3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
4JJ7A 4N7MA 5LUAA 1M72A 4EJFA 3GJSA 3R5KA 3UOAB 4QU0A 1NMSA 1I3OA 3DEHA 1RWPA 1SC1A 2FQQA 3KJFA 3DEIA 3QNWA 3R7BA 1SC3A 3H11B 3H13A 1KMCA 2FUNB 3E4CA 4QUBA 5IBCA 4JR2A 2H51A 3R7SA 2XYHA 4JB8A 2CNOA 3V4LA 1RE1A 4M9RA 4PRZA 2C2ZA 2H4YA 5LUBA 2J30A 2FP3A 4NOKA 4AW9A 5IARA 1CP3A 4QUJA 4D3YA 2H48A 4ZVRA 2QLJA 2C2MA 4QUIA 2H5JA 4NBLA 3V3KA 2CNKA 4I1RA 5I9TA 4ZVTA 2DKOA 4FEAA 1BMQA 1RHRA 1RHMA 5JFTA 4QU5A 4N6NA 4DCOA 5IABA 4NOLA 2J32A 3GJRA 2NN3C 2XYPA 3PD0A 4NBNA 2CJXA 4ZVPA 1K86A 1I4OA 3D6HA 1F1JA 4N7JA 2XYGA 2QLBA 5IANA 3D6FA 3S70A 2CNNA 4IEFB 1I4EB 4HQRA 5I9BA 3ITNA 4HQ0A 3SIPA 1ICEA 4EHAA 4ZVOA 2C1EA 4ZVQA 4AWAA 4ZVSA 2XZDA 1QX3A 4QUAA 4JR0A 4HVAA 2H65A 2CNLA 1RWKA 4PS1A 1I51A 4JJEA 1PYOA 4QUEA 5IC4A 1K88A 2K7ZA 4QU8A 1GQFA 2P2CA 4EHKA 3BIJA 4PS0A 4JJ8A 5IC6A 4FDLA 2J31A 2HBQA 4JQYA 3GJQA 4EHDA 2CDRA 3PD1A 1QTNA 5H0IA 4I1PA 4FGUA 4DCPA 1NMQA 1NW9B 1SHJA 5IASA 5LU8A 4NOJA 4QUHA 3RJMA 2Y1LA 3KJQA 4LSZA 1RWMA 5IBRA 1NMEA 5K20A 3IBCA 4JR1A 3DEKA 3H11A 2HBYA 3OD5A 4IYRA 2H54A 2HBZA 4EHFA 1F9EA 3UO8B 1JXQA 1QDUA 2H4WA 3R6GA 3D6MA 4FXOA 4QTXA 3SIRA 4DCJA 2CJYA 2WDPA 3R6LA 3GJTA 3V6MA 3V4OA 5IAEA 3H1PA 3EDRA 4QTYA 3NR2A 4EHLA 2C2KA 4NOMA 3S8EA 1RHQA 3EDQA 4AWBA 3R7NA 3V6LA 1RWXA 3NKFA 3P4UA 2HBRA 3R5JA 1RHJA 3P45A 3NS7A 4D3XA 1IBCA 3IBFA 4PRYA 4D3ZA 3KJNA 3K7EA 1CVRA 1RWVA 2QL7A 2QL9A 1RHUA 4NBKA 5IAGA 5IAJA 4N6OA 1PAUA 1RHKA 4QU9A 2QL5A 4ZVUA 1SHLA 2Y0BA 5IAKA 2H5IA 2J33A 2QLFA 4QUGA 5IBPA 1GFWA 2C2OA 4QULA 3PCXA 4N6GA 2AR9A 1SC4A 1RWNA 3V55A 4EHNA 1RWOA 4QUDA 3DEJA 2XZTA 3H0EA 4JQZA 4N5DA 1RWWA 5LU9A 4EHHA
chains in the Genus database with same CATH superfamily
1NJ8A 1RZRD 1ZGLM 1G7QB 3QEOA 1BQUA 1JVKA 1R3KB 5JCOC 4RA3A 1LP9E 4HGYA 5ICMA 2TAAA 1U7ZA 5BW4A 5EJ5A 3J8F7 4H7PA 3QWAA 1SKAA 4PC7A 1OWMA 4HP5A 2FZ4A 4M8VA 5CT8A 5GJBA 3BGWA 3WO1A 2NY2B 2G7ZA 5JVDA 5CVVA 5IHXA 4LOUD 1BKDR 4BE4A 4W5JA 1JGUL 4I2NA 2ZG6A 5D96C 1DFBL 5T3ZL 4TVOA 2DIEA 1FP6A 4ORZC 2HHJA 2PA3A 2GBFA 2IT1A 3ONNA 5DJCB 2GJJA 4K26A 4G8CA 4NE7A 2W65A 2OLKA 1TVHA 3MWKA 3H3XA 3HCAA 3VR4H 2FAUA 3RTCA 4JFXB 4Z7VE 1GYCA 1NFQA 5T4EA 3FM9A 1DCFA 2GPNA 3A4DA 1Y82A 3E6HB 1ASOA 1YFJA 4ESEA 1V1RA 1AD0B 4F57H 2SHKA 3SYNA 4P4LA 2WWTA 4ROSA 1GTL1 1SQ6A 4HF5L 3WI7A 4WBNF 3LPCA 3EBHA 2O6HA 4S1NA 3SDAB 1N64L 3TEWA 1RQLA 2WXMA 5IC5A 4QDXA 3ARSA 4Z8FH 3QEQA 1E20A 5IBUB 3DMMA 5BSUA 3LG2A 3PGJA 5HGHA 3T8XB 2RGXA 5MFPA 3P94A 4BL5A 4ZI2A 2FN9A 5EG6C 3P3RA 3LUFA 3S3DB 5T33H 4IZ6A 2W98A 2QVZX 3BPNB 2K7FA 4RDBA 1W6UA 2Q7OE 3DXAE 3BTUA 5LCVA 3Q3IA 2F2TA 1I0LA 4TTSA 5IHLB 4WECA 1LXCA 3C60C 2NX5B 1QBML 4K07A 4PC3A 5DGTA 2CFSA 4ZFQA 1VZ3A 3MUEA 1RRGA 4KI5F 4Q1BA 2I5YH 3OAZH 1MFDL 2OMXA 1PVVA 4FSDA 4EHKA 3L5XH 4NG4A 4YHBA 4R4ND 1OFIA 1X42A 3LEVH 3REGA 3HWSA 4YNBA 5EZYF 3AXLB 1EYZA 5CFLA 4RVHA 1JJ7A 3WWDA 5AVYA 1P62B 4OQTL 3AS2A 4LRXA 2ZRHA 1NINA 1R24A 2X09A 4QASA 5HYSG 1N75A 4AQ8C 1I33A 1U1EA 4G4SP 3IWVA 1UEJA 2BTEA 1E1NA 3NRBA 2I3ZA 3W81A 2D62A 3GQVA 2EWVA 1FLTX 4FXGB 3HC2A 2MTAA 2J88H 3FCYA 3EULA 5LVAA 4MHOA 1K5PA 1J2TA 4G0XA 2WFLB 2G4CA 5DEGB 2JKYA 4NI5A 3KD4A 1AKQA 2AEPL 1D6EA 5I1IH 3RL2A 2BMKA 4NI6A 4YRDA 3W39B 1E6JH 3INNA 3WTTA 4DUWA 2FUCA 7FABH 2WT4A 4AE1A 1JHXA 4MNGA 3T61A 5DNCA 1BQ4A 4TVKA 3MRQB 2VUYA 2DEWX 4Y4HA 2QRVA 4BIIA 2C9MA 4YH6A 1QTYT 3DTVD 1RKRA 4MSWA 4UPEA 3QGMA 5LD2C 2OS7A 4C4XA 4OCXL 3MRFB 1QLEH 2QQFA 4AY6A 5IVNA 1EQWA 3TR0A 4AYBA 1GJIA 1FNAA 3ME0B 3CIOA 1ZHFA 4H18A 4FYWA 1E27A 1KETA 3LLVA 4QSMA 3PWPA 2P2YA 3RVUD 2FE4A 1S2MA 4G5QA 1F3JA 3D02A 1JG2A 1OAXL 1VYHA 2JLAA 4EARA 2YOCA 2NYZA 4QY8B 1I30A 4QWWD 3GEHA 1E8ZA 4M1ZA 2IC5A 1BIFA 1P7PA 4J0EA 4KZEH 5DT1L 2R4SH 3CH8A 4A27A 2YFOA 4XC1H 1WNFA 1KH3A 3OZKA 1KBGH 5LDUA 1J1UA 4G6ML 3KQQA 3TB4A 3CZ4A 1W7AA 3JV5A 3ARDD 1KRXA 4I9WD 2BTOA 2W60B 4D9NA 2R56H 1SOAA 1FYXA 1Q7EA 4K2UH 3I5YA 1UCTA 5EPMB 1NZRA 5K3CA 4K6HA 1ZG3A 1TPYA 5GRUH 3JV6B 3CN3A 2VE6B 5BUSA 1A9RA 2FGJA 3AESB 1XWWA 2O50A 3HBPA 3D0VB 3GMRB 3TCXB 5HHXL 4G42A 5LN8A 1HR0B 3QEGH 2A9MH 3GAAA 1N1GA 4LHZA 1EG2A 4YXHH 4NC0B 9ABPA 4BFVA 2HLFD 3ARFC 3G6AB 2DUUA 4TNEA 1VG9B 5KSVB 3X44A 3QPQC 4MD4B 4XDGA 3V7MA 3GLTA 3FFCA 1PG7W 1VI6A 4MA0A 4W81A 1BOOA 4HHAA 1EQ2A 1JWMB 1RYMA 2D1FA 3MRCA 4OJTA 4WKZB 2MRYA 1YO4A 2P43B 1Z17A 1PEKE 4RIFA 4I1SA 5HBRA 2QM7A 3S40A 3FSGA 4DM3A 4AL4A 3SWWA 4BMZA 4G8EB 3FIUA 3K4ZA 2ENYA 2HU8A 5E5LA 1J8MF 2DH2A 3SDCB 3W3BA 5JORB 4XD7D 1OO2A 4L15A 2ZWYA 2JIZD 1N4XL 1PJ8A 1PJWA 3IDXL 1N8KA 5AJZA 4XVTH 4F8QA 5IJ9A 5ALLA 3U7QB 3P2DA 5E6YA 3BIOA 1RZKC 1M2OA 1GQ2A 3G7NA 4UILH 2X4LA 1HYSC 3B9KA 2A4KA 3JALB 5AVTB 3DA0A 4WK4B 4CEIA 1T5DX 2RD2A 2YV5A 3O0DA 5EDXA 4P5EA 5KU7A 2XRMA 3GLQA 3JZ7A 1XDGA 1A6AB 4YPJA 4Z2YA 4XPBL 3UABA 5CLQA 5ER9A 3QELB 3CLRC 1NFKA 5GVRA 3VWJD 4L37A 1ITZA 5DRZB 4DPCX 4M1GL 2F19H 2WHPB 2H3NA 1BDHA 1FF5A 1RLUA 4FXKB 4CRPA 1AIZA 3AF3A 5TPWH 3F90A 2HR1A 1DQTA 4UDTA 4C0BA 3IDMB 1LY1A 4M8QB 1S3KL 4Q9QL 4DWWA 4PN6A 1F5SA 3TRHA 4P3YA 3SIXA 4NS0A 3G17A 3L7JA 1IEQA 5BWOA 1I2ZA 1YONA 2WF6A 4C7JA 2XQJA 3MO1B 4FFWD 2GA8A 4HQNA 4JVOA 3DUFA 4NCIA 2WYUA 3Q3JB 4BLUA 1KO5A 4LDJA 3BP4A 1AGPA 2LU3A 1N3LA 1G5AA 1KO4A 3JWNC 4WWOA 3WNMA 3UWDA 2Y3AA 2VBGA 1DHTA 2D3NA 1CD5A 1OR8A 3DZBA 1QD0A 1HFWA 1H6CA 2ZU0C 1FPTL 4YRPA 4EA6A 2GJ6E 5G0VA 2BKEA 5B6IA 1KC1A 1IBGH 2TMYA 1QSED 3FX2A 3GFSA 2XG5B 2GCYA 3Q6NA 1OFUX 5EUOA 5IW3A 4KJQD 3FBQA 2AOWA 2C84A 4P57B 4ZQGA 3NU1A 3F8TA 2XUHA 3D9AL 4JLNA 4AQYB 1Z5YD 3P3UA 4HQQH 4P46A 4UBDD 2YWXA 3A6CL 1BOFA 3Q0HA 4PYHA 3HNTH 4JPVH 4B3BA 2J09A 1FVCB 4I4LA 621PA 2Q3CA 3MJGX 4PONA 1I2BA 3LUGA 3UO1L 3C4JA 3H1EA 1DX6A 2BWJA 1L4LA 5GS1C 3GU3A 3H3JA 1IKOP 5C09E 4U5QA 1U8PA 1EZVX 3H0CA 3EAGA 4WLVA 3QZOA 3CIFA 3TJMA 1A6ZB 2IW1A 5LAXB 4K23H 5L4NA 1HEZA 1P3Y1 4R31A 4XZ4A 1CLOH 5B2FA 2KHZA 4JN1H 3MXVH 4KXZH 3GV0A 2NSJA 4WN3A 1L9RA 5C97A 1S8NA 4WT7A 1JDTA 4F9LA 3ZJ4A 3HI1B 1OAQH 2J9GA 2I26N 3UZEC 1E8XA 5I75C 1YA5A 3EGSB 4PRDA 3TH4T 2VLRA 4WW2F 1YQQA 3C24A 4JHWH 1NIAA 3OQ6A 1X74A 1NLFA 4IG4A 3FPCA 4XPAH 1JXQA 4QPEA 4WOKA 4HUCA 4M62L 4TL7A 2ZR0A 1MJNA 4ACPA 4MICA 4TVSa 3L95A 2F1KA 4LX8A 3OAUH 5IF0B 1U95A 1GWNA 2GPJA 5JR3A 3OMWA 4N40A 1UOQA 1DN0A 2WUCH 4D3CL 3AVEA 3GIDA 3HXQA 3K6IA 3QPXL 1TAUA 5IS2A 1FYTA 4LK2A 1UCFA 3E3MA 1HV8A 1YPZF 2EHJA 3WNOA 3HVRA 4FE3A 1RYBA 4J7RA 4KAXA 3ANXA 4JFRA 3NV7A 1TZ2A 5CLTA 1VLXA 1J1PH 3H4TA 2CJ3A 3DM5A 2EKSB 4DP0X 1KSJA 3DQQA 4KXWA 3EJQA 1T4KA 3L0PA 1P81A 2JNZA 5LKNA 4V24A 3WD5H 3T77A 4MAYB 2R5NA 2OTWA 1E7SA 3WSQH 3RGWS 4RKYA 1QQTA 3F7RA 3D9AH 2IHYA 4KAJA 1NVFA 2C4VA 3CFBA 3CE1A 1J2YA 2ZBFA 4I77L 2VF5X 1CS0A 1BQLH 2X12A 5EIHA 4MVXA 3LHFA 4GRMA 4MRPA 4GW1A 3L1KA 3X13B 2HCRA 3QDJD 1KYUA 5BW6B 1UFKA 2FEEL 3K70C 2ARJA 3ZVLA 3HWX1 2FB4H 3OAYK 1YC5A 2F4VB 3WS7A 3VFRA 2EE2A 1QATA 1KCSH 5HHQA 1K4YA 4B9FA 3LD8B 4HDCA 4W1QA 3G23A 3BX1A 4WCFC 4MQFA 2BAGA 4LBVA 2BPBA 5K9OA 4KDTC 3Q0TA 4UAUA 3TW8A 5KBNC 2VRBA 3TONA 3U7HB 5AVZB 3NJNA 3GG9A 2VBFA 2CO1A 4V3BA 4WOCA 2FPOA 4F2MB 1Q16A 3JV7A 2VO1A 2W0MA 3T0DA 2VLIA 3OOEA 3KPSD 4HWZA 3RIFF 3UJTH 2C5DC 1YKFA 1G291 3OSUA 5I74C 2B8JA 1KEVA 3T08A 3VXRB 3OHPA 4BP9A 1ZGZA 3MJRA 3ROLA 5SYNA 3BP7B 4NQEA 4CLOA 4L0DA 4MIKA 4DJJA 3HI6H 1QR1B 3PFHA 4E11A 4KBGA 3HS8A 1NOAA 5B1HA 3DZKA 2OM2A 2X70B 1QCCA 3GT3A 1GA6A 3JUYA 1TLTA 3DHPA 3RSFA 1TDQA 3DRQB 2L42A 3RDTB 4PZYA 4EG0A 2NXCA 2F48A 1Z22A 2OCFD 1DQML 3QUSA 4JG1H 1TF4A 2C9QA 2OZ4L 2IANA 3T8MA 2PQ6A 5KVSA 5F9JB 2WJ4A 3VC7A 3G13A 5IOKA 3F12A 2Z7ZA 4HKBB 3OZIA 2PRSA 2EJ1A 5IVZA 5K9KA 2QOEA 3CLKA 5DASA 5HQ3B 3QWIA 3DHEA 4LGRB 5KSAD 2XTJE 2FXIA 1YOVA 5FGBA 3EPHA 1CE1H 1PG2A 2VQ6A 1KENL 1Z63A 2Z31D 3QOFA 1E4WH 3JQGA 3A23A 3RNKA 3DX6A 2IH1B 3H2GA 2O3TA 3P45A 3FCEA 3PQ8A 3UTQA 1K7XB 4EI2A 1YKSA 4OI1A 2XT1B 2PZFA 2QVYX 4BVKA 3PRJA 2CLMB 1WRFA 3GTVA 3CHYA 2J5XA 1DN2A 2E18A 4DEWA 3GLGA 4O02L 3N70A 4O4JF 3TZKA 1MJUL 4NR0A 1H8ED 1HE1C 1IFXA 1NMSA 2EW2A 4UM9A 1WVZA 2G9NA 5DR5H 1RLIA 1A9BB 2RFXA 1PLBA 5AL8A 2VRKA 2P4UA 4OFIA 3UWMA 3M3HA 1WBJB 2ZSJA 5MEOB 1GKUB 3JYOA 3RK0A 1LRJA 3NTQA 1QHEA 2R6HA 3ZIMA 1WF6A 5H3LA 4HWUA 4NC9A 4M9OA 1V8BA 3HG5A 3KPWA 5I7UA 4ETWA 1ANKA 3O1LA 4US2R 4IQGA 2CO2A 3BE6A 2QRMA 3WGVA 3PQYE 2VL5B 4L22A 3TBTB 2E5WA 3QHFH 3DE0X 3B51X 3ULVL 1RCTE 5FC9A 2D0HA 1C9KA 3RH0A 5GVSA 1IGCL 4Y9CA 4OBWA 2GD1O 2UY6A 2WKPA 3ORFA 1NW8A 3QYPA 4ZD3L 2BKVA 1XELA 4MRBA 4ENQA 3TBYB 3MOIA 3R0XA 1VEOA 5DRWB 1BFKA 4XBEL 5FA6A 3CURA 4H8WC 4PJ6A 4D9EA 1GFSA 5E38A 4EY4A 1HLDA 1JDBB 3UTSE 3NSYA 2QGNA 3BS4A 4J9UE 1AZBA 2JS7A 3RVVC 3A9SA 4NPYB 3CVJA 4J8RA 3VRIB 2QLMA 4GBXD 2AF2A 3FF4A 4ZU3A 4JUBA 4I0KA 4M88A 2ZJZA 2R2GA 4WQOA 3CLHA 3O75A 3ZTNH 2EG9A 2CNBA 4O2AB 3KPVA 3L8DA 3U0TA 2X9QA 1IPFA 4I0CC 3UIZA 2F9LA 4ABWA 4HWEH 4B4DA 4V03A 4RFNB 1MW8X 1FAIH 2FHFA 1TU3A 3MYJA 1MWAA 2QG9A 5DVMA 4XIJA 4PJIB 4MA1C 1C7FA 1LNSA 4NYJQ 2NUPA 4DMFA 2XTLA 4ZC8A 4FB5A 2TRHA 1CZ8L 5LD2B 2DQUL 4Q8BA 3ABSB 2P6MA 3BO8A 2BLNA 1JWUA 3LBAA 1WUZA 3T5PA 4JY6B 4UBMA 5KPJA 2EXTA 1PUXA 4TF4A 3EUEA 1OP3K 3KLKA 2IUTA 4BQBA 4GLOA 4WN9A 3VFUA 4ZVNA 1QQDB 4LJAA 2FK7A 4MCHA 3LFUA 4NKOB 2IXGA 1EX0A 1F51E 2V4MA 1WUJS 3IS1X 2VXVL 2J4CA 1WR8A 3IBOA 1A5FH 5CU9A 1RHHA 4H0NA 3ARVA 3FD8A 5H8WA 2WMPB 3T7IA 5EEZA 2B98A 5HYSB 3C9NA 3URMA 2XSZA 1GGTA 3V4VL 3NJHA 2BM3A 4ZX6A 5AB2A 4PZ0A 3HC7A 1E5YA 2AOTB 3IP5A 3CC8A 2JMRA 4ZXBD 2W6PA 1PK8A 3QE4A 2HVKA 3PIDA 3RWDB 5EU3A 1PS3A 4NQZA 1QA9B 5CU7A 2PQMA 3TZVD 3U1SL 1RP7A 4B3VA 3P54A 1ZTXE 3LHKA 2FSGA 5HHPA 2X6UA 3T06B 3D4OA 3GA0A 1MO3A 3TBCA 3VGDA 1L5HB 2HCTA 1T2QL 2LU5A 1ZW6A 3N0RA 1Z32X 5KYXB 2CXQA 5FO1A 3FFCE 1ISGA 1DC6A 2C2ZA 3F9RA 2UZIR 4NZDA 5MENE 4J6RL 3VI3A 4L48A 1SOMA 1QK5A 1YDMA 3NWPA 4K6CA 1UFOA 4U7TB 4Y6SA 3POCA 5SV4A 4LVOC 1YQXA 1BBJA 4ZS6C 2H9GB 4K9EH 2ZYSA 4JDEB 3EQ7A 1Q91A 1IY1A 4Z4EA 2IU0A 1ODKA 1LI5A 2O2JA 1AQNA 3OMLA 2OCBA 1J8KA 5FUMA 3ZW9A 4F3CA 1T9ZA 3FFCD 5F44A 4RTOA 2GF2A 3HE6D 3HVKA 3CUKA 1MB3A 1I8TA 2PRZA 3AVVA 4YLYA 1QH8B 2A9RA 3P02A 1JNLL 1K6IA 1JN0A 5FO9B 1DKNA 2AFHE 1FH5L 1P7YA 5HOQA 5ANMA 2AVFA 4FA8A 5KSBB 2HEIA 4BP3A 3UAJC 4Q03A 1P3DA 3TAHA 4K73A 4DCQA 3BKXA 4TSFA 1HRKA 2YVQA 5HGJA 2IH5A 3VMFA 3FLEA 1ROWA 2ZJ4A 5HBGA 4ZDHA 4YNYA 2UVDA 1PJCA 1UURA 4UDUA 1JXJA 2H0EA 4FFYL 3RG1C 3SYTA 5THKA 2WP3O 2JJ8A 5I8ZA 2X5KO 5L4IA 1D3AA 4PX5A 3DR3A 3AJ8A 1RAGA 1W9MA 4JM2B 3CX8A 1UC6A 2J9FA 4RA6B 4Q2ZA 3QXCA 1YH3A 4RCZA 5JYBA 3SBQA 4XO9A 1VMIA 2JLRA 1DOZA 3VGAC 5CUSH 5I0VA 4BUHA 1YB4A 1OLSA 4JFOA 1XPJA 5SWZB 1LPPA 1VTKA 1K6JA 1T36B 4ZAKA 3KJZA 4EZLA 2JGJA 1XBDA 3HL4A 1YRHA 4BAUA 2OCCB 4YRBA 5BV2P 3LQRA 2CHFA 4CVXB 2J5LB 4YZFF 1CT8B 1LEGB 1EAOA 2CD7A 3E6FB 1Z4QA 1T7WA 3KPTA 1UOEA 3QXDB 4IDPA 3ZEIA 3DXAA 3U9LA 3PNLA 1E1LA 1OB0A 3R0JA 4EUFA 3L45A 3OZBA 5TV2A 1UWXH 5FWDA 4BFJA 2FHCA 3DTVB 4BBPA 3DJ9A 2YPKB 4I3GA 4P07A 3DPSA 1KELL 3DZHA 1BFTA 4EDXA 2PP9A 3LH9A 4BO0A 4BSJA 3L7FB 5F33A 1PNTA 2XYCA 1YCHA 5K09A 4NT6B 3ET5A 3RWDA 1XX6A 3F7MA 4XN7A 1BE6A 5FGRA 3KJEA 4RF3A 5IB3B 3SYAA 4O2LA 4C4BA 5DMKB 1LZLA 3LRMA 4O4IA 3ZUNC 1SBIA 2CBTA 4K8RH 2XCUA 3P0GB 1GZPA 2OP4H 3BREA 3X1ZA 1KPRB 2Q2QA 1H3PH 4LJ5A 4LSVH 4MCIA 1TYBE 2XTJB 3U9WA 4R4JA 4D9LL 4F0JA 3PWLA 1BJRE 3AUXA 3H8SA 3IRCA 1A9SA 4HQQL 1NCUA 3H1TA 4HF5H 4BCZA 3E4DA 5CB8A 1NMYA 3Q6FA 2IYLD 3DUHA 1E28B 1Q9LB 4DGVH 3L7FA 3OAAD 5AJXA 3MLBA 1IGMH 1XEUA 4UQBA 2FZWA 1TF5A 4LMAA 4PJHF 4DARA 2A1WH 1UEIA 1EO8H 3LN4A 5TF0A 3AROA 2ESVE 2GBVA 1SMAA 1WEHA 3ER6A 4C1NA 4C0SA 3I6SA 4UM8A 3ZMEA 5J40A 2PCFA 2R29L 1Q0EA 1YS4A 2IOFA 1DEEB 5E7FA 4D82A 4LCWD 2I4OA 3VXSA 1M42A 2EIKB 2AG0A 2K9UA 2PX3A 3DC0A 2P47B 1MJHA 1OY1A 3ICPA 5T7BA 5JSQA 3IF1B 3MTEA 5BZZA 1A7NH 2PUFA 1TLFA 4HYEA 3KZ8A 1G2PA 5EZYA 5H94B 4KWIA 3HAEG 4UASA 3RWBA 2AX4A 2A5LA 4ZHQA 4Q3EA 2QQNH 1IOLA 5HHVH 2H5IA 2CLVA 1M2FA 4XX1E 3FDJA 3P0HA 1FLNA 4JUAA 4IGAA 1JYNA 1SUHA 1TADA 4S0XA 3UH1A 1RJDA 5D3MA 1WU7A 4RS4A 3AMKA 5CLIA 1AOXA 2OZ4H 5BXFA 3D4BA 4OYRA 4UQCA 2JK1A 2DPHA 2FVYA 5AVQA 5EU6E 5T64A 1HZJA 3U7EB 4TMTA 1BSIA 3AIOA 5IZ4A 4V1DB 1WUYA 1TTPB 1CLZH 2XKKA 2Y8EA 1TRKA 2GJ6A 1JPGA 3CX6A 1BG6A 4JL8A 3WLOA 3D08A 5CCKL 1P9RA 1YS7A 3DWEX 1NICA 4FTVB 3BHBA 1ZDQA 2KZWA 4RBNA 2JJ2A 2VSDA 3Q1KA 2DTSA 5IQNA 3TAXA 1U8OB 3ZRCC 3G5VA 1D8TA 5E9QA 1NVGA 3LXRA 2N42A 3MCLH 5D1QA 2CO7A 5I0XA 2NY2D 3ZZSA 4AV5A 2F8LA 1WIOA 2Z5VA 1TQCC 5H68A 3VD1A 4I6JA 3WAKA 2PFKA 2IOIA 1U9CA 4JW3A 4BH8B 4KQIA 5ALMA 3MREB 4FQ5A 1R5IA 1AGRA 5DZLA 3NDYE 1AKPA 3CEHA 2V55B 4EG3A 1GGEA 1BGVA 2GYSA 4IBTA 2BY3A 2I3DA 5KSBE 4J4BA 3GZNA 4K9SA 1JVNA 1AS6A 5JS8A 3AYXB 4BZYA 4I4TA 2VLMD 5FI1B 3L07A 3MLEA 1FUUA 1N12A 2FAXA 2WSDA 1SCUA 3VRJA 5ADOL 1YQDA 4BZWA 1E6MA 1NJ5A 2QZZA 5ADWA 5LGYA 1GLNA 4DLNA 1KCVL 1BEYH 2TECE 1VHDA 4YHOH 4R9NA 1Q72L 1QVOA 1P1VA 3FB6A 3GXNA 3M8OH 1I8IA 3VPDA 4PAOA 2X76A 1B1AA 5KOVC 3EYSL 2OEPA 4HH3C 2F2HA 4TRJA 3ICQB 4FIDA 1KYYA 5HHPB 1M0SA 1EH5A 4PU2A 1S7VA 2JIBA 4FLEA 3QCVH 1KAGA 4MCMA 1TL7C 1UXGA 5HHOB 4CA4A 3D25B 5KN5A 4F46A 3KB8A 2HUNA 2OCDA 1TCVA 2ZQZA 2P69A 2D8MA 3EJCA 3ZZ0A 3UG4A 4ZGGA 3PE3A 1ZJAA 2EARA 3BH4A 3NNSA 4WK6A 1R0AL 3OZTA 2CD9A 3KKEA 4Q4AA 1QI3A 3SC2A 4KKBD 1C80A 5DX8A 2JJTA 1JCVA 1BHSA 4KR0A 4JOQA 3BMOA 1M0WA 1UJNA 2LE9A 3GW8A 5D1ZI 2QGFA 2OBBA 1PR4A 4LHYA 1ORVA 1K5DA 4N3BA 4MA5A 3FFXA 2H92A 5FPYA 4Y1AB 3H6JA 3RAJH 5CCEA 2CDNA 2M6KA 3UYRH 3JD3A 2JH2A 2AF3C 1Q94B 3FCCA 1AQDB 1Z2NX 1LA2A 4XP4L 2OG2A 3TX6A 3C5VA 4HMCA 3BESR 3KZ1E 1U28C 5EL0A 3F05A 4MQ5A 3QIUD 3GZ4A 2IXAA 4KNUA 4ZPVA 3PFKA 1KEEB 4B48A 2QLVB 1M57B 5DJYB 2XWQA 1CUJA 1GGFA 2I6FA 3COSA 4HLDA 3L3JA 2B37A 2C2OA 5BV7A 4X97A 3RAPR 1ZH6A 3ZLUA 4Q0XH 2F64A 4DKXA 3SXUB 4PJIA 3GJEA 4ZXBB 4N7MA 3Q9SA 4RGMC 5IRCD 4K0KB 3TRFA 3IQEA 4YO0A 2ODAA 4JHXA 4GG6B 1V8FA 2HA1A 3RAJL 1WB9A 4XNZB 1D5WA 4OI8A 3NA9H 2NPOA 1I8LA 4UILL 3O5AA 3UK2A 1T10A 1FWXA 2QFPA 1UPFA 5JLZB 1JU4A 1R0CA 3PG5A 1N3NB 3DMPA 1GL6A 2B4TO 2WKRA 4IKOA 3JPYA 4BWVA 4QNNA 3HM2A 3ZHQA 3ANMA 2GK0A 1NWCA 2CFOA 3HCOA 3PKIA 2WW8A 5TQ0H 2BS9A 2HRRA 3Q9LA 2QYTA 1K4DA 4KTDL 4K3UA 5EINA 3WGNA 1X5IA 2C9DA 1ET5A 4TGLA 2CBGA 4NO2A 4H0LC 1CJCA 2W59A 3UEZA 2A6JB 3GT0A 1S2OA 4WZ6A 5F93C 4XPTH 3GLRA 2JK5B 5IKCB 2Y92A 3H2BA 3VWKC 1KEUA 1FYTB 3DEYX 5DIFA 2H32H 2XMDA 3F7PC 2PUQT 4AH2B 2BBOA 4BBWA 4KYIB 1T5LA 5HK8A 2XTAA 2EFDB 3AUSA 3E3QC 2BS71 3SS9X 5CXUA 3D2UB 4Q9BA 5I8EA 4QLRA 4Q9IA 4TSCL 3N3AC 2QNRA 2MR6A 1E9VA 2CHZA 3S1AB 2CZCA 2PLWA 2DLEA 5T5NF 2B69A 2OL3H 5JNUA 2E59A 1ZCZA 3GXMA 2ZJAA 4CMMB 2AC2A 4D9LH 2A0WA 4ESOA 5CX1B 1YF3A 1FFYA 4YFEA 2A5FA 5KTYA 4DKDC 4R6WA 3HI1A 1CHDA 5JMPA 4OZFB 2VZ1A 4HT1H 1ZONA 5A1TA 2P62A 2RAVA 2UZAA 2QZSA 3AJ7A 4PG8A 5SX5K 2OOSA 4LGMA 4KQCA 3MCLL 4J0HA 4MYPA 4X7TA 4IBYA 5HDBB 4HRVA 3O0RH 1QBLH 1Y1PA 3TSYA 2ASEA 3NESA 1X19A 3INOA 4DANA 3A6BH 1TUBB 1Y6RA 1TZHB 1YEEH 4GP7A 1OLUA 4HOWA 1CZHA 1X9LA 2H4XA 1ONNA 1KCUH 4ODTH 2JH9A 4AKSA 1DO2A 1E0OB 5IN5A 3MRPB 2HMWA 2FEPA 1GIGL 4YJDA 3DDSA 4DIDA 4X65B 3TA3A 1DWUA 3LT4A 2QM8A 3JQDA 1PZ3A 1J1XH 1CLVA 1NNEA 3HE3A 1CJMA 4OGGA 1J8SA 5IW1A 4TMYA 3IUQA 2WBJD 4BVFA 1Z39A 2W2TA 1WVMA 4LOVA 2QTEA 1TYAE 3PQYA 4PRBA 4NDMA 5FUOH 4N6QA 2HDWA 1DT5A 5AT1A 3GJ3A 5FKJA 3OKOA 4DGYL 3UTOA 4JD5A 4APQB 2DIJA 4G1BA 1ZC3A 3LK6A 3P9IA 4I9NA 2HU2A 5E5UB 4OLUL 4GMSL 4OFDA 1PIWA 2W9EH 4MJ5B 2VXVH 3VR6A 1CYXA 3A2LA 1C08A 2ZRBA 3OP4A 2ZJ3A 5AVRB 4P2QA 3PC8A 1ILWA 3S55A 3NQ41 3BAKA 2AW2A 2WC7A 5K0CA 1TNDA 3RWHB 2E47A 1Z66A 1KXHA 4ZODA 1KG0A 3VDRA 4F4DA 2DT8A 1T1WB 4G6AC 2ZRIA 3WWOA 1XQ4A 1ZMTA 4N3CA 5IBUG 1R3LB 3V3KA 3D7KA 1JLLA 3ONDA 4DA0A 4G67A 4Y9EA 4XX1A 1Z6YA 2ZIDA 4GIPD 4OIIL 3BJLA 2XXAA 2OMVB 4G9GA 5D7JD 3GLIA 5JZBA 1YRBA 2OENG 2JIRA 1KTVA 1QVVA 1PT5A 3CNOA 1HURA 3CLSD 1FMCA 3LAFA 3MGTB 4PGDB 5G5DA 2WU8A 4R69A 5K8IA 2WHPA 3DTYA 3X1YA 4DNQA 3ZS8A 3VGBA 3LEYH 3G6KA 5DYGA 5D2NB 3RRZA 5EMNA 4JFUA 5E95A 1GGNA 1JXMA 4J3VA 4D9GA 1NCGA 1WRBA 2HQSA 1R8YA 1KXTB 1BX1A 4YO0B 2CHXA 3L1OH 1ZLUH 2HG5B 5JSHA 2ZUWA 1JRHL 2IANE 2YBGA 1G4HA 1FORL 1K9VF 2R2AA 3VPCA 3PPSA 3EODA 1E2IA 1DHKA 1ESCA 1MCRA 1F42A 4OQXA 2WTAA 3ZTYA 5DVLA 3QIBC 4IF4A 4XNAA 3T77B 3AV0B 5F2EA 1E3FA 3RTQA 4YGYA 1Z73A 2PLNA 4LDLB 3WS6C 2NU8A 3SE4C 1CL7L 4XCFL 2IPTH 3D33A 2WIAA 4YLQT 4GSRA 3SE0A 3LT2A 1QRDA 1CF9A 5I28A 3V46A 1TNMA 2AOVA 1Q94A 4NICA 2GSWA 2O93L 3SZKC 2NZ1A 1ZS9A 1XF2A 5D7IF 2DV6A 5F7NC 1JWMA 4M7ZC 4RA6A 1VHPA 1P1IA 5HJGA 3L04A 2OVBA 2QV0A 5D5MA 1G42A 3GNMH 1WB6A 2VP9A 4KPUA 4C4PA 1FYHB 3WLTA 1U6AL 3O8QA 4U1JA 3VZCA 5A1JA 5DLEA 3HP1A 2FZVA 1F06A 3SDXA 3LV3A 5IANA 1Z08A 5C3TA 2PS0A 2G70A 1NCWL 3KSZO 4QCIA 3BAZA 1KU6A 2FTAA 1XH3A 2EWMA 3TX4A 2QVCA 2O3SA 3D0VA 5F7XA 5PCYA 5LP6A 1JB9A 5BJTB 1KMNA 1JSYA 2D06A 3VNUA 2R1TA 3K3PA 4BMXA 1F6AB 4DKFL 5IBQA 2ZJBA 3PU6A 2BOLA 3UXMA 2BIFA 1D2AA 3EHDA 3ZRFC 1FFTB 4FOSA 1PVDA 3QDMD 2PXYD 4G8IA 3H65A 1RZQA 5C0GB 1OYVA 3RHSA 4BHTA 4P5MB 4WEMB 2G75B 3CRQA 4UNVA 5EWLB 4K7PY 4JGGA 1ASQA 4MB6A 3QUKA 2XQFA 2K6ZA 4DMCA 2Q1EA 4MGEA 1Y9EA 1J8DA 1PKXA 1XRNA 3IELA 2NO6A 2BH0A 3KT0A 1PJ2A 2YFHA 3A6FA 2EKBA 3MPUA 1TO2E 1SUDA 3RTDA 4UTNA 2HZ7A 2QV4A 3ID6C 3M3DA 3UTCA 4X8HA 2V2WB 1PUIA 4DP8X 1RK7A 3FF8A 4V2IA 1HI6A 4U0QB 1T04B 5DPMA 3B56A 4GO9A 4OZFG 4YRLA 1RABA 1IN7A 1U8KA 3PRYA 2GCOB 2LW3A 3QUXC 4OJMX 4D42A 1BD3A 3G6JE 5C9KA 1W4ZA 3BZFB 3L16A 3KQYA 3FUUA 1OW3B 3ZE2B 4OXKA 3SD5A 3AXHA 1GZ3A 3ITNA 1BYUA 3SZOA 3EF4A 4GPVA 5CA0A 5CDSA 3FWNA 5KS9E 3BHBB 2VXSH 4PJ9C 1TUPA 3C16C 3K1JA 3W9YA 3C3CA 5CU5A 1ADBA 3ZL4L 4I1YA 1RZFL 1P2UA 2HLDA 1F3OA 4U1RA 1Y8AA 1V05A 5CW1A 2OI9B 3PK0A 3EJPA 4FYKA 5AVKA 4PJDE 4NQDA 2GVDC 5LM3A 3W39A 1PX3A 1RJGA 3NIDB 1WEKA 4HKXA 3B8YA 4Y4FC 1XYVA 4ODBD 4J8PA 4F57L 4B9ZA 3TZBA 3V52L 5KVGH 1Z4MA 3FUNA 4GO6B 1IWPB 2D2IA 4B4UA 3D8HA 4ZV4A 2R8YA 1BV8A 5GHWH 3OZGA 4Y7DA 3ZYCA 4M7LT 1J0KA 3KAAA 2CXUA 2NNLD 4HIPA 2HXSA 3HXPA 1L7PA 4PGGA 3G9UA 4Z4QA 3BEWA 1LP9B 3LWDA 3PHAA 3IFNL 1X13A 1RWNA 1OY3B 1YJDL 3LOWA 1UWEH 3BCFA 1ST3A 2DQIH 3JAKA 5GRJL 1CD1A 3DETC 2FWSA 4N5IX 2APTA 4HH0A 2O05A 3ZN6A 2BX5A 2JJUA 2KLHA 2XJKA 3KZMA 3CUSA 4ZCSA 5EO9A 3X11B 4B45A 2AJ3B 4NWIA 4BMSA 4GT7A 2ZYUX 4ECNA 4DN4H 3ROEA 1Z9SB 3CUWA 5FM5O 1UJ4A 4GX2A 2Q7YB 1WZLA 3OFKA 3HN6A 1HNYA 4ZUSB 1NCHA 3CW2A 1I1OA 5AUNB 3VR3D 3PPEA 1GZ7A 4KZDL 1BM7A 3UYPA 1ZIOA 1Q9LA 2HUEA 2E89A 4KXYA 5BOSB 3GPDG 4U7KA 4RIGA 4FWIB 4D3SA 5JJCA 5HE9A 2Q2LA 2REQA 3X3FL 5JHDD 5MN5A 3NIWA 3EVDA 4WCVA 4MD0B 2R1WA 3IAFA 2G5RA 3BD4A 3N1FC 3N6VA 3NCEB 1NBQA 3T0BA 2QRUA 5D7JA 2WLSA 3AQ4A 3QU2A 1X7ZB 4MJJA 4X91A 3CFBB 4D3ZA 4Q16A 2WB7A 1AD0A 3EW7A 2C7BA 4MQTB 3LPMA 2EDXA 1PTZA 5EHXA 5JIBA 3VR6H 1ODUA 4RJ2A 4KXVA 1T6XA 4XASA 2W8CA 3IGLA 2I4MA 3FOAA 5IVKA 2R51A 1E32A 1VL5A 1Y1QA 4LWZA 3R3ZA 2BZ7A 2DKMA 2ZTHA 4XXWA 4JHZA 1UMDA 2QSCH 2LLLA 4ANVA 4D41A 5FYJL 2P7IA 3T1FA 4EPRA 4BCYA 2XA3A 3MXVL 4XVSH 2Y1DA 2WHQA 4D57A 5F9MA 2J30A 3OTWA 3B7SA 3HABA 5EHIA 2BH9A 3QUTA 4IJWA 1QZ3A 2ATKB 3M17A 3TVMA 4HUWA 3KPRA 1LEGA 2V17L 5E4AA 3CNEA 1XZGA 3EVEA 4DE5A 1RXCA 3P3YA 1Z5VA 1QSFB 4J8QA 4PW0A 3HAEB 3G9TA 1R8JA 3S8YA 5H8DA 3QPDA 4PYIA 1X7GA 1N2HA 3HNTL 4KXLA 2P48B 3DMMC 2Y1GA 3MRSA 3S2UA 4J94A 1XH2A 3Q8FA 5DJ5A 5AHOA 2PN1A 5JNSA 1OVMA 2AJLI 1UXOA 4FNSA 1K0FA 4U7MA 1MPXA 5GRWA 1EEZA 2V6FA 1T21A 4PNHA 3UC5A 5B3KA 1SJXA 3WJAA 3UXEA 4NFBA 2C1PB 3ECUA 3BMQB 3FT9A 3KLHD 5CA1B 4FNPA 5DGHA 5CNIA 1THMA 1OIWA 4U02A 2OT3B 4AXBA 2E4VA 1QSFD 3MAAC 2R79A 1V7QA 4RJTA 2Z8SA 1Q14A 4L4JA 3MODL 2J2ZA 5IZCA 4KQJA 5EJEA 4UAJA 3E2IA 1P5UA 2JFGA 1ZHNB 3B1UA 3PGCB 4RWYH 1L3WA 5DLLA 3RGVC 3HKDB 3OPQA 5JBNA 4K5NA 1U8PB 1OPGH 4TQEL 2FMHA 4F72A 1D6MA 5JS1A 2ZYVX 3PX2A 4CC4C 2AXQA 3RTEA 4L2YA 4JR9L 3FZUC 3EO9H 4JRFA 2MCFA 1MHCA 5IQ9A 4UE3S 3WSQL 3PNOA 1STOA 3NT5A 3DIFB 5HMLA 1R8XA 5KAPA 2DLGA 4LJYA 1U6KA 1JZ3A 2AGJH 3MBIA 3ILPB 2HJLB 3X14B 1GG9A 2A6PA 4OZFH 2X8LA 1ID2A 4G7QB 1OX4B 4HMOA 3EDCA 3U49A 3KM1A 3FYCA 2AJTA 4MRNA 1JD7A 1R0BA 1OB1A 3D5EA 2PXAA 1A2YB 2QLBA 2QWXA 1RY7B 2PEYA 1YRAA 3KVRA 2ZXEB 5IX8A 4FONA 1JKFA 1HEUA 4GC9A 2ZZUT 4Y19D 3QVUA 4TWAA 1LJUA 1RZIB 2YARA 4N0UB 1E79D 1CB7A 4GKSA 1UBRS 2A0FA 3WO4B 1OV4A 5EYPA 3WQRA 4YYEA 2D5IA 1CC1S 3HMXA 2OO5A 4HX1B 4B3GA 3NPZB 3AT0A 2V7QD 3F01A 4DUPA 3A70A 2JKRM 5I15L 5F0MB 3FTUA 5I4KA 4PS4L 1CQJB 2XI4A 1S78C 4IBLT 3DEKA 4JDZA 2ICWB 3GMNB 5HRAA 4ZMVA 2YUWA 3C5WP 2YJ6A 4DP6X 3CBKB 4RIRA 4QRAA 1XSEA 3H1PA 2V7VA 4MA7H 4G0WA 2JLPA 3UJTL 3I83A 4A1FA 2JBAB 3HZVB 3IEAA 4ZMTA 3EFBA 3VMOA 5KTEL 4MVJG 2ACVA 3ECSA 2NM0A 3ZNOA 3TCKA 1CQYA 3T4UA 1C8QA 5E8PA 4XEUA 3FTEA 1B00A 1DEDA 2I32A 4PP1C 1RSFA 3RPKA 1GLGA 1YAJA 2P5WA 5CP3A 3B7WA 1VLHA 2HGSA 3N0PB 1N67A 1WDKA 3PD7A 3GHBH 4FHGA 4MWSA 1TK3A 1MCKA 2LAAA 3TR6A 3GUCA 4MJ5A 1RSYA 5FYKE 2F3SA 1M7IA 3GSNA 1XH1A 3Q5OA 3OBBA 2QPAA 3KW7A 1NATA 3OQVA 5KC8A 4QKTA 1S3IA 2PGDA 4BAZA 3WUWB 2QPSA 2A1IA 3OQ1A 2G25A 5FWAA 3J81k 4NO3A 5E6ZA 1NANH 1JA9A 4XVRA 3FCSA 1S02A 1E42A 1FVFA 1UFUA 2E8YA 3O2VL 3R24A 4PCSA 3B2EA 3CN1A 4DJEC 3L6OO 3NJVA 1NI5A 3EUWA 1IMHC 5IB2B 3D2UD 4PYQA 2FX7L 5E6SA 4BRVA 2OGTA 1BXGA 1DVFC 4WJKB 3EIQA 1NLBL 4BFCA 1XL1A 1A2OA 3A3YB 5EGSA 1YCDA 4MQUA 3KLNA 2P2GA 3DKIA 1EE2A 2WHEA 2YJ3A 3A6EA 3QI9D 2X4RA 2PUTA 5EO1A 3IDGA 3D8BA 3F7YB 1FL3A 4O02B 4KE8A 4QRPE 4MNHB 3TN7A 1O5DT 3B78A 3N5KA 2D0OB 1L9KA 4JFAA 1UXKA 3THOA 3ZXSA 5DN6D 4K7FB 2QPLA 1ZDSA 1GFIA 4UPVA 1Z1WA 5ANHA 4GW5A 2VMCA 1WJGA 3KCNA 4DSTA 5JI3E 4BFXA 2Y77A 2XB4A 2FPRA 3TL6A 5HM8A 3RIXA 2IWKA 4HSGA 4KI5D 3L92A 1LMIA 4LF6B 4PRHD 3LRTA 3IPLA 1JVSA 1B2RA 4UT7L 3C70A 2O5YH 1JHVA 3T0EE 1B0PA 3VFSA 2XNDA 1K8RA 1W1UA 5HCIA 5JNWA 3MF4A 4G81A 1E5BA 4N0YH 1A7PH 2JANA 4C7XA 1JPTL 3LH8A 1EUDA 3O4JA 4HDRB 4F4CA 1HT0A 3WRYC 3HI4A 3PDDA 1X86B 1BYIA 1L0QA 5D8JH 3HC0B 3ZHYA 1T66D 4E5XB 3ESXA 3MR9A 3M45A 1R8SA 4KK6C 4UBJA 4M61A 3G9QA 3WAJA 1K3UB 3EPRA 3RYCB 1JU9A 2UYQA 3R5XA 3JWNH 3EJRA 1G9SA 3T7DA 4GQZA 3IV6A 4G9FA 4ZTUB 4AT1A 3KDPB 3N3BC 4K8RC 4UTAL 1KNOA 2QUJA 1AC0A 2C1OA 1EGHA 1SHWA 4M6OH 2IS2A 3LS5H 1YQ9A 4YAOA 4MITA 5LZ9A 2AJZA 1DUZA 4XBPA 3VR2A 4WUKH 2ILVA 1JT9A 4JRYE 3OLIA 4WZBA 4LSUL 1VE5A 3DE3X 4Y7OC 4RQUA 3OHXA 4G0NA 1A3CA 3UFIA 1JS4A 2NT4A 4F2DA 1TVCA 5JW4Q 3I0ZA 1OILA 5AW6B 5CP7A 4F86A 3AT9A 2Z8YM 3DYVA 2ODNA 5TNXA 1VL8A 3QYMA 2XV3A 4L4YA 4KFZC 1ZS8A 3DEIA 4HWRA 1MXDA 1EUCB 5ALVA 3CKLA 2BRRL 4AW9A 1B74A 3RYFB 5EZPA 4K3JL 5GS0L 3C1UA 3EOTH 4GQQA 4DGVL 1A8PA 5DOVA 6LDHA 4AENA 5CJQL 3VH8G 5FYQA 1VFNA 1HCFX 4P48A 3JQBC 4L1BA 4LL9A 1JHRA 4M93C 1R8QA 1DAFA 1JK8A 2W6NA 3T94A 4KTVE 3PEWA 4H13C 4KK9D 1QV7A 3I39X 4LMQI 4UQ3B 5I5IA 3ZWCA 1IE5A 2GVNA 2WWNA 1W6WA 4XW2A 4RDQG 1FVEA 4XNQA 3RWJA 4P83A 2JKIS 3Q48A 2VTEA 1E43A 5CYPA 4D0RA 2XA9A 3UAGA 5LZ4A 2Z31B 3CJTA 1WSST 2Q3MA 4ZQEA 1A8QA 1YUHA 2UZ0A 4B85A 3ALWA 1E0DA 4V2UA 2DI9A 2C31A 2G9VA 4D3XA 1MQKL 3NI2A 1VLZA 5BQOA 3LTEA 4ZQTA 1OCZB 1X1EA 5JDJA 1K7YA 1D6JA 1FNCA 2F5BH 1RWVA 3L1JA 1A2BA 1WXXA 3MNDA 3PNYA 3B2QA 1JVOA 2ES4A 2PWFA 2KSQA 3H83A 5JH7A 1WVGA 3PNRB 5FR3A 4OXYA 4HGNA 1SR8A 2X3BA 5EN3A 2CVZA 3TVMC 2W0PA 1FJXA 3ZK0A 4Q05A 2ZSWA 1L3NA 1ZIYA 1V8HA 2JFZA 3G1WA 1CUUA 2XBLA 1CF2O 1E18A 1P44A 2X2IA 3MUHL 2ZREA 4N6RA 2DQGH 3CFYA 5I8PA 4B8YA 1P9NA 1ZWKA 3ZVVA 2CNKA 4FEAA 3TK1A 4NZJA 4NLLA 3X12A 5KHOC 3K5SA 3L6FA 3B82A 4K23L 3I9V6 4ZXPA 1VEMA 1U4SA 1I0IA 3K1YA 4YAFA 1WBXB 1XF4B 4H3HB 4B41A 2E9JA 2BRUA 2J88L 1QX3A 3C8HA 4KY1L 2PGNA 4NHOA 3ARBC 3R0ZA 5F7DB 5CXSA 5FBWB 4BJLA 1NBVL 2P6OA 4LPCA 4KJPD 2QTRA 3EJTA 1NU8A 1Z36A 4UOJA 4ENPA 3A4TA 4FFYA 4GI9A 3FO9A 2PKXA 3BD3A 4TMPA 4MO9A 3U40A 3VUEA 2V8LA 2PGLA 3ROXA 5HHTA 3EBLA 4DP1X 3EPPA 4U6TA 1F8TL 1KO8A 4PE5B 1YN7A 5AZEL 2QR2A 2ZSHA 2HLPA 1Z47A 1J09A 1QO0A 1YFLA 2WSBA 3D30A 5EB9A 5FOBB 1JYWA 1L1QA 2E3JA 3U82B 1AXTH 3OJ0A 3HJAA 1CY6A 2WSLA 4F24A 2Q3HA 2NZ9D 1DAEA 3DO8A 3MMXA 1I4FB 2EYSA 3BH8A 3O3EB 4BNZA 4HN2A 5HBBA 1Q0SA 5BV1A 3U3MA 2H2GA 4OHBA 3IBGA 4KKZA 1N9ZA 4I8XA 4JL2A 4LIPD 4UXHA 2CLKB 2HT2C 3OEWA 3TFWA 5L4LA 3VD4A 1Y7HA 5GAJA 4MASA 2GHIA 4M6NH 4PIMA 4A6YL 3WMEA 3QI2A 4QRTB 4DR4B 3F2IA 2ONJA 2YA0A 1ZK3A 3SX0A 3V1YA 1QRND 4MX7B 5BW5A 1ROCA 4YUAA 2MSPA 2YBRB 1KTLB 4MXQD 3NACL 4OSOA 6GPBA 3REVA 1M6NA 4PLTA 5C7XL 4MXWH 3AWGA 1MZPA 5EU5A 3ATEA 2FVNA 4ZOEA 2FD6L 1GL4B 4LQ1A 2IOQA 4ZK6A 3DTXB 1LO2H 4AJ9A 4KPHH 2NXZB 3VR1A 1MKYA 4J3WA 1FDTA 4OD1L 1VGVA 4RZ3A 4YUXA 2V4LA 3LCCA 3C6LA 4BP8A 5CLGA 4WLCA 4M1TA 3UJ7A 4NAQA 1A3LL 1CF4A 2IH9A 3WDSA 1N10A 2G82A 4J12A 3LC7O 5E1BA 2G83A 3GJ7A 4C43A 5A4DA 3JWJA 2VDPH 2NU8B 4F7TA 3WIDA 2C2KA 3KYAA 2RB8A 5DYWA 2F0CA 5F3HA 3JAKB 1PLCA 2YMPA 5DTRA 2B6HA 3DMNA 1UWXK 3INTA 1A1MA 1KU0A 1SHLA 3IMSA 1VG0B 3KBPA 1A4JA 5A40E 3IP1A 3OHXC 3GUFA 3B1FA 4WU5B 3KXFA 5IVXE 4PLJC 5EP3A 5I6KA 4WA8A 4FB4A 2WA1A 1RU9L 2H2PD 3N59A 3RBSA 4MRMA 4LDQA 2HMID 1TKCA 4R3UC 3EXHC 2VN7A 4JG9A 4BZ2A 4UVDA 4E1BA 3HA5A 3UJAA 4BTVA 4EMSA 4BCBA 3UAYA 4NO0D 3B70A 4JODA 4FMDB 2Q5BA 2FPGB 3BJIC 3DE6X 4FM9A 4P5KA 1QOZA 4Y9FA 4P23D 2XRZA 1P5VA 1VE3A 4K1LA 4LK3A 3Q8MA 5EE3A 3E5NA 2C2WA 5DWUH 4WI3A 2Q8BH 2YC2C 3X1NA 1N6LA 2AAVA 4KZKA 2V7BA 1NUHA 4ELMF 1SVLA 2BNRA 4IRJD 2B35A 2COUA 2AV7B 3DBRA 3IT3A 5D5ME 5AVVA 2HK9A 1U1IA 3FTCA 3WAGA 1YB2A 4XOCA 2X5PA 1TJ4A 1TITA 3MN8A 3HA3A 4KO6A 3QXHA 2B2XA 3C6MA 5EEUA 3GKWH 4ZEOA 4FUQA 4PFQA 3GSWB 4D0SA 1LDPL 2V7UA 3Q8EA 1V71A 3S96B 2AQ1A 4LLVA 2O7QA 4LL1A 5ALKA 1DANT 3EDKA 3QFJD 3SE3A 2EKQA 4WZAA 5LJYH 3A4NA 1QJCA 3PXLA 4CIDA 5CWSA 4J29A 2IIJA 4A2MA 3VWKA 1WSAA 2VP5A 1ST2A 3EBOA 1GY1A 5AKZA 2D9QB 4JUCA 2CDAA 3PUZA 1YDPA 3EG9A 1AKWA 1Z25A 2YQ2A 4AJYV 3KQTA 1QI4A 3DSFH 4M89A 1IQ0A 1I7RA 4L76A 4Q3OA 4DGQA 1RYFA 1JG6A 1VCAA 4U1HB 4XNDA 1Q0XL 1WA1X 2Q7XA 2WZ6A 5JUEL 1Z37A 4WKZA 3IERA 1ZK5A 5K9JL 3UERA 3NVAA 2FL5B 1SPXA 2O0JA 2EIJB 4NYLB 4XCCH 1XLTC 1JJAA 2J6HA 3IKCA 1DQQA 1U9IC 4JRYB 5F78A 4FDTA 4OQPA 1Y6NR 4UCQA 5CFRA 2VJQA 3ILSA 1XN1A 5JDIC 1MP0A 3PNSA 4AWAA 12E8H 1KBZA 4ZVSA 1U2PA 5JOEA 2MMGA 3EGIA 3AQZA 2WWOA 2AJDA 1AZLA 4M9ZA 4ABQA 3HB9A 3PUJA 3VFNA 4RCAA 4WKPA 5JXWA 3LXXA 5K93A 1PGPA 3QAQA 4OJCA 1KF9B 4FI3C 5K1NA 2IGTA 3Q85A 4BV9A 5EIIG 1CUEA 2C0CA 2Q86B 4ICWA 4AYFB 1YIAA 1VL6A 2VTKA 3MW8A 1JQAA 1RYZA 3KG2A 1XV5A 1ZNZA 4E0BA 2BFDA 4NMXB 1C5DA 3MCKB 5G0UA 2VIRA 1A7PL 1GSOA 2RB5A 4V0SA 3AF5A 1FQJA 5E08L 2W2OA 1FNEA 4N1AA 1NBYA 4IJUA 2VYNA 2GC4C 3NIFB 3UMTA 3R9KA 4QBHA 3DX1A 2YD4A 3M6XA 3TEMA 1N2XA 5E6IC 4XP9L 3TW6A 5IF9A 3KE8A 4Y1FA 1NGYB 5C08A 2GEDA 1JZ4A 5JSYA 1U2CA 4B6ZA 1KV7A 4LE1A 1MFCH 3SF8A 4CW7A 3U4HA 4ND2A 4FGWA 1Z5ZA 3V4PL 1FIGL 1DKOA 2FMXA 1O4WA 2ZIZA 1R7RA 1CP3A 4LFHG 1BX3A 4RD2A 3VWJB 4M5TA 3LOPA 5J9FA 1T5KA 2Y2UA 5E23A 1NFRA 3A05A 1CR4A 1RHMA 4GP8B 2BSBA 4FEIA 4JFFB 3R1GH 2GPAA 5EZOH 1V2GA 4MAFA 5BORA 4TXHA 2QF7A 3GMDA 4BXOA 4X71A 3SE9H 2WWMC 5BV7L 2A3NA 4LBZA 5D2NC 2O5RA 2JB6B 3AY2A 3THWB 4MVJM 1U0JA 3KYDB 2BMFA 3FU5A 4AS3A 1DJNA 3K2UL 1QUPA 1DIAA 3W5BA 5IBTL 3WNIA 3UBHA 4KGZA 2VJPA 1NCIA 1N5AB 2CVOA 1JXOA 4MB2A 3HP7A 4TULH 4YHYC 4QPJC 3SYMA 2H16A 1ELOA 4RH3A 3RNQA 3L5IA 1USZA 5LA6F 4K4KA 3LCYA 3O47A 2C7RA 2L82A 3IXMA 1CQJA 3V1KA 1MIOA 2BY1A 3ARDB 3MN1A 2FQYA 4DCTA 5KYWA 2GITB 3KJNA 4ZOLA 2O6FA 4OI7A 1F4WH 3ZIAD 2EXYD 1I75A 4GFDA 5JPMA 3EWIA 2QADC 3FDXA 4WFGE 4OHPA 5FTKA 4ZANA 3WLMA 3ISTA 3ICVA 2C7UA 3JQCA 4UTPA 2DOCA 4L4VD 2DQ6A 2VIIA 2F1IA 4M8KA 3D31A 4N5DA 2HV9A 3GS7A 3ASNB 3PR3A 5FBVB 2FJFB 3M3PA 1RZGA 5I1AB 1GQRA 4EHIA 4OU3A 2NT3A 4L5YA 3PHCA 2ITDB 4DWHA 1YNTF 4F6RB 4XAKD 4IDHA 4MYUA 5C3MA 2E5LB 2HSGA 4YJGB 2A9VA 5AP9A 4BV8A 1SLUA 4NBUA 4PHHA 1KLFA 4UOEA 4ALAH 4F20A 3SCMB 1FTGA 1EEYA 3PPYA 2D7JA 2W6JA 5C9ZA 1IOVA 3NMUF 3KZOA 1EE9A 1XOIA 1YK0A 1Z16A 3HNVH 5FF6A 4P2QE 1YRYE 4PS0A 4CF6A 5FM4A 4EI7A 1NQVA 2AF4C 2EILB 3FRPA 1A0OA 3HCEA 4FDWA 4CKBA 3EJSA 2Y24A 1BMFA 1VGRA 2B9VA 2CO4A 1DBSA 1XXLA 3BDAA 5KVDH 3DBXA 3RQ3A 6FABH 5FEUA 3F1LA 3MS4A 4UKDA 3GLHB 4PJ8B 1XVTA 4UTBL 2Z1MA 4JLJA 4AXXA 3IBFA 1KEKA 1X4YA 3EFDL 2AVGA 2DYRB 2W6IA 1AZRA 4PCLA 1Q7RA 3DV0A 4PXYA 1EXGA 1KQOA 5K0EA 2WIIB 4GOSA 3ZL1A 1RMYA 3MRDB 4JGUA 3S5YA 4L23A 3BXFA 5E8JA 4FBGA 4GICA 4I9HA 4FQJH 3SHWA 9CGTA 3M1YA 1OW0C 1RJ9B 3GI9H 3WKDA 4JO3L 1SEQL 3NFSL 2M32A 2GSGB 3EN0A 5EOCJ 3ELDA 4RQQA 1ECFA 4HKZA 5JDSB 3UH8A 2AKAB 3L7OA 3MT8A 4I50B 2WTRA 1TFHA 4AYID 4BE7B 3OFND 4ZMNA 3HNSH 2IDZA 4CIBA 3FTFA 3APCA 4CMBA 2JRCA 4HVLA 4PVNA 3QARA 2CNDA 3IJSB 1BD4A 5A03A 3L5JA 3VZSA 4N86A 1PV2A 2C20A 2C54A 1XVUA 3OG9A 5TQ0A 3UVEA 2OJZH 1IQDB 5C8JB 5SX5H 2ZUSA 1H2HA 2GK0B 1EGAA 1SJEA 2X6AA 4R6UA 1L5NA 4BLQA 3OPZL 2YAPA 3TPCA 3E2HC 3P2IA 2CGRL 3NCMA 2ERXA 4PBSA 5AIAA 4JFYB 3HRKA 1NY6A 1QNZH 2WNIA 5GGVY 5DA4A 1HYEA 1B8UA 3QPWA 4RF4A 5FUXA 1QG0A 1RZKH 3BEVB 2EW1A 3I9JA 3RUPA 3ZKQD 2AKYA 1EFQA 4YHOL 2JIDA 3DB2A 1F11B 2LGJA 1B7GO 1CCZA 2OBLA 4MS6A 1P80A 4HYYA 5TX7A 3FQRB 4Z0HO 3UYPB 1GFWA 5IQ7H 2CJUH 3ZLQC 2ZWSA 3ZWBA 1BW9B 2I60H 1ZXBA 4INAA 1U8NA 2X9XA 4ZIRB 4BZ2H 4HDAA 1MRDH 4M3HA 2G9HB 1GRVA 3A6KA 3W9BA 4BFZA 3QPXH 4W4NA 3UG6A 5C92A 5JIHA 1X6VA 3OWEA 2ORVA 4JO3H 4OCNC 3UOWA 1B0GA 1TZIB 4F2WA 1CE8A 4AIRA 2WJVA 2VK4A 2IWFA 5F6IC 2JFPA 2VDMH 3J07A 2SKDA 5CINL 2EFJA 5D3ZA 3NH7L 5A3ID 4IRSC 4ZAYA 3ESUF 3V5HB 5A2JH 3WS6A 5BN5A 3D4ZA 4L0CA 2UYLA 2C3GA 2ED8A 1EIZA 4U1LB 4ANFA 3H9EO 1N5JA 4ID9A 2J6EL 1FDSA 2R44A 2V4ZA 4A7UA 4WSJA 3OOSA 3ARED 1SBNE 5EFOA 4P4SB 4D26A 5JEDA 2E7HA 4OCRL 2CMHA 3AF4A 3H1BA 5T3YA 4NZUL 1PW5A 1KVRA 4GLLA 3AFGA 1LEKB 4J1TA 5CH5A 3DEAA 1U8IB 3LMJH 4MJ3A 4EQ6B 4BVJA 3G6JA 4TXVB 2LD4A 4NBWA 3ZKND 1F2UA 1E8WA 2ZEJA 1N6PA 1ZRHA 4YDJA 4KDVA 3PXGA 1CYDA 4LCCB 2A74C 1N2CB 4ARIA 5CILL 4XQCA 5INDA 4YJFB 4PIVA 4DR7B 4IY1A 3VD2A 3QRFM 4IBWA 4X5LA 4MWFB 1EK2A 3KPRE 2IJGX 2FO1A 3MV11 2D2OA 4D79A 2KUTA 1VG8A 2ZRCA 1LSOA 4R6XA 3GXPA 3OEHA 3QUMA 2KC0A 2I5PO 2ADFH 3PWUA 1TJGH 3L4SO 1F4XL 4M46A 3T7RA 5E6RB 3NIDE 5DBFA 3I3SR 3IJEA 5A4FS 3WHE0 2R0QC 5I76A 1W88B 3CVOA 1GU0A 1D6VH 5EP2A 3QHQA 3O93A 1PQ4A 1MJGA 5DNDA 4B3MB 5ALHA 4ENWA 5AUMB 3SYKA 2FV8A 3X2FA 3P26A 1LK2A 1DIHA 4M0KA 2E74C 3WE6B 4MJLA 1RVDA 1TQ8A 2PWZA 2XETA 4HZIA 1E0AA 3G5VB 3MJ7B 4TS1A 2FUG6 4NNOA 2F1AA 4IQ8A 1JZIA 3MJ8A 3VFTB 3BIJA 3D3WB 5GRZA 3QKSA 3W9DB 1JRHH 1Z33A 1OAZL 3UDWC 2X0NA 5EEVA 1FW8A 2BZSA 1SFHA 1UEYA 1UKZA 2V9PA 4R05A 4ILEA 1DJSA 2MSDB 3AVXA 3SQOA 5IJVA 1WITA 1ZGGA 3RDTC 5E00A 1BCSA 3BGMA 4BVHA 3L5WB 4NIMA 3AT8A 3QQ4A 2DTDA 1WWBX 3WLIA 1QVAA 2J8UF 4ALAC 1U3HC 1IKNA 1IGTA 3UJNA 5CXXA 5L51A 1MNNA 1O2DA 3G7UA 3E9RA 3RASA 3DO4A 1JHZA 4WNSA 3L79A 1XH3B 3FYIB 4NJMB 1SXCA 2J0VA 3DSNB 4Q5IA 5G1OA 4D9JA 1SU7A 5IFKA 4L07A 4BDTA 1KLUA 2WOBA 3F7NA 2OXGA 3L3OC 4D45A 3QG7H 4EVNA 2NO1A 3ML1A 3C2QA 3SVZA 2G5BB 4Y16C 5D7SL 2BFCA 1RZGB 4LS3A 3WXVL 1BGXH 5EHNA 2Z9TA 3H86A 2VUKA 4IDEA 2XCTB 1SPDA 2H1SA 1INLA 4YUYA 3E53A 3ZOKA 3WMXA 2ZCZA 1V3UA 4ISVA 3W6PA 2CV0A 4TUOA 3OZRA 1FMJA 1LYQA 1W1WA 3SEQA 3HVNA 1IB5A 1KZYA 1W88A 1I51A 1ZT4B 2PL9A 2B30A 4QYOB 1S4QA 3HCNA 3U36A 3B2PA 3QORC 2P7TB 3SCZA 4WZAE 1Q92A 4OLJA 1VFAA 4PJ9B 5F0PB 1UDCA 2VW4A 3R3YA 2YZ2A 1M7DA 4W68A 3MO1A 5FHBL 4S35A 4IRZH 2A9AA 4G8AC 3REOA 4KH0A 5J6GB 4XPFH 2AXHA 4HHGA 1W4CA 2WQZA 2Z0BA 4OHKA 4QGAA 4J3OH 3ZE2F 2Z34A 1KXTA 3MBED 4N26A 1E3LA 2ZZNA 5A4JA 1R15A 3TCLA 5IR1A 1DE4B 2BM1A 4ZT7A 3F6BX 4ZPTA 4ZHSA 4DIOA 4FERA 5D2NA 2NNWB 5EZQA 3AF0A 2F18A 5B7GA 2YD6A 5EQFA 2PUHA 2FPGA 1DQNA 4LSMA 2PUVA 4BLTA 1V7NH 2SCUB 5LGHL 1HIMH 1B3IA 2WAOA 4AF6A 3AUUA 1N0HA 1KI1A 1NY5A 3FULA 3WS3B 4PGEA 5ICZA 1XYYA 2WM2A 3B13B 6CGTA 3AZOA 3KE9A 1LEKA 2PTTA 2Y3NA 4JFDB 2L7JA 4FFVD 2E7ZA 1Z0AA 5LNK6 2P9CA 1FRVA 1QU2A 3EADA 1HCYA 4ZU1X 5E0OA 1U2QA 1LWJA 1RV6X 3U46B 2Z6UA 1KG0B 3HOGA 4PRIB 4W4OC 2B1JA 5HDQL 5J1TC 2COVD 2DI7A 1IFHL 1JUFB 5AAPA 1HHGB 3T3NA 4GZ5A 2JGFA 3FMPB 5EUOE 4G8GE 3BXHA 2JFUA 3K5IA 1SLWA 4CMIB 2W93A 4PTLA 3UCXA 2R27A 5BN5B 4EZIA 3VAAA 3MINA 5DHFA 1I8LC 4IIFA 2Y5TB 4BJ6A 3K4HA 1XVLA 1AD9A 2IPUG 1VJDA 1LX6A 3V00A 4NOJA 3B7UX 2OPHA 1QC5B 1N5KA 1NAKH 2X0VA 1L6RA 4YV7A 2DVMA 3ZH9B 1N2IA 5J13C 1E9FA 2DD8L 1O96A 3EMVA 5BQ5A 4KVCH 5AOKA 2OK8A 2OZLB 4JI8B 1KSFX 2IYWA 3T9EA 1FG2A 3VC2A 3DV4A 3U83A 2E27L 1DAOA 3E0XA 4YSQA 1U3GA 1SBHA 1HKLH 4DY6A 2R83A 4P59L 4O02H 4GOJA 1IAOA 3VR5A 1CRLA 1CP2A 1GY2A 4BNJA 1NOIA 3T3DA 4J6EA 1YR1A 2P2ZA 1Q1QA 7GPBA 4Z78B 4GWGA 1A69A 4MLCA 1EE1A 4JKWA 5EZ6B 4BLSA 1VKRA 1RWPA 4QRHA 3MV7B 2D9CA 4Z7QE 2QN2A 3P7MA 3K8YA 2QTVB 4NFSA 1PS9A 3Q7SA 2YN3A 2ZRAA 4UVIA 4ANUA 4JPWH 2YMLA 4IBSA 4JJOA 1ZMOA 1PUJA 1I6LA 3G89A 2J73A 5HGAA 4LRYA 1BVYF 5D85A 2CIIA 3LUDA 4O1IA 2BSSB 4PRNA 3IN2A 4OLAA 4X98B 2PSJA 1AGBB 1MO4A 4DKFH 5SWZD 1IILE 3VZQA 3GJYA 1I3RA 5DNYB 4PJBB 4EFLA 3WISA 1F3JB 4XLTA 2VLBA 1XF3B 2ZYGA 4ZN6A 5CTAA 4JCWA 3KL3A 3BZEA 4HYTA 1E27B 4MAZA 5J06A 3UJIH 4PJXE 4R51A 1MOSA 4Q82A 1E4OA 3HB3B 3DOHA 4HD8A 5KYXA 2JKWA 4BQNA 4BY9E 1UWLA 3TSAA 4KVAA 2JGDA 3SGKC 2DTEA 3A6DA 1MW0A 3SE8H 3V33A 1MFPA 35C8L 5L4MA 1KXQA 4JDVB 2WK1A 3GRZA 3T5DA 2JKVA 1AXGA 3LZNA 4F8NA 4PLPA 3K72B 1G60A 2ZWMA 4LCUB 1T0PB 4YY3B 3M1OA 4LCWE 4DBVO 4DXHA 4YWJA 2PM8A 4YJFA 4QOSA 4J4TA 4WI1A 4KKLC 2IBZY 5D70H 3O0TA 3ZU8A 4AOFA 2BVYA 4R7GA 5L3SB 1NDHA 1RE1A 1E3QA 3CR7A 2W0FA 3SQMA 4IH1A 2AI2A 5GS0H 5HGBB 3VVLA 5M7EA 4CC1A 2XZCH 4D7BA 2B9AA 3LYUA 4ZA2A 3BK7A 3WHPA 2PLRA 4PTYA 4W5HA 3L4TA 4BFBD 5D1HA 2CXGA 5JARA 2WM9B 4BC1A 3ODGA 4HZLB 3QEUB 2JFHA 3DRQA 1D2NA 2ERJB 1OAKH 1K98A 1COWA 3ZC3A 1MPAH 2J3MA 5L4SA 4LNHA 1ECPA 2X41A 1RK0B 5L8JB 1T2AA 3QUYA 1DLFH 1E4JA 1Z6JT 4L3AA 1HOTA 4MGZR 5FK9A 3UTDA 5HVNA 4IOIB 2W95A 2ERJC 2DQKA 3L6RA 2ZJYA 1FTQA 1X7YB 4FI6A 4XM0A 2Y7QA 1IKFL 3G5ZB 4FJ0A 4B7XA 4MUMA 3PGXA 1DEKA 3QKUA 1XAKA 3NZEA 3C2AL 4M6WB 4WFHE 1QIDA 3QUQA 4JUIA 3WIHL 5L8KB 2XADA 1UT5A 2UYYA 1JNJA 4OLEA 4MA1B 5K0FA 5LIPA 3H0TA 2VWQA 2GUOB 1NV9A 1ENZA 4L5CA 3FXIC 1LFDB 5FJIA 4KGXA 1DXOA 4RK1A 3K1TA 2KE5A 3UGEA 2Y2WA 2PABA 4Z3HA 1JPUA 3BEVA 1DKQA 2YC1A 4B9GA 2XTJA 3IDZA 2RAMA 3OPYB 3GGOA 4KE9A 3FRHA 3EBPA 3ZW8A 3QOWA 4RY8A 1CF8H 4KJYA 4U7GA 2BR3A 3WDJA 4FMFA 4OI0A 3F5WB 2F43A 2R84A 3SFZA 3CFIC 3DWTA 1OCWL 3EFFB 9ATCA 3TF5A 1SBSL 1J5PA 2L0XA 3QC5X 1N2RB 4NH4A 3UTPD 5IJKA 3WGIA 2VWEC 4ETIA 4BCXA 2WN3A 2J9RA 1SGKA 2YV1A 3KLDA 4P99A 3QUZD 1FN4A 5E2BA 1JLSA 5GS1A 3DX9B 4GKKB 3K6KA 4R3SA 3AHHA 4RZCA 3UYRL 1LNQA 2WLMA 2GFIA 1SWVA 2BGUA 3SDAC 1IIRA 3UAZA 4Y7CA 1DXHA 1JX6A 1P6AB 1Q0YL 1KIRB 3KU4A 4XBEH 1MLBB 2D54A 3GGWB 2EDTA 4EJSC 2WDPA 2AK4E 3VX0A 2JAPA 4K05A 2IS6A 2HHLA 1HSAA 5FUQA 1R66A 4N0EA 2EEBA 3H3PH 2G6TA 3R7NA 3GMIA 5ALQA 4JYMA 4UYQA 1J0CA 3NP9A 4ONGH 5CCJA 2GN4A 1T36A 5EMYA 4LTDA 4OJNA 4PHGA 4QGSA 2CLZB 4X6BA 2H7YA 1Q9OB 2H0JA 1PNQA 3WE7A 1NTOA 3QXGA 3MJFA 2P49B 4TZ0A 4ZJPA 2DD8H 1VRSA 4JJFA 3CG0A 1EXUA 1MW3A 3KXIA 4IUYA 3S6JA 4HIEA 4O2AF 5GS2D 3JY6A 2JAXA 2D7MA 3Q8LA 2BHLA 3X3HA 1C41A 4ZX3A 3D05A 1OE0A 3OQIA 1A14L 4WTQA 3N05A 4AM0B 5A0TA 1YSOA 3VTAA 1DKMA 2YUVA 2C3OA 3ENQA 4P2QD 3QG1A 3ZKWA 1M1YA 1SYSB 3AERB 1GW6A 5E2WH 4DCSA 1FE8A 4W1TA 4UNRA 4Y19B 2YYYA 3OPMA 4MXVE 2I7OA 5TH2A 4KN9S 1NPUA 4R01A 4A7VA 1M2NA 2WD7B 5GS3A 3T0FA 4B3IA 1L7OA 2CKMA 2O8DA 1Q7GA 4DP5X 2V96A 1MT3A 5DYNA 1W72H 4QTFA 5ISZA 2WQ8A 1N18A 5D2LB 4R9HA 3D2AA 3CC5B 1H19A 4AMWA 4N39A 4TMKA 4L5IA 5CBEA 3D8UA 3QF4A 2P9BA 3RJMA 1ZD4A 5FDYA 1M0TA 4PB0H 5TT0A 3DMGA 2DPXA 3G0CA 4S1SH 5LYJB 3V8MA 3BFKA 3HEIB 4CV3A 4G1CA 2NV6A 4KDWA 3IOYA 2J12B 2CUAA 3THMH 1VLQA 1QQBA 4PZDA 4MS4B 2XG5A 4WZZA 3QCTL 3C7AA 1MRNA 2E85A 4WZAB 5FA4A 2PA0A 3O81A 5AOIA 4YH1A 4LVHC 3GI8L 1UB6B 2PF6A 3JVEA 6FABL 4Q01A 1SZCA 5BSVA 1JAZA 3TW8B 4UW9A 1L5WA 2I9LB 2X9NA 4XAWH 4YGVA 1SQSA 1D5IL 5L3RA 3I02B 5C7LO 2DBVO 3F3HA 5AW5A 3PNWA 4XNMB 2MCAA 4HGQA 1R46A 1PTJC 1FFSA 1DC5A 1E59A 2XTJD 4L3WA 4HZGA 2DDQH 3AOEC 4NSNA 3ROGA 3O4LE 4EY7A 4N3AA 4BV1A 2JFCA 2Q0SA 4QHLB 3FZNA 3T3MB 3AWIA 4G36A 1OI7A 1LM8V 4ZDIA 1X9UA 3VXQB 3IUBA 1SXBA 1B6RA 4GKZB 2XDWA 1WIUA 1CS0B 1ZVJA 3Q8AA 4PJGB 2EIHA 4Z3KA 3IJHA 3TM6A 3O8BA 2G60L 4JR0A 2OOKA 1C16A 3OGCA 2V2XA 5FULA 5D3QA 5EA0L 1SDDB 2YOAA 2OMNA 1ZUD1 5U1PA 3TH2T 3FN0H 3AR7A 3R44A 1GU1A 1EDYA 5CCBA 4GX5A 5DQ9B 3KQOA 2QQKL 2WZAA 1LO5B 3CG8A 1KFEB 4WHMA 5CR8A 2PGOA 2NAFA 1CUOA 5K5EA 4D4LA 4S1DC 1RE0A 4JGIA 2KKQA 5IMMA 2WKSA 1EEQA 5FB3A 5JCZA 1H1LB 4JYZA 3VG9C 1U0RA 3E80A 1GS7A 2BELA 2F7IA 3SN6A 2JJ1D 1B2YA 4CVXA 2QLTA 4JEUA 43CAB 4Y4HC 1G8GA 4O2EA 1EUDB 2IELA 3TTWA 5IBPA 2W9LA 3EX7C 1OWWA 3L1UA 2EAUA 5EXSA 4FJ1A 1P4LB 4M7KL 5ESQA 4FQIH 3DF7A 3NETA 2KPNA 5KTMA 5CNJA 2UXDB 1SYVA 3HVHA 1VACA 1RHFA 1E0KA 4G8FA 2NXYD 1VJ1A 3S3SA 4EBFA 3FL7A 1H6DA 1P5UC 2IPKA 1NFAA 1MZVA 5GZ6A 1ABEA 1CUDA 1B2WH 4PM1A 5J11B 1ZGJA 3ND6A 5BNXD 5BSFA 1IHXA 1A7JA 1Y6QA 4D9QE 4YMUA 2XSKA 4II3A 3ZE7A 3KQWA 1CBVL 3U1SH 3VNYA 3U0BA 2GI0A 2QTAA 2BNQB 3G82C 4R8WH 5AOJA 5CGZA 3I72A 3APNA 3UAJA 3KGUA 3QLEA 4WEOA 3OETA 3HN8A 4HTFA 1SYVB 4E70A 5EGNA 2MCPL 4UUNA 5FO2A 4EN3A 3D54D 4RFVA 2LBPA 2SKEA 2XCMC 4X4ME 4ZICA 4KK8C 4U5XA 3LLUA 5MENA 4HT3B 1KHHA 1T6VN 1E2DA 4L3EA 1RSZA 2NY0C 2BEUB 3IOEA 2RGWA 3GDBA 2QTCA 4MJID 4ND4A 2ASVA 1RHKA 3I2JA 1RJEA 4Z99A 4CKEA 4FBLA 1GU7A 5JHBA 1R4AA 4TYQA 1WV0A 4KJZA 1AKUA 1EUTA 3GHEH 5GV8A 1QFYA 1XZDA 4EPVA 2AGJL 1UMDB 1X7DA 1JWSB 2W91A 3FU6A 2BEKA 1YOBA 3RS2A 3KE0A 2ZIGA 4FHDA 3NYWA 1V43A 4IF6A 2RFLA 4H27A 4BHUA 2EH8L 3IAHA 2CUIA 3DK2A 3ME0A 3EYFB 1DKRA 4XCVA 4QHSA 3I8SA 4BNDA 2B0SL 2XTSA 1QZXA 2HUPA 3VYTB 5JZOA 4UQPA 4LF3A 1N36B 2DQEL 1X7ZA 2HVJB 3DIVA 1GZUA 4Q12A 4HBQA 5C3IA 3QG7L 4KDCA 4WW2B 1Q7CA 3UWOA 1MB2A 2XDQB 5IM7A 2FQXA 2PWHA 2XMZA 5KVFL 1LLQA 5G4KB 4Y9UA 3B5HA 3HGMA 4ZWNA 1WWAX 5KKNB 2HBQA 5U4QA 4D9RE 2NUTB 1OQOA 1ZY2A 3DO7B 1L7MA 2WKGA 5INDB 4NULA 4PR0A 3MRHA 4LCCA 1N2CA 3QU5A 3NFPB 5A16B 5GXBB 3E3QE 3F96A 2WBWB 1XO8A 1AHMA 5H2BA 5T3XD 4L37B 3NOXA 2AUMA 4EI5D 4H6PA 2CHNA 1EK0A 1TCAA 3SKOB 4IHJA 3D64A 4LBWA 5BWNA 1HMYA 2GMWA 3U6KA 1D2PA 2XA8L 1NBCA 4MFHA 4IDGA 5L6YL 2BEVA 4NC2B 1A9EA 4URHA 1J12A 1VKJA 5JASA 4NZTH 3SYLA 4BX2A 4G9DB 3QNWA 5TJHA 5EJ9A 4PZLA 3BO8B 4J4PA 1B8OA 5LQMA 3DMHA 1WHSB 5BMVF 3T2NL 3SX2A 2ZF8A 2GN0A 2PSEA 1F1BA 2H29A 3RDJA 1B93A 4PY7B 5C7ZA 3BL5A 4XPFL 3ZZLA 5F1KA 2GIYA 5EUCA 3LPWA 1P69B 5C5DA 2ZKXA 5K9OB 1V5EA 1ICEA 2XUKA 1X7WB 2GPYA 4E1VA 3F6IA 3WIHA 1FNFA 1KBBA 4LLQA 2Z3FA 9LDTA 1BJ1J 4HISA 2I71A 5FW7A 3EGDA 4M9SA 3W1WA 1NI4A 2B1QA 2VR3A 5A1AA 3MCAA 1S5IH 2FJGB 4AD8A 1VXOA 4U1IB 1FB5A 1QVZA 1PLKA 3LBIA 3T95A 4AMUA 3K71A 3K6NA 4LLDB 3DD5A 3CRMA 3GMRA 2AXFA 4LLUA 1QIKA 3VBCA 3MRBB 4HPHA 2FGKA 3ZZ1A 4GRIA 3NONA 2W07B 4AMZA 1AMYA 2IHJA 1PTKA 4Z0TA 1Q20A 4AY3A 2YHBA 3P2JA 1WHTA 4LY6A 3I8OA 1R6UA 3C43A 1CL7I 3LE8A 4NTZA 4WZBB 5DUBB 5ICSA 3UKJA 1EBAA 1RH8A 1DQLL 4K8RB 1R6AA 1EGVB 2PKEA 1E77A 1AGDA 4E30A 5F0LB 3RIEA 4JXZA 4Q48A 1LC3A 4LGCA 4W9GC 2YOGA 4LF4B 3QQ9D 1QR2A 4B5KA 5KS9F 4NKMA 4AQEB 3FRPG 2EZUA 3QPCA 4HIIA 4M4RB 5CZXD 4XPHH 2BCKA 4IJTA 4ENRA 5GM2A 3C39A 1G7JB 5J8OA 2IJ0C 4BO4A 4XWYA 1DQJB 4MPRA 1DVXA 1WZ1H 3U44A 2VDML 2GK7A 3H2JA 2BW4A 1NC1A 4L8DB 2AMJA 2JF0A 3HC4L 1QHHA 1A6PA 2RARA 1CY2A 3W8FA 1HNWB 4TSBH 4XNYL 4X63A 3B2UD 1YV9A 1C5BL 4L9RA 4P84A 4GUDA 2PMZA 4YT5A 1Q77A 5TQ2A 3UB2A 1SVMA 3GS4A 1E1MA 4EA8A 1RW4A 2E82A 3BH9A 5HI5C 3E8XA 3FPAA 3QS2A 2H08A 3BZ5A 1RPZA 1XMPA 4DKTA 1TIUA 1W59A 3BH0A 3N87A 1SXZA 2H0FA 5FOWA 3VISA 2ZPKL 3LKOB 1OGYA 4V1CI 5WRFA 2HJRA 2E37A 3RY6A 3O8QB 2W1NA 5AK6A 4RVOA 2DC1A 5FO8A 2GPZA 2FEEI 3NRJA 4TYYA 3OJDA 2GO7A 4UEOA 4MV6A 4CG0A 4ATTA 2NQTA 4PC1A 4K7PL 2QX8A 3A7DA 4DADA 4BEJA 1E1QA 1RU3A 4TKUA 3H53A 3IUNA 2J8UB 5I19H 1BXGB 4ZJ9A 3NTOA 1SN5A 1R0YA 1TJ5A 4YMSA 3Q2IA 1IAVA 4QXUL 1XXDC 2XAUA 5DHYB 1E1RD 4UHBA 4RCYA 2PMDA 3WKNA 1CFVL 4BINA 1JF8A 3QVLA 2D0FA 1RXIA 1CICA 3B3BA 3LQAC 1E2BA 1EJFA 1WQVT 5K9QG 4WNAA 5I1JH 3W5JA 4A5SA 2H6OA 1IONA 2FZGA 3C3PA 1QCDA 2UY7B 2WLIA 1Q7TA 2HFTA 1IJ9A 5TGBA 1QK3A 2YUIA 4M8NE 4DW2L 3L7IA 1QYDA 3O4LB 4RAVA 5GTDA 2Z92A 1EHXA 1DHRA 4K1XA 4C4OA 1WFUA 4LSQH 2XSZD 5EE1A 4DTGH 3C5SB 2NV0A 1VYVA 3DL2A 2BI4A 4KO2S 1VBNA 5GGRY 3R7WA 4LBEA 4WWID 1QYCA 4N2NA 3NA4A 3D5OF 4BJ3A 1U8EA 2RGAA 3EDEA 4HG2A 1OGSA 2ZE6A 5FLXA 3LAWA 5EEGA 2OFFA 1LDNA 4U2ZA 4HUQB 3EOYG 5CJPA 5JCXA 4XXCA 3DZFA 3OJFA 3ZK8A 1SEBA 4RAVB 2CLHB 4J4PC 2OSLB 4B5LA 5JD5A 4TSRA 4G5FA 2WICA 4WLOA 5K59F 1EX7A 3ZZQA 3RAEC 5ICYB 3O0RL 3D48R 5K7SA 5IB5B 1OV8A 4FHZA 4F5DA 5BUGA 1UDAA 1IEWA 2XQGA 3S27A 4BYGA 1DBRA 4UUJB 3CFCL 3MA7B 4ZMXA 1WW8A 3HC3L 3I05A 4NN7B 3WFHA 3G9AB 4M0UA 1M53A 3UCQA 5EYPB 1M2VA 1PLGL 4IKKA 1UEMA 3I8XA 3H9UA 4WI6A 1V1JA 4QO1B 3WK7A 2GZDA 2OMUB 3QVAA 3V6OA