XX9C 2R7NA 4BFGA 4NGHH 3VR5H 1P5UC 5FB8A 4MXVE 1Q83A 1P0QA 2CUAA 1S8DA 3AC0A 3F6RA 1DBBH 4I1OA 1TM7E 3A4MA 3LBFA 2G4EA 3MZ0A 2WLTA 4ZEXA 4DNOA 1PTKA 1ZXXA 4YCJA 1J9SA 4M6NL 1Z38A 2VKWA 2F90A 2DQDL 1T2XA 1FBNA 1E7MA 3L3OA 4RCAA 3ULVL 4IDGA 3GMMA 4BNKA 4Q6KA 25C8L 4WCVA 4BMYA 1LO3H 1D4FA 1HUQA 1SIBE 3AR5A 3BT2L 3P4MB 2I7XA 4W1TA 1MVOA 1GOFA 1S7XA 3OQPA 1L9KA 5B57C 1QP8A 3V1MA 2AF2A 5DHYA 5IVZB 1ITCA 4JASB 1G64A 1IBYA 4JG5A 1ML3A 1I7UA 3KDAA 5DRWA 3DX8B 4UV4H 2VXVL 4K2UL 1ID1A 2JH3A 4NQCB 3BZ4A 5IVHA 4A2FA 1F11B 3SE4C 5HIJA 2QVYX 4OKDA 1X7WA 1UDCA 3ENNA 5SWZA 4TMTA 4YFDB 2OILA 5I18H 3VFUA 1JB1A 2D74A 1WISA 2JEOA 1ZAGA 2WBJD 1DE0A 3RZCB 3FFDA 4RX4D 4QKXB 1X1SA 1J11A 1O5TA 2BY3A 4GEJA 4X1OA 3NWBA 2XBZA 5EBWB 1ZA6A 3L4YA 5FUWA 5NULA 4XP1H 3ZHTA 3QZWG 3RVSA 3OIGA 1R1DA 4U7HA 4KXVA 3QNWA 1Z5GA 2HBYA 1JEOA 2Y76A 1I8MB 4FQJL 3QZWB 1RJEA 4ODWA 2NTFB 1V3QE 2XT0A 4XEUA 4WLOA 3M3DA 3EZ7A 3D39E 1OZUA 4D97A 1ZMBA 3P32A 2Q2NA 4X24A 2PTGA 4PZPA 2P8PB 2VZUA 3MMXA 4WESB 3BEDA 2ZYAA 1OZGA 5CCHE 3KWMA 1QVRA 4BCXA 1XVSA 1R6DA 1KIQA 2E9WA 2YXVA 3IBYA 3CFCL 2AV7A 2BHFA 3K70B 5EZIL 4OM0L 3QELB 4DTGL 4OFPA 1GT6A 3WELA 2N7AA 1JDDA 3WHPA 2BI8A 2FP4A 3N0AA 4MDJB 4LCIH 2PGJA 1THAA 3I3DA 3EYUH 1P77A 1UQTA 3CN1A 4BH8A 1KFEB 1RFGE 3EXHB 3KZXA 4MFHA 3OPQA 4HNRA 4KUCD 2UUCB 3KW8A 3SHQA 4JBIA 1KQNA 2GEQA 4PRIE 1REIA 3SZ6A 2NXEA 3FUXA 1V37A 4JHZA 4EVNB 3GMIA 3MMNA 1IBLB 3KJFA 2C58A 1X8XA 1T2FA 3GRBA 2XLBA 1RYDA 4XBPB 1QIMA 3GFRA 4QPPA 4TMWA 3SN6A 1EK6A 1L4FA 2HHCA 2VZEA 1UDAA 4I7ZC 3KPRB 4HAOA 2H45A 3VVMA 2BZSA 1EWTA 1JR3A 3DKKA 1NMYA 4JL1A 1WUJS 1SH7A 1KV7A 5DN9A 3WYGA 1NXSA 4A67A 1QKIA 2ZXQA 2FY8A 2E4TA 4E4TA 4D9BA 4QZVA 1RMFH 1B8UA 2DFKB 1J25A 5DGDA 1CEEA 5DVPA 1VGEL 1ISGA 1KMQA 3BTUA 1O97C 4XD7D 2HUHA 1EXVA 3QP3A 3C5VA 1F2VA 1YJCA 3AZUA 1WSDA 3MRIA 4F33A 3CX7A 1K8YB 3NT4A 2Y8EA 4J2HA 3EVGA 3L0OA 2QT0A 4CM3A 3ATDA 2PKYX 1KZHA 3B1FA 4FQ7A 3RJQB 1QPGA 4G89A 3RURA 1LEIB 1FG2B 3T65A 2WZ6A 3CNQS 1RKXA 4W9JC 1H9VA 4B9ZA 4V0MA 1FUEA 4JM2C 2CMFA 3WLJA 4GRDA 1PHRA 1U0JA 4J3BA 4AVIA 1FCJA 2DU8A 4F3KA 3SJ7A 3HB4X 4P59H 4GYJA 1LE9B 2W91A 3IDIA 3HB3C 4IQ8A 2V5MA 3L4TA 4GQPH 5CA0A 3SQNA 4BQ9A 3NAMA 5HQJA 4CXMA 1HKLH 3DKPA 3GBLA 3PGLA 1ORRA 5EU6E 2JI2A 4RACA 4JC4A 1FL5A 3RV4A 5J12C 5AQ0A 2ZS8A 2XUJA 1KJYA 1NDTA 4P5EA 1AIFA 2E27L