3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
3H11A 3KJQA 1RHUA 3NS7A 1SHLA 2C2ZA 2CJYA 2CDRA 2K7ZA 2QL5A 3IBCA 4HQ0A 4PRZA 5JFTA 1SC1A 1M72A 4PS0A 4QU9A 3BIJA 3GJTA 1QX3A 3EDQA 1GFWA 1RHRA 4ZVTA 2H4YA 5H0IA 2J33A 3SIPA 5K20A 2J31A 5LUBA 4IEFB 4QU0A 1GQFA 3E4CA 3H1PA 4DCJA 2J30A 1RWPA 1RHQA 3P4UA 2C2KA 2XZDA 3V3KA 4NOJA 5LUAA 2CNOA 3GJRA 1PYOA 4EJFA 4EHHA 4ZVPA 4QU8A 4JR1A 1RHJA 5IBPA 4QTXA 1IBCA 3DEHA 1NW9B 2DKOA 1CVRA 1NMQA 2QLFA 3NKFA 3R7BA 1RHMA 4QU5A 5IARA 3D6HA 4N6OA 4JQZA 4JR2A 1RWMA 4DCPA 3EDRA 1K88A 3SIRA 1RWXA 4PRYA 5LU8A 3KJNA 3RJMA 4FDLA 3DEKA 3R6GA 2CNKA 4EHAA 3QNWA 1F9EA 4ZVRA 3K7EA 5IAKA 1F1JA 5IABA 1JXQA 1ICEA 1K86A 1QTNA 4ZVQA 3H11B 2HBZA 3R7NA 1RWKA 3V6LA 2AR9A 2XYHA 2Y1LA 2XYGA 2CNNA 4N7MA 3PD0A 2H48A 1I3OA 2FUNB 4EHDA 4D3ZA 4JQYA 4QUAA 4D3YA 1I4OA 4QUJA 3UOAB 4QULA 4JB8A 3V55A 3GJQA 3IBFA 3R5JA 4IYRA 3D6MA 4NOKA 4QUEA 3OD5A 2H51A 2H5IA 4I1PA 1SHJA 2QL9A 2H4WA 4QUIA 4LSZA 2P2CA 2H54A 4QUGA 4QUDA 5IAGA 4I1RA 3H0EA 4ZVUA 1RWOA 3R5KA 4N5DA 2FQQA 5IC6A 2QLBA 4HVAA 2C2OA 4JR0A 5IANA 2CNLA 1RWNA 5IASA 3NR2A 1KMCA 4AW9A 2QL7A 4N6NA 2HBYA 4N6GA 5LU9A 3KJFA 2QLJA 4JJ7A 4D3XA 2HBQA 4HQRA 4FGUA 4QUBA 4AWBA 1CP3A 2C2MA 3R6LA 4ZVOA 4EHNA 4EHFA 3V4OA 1RWVA 4EHLA 1RHKA 3V6MA 1SC4A 3P45A 4QUHA 4QTYA 2WDPA 5IBCA 2XZTA 5IC4A 3DEIA 3S70A 2Y0BA 4FXOA 1SC3A 2XYPA 4FEAA 4JJ8A 4M9RA 3S8EA 1RE1A 1NMSA 5IAJA 1I51A 4DCOA 3DEJA 4NOMA 3D6FA 3H13A 4NBLA 1I4EB 4JJEA 3PD1A 1PAUA 1RWWA 5I9TA 2CJXA 1BMQA 5IBRA 4ZVSA 2J32A 3R7SA 4AWAA 4NBKA 2HBRA 5I9BA 3UO8B 3V4LA 2C1EA 2NN3C 4NOLA 1NMEA 4N7JA 4NBNA 5IAEA 2H65A 3PCXA 4PS1A 4EHKA 3ITNA 2FP3A 2H5JA 1QDUA 3GJSA
chains in the Genus database with same CATH superfamily
1WPCA 1GG9A 2R9VA 1C2TA 1ZM3A 3BWAB 5BRZA 1BVLA 2HLFD 3UERA 3BZDA 2ATVA 3ZY3A 4OBSA 4INAA 1DU4A 2IYFA 4L05A 1E4WL 4Q3KA 3TB4A 4KC3B 4C2TA 4OHKA 2XNAA 5CDUA 1HTBA 2ZSUA 4Q39A 4E08A 3MJ9A 3WMEA 2QU8A 4Q4IA 5E51A 1YWGO 4QRRA 1CRWG 4YCCA 2QGEA 1H6FA 5B57C 3QUSA 3R7LA 2FZCA 3K81A 1EM6A 1Y3DE 1ZK3A 5F21B 1ZIPA 1M2OA 2YRLA 5KVAA 4QHTA 3GRCA 1G7LA 2W5PA 3BMCB 3GHEL 5F64A 2HH0L 1ZMYA 3CKLA 1KMNA 2OW6A 1XFDA 4N8SA 3QDJA 1BSIA 2GITB 1PKQA 2MTPA 3FHQA 3MXVH 1P7YA 5ESDA 3H7BA 4RTLA 1SA0A 5U1PA 1GOHA 3GGOA 1XELA 5A3SA 1PZCA 2QLNA 4TMVA 3HC0B 2AK3A 4X90A 4V11A 3WQSB 2JGLA 4CVXA 2R0ZH 5BWLA 2J1KA 2XYRA 1X7XA 4PPNA 4WV1C 4RWYH 3F6EX 3UC0H 5TFSH 1XB6A 2JGDB 2A3TA 2ZONA 3N0WA 4EI7A 3MXVL 1B3BA 2H08A 2PE5A 4B0PA 2YHGA 2BSCA 2OA9A 4XQGA 2P9GA 1H9BA 3KU4A 4BFJA 4DCSA 1SG0A 3VB9A 4IJKA 3N39C 4ZAXA 3AY6A 4Z7VF 5KKAA 4IDCA 2D0PB 3RVJA 2H31A 4N6RB 4AEHL 3AUSA 2L17A 2Y76A 4GAYA 5G02A 1ESEA 5GRUH 5LO7A 3NJ8A 1NCAH 5LQUA 4J0FA 5C8YB 3ZYJA 2G7MC 1SXHA 1F02I 4QBTA 3C6BA 2ZAYA 2E7HA 4OUDB 3KLNA 3V8RA 2CHFA 4P2BA 3DLCA 1FJXA 4M0PA 1EFPA 4NFYA 2K3HA 2ZKLA 4MYPA 4PJ8B 4BO6A 1Z9LA 5J5EA 1DC5A 4CCYB 3KR3L 4M1QA 4O29A 4C7OA 4OYYA 1E2HA 2IDCA 2EO1A 3WGNA 3SKOA 1ZD4A 4V1DE 1UJNA 4AJ2A 4PC6A 1DE4A 2BFMA 3ARSA 4YAUA 4MPDA 3LXRA 1J8MF 3R3JA 5FO9A 3NDIA 4LECA 4TZ0A 5ITFB 8MHTA 2HG5B 2G4VA 4D4GA 5JQWA 3KPPA 4CKQA 4CV2A 1DLHB 1NL0L 4R41A 2WINB 4OCYL 3PSAA 5GWXA 3MLAA 5TT1A 4W9ZA 1QH8B 3IAS1 3NCEB 3TGWA 1B16A 1RV6X 3HR7A 2KS6A 4D5GA 2QVKA 2XRFA 2NZ2A 1URLA 1JHVA 1ZKDA 4NOMA 2B9BA 2YVAA 4DV0B 1SBHA 3KPPB 4AB1A 1XWFA 3EKCA 1TAUA 3ZX5A 4PY8J 4N7JA 1X5HA 5DJ6A 1BXRB 4HXGA 1J11A 5B39B 1PGPA 4UDOA 2B36A 3TPCA 3MMEB 1CQPA 3KW7A 1GQFA 4OT1L 5C52B 2JKSA 4NS0A 4WGKA 4CF3A 4CMEC 2DKOA 2EL9A 3AJ9A 4PB0L 3V6ZB 1AZWA 4KXAA 1V16A 3FFAA 1WGVA 3FUJA 3T2PA 5SICE 3L3OB 3JARA 1QOPB 1KWKA 5KYKA 5K2MA 3ARGC 1F48A 2JSFA 4HWTA 3NIFF 3UTTB 2OVFA 2PYIA 3S88H 3B1WA 4HCJA 1P7WA 1X6VA 3LQAC 2X9VA 2X6UA 3K94A 2VYFA 4IQ4A 3KPQB 4N54A 1W76A 3REVB 5CT5A 2VDRL 2AXGB 3UJTH 4NT6A 3OAUL 1LDEA 1JXJA 5LKRA 4NM8L 4MNQE 3ZR5A 3KDSE 3Q7SA 4TUJA 1EQAA 2O7VA 4H16A 2VLIA 3CX7A 3CLUC 3KTFA 3FU8A 4BQEA 3H54A 3A9TA 3H1BA 3F12A 4V2CB 3WTTA 2HRDA 4D46A 1MX9A 3KHUA 4I2NA 5T3XE 3DDWA 2QT0A 4GG6B 4LKXB 4OTZA 2J1YA 1LDSA 1OIWA 3DV6A 2OCGA 2ENYA 4KXDA 1NW8A 1KF9B 2H1OA 3SJAA 4M0FA 5AW5B 4J94A 4GXTA 2ECPA 2P47B 3MA0A 3MF4A 5MHTA 1G7LB 2C07A 3UHOA 3KV1A 4KQCA 5IYZA 2CXTA 4JY4A 3GUVA 1ESNA 1S5PA 4I18A 3SBWC 2P9BA 5IZCC 3MRHB 2QX7A 4G6ML 3O4LE 1NFRA 3VXPA 2G36A 2H3XC 3DBIA 1OXYA 3AWFA 1KCRH 4PRID 1FV1A 1QO9A 2CLOB 5D5HA 4N41A 4WXHA 4QTXA 3OQHA 1MC8A 1UK8A 1OLSB 3H1EA 1KFAH 4IU3A 4MTLA 1NATA 4OQ1A 1H3GA 4NEQA 3ASZA 4GKAA 4A82A 3CUPA 3UPUA 4RIFA 2HYDA 3NGLA 1OK8A 5B58T 1AD0B 5DN6D 3W11D 4BYHA 1IRXA 5E5RB 1EMDA 2IYSA 2DJMA 2MSEB 2QPUA 3GCWA 3KGTA 4M9OA 4Q52A 2IFFL 1L6IA 2MWCA 1X1CA 5T6BA 1KHTA 3N91A 3D2AA 5CDGA 3P3UA 1HINH 3HFML 1XR9B 4WCYL 3TECE 1C81A 1YU6A 2MU1A 4DY4A 5FI1B 1X6NA 4FGLA 3MSPA 5COBA 4JO2H 3NRQA 1WXGA 2OJEB 4I6GA 3TQCA 1PCXA 3W2EA 4LEIA 5CF3A 4NRZB 4EZMA 4OCMC 3ZPXA 3QNYB 4L95C 4P9ML 3TO4D 1JAEA 5DDHB 5D3QA 3QMMA 5CEXB 5LSAA 2ZP8A 4QTIH 2H7YA 1G5HA 1EXMA 1BXXA 3CSFA 1WO8A 1MN4A 1T6VN 4Z0PA 1K8DA 5JJCA 4R4FL 5D7KE 2FR1A 5CX1B 1BROA 4LRSB 1GITA 2ZCUA 5D7SH 1NUDA 1NOIA 1V7ML 2YXBA 1M76A 4YJFA 1BJKA 1YNOA 4L2IA 3SYAA 1HHHA 1SZNA 2GMWA 5EXDA 4XOAA 1CTOA 1BIHA 5ESAA 1GYAA 1XO1A 3K0CC 4P3PA 4PFJA 2F1EA 5EBMB 3RY5A 1NJ8A 3IXMA 3ECWA 5GGTA 2Y1FA 4LSMA 2ZWOA 4B46A 2NW3A 4E14A 2NACA 4KPFC 2Q4RA 4PIRF 3EVNA 2F74A 2XTJE 1RTTA 3ULUC 3HB1A 3L0BA 4PV9B 2QZSA 4D56A 3HKZA 4KHPB 3LGXA 2Y3AA 3MLWH 1DPGA 5E8OB 5KBNC 4MVJG 4F5WA 1JZ6A 1B2LA 3R2JA 4XWOD 3I72A 4HALA 4DG8A 3RU8H 4JVPA 3I2IA 4Y2LA 4P0QB 2CLZA 1Z5OA 2C7PA 4CRWB 1T03H 3M4XA 1JZEA 4HZAA 2INGX 1U1CA 3CVBA 2DQZA 4F2PA 2O0KA 4P2QA 1IL1A 2NG1A 4UILL 4NFBA 1GY2A 3KYAA 2AEEA 3GNML 3CH8A 1JYFA 1ZIXA 3WB2A 3KE0A 1WTCA 2PUWA 3UUWA 2N4IA 1P2TA 4X7TA 1UD2A 5D1QB 1FNHA 1AOXA 2WICA 3OX8B 4RNCA 3I2YX 1AZRA 5JXEC 2LKCA 1T1JA 1ZJAA 4H2CA 2VHJA 3GMNA 3ME0B 4QU9A 5BV8A 3IDGA 1MFEL 2Z56A 2FSEA 2OECA 2Z7WA 1QZZA 1HTTA 3VWJD 4H1UA 4O02A 1W0WA 4FGWA 3KB2A 1RK0B 5K8JB 1EFXD 1V26A 1COWA 4Q5IA 3X1JA 3M1BA 1RK7A 1E30A 5E5MA 2A94A 1FLRL 2PJUA 3FTZA 1KPRB 2F00A 5F7EL 3R41A 3VYWA 2Y9MB 3WXMA 3HPLA 2FUCA 3AWDA 3HCFA 1K0UA 3SPJA 3TTTA 3PF2A 3W57A 4MRRA 2CNZA 1Y9JA 4JBIA 1GEEA 4Y6GB 1HQ4A 4IXTA 4QUGA 3EEBA 3KD2A 3WO4B 4BZ2A 1NOKA 1ORTA 2FXIA 2HSGA 2I1QA 3KZNA 3QE9Y 3V34A 4YO0A 3FT1A 1H69A 2GBGA 3NPAA 2HQSA 3BP6B 5CU9A 1LK7A 3M3DA 3EO1A 1M71B 4XIYA 3QAZC 1K6XA 3M3HA 4UU8A 3BBPA 3TBWA 1TKCA 3H97A 2ROXA 4LOHA 3GH3A 4XGRA 4P4SA 1TTGA 2A92A 4ZT3A 3MFGB 2EQ5A 3QDGE 1HQCA 4NMXB 3O90A 1SXZA 4Z54A 4II7A 4BVBA 4ZNCD 3OTTA 5THQA 3GSXA 3MCKB 3Q6FB 5HJDA 2NUBA 1DQVA 3QZLA 4HQ0A 1X7GA 2X13A 4A39A 4MPJA 4FFYA 4X9YA 1MNUH 1FQ9C 5DJ8B 1FYHB 4ZT6A 2ZXDA 4DV7B 1Z0MA 5JNRA 5FYJH 4R97B 1A72A 4OHRA 4Q3OA 3VAEA 1PNTA 2QGFA 4OH7A 3A3PA 2JCCA 3AGQA 2WOBA 1JWAB 3CLSD 3B3IA 1E3WA 3S1SA 1RIHL 2VE6B 2BVUA 1N0IA 1ZVJA 2DQHH 5FOTA 5F35A 2HKHL 3OWOA 3R5FA 4X71A 4LHXA 3INRA 1JMXA 4HWUA 5KQMA 4ZUWA 1WP4A 2WSYB 4WZBE 1Q95A 3K2UL 3OOWA 2QR0A 3V0VA 4LI3X 1DCEA 3O6FA 3TK1A 1XH1A 2QVXX 1U2PA 1BCSB 1XEUA 1QC5A 1O77A 3QJFA 3G9VA 5I23A 3GXPA 1YZTA 2FX8L 1LPBB 4KVZA 5L8JB 2ODHA 3N53A 2C4TA 3AR4A 1IC7H 4KXQA 4W5WA 3SKJH 4B5ZA 3IEVA 1KBBA 2A9AA 2WU0A 1AM4D 3C7TA 1TUPA 4AJLA 2ZUFA 5CYGA 4Y2OB 5FHAL 3GJ8A 2PUJA 10MHA 1X8JA 4J8RA 1PEZA 5ELXA 2WJVA 3KOZA 2X3CA 2V7BA 3PJNA 4LARH 4B4UA 3HKBB 3VGBA 1UTDA 2HT4C 5BNZA 4RSRA 4PM4A 1AKPA 4URTB 2WDZA 3QRLA 3SDAA 2P6NA 2W70A 1WC7B 4MQFA 1DUYB 3FONA 3IJHB 4FPXA 3U56A 1BKSB 2E4WA 3WS7A 2QZZA 5BPHA 5AYUH 2FU5C 1XZQA 1ZL0A 3RUGB 4XR4A 1HSAA 3AY2A 4KGJA 4I13B 3BN3B 2DQHL 1Q9KB 4JOSA 3CDCA 4CGZA 4R2GC 1HNGA 3QVWA 4ZUUB 3WNOA 5BRNA 2G83A 2VW4A 4A7SA 3CBGA 3WR5A 1L5GB 3T5WA 3G2LA 3OU2A 3ACCA 3VXNA 4S1TA 3H2IA 3C6SA 4Q1EA 1A9VA 4GOJA 5EWJB 5IW1B 3KZ8A 5KVCA 1E7YA 3QQ4A 3KQKA 1AS3A 3G5TA 3T54A 5TD4A 3AYZB 1U8JB 5D8DA 1KB5L 4O63O 2Q3LA 1R0KA 4PTUA 1DBWA 3JZFA 3Q85A 3MGCA 1AO7D 1L7DA 2YEZB 1C0LA 5HDWA 1INQB 1TJXA 5C86A 4X5RA 1N32B 2P42B 3SS8A 3HI1B 2AMYA 2GAAA 4CL7A 2VAAA 5D3MA 4FERA 4Y6OA 1YZFA 3SSOA 1T4CB 4JS7A 1EYZA 2HCTA 5C7LO 2YD4A 2A9PA 4S1SL 3RE1A 1PT7A 2GEEA 1FNBA 3UAVA 3WLBA 1BOOA 3G2KA 3T4EA 4XBPB 4MGZR 2RGNA 4ZDHB 5F2FA 1MABA 1OKKA 1SKBA 1RXVA 1ZDQA 2V1UA 5IROA 4Y1TA 1RBYA 2BFAA 5I7VA 3JWDH 1Q38A 1RC1A 2EW1A 4AUEA 3O8XA 3A4MA 3G5YB 3ZE2F 1D0VA 3ZDEA 5I2IB 4CVZA 3LWBA 4MNGB 1DE0A 4JUBA 3KXLA 1EAPB 2ZRGA 4NECA 3UT5B 4PLCA 3MB5A 1OGAA 4MQLA 4NQZA 3UJ3X 1KXTA 2POCA 1ZBDA 1G7PA 5JD4A 1G0XA 3V0EA 1JX6A 3CFEA 3JWNC 4PZAA 1NGQH 3O83A 4IDBA 4S2SB 5K05A 1HLGA 1X1TA 2QSZA 4ZS6D 3JQ9C 3UHPA 2X2PA 4BC1A 4LHUG 3FAKA 1RLUA 1RFDH 5JTTA 4EX6A 4YTEA 4OLAA 2WK1A 4H7IA 4JJ6A 3NIDF 1U8YA 3W3AD 3UY4A 1E27B 4D57A 5AESA 3GMMA 3KTDA 4Z95L 3T3IA 3O8QB 3A10A 5BV1A 4XYLA 5E9JA 4DK3A 1B7GO 4HJSA 2DU8A 2BFGA 2EZTA 2J5LB 5IJKA 1SBNE 4LCVA 2OCXA 1IGCL 1KI4A 1II4E 1RKQA 5ENWB 1C5DA 2A0KA 1HK7A 1X19A 4F3TA 4QTHB 5LGJB 2M98A 2J9FA 3FF7A 2WD9A 3DIFB 4IMRA 2IEGA 3GD5A 3VWJB 1RLBA 4QDGA 1BFOB 1BZ9B 3EZ6A 2VRKA 3A24A 4R7VA 1WAEA 3GPEA 3H9JA 2G2NA 2C9SA 3OE5A 3UK1A 5P21A 2VR3A 3CE1A 1FLVA 1UCTA 3SKNB 3IP7A 4M62H 1NA5A 3ILEA 1VLLA 4FI3F 3HN5A 2MHCA 4J43A 2D2VA 4LQFH 1P7QB 1MAWA 3MLUL 4EKXA 3S2FA 5AAWC 5BWOA 1EJ6A 2JXMB 1F97A 3E5NA 4B3DA 4F80A 1PWEA 3SZ6A 3EWNA 1FORL 1QQAA 4KNQA 1G5FA 3M5CA 2P8LA 5JXHA 5IUSA 4MW5A 3ATBA 4LTDA 4IRXA 2AMJA 1CUEA 1K5HA 4DSAA 5BMFH 2VERN 3F3HA 2WR8A 5LDSA 4IH9A 1GNQA 4LFBB 3KQMA 4H7FA 4HBCL 3CH1B 2OL3H 4PS4L 2BPBA 4Y1AD 3OZAA 4LLUB 1W15A 2WVVA 1JG6A 2WGNB 3NDJA 3BAEH 2XX3A 2PBRA 3BXZA 4X6CE 3EZ8A 1L5FA 4PCKA 2R29L 2AKRB 4LRIA 4YJGA 4WHYH 3S4SA 3OU7A 3IL2A 5K4AA 4KLNA 4C7XA 4XP5L 1JHLH 4BIIA 1QG6A 4IZ6A 5F97E 3OHMA 3ZBMA 3BSZL 3IALA 1NHWA 2XXGA 4CN9A 1KZYA 5L3QA 1D9KB 4GFXA 1SKAA 4ZZKA 2J0EA 2APSA 1EBFA 1O3YA 1WZCA 3IGLA 1X86B 4G23A 1R33A 2C04A 4ZQKB 3UC2A 3DVNB 1SU8A 1XQXA 4P5TA 4KZPA 1W9XA 4XWOC 2YZ1A 3U7IA 1JS4A 3N8KA 1JE6A 4S1NA 4PHCA 4KWHA 3UTZA 3X13B 5C09A 3WIAA 3O93A 1QEWB 1CQJB 3A2NA 1RSZA 5CYPA 4OU5A 4POZC 2WIIA 2I8AA 2NT4A 1MSPA 5I8OH 1W25A 4Z9YA 1G6RL 3IPXA 3EOYG 2G3XA 1GR7A 2XB9A 3WHXB 2IEDA 1KCBA 2L3BA 2HV8A 4YJ2A 2FEOA 3MT9A 3BXNB 1MN6A 2BM0A 5KNDH 1BX1A 2QN7A 1AXRA 621PA 3UZEA 3L7CA 3GIVA 2DWEA 4ZZFA 1KH2A 5BXFA 5EGNA 3JD1A 3MLTB 3EA0A 4LPUA 1LSJA 4L9SA 4U6QA 3NT0A 1IPHA 2BEVA 4WKNA 1MW8X 1J8RA 4GI8A 3O2JA 1XZDA 4MYCA 3WBFA 2F0CA 5CGTA 4C3ZA 1ZVHA 4I8IA 1I6LA 1NBIA 3AF0A 1FPMA 1JQKA 3EN0A 5K9QI 1QUPA 3AAZB 1OTXA 4JFFE 1W88A 4AX4A 3VR5H 1FNSA 3ZHNA 2WA2A 4HG2A 3VX3A 4NOFA 4B76A 5C0AD 3E58A 5B1CA 5JZOA 1PV4A 3CNOA 4HHAA 3CX5J 2VH1A 4FFYL 1KV7A 5DU7A 2FZ3A 2HLPA 3THSA 2NSQA 3NHZA 3PGA1 3MA7A 1A4CA 5C71A 4OLYL 1JEJA 5DWDA 4BKRA 4DMKA 3E0XA 3A4TA 4LZJA 3TYXA 4ZSOE 2UYCA 3GJSA 3FSVA 4AZVA 4XC1L 1NVBA 2ZIDA 2VPZA 3VI4E 4LAJH 1TPZA 5JNVA 2Y7LA 2BBWA 5EOCH 3GSRA 2YZKA 2H1LA 1UPFA 1SULA 5DZLA 3H1ZA 2WT9A 1SD2A 1GG5A 3U4QB 4ENWA 1C29B 4PZZA 3WYBA 2F53E 3K1KC 4TTQA 3F9RA 1E4XI 3GK3A 5DD3H 4DJMA 5FYLH 4YH1A 5CWSA 4BVAA 5E6IC 2RC6A 1IZJA 4GECA 2Q8AH 1YMHA 3P7MA 3ANNA 2VXBA 3V32A 1IBMB 1LRJA 1OEZW 1JV2B 4BMDA 5EJEA 3U7FB 4CV0A 2QMKA 2R7MA 4ECNA 3S37L 4B17A 3F98A 2R87A 1T1EA 3WZ2A 4XYBA 1I9EA 1LI5A 4CUZA 3EPJA 1QIMA 4GNKB 5DLLA 3B6JA 3JSAA 1T13A 3WLQA 1QKZL 1KTKE 2XZQL 2C8JA 3GRFA 2J5QA 2VUUA 3QIAA 1YCDA 3M6AA 1B0PA 4UTXA 4DQLA 4WD3A 3E8MA 4WCYH 1MG5A 4TLBA 4W1QA 1F2QA 4DP6X 2Y6SD 3EDDA 3I75B 2CXPA 1R0XA 4YPVA 1LZLA 5BXYA 3PGFL 1IJFA 1FDLH 2C2YA 4DW2L 5JBIA 2NCEA 3B1ZA 3O8XC 1CYGA 1P4RA 5D6CB 5E56A 4F57L 2AOTB 4UJ5A 2AJDA 2WMPB 4PG7A 1ZK5A 4O6VA 5DGHA 1O94D 5BV7H 1OD9A 3DONA 1MCNA 3HMXA 4UYQA 2AJTA 5DHPA 2WYUA 2WSSD 3OQ1A 3UFXA 3L4XA 1ZR4A 2H3HA 1LK3L 3H5OA 5JPMA 4CA4A 3QUHA 3BP7A 5AWNL 2WM3A 4HIIB 4JE0A 2A0FA 3OLYA 3O4JA 3NHJA 4XNAA 4U63A 4AQEB 2BI4A 2KHAA 3EJSA 3PQ5A 4P4GA 2WVTA 3B34A 5I9LA 2VDNB 5IM4A 4X5WA 1PVVA 4Z9BA 2IDMA 3JT2A 2IA5A 4I1YA 1C8VB 1R3JA 3LQKA 4K9DA 4XE5B 4IKLA 2LLGA 2VXTH 3L0CA 3FHAA 3L5OA 2ZW9A 1PFOA 1Y1DA 2JKZA 2YJNA 2NYRA 4ZSOB 5EOQL 1HTWA 5JR1H 4LRUA 3VXUA 2BTEA 1BV8A 1MIEH 1JJ7A 2WP3T 3ROGA 4TM7A 2XWRA 4Z5RB 2OP0A 5EJ6A 2WIDA 3D6NB 1F42A 2P5PA 3LOWA 4FOOA 2EUXA 5CBPA 1WBYB 4FXKC 3HI5H 1NONA 1CD5A 1H1LA 2HRQA 2FOIA 3BCHA 3FKQA 4WUUE 2BI8A 5B3JC 4GINA 4R7NB 4ADJA 1UG9A 3DMMC 4MTMA 1DIOB 5FM5O 2CGYA 2NN3C 5J4KA 4YUYA 4BUZA 2A2ZA 3ITNA 2K9UA 4PP2A 2DWPA 3WA6A 4N2BA 3UJNA 5B7PA 4NQEB 5AW7B 4AQAA 3ZGNA 3WIIL 3LRHA 1OTYA 4MMZB 1B73A 3LKQB 4D9EA 5EFZA 2EYSA 5DJZA 1QP4A 2X4OB 1FQKA 5LUAA 1FO0H 4PJ7B 3Q43A 5TF4A 4JR1A 1DVFC 2M26A 3WRVA 1MIOA 1JHOA 4YBZA 5K59E 2JKYA 4KIGA 1MPTA 4XA8A 4G81A 2OCLA 5D2NA 2XUWA 1VIVA 1TETH 2B6NA 4UUPA 3P2BA 2Q2EB 4Z7WB 3PC8A 1P62B 2BBOA 2K4WA 1WTLA 5EU4B 4M5YL 1XF2B 1G4HA 1BLNB 3WWYA 2Q0SA 4XB1A 3EZXA 3QJVB 1V27A 5E8EB 3QXDA 3VHQA 2D3WA 2QSVA 4CJ0A 4E9SA 1Z5NA 5CZXD 4WCDA 5HFAA 1FSKC 1U8XX 4JDPA 3ARWA 5D7JB 1F45A 1NSTA 1E2PA 3DCNA 4O1MA 3L8YA 4XMZA 2ESRA 2G30A 4B3EA 1SMOA 2JJTC 3UHJA 4N6GA 5ERYA 2Z9DA 3CPJB 3W5JA 2D8KA 1E9CA 2WMDA 4FGMA 3KETA 2DHDA 3M2PA 5K8IA 4FAAB 5I73B 7REQB 4G0WA 4EUPA 4LHUB 4BNYA 4I0PB 2X0VA 5KQRA 1P33A 3B2EA 4TMYA 4NC0B 3CXRA 1AU9A 1D5CA 4K40A 4FLFA 2CO7A 2NW2A 1Z4NA 1YGYA 3HXKA 1OXKB 3M0EA 1BEEA 4S1QL 4ZOLF 2RB4A 4LCYB 4GGOA 3QFJE 4WEOA 4V03A 2HKIA 1AMXA 5EPUA 4DDMA 3C60B 3G9QA 2I4RA 4OL9A 4FNLL 3QJUB 3VU8A 3IMVA 1BLNA 1ZTXH 3VWKD 2Z8SA 3EEOA 2QW8A 2DYKA 4CT4B 3GZ4A 1BGXH 4LXFA 3TQRA 4I50B 5KOVC 4Z7WA 3RANA 3R4DA 2ISCA 4Y4FB 3HFGA 2X40A 3FFCA 3IFNL 2BFBA 1HWHB 1N68A 1HHJA 1BA2A 1E98A 4J6EA 1W93A 1V4BA 3IB3A 5B1IA 1FU8A 1CXLA 3BZUA 5DZSA 1HL8A 2YGVA 5B64A 3LS5H 5CFQA 2X4OA 3IQIX 5LMCA 2XGOA 5AQEA 1A9QA 2CIKA 4P3YA 5KW9H 4MVJD 3LKQA 1YDEA 1UWFA 3G7UA 4Q7DA 2XCSB 3PYMA 3BMQA 4M43L 2O6EA 1GGKA 2VSYA 3GPBA 4FNLH 1USKA 5JBQA 5WRFA 5E7FA 3PK0A 4Z7UE 1XBRA 4R7NA 4OFIA 1BG6A 2X89D 2D4AA 3ASOB 1IGMH 2P7TB 3O3EB 2I3GA 4X1YB 1XZLA 4F33B 1E4XH 2X6VA 4XIGS 1PZDA 4REMA 3UMVA 4EVIA 5JXEA 5I7HA 3C09B 2E4TA 2OTCA 2C78A 3IE9A 5IC4A 1KGXA 4KPGA 2ZUSA 3DX4A 3MACH 1N6KA 1NMSA 4TKUA 3TE7A 1MLDA 3F7YB 4JRYE 1JG2A 4GBXD 1POWA 3KELA 2OMNA 3A9RA 5FF6A 4AQ1C 4WLVA 1P4JA 5BUPA 3ZO0A 4PJBB 4JT2A 1Y4UA 4XPFL 1UBHS 4MB6A 1E32A 3K35A 3EYVB 1B0IA 5FX3A 2JGFA 3DRTB 1HYSD 3AOEC 1RJGA 2NYKA 2DDQH 4A1RA 1ADBA 1T91A 1KVQA 2YBDA 4CL0A 3T3PF 1J1UA 4EKEA 3URKA 5KUKA 4UNUA 5DGTA 1K6QH 1A82A 1IJEA 4E5XB 1AGEB 4N3GA 1O1YA 3CF2A 4EEEA 1YQWA 3HDVA 1Q0PA 3L6UA 2DYPD 1LDYA 1H5BA 4WADA 5CM9C 3VO9A 4UDUB 5CS7A 1FNNA 2X4DA 2C3OA 3WAJA 4IQFA 2XLLA 1K2DA 3ABZA 1HZHH 3ZDFA 1GMIA 2WLKA 2YH2A 4RENA 4MUAA 5AZUA 4B44A 1JL3A 5GIRA 4MDEA 2EFDB 3GTNA 4NRYA 1IQ0A 2WZ6A 1MC5A 3QO0B 1JZ8A 1VBMA 1JXAA 3GSNA 3BRDA 4BFLA 4AYTA 5CH8A 3N07A 2ZR9A 4GI1A 2Z8YA 2CJTA 1JVOA 1UZGA 4B9IA 4TTAA 2OXGB 2X4PA 4MB0A 1W8IA 1WSBA 2R48A 4XGIA 2I66A 3C1UA 2VGLM 3GI8L 1XJCA 1PSKL 5GZOC 1KGUA 3K6OA 5BPFA 1KETA 2DH5A 1XVAA 4ND7A 3I6MA 4B83A 1C9SA 1MEEA 2G06A 4NNXB 2YMQA 4KIWA 1ULBA 4N26A 4OA8A 3SZGA 1SOWA 5BUQA 2RQ8A 4EDXB 5I18L 3B2VL 2I69A 4KV5F 1T5WB 2FHPA 3MCYA 4B6SA 1H8HD 4IZHA 3C3EA 1FYFA 1KCKA 4EBBA 3NVDA 5KVGL 4XDZA 4D8UA 3EJUA 1LO4H 1JFFA 1EHLH 2A35A 4V1CA 1IOWA 1V11A 3KHTA 4PV7A 3KUCA 1R5WA 1LP9A 2Q5BA 2BR3A 2ZJFA 1OW0C 1G7TA 1CQKA 3KZXA 4GEKA 2WVAA 2OHHA 4H77A 2BIIA 2F64A 4EFNA 1X8LA 4OIIH 3MRQA 1I3MA 1VC2A 2QPEB 1ZJ6A 2V7VA 3GRWH 4BD4A 2R44A 1CF9A 32C2B 1MFBH 1ZK4A 3VXRA 1HINL 1RPQA 1U94A 2J5XA 1SHSA 4Q97A 2VZ9A 5K0LA 3IDIB 3JWJA 2HRPH 4AAYA 4OGAD 4H35A 5DCLA 3MXWH 4BO2A 5FCUL 3ONWA 2Y7NA 2FK7A 4P98A 3IF1B 1Z37A 5F98A 2FPUA 3RYCB 4TKWA 4NFLA 5HP4A 1QFWL 2YXEA 4R54A 2A0LC 2H63A 1JZ4A 4QOEA 3FT3B 1RU3A 2ILVA 4GUAA 4W9JC 4W5OA 4J7AA 3WDIA 1DB3A 4D0NA 5GJBA 1EA7A 4Z3JA 2XV6B 3A2KA 1LX7A 4K86A 4HGZA 1O95C 3QNMA 4HIHB 1L5VA 4EG6A 3DBXA 4LOAA 1G21A 1KERA 3AETA 3MLTA 4G0MA 2VFAA 1BBJA 4OCNC 4JQXA 5ELLA 1OTHA 2RJNA 4KQJA 4PLPA 1GRQA 3F00A 2DWEB 2RK6A 5CFOA 3QJSB 4QIHA 2BSBA 1ORIA 3LLVA 1TQVA 5FNVB 3TJPA 3M8OH 3HG2A 1O94C 1QNZL 3U36A 2C2XA 1BCRB 3M1YA 4AJ9A 4FYJA 1NFIB 1PEWA 3O0LA 4XB7A 3FKSD 5JRZA 4O33A 1QW9A 5FJIA 1FX1A 3V6FB 1Z83A 4MV4A 3DG9A 3R1IA 4ICIA 3H4HA 4RX4D 4PQFA 3LRLA 4P99A 3DMMB 1ODCA 2IK8A 5M29A 4QBFA 3EBAA 1KEPA 4I6JA 2G9QA 1G84A 2XA8L 2FMIA 5CNKA 1J70A 4J2XA 3ZIUA 4EHNA 3OAYH 3UYKA 2EF0A 1OJ7A 3EZYA 4U6SA 3H85A 1Z2PX 3NJNA 1A0QL 2JIXD 1TNDA 3O26A 4KQIA 2CWWA 5JCZA 5L3QB 2GN9A 3B9KB 3OWRA 4UCXA 3IDNA 1J4AA 4JKPL 1YBFA 1RUKH 1FTNA 3KH3A 2W2VA 1QR1A 1GS8A 1MD9A 1WXWA 4YCNA 1JRLA 5F2EA 4P3XA 1CT8A 3B4NA 1B93A 4JLVA 5C2JB 5IC5A 1PKOA 2VIRA 2GK3A 4XXWC 4ND1A 1LPMA 4XRGA 4E9XA 3OZSA 1FE8A 1MAJA 5TQ2A 1GNSA 4ANXA 3HV0A 4HFWA 4PJ5B 4F38A 4JO3L 4H1HA 4ZW6A 2ZVQX 1USGA 2V6BA 4JFOA 4D2IA 4MXQD 3GVIA 2HFTA 4U6XA 4JRXE 1JA9A 4PJAA 2EUWA 4JLDA 4Q3CA 4UNTA 5FPPA 4D0CA 1ZC3A 4CR7A 4LZOA 1CUBA 2Y6TE 5E7JA 3MRMB 5PNTA 3AVUA 4QHLB 2JIZD 1JR2A 3V7YA 4D9CA 5CVEA 1WEHA 1L5ZA 2Q0QA 5C51B 3U7JA 2XZQH 1A6WL 4JREC 5IDYA 1MORA 4JYAB 3NEPX 4R26H 4KJZA 1I36A 3Q5YA 4ZJZA 1RZFL 3V1TC 1YVEI 1Q0XL 4NKRA 2EO7A 1LE5A 4WSGA 1EFLA 1U8UA 1NZFA 1WF5A 3OJDB 4NF2A 1FF5A 1NIAA 1OZFA 4XC3L 1DWPA 5FOSA 4P3KA 1CGYA 5E0KB 1CFQA 4JKPH 3OC0A 3VYOA 4JG5A 3FHLA 3FPGA 4O00A 1EX0A 1OC4A 2YASA 5AKGA 1UH5A 4KEAA 2OWEA 5J89A 1UKYA 5FM8A 1IXKA 1P6XA 5BOSB 3BPNB 1C12B 4PSPA 3QZOA 2Z7ZA 4NK4A 1H3VA 3V7MA 3VXMD 4G89A 3O8RA 1Y1SA 1FIGL 4PJ9C 4CW1B 3CYFA 5ENWA 1Z5VA 1QDUA 3EQZA 2JB5H 4Y4KD 2N59A 3I32A 3TIEB 1BQHG 5ADVA 3P0IA 4DUYB 4QYMA 1R88A 4XPHL 3WY4A 4R05A 3C16C 1QA9A 3SQBA 2VQUA 3GAZA 3ZHVA 3L7EB 5JMRA 4GAJH 4ND6A 3VGAC 2Q5LA 2HJ9A 3A0UA 3PP4H 1NVAA 5ALRA 4XX1A 1PFYA 3E81A 3HG7A 4XARA 1TOAA 4MWSA 4I55A 1RU9H 3FOEC 2H85A 4IQGA 1KQFA 3ILSA 2NU9B 4GIBA 3G6AA 2Y1CA 2AA3A 1FFBA 3ABQB 2IFTA 5CA1F 3P0FA 2CGRH 3A67L 1U6IA 2Y1XA 5DF1A 4BXOA 4DJTA 4IDHA 3BDXA 4FDAA 1XGYL 4YRAA 2I4OA 1XXDC 1UADC 2AV7B 2RHJA 4F20A 1KGDA 2IAAC 3RUFA 4C76A 2XWDA 4D6YA 4W9NC 1DLJA 3UT5A 4QRTB 2AHRA 3DMDA 1NVKA 5HJ3B 3RBAA 1NPTO 4I18C 4I6EA 3I2KA 3OR7B 2YDYA 1XGRA 4P4RB 4Q89A 1KOJA 2HFFA 4OLEA 1DAOA 4AJYV 2H4JA 5IPFA 5CIPH 5DTJA 1HWYA 2Y5TB 2FDRA 1VA9A 3Q8XB 1D6VH 2O61B 2A9BA 5HGGS 3OTIA 1VACB 4MYTA 2XFXB 5A3IC 4LF7B 2R2HB 4NJMA 1T8WA 3L5WB 1PD1A 4ODXA 3ELAT 4QT4A 2WTXA 3I6GB 1PVOA 4KOCA 3U46A 1JE1A 4LBEA 4TLMB 2GEDA 5I16A 3KWJA 3GFGA 4IH4A 3RIGA 1QOKA 1OAQH 5JD5A 3ZMNA 4WQMA 1ESDA 1IRIA 5LG6A 3CXHK 3BGMB 4MMYA 2B4AA 3LMKA 5TE7L 4M3NA 4YMHA 1J0YA 4WNQB 3ARDB 2FSSA 2HLEB 4JFWA 5L2KE 2FJGB 3A4VA 2M32A 4DLUA 2J0UB 2QTZA 2XPGA 3A2MA 5JOQA 3SSAA 2WQZA 2DHEA 2WLIB 4Y2YA 5DGRA 3TGXA 2Y25A 3BDYH 3IJ8A 5D71L 4BV8A 4R3SA 1S7WB 1H1DA 2WAMA 3QPAA 1EFQA 2R1VA 4ODSL 2XIDA 4URFA 4JFVA 1H3TA 4ODXB 1ML3A 3CVUA 3HB9A 4UTOA 4QGTA 1U2RA 3KFLA 3S36X 2HWYA 2OE2A 3FOCA 4OQXA 1GPUA 2I9KA 4AIZA 4Y2XA 2JKLA 3MA9L 1NMBL 5HKAA 5FA5A 5C97A 3G5VB 3D0OA 4HQNA 5JNUA 1YCGA 4LS3A 1R9JA 1RJWA 4YUXA 1VDMA 4A7QA 4O2AB 2AK2A 5HJ3A 5FYLE 1YS7A 4JZOB 5JALA 4I9WE 1DTWA 3P9KA 1OV6A 3S7ZA 2NU6A 2REQB 1RIUH 4P7BA 1V2HE 3SE3C 1SVIA 2H41A 5JXED 4J0CA 2AQ1A 1AHHA 4NQSB 3RV3A 3UIZA 3ETBJ 3WYNA 3E9MA 2RTTA 2BJMH 4JFEE 1EBUA 3DC0A 4MRNA 1Q9OB 3QJRB 2IYZA 1FNSL 1JPNA 5HYVA 4BXOB 1BAPA 5IAEA 3VGDA 4JP3A 5D71H 4Y5VB 1C4OA 1U80A 1LMIA 3VPSA 2QUAA 5DRWA 4WUKH 4Z9AA 5C35A 3WTXA 2EHDA 2GTQA 2WEKA 4EJ2A 2G8LA 3E4CA 4BKMA 1J22A 3VFUB 4OFDA 2VE6A 4LJ6A 3DL2A 1UJMA 5FKPB 4P5TD 1E3WB 1KMGA 4LRYA 1R8QA 4PPTA 2BZ1A 2Y22A 2EZ8A 4R84A 1BLIA 3H0TA 1NAHA 3KWUA 3QBEA 4X64B 4KLRA 3ATAA 2OCPA 3KRTA 3JQBC 3BILA 2FPGB 5T3ZL 3LG2A 2IF2A 4LDJA 1EAQA 3B9KD 4O51B 4R6XA 1BNCA 4GRWE 3BVNA 5FWQA 1S8AA 1BDHA 3RSGA 2VJLA 5IKPA 4EG8A 2A58A 5HF9A 1NCNA 1AS2A 3QHZL 2WXFA 3MCKA 1ZWIA 2QQGA 2G08A 4JGNA 2CCJA 3C8ZA 1F1DA 4PN3A 4EARA 3UAGA 4JBWA 1JZTA 4HKZB 3T15A 4LPSA 1RZIB 1FPTH 4HWSA 1C50A 3U4GA 3TBWB 3T0EE 1SJ9A 1O75A 3BSHA 4XMKL 2GWRA 5LP6C 4A1OA 4G71B 1FXWF 1P1CA 1EG2A 3I85A 2ZZMA 2VAWA 2QD4A 4JM2F 2GSGA 4LHJB 3U44A 2WVJA 1G4UR 3TZVD 3PGLA 2GCEA 3U7RA 3EYUL 1SIBE 3J81A 1PLGH 5E0OA 3BCRA 3L4KA 3K3PA 3IDMB 1TO5A 5T5NG 4YHZH 4LZNA 4KMQA 4N0CD 2VK2A 5EZJA 1C3JA 1OAOC 2DBZA 4TS1A 3PFKA 3MN8A 1X6LA 4F37K 1XH3B 3L7IA 3VM7A 5FL7A 3MUGA 3E15A 3LMJH 2XUGA 1E96A 1SC6A 3T35A 4EMSA 3S36H 3MWJA 5TEVA 1SN5A 2HJKB 4JC0A 4EIZC 1YEKL 3AJ7A 3L5IA 4JNXA 1AR1B 3FRHA 1V3UA 5GJSH 3RGVB 3CUSA 4OHVA 3Q8EA 1EUQA 2BEUA 2JK1A 3N1UA 3K0HA 2LIPA 3SXUA 2P2LA 5AAWA 5KOJB 1UDBA 4A1FA 4AFNA 1M1YE 4YP5A 1PWHA 1MX5A 3BYTA 1XZBA 4G6MH 3IDGB 2OULB 3DLTA 4MDRA 4JUIA 2Z35B 5T5QA 1EERB 1FJ1B 3CEHA 1ZOLA 4PC1A 2VDWB 2VG8A 1KO1A 3OD5A 3IVRA 4OLZH 1HFJA 4MP8A 3SGLA 2ZCLL 3ORYA 4EN3D 4OHMA 4CUKA 4HAGA 3FNKA 4AEIL 1V35A 2GJ6A 2CR3A 4LXIA 3QKUA 2ZANA 3FU9A 2DLNA 3GUCA 1IL1B 2ZAHA 3KPSD 3MLYH 3C2AH 4QHKJ 1SQSA 3UTPE 3OICA 2X38A 1YK1A 3P3RA 2J43A 1L6ZA 4BX0A 3X3HA 1BFVL 3VGPA 1JDCA 4NYMR 3VGEA 1G98A 4MGEA 3VACA 5AXCA 3RVNA 4LNAA 4UT9H 1TM4E 4ZK6A 3AUAA 5LVAA 1W0KA 1NIDA 4OF3A 1ZGBA 2JFPA 4PYMA 2WLYA 4IBYA 4MUHA 5ALBL 4HX1B 5AOZA 4DGWC 1I82A 3IWUA 1ZDMA 5D1XE 4F8QA 5LR6A 1A1SA 2YWCA 5F9OH 3RE0A 1Z0FA 5K0NA 3WJMB 1O9WA 2QVIA 1M9WA 5ID1A 2D1YA 5L9DL 1IN8A 1YEGL 2GW5A 2GB4A 1F6BA 5HHVH 3HUDA 4RKEA 1G6VK 1WBZA 1E2QA 1EXDA 1TL7C 1XLUA 1T1ZB 3HCCA 1RHJA 4U5XA 2HYIC 5F1KC 5IH7A 4K7PH 3S1LA 1J42A 1BKYA 3FIJA 3GS0A 4J0GA 4ZI7F 1PG7X 5C1OA 3F5WA 1AF7A 3D39E 2VC2B 4XFDA 3DQZA 4ZTBA 1MPAL 3D25B 3TXAA 2AFIA 2ZQ5A 2JHAA 4AIIA 4XOIA 4YOKA 4HGKC 2W8BB 2H92A 1SCJA 5CM2Z 2X6BA 3QI9A 3FT3A 3GXIA 3OZFA 3PGCB 2XB8A 4B6FA 2EGHA 4ZMTA 5JYDA 1DV2A 4HDIA 1SY6L 2EDEA 1EGVB 2F55A 5GZ3A 4FFVD 9ATCA 1EUDA 3L4BA 5E1DA 1NU8A 2GD6A 4R6UA 2DWXA 4Z7NE 4UILH 2WKQA 4A7GF 4MZIA 4PLKC 3IDIA 4G5XA 5DF0A 1PR4A 5MFPA 2C7FA 7AT1A 3IDSA 4XPGH 5DK4A 1IM5A 1PW5A 4P83A 2VHWA 2M2IA 4C0JA 1YIDA 5E4JA 3MTAA 3KAJA 4HISA 4OJFH 3EFHA 4U0RC 1KEZA 4XVUC 4BK8A 1QBML 1J9GA 3PQ2A 3SP1A 4A7VA 4HGRA 2DMBA 3KW8A 1ZTMA 3EQ8A 3GHHA 4HO1X 3SGKC 5GZOD 3ZE0E 4C4AA 4O4HA 5EMJA 1ZMTA 4DLAA 1TZBA 5DH9A 3L8DA 4IGBA 4OT1H 4EOGA 3S35H 2GIYA 3ENVA 3BHJA 3STWA 3GNLA 1O7DE 4YR6B 4RDXA 1M34B 3B3FA 3B5JA 4DWHA 3VGJA 3IU4L 4ZVLA 1AACA 5I8KL 2NXZB 2ZSEA 2H1PL 3OI7A 5KVFE 4J1UB 3QIUA 1YJDH 4GSLA 1MHPA 3MIZA 4I5DA 3HHSA 5CJBA 3VXPB 3AB7A 2GEQA 1PR9A 3TSWA 3RHZA 4PS8A 1A8QA 1WZNA 5AW2A 3IBEA 3NAMA 2W90A 3GIDA 5CKAA 3AY7A 1XPUA 5ID0A 2ENQA 5IYZB 4H0GA 2CW5A 4LGPB 3SJVE 1GZPA 3KXFB 1A95A 5TF1L 3KNBA 1EI9A 3D50A 4HIEB 4LRNH 5ALNA 2F90A 1XZMA 5HD8D 4M1MA 2EKPA 3WFEH 4BV2A 3UKOA 3F7RA 4ZBJA 4QUOA 1X4YA 4BS9A 1IGCH 1UMBB 3X12B 5HUJA 4CEJB 3IVGA 3CPUA 5CEZD 4RK7A 3SG0A 5F7BA 1HJBC 3FPHA 4POYA 3O41B 1FQOA 3AFNA 1HV8A 1QO3A 1O5PA 1W0VB 2G9VA 3QEBZ 3U83A 4LVOB 1J1PH 3IFOB 2BVPB 4OCWH 1SVCP 1OW3B 3CHPA 3F5MA 3T9EA 3M1LA 2IUFA 1PZAA 2RA1A 4U7WA 1YULA 2X0RA 4CMIA 4OJYA 1MRFH 5TF1H 3DO7A 4Z3DA 4CU2A 3MJGX 4HWBH 2IWRA 2CCGA 4RSGA 1WWKA 2WC1A 5EHZA 3TYFB 4GRDA 4JAMB 4Y1FA 3TR5A 1HDMB 5FR3A 2XN9E 4JHWH 4KJXA 4KXNA 4R1PA 4E03A 1FZJB 1G8KA 4DHWA 3CUWA 3EC7A 4RPHA 1V3LA 1FFYA 3W8RA 3MD9A 3G6JA 5JATA 4B4WA 4XC3H 5KTRA 5KWIA 1ZU5A 4LDRA 2DQCL 3RTLA 2XDYA 3EDRA 1C7IA 4UM9B 3AHEA 1IZ7A 3ANSA 2O5CA 2YCLA 3UJBA 4H0LC 3KM1A 3UH1A 1RZFH 2EVJA 3H42H 4AY3A 2ZLBA 1SJHA 3EYVA 2PSHA 2H6OA 4YWJA 3S28A 2NT0A 1LPOA 1JZ7A 3R77A 4KWTA 4AGQA 2P2YA 3U39A 2XJLA 1ZN2A 3CLRC 3NGMA 1AR2A 3DAPA 3D6UA 2IH8A 3C60D 5KNBD 1RWOA 3SPVB 3OKAA 4F71A 2PUTA 1R24A 2PW2A 4MDJB 3QIWB 1HYQA 3IO5A 4HDOB 3OT1A 3H87A 3W0WD 3Q9SA 5A2CA 4B7ZA 1UJ3C 3PQDA 4KR3A 1KT2A 1BJMA 4UWQB 2QW0X 1JZQA 1CU1A 1FOEB 2IWKA 4JM4H 4B0OA 3FYIB 2ZOLB 4ZAGA 1GKYA 2OW7A 3ZHLA 4L0PB 2CJUH 4RM2A 3SBEA 3SR3A 4Q66C 2I3ZA 2XT0A 1XPJA 3PITA 4H7EA 2XKKA 3D3VD 3KQOA 4AMYA 4L23A 2WIMA 4NS4A 2BC4A 2VDRH 3KPRE 5I30H 3HMXL 4IS6A 1IPFA 3Q4GA 3KGUA 3OQMA 2Y06L 3LCYA 3CIFA 4OK5A 1Q0TA 1A0OA 2E85A 1JJBA 4H8WL 5HWSA 1NVUQ 2GNOA 3CH5A 4XB2A 2EE2A 4QOKB 2YAMA 1UOOA 5AJTA 5ERXA 2CXQA 1ZT1A 2B4TO 1L9RA 1DQDL 3EH4B 1P6WA 4LPXA 1PX4A 1Z35A 2BVOA 4OUKX 4ES6A 2APWA 1IZZA 2QBYB 5ADPL 3FPFA 5AK0A 4MBOA 3ND5A 3ND9A 2GHWB 2HXYA 3U40A 3R9IA 2J08A 4YSOA 3EQ9A 1VDZA 3U7GA 4WVRA 1ZT1B 1EK0A 2DG2A 3IBSA 2H57A 4EN3C 4Y4FD 4DLKA 3JTSA 3C60C 3E70C 2CNWA 2ATAA 5KYTA 4ZQHA 5CEEA 2B9EA 2O2HA 4W9DC 4KR0A 5CUQA 1QHIA 2XHEA 4MCYA 1OD6A 4QFBA 1TVCA 2VLMD 1VCBC 5HCNA 3ZDZB 1PJ8A 1V5GA 1I1FB 5JXJA 2DFVA 1FYTA 5EULV 4GW3A 3T2OA 3MLSL 1QV7A 5DYOA 1XF2A 8AT1A 3LDFA 3LH2L 4UOZA 2R2GA 3K1JA 4GWKA 1TQHA 3NHFA 1KS2A 1U9IC 1H4QA 2A9NH 4FYHA 4LJ8A 1CJYA 2YXNA 1G41A 4LSTL 4L7QA 1XO8A 3ETCA 2EQDA 4E5NA 4DDHA 1TTRA 2DFTA 1EWRA 3ILPA 5A4IS 5M7EA 3Q1EA 1XD0A 3MRCB 4GEGA 5D2CA 1RWMA 5KJRH 2V2XA 1T3LA 4URZR 1H8EA 4TTTS 3QIWA 1RC0A 5FV4A 4NCDA 2JLWA 4ELMB 1R0WA 1UKQA 1XGTA 4PJFB 1LD3A 2YJ5A 4FQ5A 5IB4A 2VDQH 1FZMB 5ALQA 4TNWF 2GRAA 4ND4A 1Q3KA 5I74C 4HUWA 4D1YA 3G89A 2ZK7A 3ZBPA 1KZYC 1UH4A 3ND6A 4HEPA 3II3A 1EJ8A 4JCLA 5CBPB 3OBIA 1QE3A 4Z7AA 3F58L 2HMUA 1Z47A 3L7BA 721PA 2CNYA 2O93L 5BYKA 2HGSA 2OY0A 3CRQA 3EOBI 3ZRSA 4HH1A 3IJ5A 2NP6A 3ROQA 1I6MA 2JF0A 1T7XA 5FLYA 1CR6A 5I6DA 2EFYA 3FMVA 1J7JA 1DQNA 2CJXA 2R23B 4R5MA 1GNRA 3PJSB 1PG0A 3O2VH 4AGOA 3A67H 2JCVA 5I1HH 2XY4A 5E3JA 5IF0A 4HXAH 2YINC 1PUXA 1U0FA 2BMEA 5B5SA 5DD0H 2H07A 3T5TA 1BRTA 2X3AA 1Q44A 3GJTA 3OOHA 4PD4J 2NO0A 1E9SA 4S1RL 2C3XA 2BVPA 2F9BT 2IPAB 4KR9A 2ONCA 1R3LB 4BMCA 3O41A 2K8MA 1PL8A 3ZLTA 1ETZB 2YJ3A 4HS9A 1JL8A 2V55B 3UMCA 2G75B 3X2EA 3O4LD 1FMJA 5AP9A 2QE7A 1O6FA 1QHGA 3GJZA 2BELA 3EADA 3DIVA 4P23B 3GFBA 3RBSA 1R0AH 1PMYA 1LD9A 1WHSA 3ESUF 4K5MA 4ANFA 4F5DA 4NJ9L 1GUAA 2D2OA 3KWFA 2WHXA 2RGYA 5I51A 2VT0A 1OY1A 3LYLA 2IBZX 1N0HA 1N5AA 1XX9C 3WGTA 2QJTA 1OH6A 4WWPA 2R7EA 1JPSL 4AMUA 3RWHB 3ETTA 2ECOA 4G6ZA 4B6PA 1GADO 3L8FA 1M34A 5LLDA 2HSDA 3QYAA 4X3OA 2QGDA 1C30A 3TFKD 1YA5A 3P0VL 4JKMA 1JLHA 1VPOL 3CLWA 3TLAA 5AW8B 1B4LA 5E2AA 2RHGB 3DSRA 4JY5L 5IAAA 4CKWB 2VPIA 2B2CA 3I9PA 3VXTB 4IJMA 5J57B 3AM8A 4AC2A 3STXA 4G6AD 3ZLUA 3KQNA 5CINL 4AGPA 5B36A 3EDYA 1KTDB 5D72L 4Z95H 1GZDA 1ZM9A 1YBMA 2OBGA 4QU8A 2IBBA 4WJLA 3N06B 4Q00A 4P5KA 3TO4C 1YHPA 1D5ZB 1V4VA 3Q7QA 4UVEA 2E4FA 4KITB 2ZOOA 2JIXB 4PJDF 4RGBA 5CHNA 5BYJA 4ZW8A 2W0PA 1QDLB 2ARWA 3LH5A 2FGJA 2Q2NA 2BFCA 4AEEA 3ZQJA 1SUEA 2EBWA 4AC9A 4HAXA 3AS0A 1R8YA 2X7LB 2Z8XA 5FXMA 3AM8C 5KSUA 2RGBA 4K8RL 2F1BA 4B6GA 1G6RA 2GKOA 1VCAA 1E5TA 1UT9A 5TNXA 1A7RL 1QFPA 4Y2DB 4YDJB 1X1BA 2J44A 2IGLA 4Y16C 3VU3A 2K7FA 2CVHA 2A67A 4DN4H 4RY9A 1LLCA 5HHNB 4RXTA 3MROB 2E56A 4U4AA 1O6BA 4MVCA 5JH7A 1SXJB 3DX7A 3GMLA 3E0GA 2W8CA 5F7WC 4YR9A 5HG0A 2HFEA 3THWA 4K3DL 3UTTD 4UCFA 3AWIA 2IGTA 3QHPA 1F7UA 2FP3A 5F8RC 5DD3L 4HX1A 2FEAA 3ZUCA 2E1RA 3VO8A 4OBRA 2QMOA 3P26A 4KN8A 5KYWB 3KLHC 4JP5A 1TLTA 1AD2A 4QYSA 3G8AA 2O2YA 1NQWA 4RZCB 5F96L 1JF6A 4MW0A 2H7VA 2GUOB 2CO3A 4ER0A 2Y77A 1QF6A 4FU0A 4NHUA 4ZYLA 2D0GA 1OQXA 5MEPA 3QQ9C 3WP0A 1CB0A 4OL0A 5H9VA 5E5LA 3OQJA 2E74C 1HI6A 3DV4B 2IDKA 1QORA 3TYGL 2NQTA 2JL1A 2IAMC 5AK5A 5SX4H 2ITFA 2IHNA 4JZYA 4HPOL 5E6UA 4JT8A 4W8GA 2H5IA 3INUH 4AQ1B 4B45A 4LCCC 4ODVH 1IILE 3BUYB 4I3GA 3IKMB 2MINA 3HKEB 4IDJL 8ADHA 3B85A 2L8AA 5EZYB 2VHZA 2ZG6A 4Z0XB 5DYWA 3S88L 4P4NA 3WYDA 2R83A 4XNYL 1N36B 1Z6QA 1JDBB 4ZGBA 2EFEB 1ZHLA 5HK9A 2FHFA 1ZIYA 4MH0R 2PP9A 2P7HA 4F1JA 2X1QA 2XFGB 4MDIB 1VGVA 4PAGA 5CMLA 2UZ1A 3SJZA 4JOCA 4RGVA 4RXMA 1FFCA 1K7CA 4HUQA 4QREA 4MIKA 1CZHA 5AKJA 2C1EA 3TFQA 1NMXA 3QWBA 3J7HA 3GUUA 1BEZA 4EYSA 3L06A 3DJRA 3CO0S 3HO1A 3BTSA 1LLQA 5JCJD 1SXQA 1UD5A 4HX5A 5K8CA 4ELMF 2J33A 2W88A 2B94A 4IK6A 5D7LD 2PWGA 3RKSA 1F58L 4EZKA 1AKYA 2FJHA 4HJIA 5CD5C 1L8XA 3ZL4H 1AE1A 4BO3A 3RC1A 3DC2A 3ESZA 1NGWB 2BW0A 4UI2A 1EA5A 3DUFA 4G7VH 3VNRA 1RRMA 3VDAA 2P44B 2WB2A 3FQWA 2PD6A 4JS0A 5EJIA 3V8EA 2C2BA 1XCTB 3FB7B 3CUEF 1RL1A 3RKPA 5D4IA 3EJZC 4XDGA 2WYVA 2GPNA 4HKZA 4ZANA 3VFOA 2JFGA 1GCAA 4QRDA 1FNLA 1I9JH 3WG7B 4P2YA 2EXTA 1UIRA 3BS4A 3OPNA 4Y4KB 2QGNA 1NCCL 4MA0A 1BQLH 4F7CB 2WVUA 1A2QA 3FK3A 1J0XO 3UMTA 3O3BA 4KJPC 3RB7A 5BZDB 3L2NA 1NNUA 4EHBA 1JK8A 4TZKA 5EU7E 4RXUA 4TV9B 2OZPA 4YPOA 3RI5F 1B6GA 5E5UB 4FXOA 1SUFA 1CNMA 2I2AA 2A9JA 1PDVA 5D86A 2YZ8A 3BVWA 3ZDCA 3D5OF 1ZX1A 1MWAH 3T0EC 5EJ2A 4FMCB 4UTAH 1C41A 3RL1A 4JQIL 4PZYA 1GLVA 3SHVA 1MCIA 3GNQA 1AS6A 4L8SC 1U90A 5F0PB 1MCSA 1UZ6F 1NVVR 4HPJB 4GKBA 4MWOA 3ZQ4A 3S36L 2OCAA 2QTGA 2GEKA 2A9KA 2HJGA 5EP3A 2ACVA 1F2UB 1E60A 2VN4A 1MOEA 3GMMB 3IX7A 4JZOA 2IV9A 2Z5LA 3Q2LA 2B4YA 4MUGA 3RPIB 3ZCUA 4I4TF 4MP3A 1OAAA 2JJQA 4D99A 4NAJA 3TX4A 4HLCA 5DZPA 5LAXB 4S2SA 4ZAFA 4EQZA 3HLYA 4Q3BA 2GABA 4AIZB 2I65A 5D9SB 4FMVA 5HZHA 1EVYA 1KDVA 4JOQA 3QF4A 4MA1C 3T5MA 4MNGA 5LNDA 5KI6A 4QTIL 3BWDD 3BEVA 3K9WA 3R5KA 3RK0A 4S12A 5K8TA 1IAIH 1XNQB 3MV7E 5KO2A 3HN8A 2HV9A 5EMMA 4Q7KA 1QSEE 4YLYA 1DSFH 1EFXB 4MS6A 4KIFA 3AR6A 3B5IA 4B5EA 1VGKA 3NXSA 3EW3B 2ZXAA 5C0OE 5BZDA 1E5CA 2YQ4A 3JWNH 2O5ZL 2FZ4A 1VJGA 2PABA 1Z6AA 2XV3A 2HJLB 4IXDA 1XZGA 1BIIA 4Y4KA 2VLKA 4HADA 1MCHA 4C03A 5KBPA 5A6SA 3MV8B 1TZOA 3VFOB 4C0XA 3UEOA 1IUKA 1OPXA 1FTGA 4IRJD 5MENB 3BPCB 4AYGA 1HT0A 1T4GA 5AKXA 4NN7C 3GUYA 4U2CA 4Z4GA 4WERA 4FFLA 3I30X 4WSJA 1OUMA 4K9SA 4X7DC 2ARKA 3CZNA 4PJXA 4LYEA 4OJCA 3CPEA 3WXVL 4B3HA 2P28B 4G6AC 3KOYA 4PD4K 3S98A 1JPVA 1RI8A 5CP3H 5DRNB 1MG0A 4PZEA 3D2UB 3EOTL 2R15A 2Z92B 3LYRA 3VX1A 1EFTA 1PJ4A 3SC4A 5K0EA 4YY3B 4NO5B 4UB0L 5C07A 3KLMX 2YD9A 3D3QA 3SCZA 1ZZGA 1XBDA 4WFEE 1F8FA 2HKAA 4X0EA 3TO4A 2ZYWX 3L02A 4XN2A 1DQLL 1WA0X 1E2MA 1N0VC 4JRFA 4C0KA 3LIZH 3EFDH 2HU5A 1KDYA 2VRWA 3OZGA 1DG3A 5CT9A 3MRLB 1WDAA 3USZA 1TYEB 3EYWA 2J56A 5KTTA 4JFFD 1CQIB 1MB0A 2W2NA 4Z0XA 3LO5A 5EZYA 1ZLWH 3EOTH 4HLZG 3PF8A 1F11A 3K0CA 2E7BA 3KX2A 4JREB 1QA9B 3SQBB 1QC5B 3MGKA 2Q20A 4AQ1A 4MPPA 4RRPG 5A6IA 5HVGB 1GZ6A 1M7IB 1Z12A 3EJPA 3GW8A 3BGDA 3M6DA 3HWWA 4FOPA 4GQ9H 4JN2B 1CZLA 5EAIA 2FUKA 3BESR 5CLXA 5HGHB 1HI6B 3LDUA 5EUQB 2ZJ3A 5BSUA 4UNIA 1ZN9A 4Q14A 3KLPX 2PZFA 4YRJA 3H9UA 3B3IB 5CEZE 1N6NA 1K7XB 5ES3A 3PVCA 2QRZA 1PL6A 3CINA 3DEYX 2FPPB 1YC2A 5IBUB 2Z91B 3AZPA 2QSCL 2WE8A 5DT1L 4NNPL 1CDDA 3OC8A 2CNKA 3IDAA 3N2NA 3KJXA 5K01A 1YN7A 5EPEA 5U4XA 4HRVA 3GXTA 1L1RA 5L40A 4BH7B 1TM7E 1VDGA 2FWBA 1UP7A 1TPXB 4HD9A 4YC2B 4JMNA 3E2PA 5I7RA 3VTAA 5TH2B 1Y5NA 4JB8A 5HGJA 2V7XA 4AO8A 1BZ8A 2QTFA 3M5PA 4Y4HA 2JH2A 2IV2X 1PYWA 3MJ7B 3FB1A 5EHNA 5ISZE 1VCOA 3BE8A 1GLNA 2H2WA 2DPXA 3Q88A 4DILA 3FNEA 1WKCA 4JLJA 3ROOB 3AG6A 3H9HB 4DP2X 2V3CC 1B2RA 2Z31A 1UBFA 3UJIL 2XDQA 3DBHB 5FUCC 2BNQB 3M9WA 1XL1A 1A4JB 1SXPA 5FPKA 2BSXA 1QIHA 5T6MA 5C0ND 4L57A 4BVFA 3OSVA 4L72A 4U1NB 4BRUA 2BL4A 2VR4A 3HJBA 3VQMA 2WI8A 1CT9A 4OHYA 4AM0Q 1YN6A 3VQLA 1R0BA 1JQLB 3L2OB 2AW2A 1EANA 4TTDC 2E2WA 4YCLA 5E2UL 2C9QA 5JDCA 3DPUA 4HK4A 5KSBB 3QAZB 5CHNB 1HA3A 4C9BA 3IH5A 3KHQA 3R7RA 3H9SE 5CLGA 4LYGA 4XOCA 3Q98A 121PA 2IF7A 2QU7A 2NGRA 4U0QB 4XVSL 4IDGA 5A4AA 1ENOA 3D0VB 1FIGH 1RZJC 4WKPA 1NBVL 1QPGA 4QRSB 1W73A 5AK4A 4XHJD 1P29A 2HJVA 4QA9A 3T1NA 4UMEA 1T66C 1ODJA 1GLGA 2E21A 1KNXA 1OAOA 3V9CA 1V8ZA 3VXTA 3CUTA 2PD4A 1GYRA 4MBRA 4XBEH 4F1ZA 1P84J 2PSSA 5DTEA 4XOUA 4P2OC 4DLRA 2I9LA 4FQ2L 5D93B 4UDNA 4XVOA 4OZIA 3U1PA 1KZGB 2BUBA 5DYYA 4P5MB 2EEZA 4I9HA 3FN9A 2FOXA 1C30B 4YBLC 1B0RA 3DNKA 4Q0XH 5KAQF 2E1PA 3DOUA 3AB8A 3NCXA 3GEGA 1NFIA 2J7PD 5GISH 3GO1H 1TI7A 1QVVA 1E3EA 2IOQA 1VLJA 1RUQH 3SYOA 1OBOA 4NSKB 3MTIA 2ZZKA 3RX9A 2R7EB 3HK2A 4QLAA 1T9HA 3HI6H 1N5YL 5INDA 4OAWB 1KI1A 4X6DB 4LP5A 1VZIA 3SYPA 3BIAX 2XLCA 1ND6A 1V6AA 3EPPA 4QQRA 1T3ZA 4RZIA 5FJJA 1ECYA 4UM7A 4DFDA 3QARA 4OD3L 2VXVH 4HNUA 4KQ0A 4DLWA 5FTWA 1BAWA 4MB1A 1ZIDA 4BN4A 1XYGA 4HKXA 4Y6PA 5AG8A 3O3CA 3B20A 1N3LA 1YQ2A 1N12A 2Z83A 3PA6A 2XE8A 4FR5A 4GGPA 1TXGA 1DVQA 4BWUA 1XVTA 4KRLB 1ZJJA 4P92A 1UD3A 1NAMH 3QNZA 5EO0A 4JFED 2Z95A 3PXHA 2ZUYA 2C3GA 3N6VA 2XWJI 5CX1A 2WFMA 4YWGH 5ESXA 4QIRA 3OAYK 2P5ED 3KZCA 5K69A 4IHJF 1GNPA 1XB3A 4GBED 3W5UA 3S81A 3MLRH 4MRPA 5H4ZA 3LH8A 1NW3A 1U93B 4IKIA 3PF9A 4ZO7A 3SO5A 4X97A 4CMBA 5DDHA 3P9LB 1YQTA 1QRNA 5EZSA 5CD5D 4B7UA 5IF0B 4Z7VE 3QNYA 5GGQL 3EX7C 3EVZA 3QDMB 4HUMB 4HG4K 2XE4A 3TP4A 2CJPA 3GJ0A 1QE0A 4LF8B 1G3MA 1H93A 3IQEA 4C22A 4LLMA 1FSGA 1T2NA 4FDWA 5F88A 1G0OA 2YWXA 3ITDA 3TN0B 2BWJA 5L6MB 2X4LA 4OUUA 4AJVA 1XSIA 4PX5A 2OA0A 1J24A 1F5NA 4N2IA 1R5WB 1TGVA 1A9TA 3REWB 3KVNA 5I7AA 4FFMA 1D6MA 3IRVA 1JFHA 2DEWX 4FI8A 4HK3J 5SX5H 1LF0A 3NHYA 3OWEA 4R7GA 3FTXA 1IGIL 3HB0A 4J16C 4IVNA 4G42B 1QW8A 5CJOL 3MWEA 2G5BB 2OI9B 4NNXA 2BM8A 1S6YA 1Y1QA 3Q5TA 4Y2SA 2J0SA 1R3IH 4JA0A 4W4TA 2FSGA 1N0XH 2Q4BA 5BZZA 3BH9B 4JGJA 1OLSA 1DKRA 3QIWD 4QE3A 2MYUA 2P9HA 4LBZA 3FW1A 4NNJA 3FSGA 1V7PC 3UBMA 3CJQA 5IQNA 3HVHA 4XN9A 4IJ6A 4F5YA 1S8NA 4GAFB 4RM3A 3OZ9L 2MNWA 1QNIA 2OP4H 3MBEC 4DZBA 4CAGA 1AN0A 4U2EA 2HT3D 5JQGF 1J8HB 3OAAD 1EHCA 2H1CA 2PT7A 1GEGA 5EY5B 4PJIB 4BP1A 2XOKD 4PPQA 4MJHA 3NALA 2B0JA 4AG3A 1DVXA 1XZKA 3EIHA 5FV7A 1SY6A 1E20A 3NCMA 1T9BA 1P72A 5EUKA 4FONA 2AMGA 3N3BC 1BQHB 3ORFA 4OLFA 2P1DA 5EOQH 3RC3A 3T0AA 4NN7B 1E5YA 2OXIA 5E1QA 2EUVA 2RB5A 2NUTB 3VFGL 5L2JB 4E0RB 1PFVA 1Q77A 1Z38A 3ACDA 1LSOA 4EPXA 3T7JA 2C31A 1WCBA 2XVBA 4XCQA 4AG6A 3FPSA 1OH8A 2HNAA 3TM5A 1PZ2A 4R1QA 1MVYA 4DGVL 3VVLA 2O6PA 4OHWA 2QRQA 5IDQA 1P4HA 1FP1D 1FMLA 3FPKA 3YASA 3IKLA 1MRCL 4QQNA 2NZ9C 4ZX6A 2DEXX 2O4UX 2AX4A 5CP3A 3HSYA 5DURB 1S9DA 3EMKA 1Z7YA 4TKUB 2BMJA 2FF5A 4JI2B 3BPNC 4OV6F 1CZOA 2KLTA 1I1AD 1P9MC 3CQPA 3QWHA 2ZIUB 4KPEC 3CH7A 4RLSA 3O4VA 2V4ZA 4F33A 4NNYA 5B39A 1WHPA 3SCMB 4GXNA 1JDZA 3JWDC 5AUOB 1NOLA 4OCZA 4OFBA 2CXOA 3CVHL 1EX7A 1N2CB 3R4RA 3C6LD 1NCCH 1UFRA 3EY4A 1RPJA 1BDYA 4U49A 1F2TA 1TTTA 3O6ML 1QYCA 4DH2A 1YZ3A 3RVDA 1IG0A 1TCUA 4ZEMA 3BUBA 2Q0HA 3FRUB 2H52A 3HPJB 2OM2A 4YDZA 1GYWA 5KYUB 1CFTA 2AC2A 4KMMA 2VP3A 1JSZA 4GW4A 2FUG6 2HMVA 4ZMVA 1CGXA 1DSWA 5LQAA 3W9EB 2OLJA 1INDL 2WLTA 2VR1A 4UATA 4RTQA 2P5SA 3INYA 3RRZA 3W04A 4ZTPH 4UIMB 4JJEA 4UHDA 5GRYA 1P69B 4X7EC 5ULLA 2BZSA 1QHFA 3DDZX 1TZHA 5K9QG 3VFSA 3L81A 3T3DA 1AJEA 1UM6H 2W0MA 1WE5A 3V0HA 3OIWA 2P8MA 4S2UA 1IAOB 2P6OA 2YRZA 3CUUA 1EEZB 2C4FT 1C7RA 1XZNA 3SIWA 4BP3A 2I3AA 3HN7A 2O57A 1OYVA 1FSPA 4K46A 4CCYA 2V5MA 1KO5A 5E99L 1QX3A 9GPBA 2X9XA 4UOJA 2UVDA 2B8JA 3VSBA 3OLVA 4F2FA 1DAGA 3IPBA 1KEGH 4OKSA 4BMSA 7REQA 4JDEA 4BLVA 1MRDH 3QPQD 5FWYA 4U3JA 2NY7L 3M1AA 2DY0A 5EHGA 2VAVA 4WZAA 3WIFA 1WY5A 4XX0A 3FYSA 3TGPA 3CFCH 2ZSBA 4YHOL 5LNK6 1U0HC 5J4LA 1KVRA 2N9UA 4YIKA 4MAFA 4ZVQA 4YDRA 3OIFA 1RWKA 1VMIA 4JN1L 4L5FE 3FCBA 3QXVA 2BP3A 2V96A 1N2JA 3DPSA 1O4WA 1XHHA 1CY7A 2JGDA 5DUJA 3IOYA 4EDFA 3K6IA 3WVNA 5C09D 4L8FA 1CLEA 4PRHE 2NX5A 1ZY2A 4IYKA 1S8OA 3ULVL 1N64H 1BX2A 4EVNB 2NAFA 4FE9A 2QLMA 5J06A 1M5RA 3Q0EA 5E7QA 1D9ZA 5D84A 1Y7TA 2Y99A 2CLKB 1RP9A 2VCEA 4IKPA 1AMOA 3OZLA 4P5DA 1S7XA 4IUBS 1NCHA 3BA6A 4N39A 3F6LA 5DRZA 5CW2A 1ZMXA 1PKQB 3CZ5A 3BH9A 1RM0A 5CXQA 2BEJA 2FWOA 1GZPB 3F78A 4D9JA 1M2OB 2Q5IA 1PNQA 3JALA 5AZEH 4K23H 5K9OB 2BSQA 4QNPF 1NIJA 4U1JB 2CBXA 5D93C 4G6JL 1I4WA 1V45E 3GMIA 1Z74A 2H3KA 3HPQA 3TEJA 2CO4A 3C3AA 2B2XA 2LLLA 1P0QA 1B3IA 4NYJQ 1KY5A 3WFCH 4UEOA 1CDJA 4XIIA 2VJKA 4XN8A 3PWPB 1CUDA 4O4HB 2D4FA 3ZKAA 4ZIRA 4MKTA 3LM8A 4QAJA 3TNYA 4DP5X 1K2VN 4H0HB 4FWBA 4RK4A 3L9RB 3E8SA 3BD8A 2QN1A 4N2EA 4LCEA 4OZGE 4LJLA 3IURA 1UXLA 4BZPA 1YFJA 1B26A 5HZGA 4E2WA 3DJ9A 1JUDA 3G2IA 2ZKXA 1KNQA 2CFIA 4N2HA 1IOZA 1KKUA 4R4JA 5C46F 1ZAKA 4FP8L 1ZVVA 4LQLA 3NHKA 1PFWA 5EF3A 2IW3A 4XN5A 5E95B 4BKLA 3U1VA 1IGYB 5KYGA 3LGAA 3KJIA 5C8JB 4B34A 2J3MA 2PQMA 3ULVD 3LHSA 1NC1A 3RVMA 2AXWA 1L9OA 1L5HB 4HDKA 3U4EA 4OD0A 3WEAA 4IFIA 1NQ5A 5FLVA 4GSQA 5EO0B 2FEPA 5KX5B 2FGZA 3U7WH 2K78A 2VB5A 1E8ZA 3IJ7A 4JHBA 4KKAC 3TUIC 1T1YA 1GN8A 3SZMA 3WV4A 1WPGA 5TC4A 4HEA6 2QLVB 1U3UA 2ODIA 2IF0A 2QG9A 1HL7A 1HCFX 3HXPA 2MSWA 3A32A 3FMOB 2V5YA 4U7MA 3B2VH 4TKVB 3DLBA 3W5NA 5TIIA 3VVCA 3GUHA 4YE4L 4HZ1A 1RLJA 5I6MA 4N8EA 1RJZB 4XPHH 4G5RA 3NJVA 5JU6A 3ZN2A 5F7LB 1WBZB 2VLRE 4QPEA 3EVGA 3N70A 4X94A 4IX9A 2I7CA 3OKKA 2VYRE 1MREL 4U1RA 2AEMA 4XVTH 3NUQA 5KBDA 4UBOA 1L1EA 2H0EA 2X0NA 4AMVA 1MJNA 3QK7A 1AUOA 2WQSA 1IX2A 2H9AA 1DBJH 1S2OA 4AURA 1L9XA 5BNTA 2HB6A 1O4VA 2FJFA 3KLOA 4PRPA 4CQMD 4QG7A 4RESB 1IM9A 1T7VA 3P54A 4MJ7A 3D69B 4QRQA 1MHHB 4IRSC 4G5AA 3W06A 4MB4A 4DP4X 1SIWA 2D5IA 1CTMA 5FW8A 4F96A 4XAQA 3O4OB 3ABIA 1AKWA 4XQCA 1MCLA 1R0SA 1KN4H 4CM3A 1KENL 1WK0A 2QJWA 5AOCA 3EH1A 2VMJA 1II9A 3MK31 3T4UA 4GP5B 2XNDA 1QVAA 3ZGOA 2XVYA 1CU4L 1QVZA 1HLPA 3FQNA 1XXLA 2HDNB 3PGVA 2CR6A 1XU4A 3A7DA 2IYVA 3DZDA 5JNSA 3P9MA 2XR1A 1P0MA 2VPWA 1C1XB 5T41A 4JFYB 1G7RA 3C1AA 4GAGL 5FW7A 4CMHC 4Y2HA 3CLSC 3ERCA 2UVQA 1L9NA 2R27A 2JV6A 4EI6A 3BLKA 3G5UA 3BUPA 4IEFB 3H2YA 1IM8A 3OJCA 3Q8AA 4RFOL 4H4CA 3BKJL 2XWEA 4RVHA 3GFQA 1JUFA 2WUVA 2OOSA 4XMTA 4XI5D 1NYTA 3L3DB 2DLIA 3KSBC 4LYYA 1LS6A 2H18A 5EQJB 4AMZA 2QKIB 5D7JC 3A58B 3S40A 2ACEA 1YB6A 5GGTL 3SM9A 4I89A 5EWLB 1T29A 5I1CL 2QRKA 5AKYA 4IVRA 1EE2A 1QACA 3MJ7A 1YY8B 4ACPA 3V2AR 4AN1A 3OJXA 4UT7L 4HR7A 1E1QD 3PDOB 4I1PA 1DFIA 2PEZA 3HKFA 3ANYB 4MI6A 3FXAA 2JANA 3T6WA 1EUZA 4HRYA 1XZIA 4PQEA 4X5XB 4H5SB 2LBPA 3VVVA 2Q3MA 1KBQA 3A1NA 3CDYA 5J2UF 4UKDA 2ZIXA 1YR2A 3SPXA 2ODPA 3HBLA 3ZKND 1G8AA 5FFNA 4EGAA 5A7HA 1JDVA 3QU7A 4FFDA 3ZVKA 1EK6A 4A3SA 2QAJA 2PRSA 5KJCA 2B39A 2BIOA 5F7KC 3B1YA 2A9NL 1U3ZA 2RHWA 2Z65C 4GOLD 3PDIA 3GGWA 4ZD3L 4EI5C 2HA6A 3H11A 4IFBA 1B0AA 1Z0NA 3QXCA 4FQJL 3UEZA 1XF4B 4R5VA 1R6AA 4Y0GA 9PCYA 1QK4A 1D5XA 3RADC 3WIHA 1ZGJA 1W6WA 5AKTA 3FGZA 2YOCA 1THCA 2Q2QA 1CIJA 3WB0A 2FUTA 1X7SA 1AD9B 2BGGA 2BX5A 3WLHA 3JU3A 5KIAA 1W2HA 1U92B 3IN2A 1VLVA 1YB4A 3VR4A 4F7PA 3SDXA 3CVWA 4A5OA 5BV7B 3KPLA 5TE4L 2WXNA 3C08L 3W8NA 3KAAA 5C3TA 1PJBA 4V3BA 1I7TA 1XGPB 4LUCA 4YJGB 4IIFA 1OSPH 4L8BA 4J3XA 2PYDA 4MYWB 3U6XA 2GKSA 3BEWA 4XGZB 5FO7B 4CPDA 2UY7A 4WN3A 1LCIA 1XMVA 4Q21A 1TMOA 4DV2B 2XUFA 4K0RA 1U3GA 5K6AC 3DE3X 3BYZA 1N8ZB 4KDVA 1JMYA 4HUCA 2AN4A 3G5VA 2O9JA 1SQGA 1UM9A 2F54B 3ZUGA 5TX7A 1E6OL 1FH5H 4KDRA 2FO1A 1GYUA 4PVCA 2VHTA 2J59A 1EE9A 4F37F 1A9BB 1IDN1 3KCPB 4Z3HA 1AP2A 4XTRA 2VLJD 3D4LA 5EBLA 3VDCA 2VJOA 1YEGH 4ZC8A 3W5VA 1YQGA 1AKNA 4ONFL 1XZEA 5IT4A 1DIGA 3K71B 3S2EA 1HH9A 5ISMA 1KSGA 4OZHF 2NU7A 3ZXIA 1KFAL 4JM2C 5AYVA 3KYNA 5I6OA 1GZ3A 4WNQA 1J2JA 3L1HA 3P4MB 4LLQA 1C16B 3Q7IA 4BNZA 3B70A 3FZYA 4G9DA 2HVJA 4AJ1A 1Z6YA 2WIJA 3WDSA 4KNWA 3V2GA 5JOFB 3HSKA 5E1AB 4H08A 3C3PA 5CSGA 4YYEA 5A5DA 2R2HA 2YICA 4R2JA 2LVBA 4KTDH 2D2CC 1S7VB 2V0AA 1WZAA 2QV0A 3QW2A 3N5CA 2O61A 1G2IA 3LCCA 3R74A 4JB3A 3MUNA 3KDMB 4AXWA 3MR9A 3AVYA 3U2SA 1SXJE 2K7QA 2NNFA 1SHMA 5I6NA 3DF9A 3H42L 1INLA 1JDDA 2ZR0A 3GFRA 3OQPA 3N74A 1G4MA 3RPIA 3TRKA 5BSTA 5FLXA 4UTBL 4A92A 1B4JL 1XKQA 3F7PC 1PBTA 3QKSA 4DDTA 1JHKH 2FEJA 3B12A 5C37A 2E8YA 4HFMA 3FBKA 3RU9A 1PAUA 2MR6A 3S27A 4ISCA 2QT1A 1SOAA 1VFAB 4ARUA 3DTYA 4X8XA 4MVXA 1C9EA 4UJ3A 2EEAA 3PJEA 4GRLD 2V7QD 3OUTA 3NJKA 5FBHA 3F7TA 3HE3A 3ZWYA 3P0EA 2OKMA 3B6EA 4EJ6A 4Q6IC 5A5VA 1G7PB 5J12B 4PG2A 1FDOA 4NI6A 4XAKE 3AVOA 3NWEA 4W1RA 4Q82A 1S96A 2ABWA 4M3JA 2P3LA 4X4XB 5CAEA 3KGRA 5D2LA 1U8FO 4MRCA 1G6Q1 1XMXA 2QZPA 3W8DA 2Q5QA 1CVRA 1FLAA 4J0IA 2WKLA 3AINA 3PTLA 3QPXH 5DV9A 1F6FB 4PIBA 2HMIC 3RVLA 2C98A 4OGQC 1PS8A 1P6UA 4BKUA 1M3IA 4O2EB 1ZQ9A 2WKPA 2ASEA 3JAMA 3K4ZA 1SFDA 4CBZA 2YMLA 4LA4A 1QZ3A 4M8QA 1EM8A 1YZKA 2ANBA 3WBDA 2VH5L 5JOFA 3WOVA 3PICA 5JQGB 4EXKA 1CK4A 1E2BA 4DAGH 5IMOA 1LRKA 4PF1A 3LZCA 4K2UL 4MQSB 5K3FB 3T3OA 5I26A 4NFSA 4UZEA 2Y05A 3GBSA 2YRPA 3SDDA 4WZ9A 1LEKB 4NN5B 1UT6A 3MT8A 4HLZH 5G3YA 2XWBA 3CV3A 3TIIA 2I67A 2C3WA 3NM4A 3COZA 2WO4A 3FROA 3L8MA 3P0JA 5HGXA 4RA3A 1RIFA 2WMOB 1C1EH 1DIBA 1MEXH 3MRMA 2VBIA 4BFZA 2UYHA 4BGLA 1QIIA 3N9IA 2WTNA 1XTBA 2NQ2C 2A5FA 4HPHA 4EFDA 4G8IB 3CGTA 2CK0H 3HKBA 4PV8B 3JAWA 5J5AA 1DQML 1ONPA 2QI9F 5FFLA 2Q1EA 1DBML 4JFOB 2JKJA 5BT9A 3D30A 4J8RB 4NE7A 3IFPB 5HJEA 5F44A 1N6UA 1ZHLB 3EGCA 1CGSL 3TVMB 3TDKA 5LQDA 4NZYA 1SLWA 1FBIL 1U28A 3KJNA 3BREA 1KJ2B 5IY5B 4HPXB 4MYSA 1WUHS 2VJDA 1KB9K 3CXHJ 5DK0A 2BGUA 5KU7A 3SZKC 1MNNA 2P9ZA 2CNNA 3TLEA 5JNLA 4UEWA 2YC1B 1XJWA 4U2DA 4FT2A 3FSRA 4TV8F 1A1VA 3FAXA 3VJMA 1JECA 2H4WA 5LBIA 4CUCA 3AWGA 4NS1A 4ZFGH 2ODEA 1OFHA 3PFGA 3WKQA 2P0YA 5ANRB 3DTXB 4MITA 4YX2H 3PIQA 4BKSC 4GW1B 2KYIA 3VTFA 1OSYA 4HCRL 2H0AA 3O9MA 1NCJA 1L3CA 2EFCB 4GSYA 1CRPA 2KBEA 4H88H 1ACXA 4RF4A 2EVWX 4E5DA 4F5ZA 1OAUH 3UTQB 2H2GA 2BK8A 3FH7A 3EIUA 1SC3A 1ULTA 2F1RA 2Y9PB 1SLVA 5B4MD 1BP3B 3DGGA 1WXEA 4I4CA 5KS9E 3IJRA 3P30H 4V0QA 2YUWA 2V4MA 4A10A 1GCIA 5SYNA 2JK0A 4YIHA 2FD6H 2YSTA 2XVGA 3CRW1 3E9EA 1ID1A 1K68A 1PK9A 3IP3A 3L7JA 2OMWB