3V4PH

Crystal structure of a4b7 headpiece complexed with fab act-1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
218
structure length
211
Chain Sequence
QVQLQQPGAELVKPGTSVKLSCKGYGYTFTSYWMHWVKQRPGQGLEWIGEIDPSESNTNYNQKFKGKATLTVDISSSTAYMQLSSLTSEDSAVYYCARGGYDGWDYAIDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-4
total genus 32
structure length 211
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4pH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4pH02
4JZNB 4UNTA 1KJVB 5TE4H 2XN9E 4UQ3A 2XKNB 3B2VH 4PRPA 4JHWL 5ISZB 3I02A 2W9DH 1CGXA 4OSUL 4I2XA 3CVHB 4JHZA 4LQ1A 5T3XL 1TMCB 2X9YA 3MRKA 4LLQB 4R0LC 6FABL 4XCEA 5DTFB 2BY2A 5I16A 5E99L 2A74A 3MNWB 4J3TA 4FXGA 2XQBL 3CX2A 3VXPA 1FNHA 4HXAH 2YS4A 4L9DA 2NX5E 2G9HB 3IAPA 3D3VB 4FQLL 2UZIL 3LKSB 2C3VA 1WJ3A 3MNZA 3AU1A 4HWBL 4HKJA 2G5BA 4MA1B 4JPIB 1CE1L 5F6IB 3FFCE 2RB8A 3DUSA 3UYRL 5DMKA 4D0DB 2B0SH 3QXVA 3DX9A 4QRUB 2NX5A 1XGYL 1LDPH 3C9NA 4NNPH 4G8FB 1T3FB 3IYLW 2KQNA 2NY2C 4PRAA 4K2UL 4R90L 4G6MH 5C09B 4X8JB 4OQTA 3SKMB 4NZUL 2NY4B 3DSFL 5A3IC 1H9VA 3SJVB 3A67L 1MHCA 1AIFB 1I9JL 2WIMA 3QUMH 2BSSA 4L3CB 2NMSA 4I3RL 1KJ2A 3RJQB 3GK8H 3DV4A 1N64L 2JK5A 1NBVL 3H3PH 5I73B 4WHCA 3REVB 3WIIL 1YEDA 5HYQB 3G6JB 1A6ZA 5DMYA 4HF5L 5J3HD 1S7WA 2IPKA 1DQLL 1R3IH 1W8NA 1OP3H 1OHQA 3V6FB 3IJSB 4PJCB 1IGIH 2GI7A 4DW2H 2UWEE 1FN4B 1PEZA 5DJ0B 1ZLUH 2XZCH 4DUXA 5B8CA 4P9HC 2QHLA 4JY4A 1J0HA 4AZ8A 5FK9A 3U82B 4OUOA 1RUML 1AXIB 3PWNB 3TP4A 3QIWC 5C09E 1MREH 3KHOA 5EZIL 1TTUA 2EXWC 4JFHD 5DGRA 4X5WB 3UTSE 4P5MB 4HEPG 5J7CC 2BCKA 4WTXA 3WXWH 1DDHB 3IDXL 4QNPE 3LKNA 1ZLSH 1NLDL 3AXLB 3ULVC 1RZIB 3U9UA 4OKVA 3STBA 3HUJE 2M2DA 3QEQA 4KK5D 4JKKA 1U8LB 2KL6A 1U3JA 3CX5K 1U6AH 5D8JH 1FAKT 4O4YH 3A6CH 4TOYH 3K74B 1BQHG 3UYRH 2VKXA 4KK6C 1NCUA 5GRVL 2P4AB 4PJXF 4TSBL 1JTPA 1CCZA 4KTEL 1NSNH 4NNPL 2FATH 5CZKA 3JBG7 2A6KA 2OK0L 3S35L 3C6LC 2FSEA 3MR9B 4LPXA 5F1KC 4LLUA 5HHMB 2NZ9C 4OUUB 3LPFA 3LHPH 3QQ3B 1FC1A 3MLSL 4OGAC 1FFNA 2GJ6D 4FFYL 5EZJA 3QO0A 4ZUWB 1I3RA 3TN0D 4OJFL 5JW3H 3QIBD 3ZL4H 1INEL 3BPNC 1DLHA 3PHQA 5IQ9A 4NRZB 2I5YH 4JY5L 4CMHB 4IIQC 2LE9A 1RV6X 5GS0L 4RGNB 1A6AA 3SGEH 3S3SA 5ETUA 5DD1L 5HXMA 2HVKA 3WEXB 1MFCL 2H2PD 2W60A 3BEWA 4WEBH 1A7RH 1I1AB 2ZUQC 3G5YA 2AJYL 3UTTA 3NFNB 3L3KA 1S7VB 4Z7WE 1WEJH 1BF2A 3PDOB 3VG0H 3MLTB 1CFTB 4GFTB 1T03L 3MJ9H 7FABL 3T1FA 4LCYB 4XNYL 4R4BA 3MBXL 3DVNA 3VD9A 1CLZH 2FO4B 5D72L 5E6IA 5I1GH 5CMAA 2OQJA 1TNNA 3BVNA 1OD9A 4PJIF 4NSKB 3HE7B 2YPLA 3V8OA 4LAQL 1FBIH 2VXQL 4LLVB 1YEFH 4BKLB 4DN3H 3D25A 4GMTH 4W81A 3DSFH 1RIUL 1H3UA 4JM2C 2R0WH 2Z31A 1WICA 2DQTL 3BDYH 5K9KB 2V2XB 4OLEA 5GRVK 5A2LH 1RHHA 5AG9A 3IFOB 4FXKA 3RBGA 4FA8A 5C0DB 4PREB 2M26A 1LO0H 3MLSH 4RIRA 2E9JA 4JPKH 1AHWB 1I8MB 1W2KT 4YDKH 4QTHA 3GMOB 1UH2A 4ODHH 5B38A 4JPWL 3KWWB 1RULL 1OF2A 4ZAKD 4KXZI 4ESKA 3KPSD 3MUGA 3JWDH 5E8DH 1A9EA 5F7YC 1WIPA 5DXWA 4S1RH 1SJEB 2DWDA 1NGZB 3V6OC 2Q86B 5DWUL 3L3IA 2Q8AH 3DETC 5IV2B 1KCRH 2H32B 1BD2B 4YBQD 4GW5B 2FR4B 2K3TA 3UPAA 1QSEE 3FB7A 3RHWK 3LS4H 4IIQB 3K4ZA 5EWIH 3U4BH 3IDNA 3W5MA 5C0AA 1UGNA 4OLYL 1WK0A 3OKEA 5EFIA 4GSDH 1SEQL 1G7JA 5KN5B 3MRQB 4XMLL 5F7EH 3CZFB 2CDFA 2OMBA 2D31B 1OGAD 1YJDC 3CLEH 3PWUA 4LPYA 4U05A 3X3FH 1T1XB 2WIIA 1H15B 2OL3B 3AMLA 1A7BA 1IM9A 1IT9H 1OAKL 3S4SG 1Q0YH 4YLQT 3Q0HA 3VRIB 2C3HA 5MEPA 3VFSA 2Q1EA 3VXNA 4UB0L 4PJCE 3TBWB 1AGEB 3K4AA 1DQLH 1ZT4B 2CIIA 4FQ2L 2EKSA 5E8EB 4MQSB 4M1GL 5ILTH 3MRIB 4ZSOA 1F4WH 4WU7A 1V7NL 2YK1H 4YHOL 2AJZA 1U8PB 3EFDH 5KSBB 3MV8B 5T3ZL 2F54A 3KPPA 1S7SB 5IFHL 3MJ8B 5CJQH 5GRXG 4KQ4H 1LD9B 2ED9A 4RGND 1LEIB 4JM4L 3BRFA 3D2UB 3SDCB 5MP6L 1HHHB 3AGVA 3FT4A 3U0WL 2D3VA 2C1PB 3O6LL 3WLWD 1F8TL 4HS8H 3D69B 1TXKA 3W0WD 3EDFA 3A6CL 4NKOA 2B7DT 2VMFA 2W0FA 4FS0A 1ZMYA 4PRIE 1FGVH 3QXDA 2BRRL 5EA0L 5BS0D 4G8GA 1T5WA 4KMQA 5A16B 5ID1B 1LP9A 3RUGA 2V9QA 5EBMA 4MNQB 3C60C 3HS0A 3DX8A 3JTSA 1DVFA 5JXEA 1YEFL 1EGJH 3B5TA 2I26N 1K8IB 5GGTL 5DI8A 1KC5L 4EQ3A 5EO0A 4LVOC 3GMRA 3UBXA 1CXEA 5I1CL 4D3CH 2ENYA 4JFFE 4MB3A 1F6AA 1NMAH 1GGIL 3WFCH 3EYVA 3OAYK 4YQXH 4L9LB 5C0BB 2EKJA 1EERB 3WNPA 1F4XH 4B7LA 3O6FA 4OLUH 5EORL 4I3SH 5D7IF 4H26A 4WI6A 4Q9QH 4ALAL 5HI4C 2W92A 5I19L 3HUJA 1UVQB 2GEEA 4ZUVB 1R0AH 1DLFH 3I85A 4JFPB 5EC1B 1TTFA 5F7HA 3AFLA 4P2QB 5C0NC 5GHWH 1JZ4A 3SE4C 4ZFGL 2HAZA 2Z8SA 3FB6A 3NIDE 4HV8B 1JYWA 4ODSL 5DEFB 3U4EB 4JM2D 4C56A 4A6YB 1S7TA 2I9LA 1S78C 2JE8A 4OLZL 1RJZB 1WISA 5GJSH 3IDGB 1BM3L 3WSQL 4DN3L 2AI0H 1F42A 2MWCA 2IFFH 4KRPB 4P59L 4TUOA 4UIKL 3RIAF 5C0EB 5KSUB 4XP6L 4P2RE 5E2VL 3UTSA 3KJ6H 5TDPB 3W2DL 3PF2A 4MJ6A 4U6VH 1UM5L 2C4FU 4P2OA 1U8KB 4ZS7H 5K33A 4APQD 1XCQA 3WIHH 3HR5A 1QSVA 4KI1A 3CDCA 4NDMA 4OD2B 1OP3K 1S5HA 5SV4A 4OZGB 3P9MB 3VXUE 4EI5C 4UB0H 4Y1AD 2F5AL 1PZUB 5IJKC 2AQ1A 4GRMA 3TH3T 4M62H 2RFXA 3RL2A 1F5WA 5DD3L 4LOUC 3LZFH 2DQFA 4RAVA 4X4YA 5D7LA 3U46A 3Q5YA 3RDTC 4NKIL 1RMFH 1WBYB 3ZE1F 2JJVA 5JORA 1IL1B 2W91A 3C5ZC 1OTTC 3HCVA 1KLGB 5L88L 2WBWB 4CVUA 1GC1H 2X4RA 1NFKA 2HT4C 3MUHL 3WD5L 2Y9RT 3KPLA 3HZMB 5EBWA 2A77L 4GRWE 3AC0A 3RZCA 5HYJB 5JA9A 2EIEA 4G9DA 1JHTA 5E9DE 4G9FD 4B41A 2VZ1A 2VABB 4KDTC 1CXIA 3BAEL 3P9LA 5LGHL 5D1ZC 3HC4L 1NFIA 1AXSB 5IIEA 1KULA 1JPSH 4NN5B 4WI9A 3FMGL 2Y6SD 4Y4FA 2HVJA 4ZPVB 1FIEA 1N0XH 5CEZH 3Q2CA 3R1GH 5K9OA 3EKCA 4U1NB 4MSWB 3B2UC 5GSRA 2HKFL 3B6SA 2BVUA 3BWUC 2DTMH 2UY6A 5DR5H 4XPTH 4YIQA 3LEYH 5DEGB 3KPNA 5KSBF 3DURB 2FJFB 3GSXB 4NC0B 4NWTH 2FB4L 4NRYA 1DBML 3PNWB 4A2MA 3P11H 1FNGA 3WFZA 4PY8J 3RPIB 1NFDA 2H9GB 5L8JB 2NY5H 5DVOA 4WENB 5CHNA 4XPAH 5CZVH 1UEMA 2RCSH 4LCWE 5I74B 2N4IA 4M7ZB 1ZHKA 3PQYA 1VKXA 3MOAH 4J6RL 4HULB 1R5IA 5FYLH 5IFHH 3EYOB 3LKOA 1VPOL 1CXFA 4UMGA 5J6HA 1LK3L 3WNMA 4TTDC 4X6CA 3PABB 3QZWG 5JQ6H 1RJLA 1NAML 2C3XA 3QO1A 3VA2C 5FF6A 3EYSL 1FVDB 3BJ91 4L29A 3LZFL 2YPVL 2QQKH 5L0QC 1RURL 4JRYD 2FIKA 3LD8B 5T1MA 5DD5L 2J3SA 3UYPA 4AMKL 4RGOL 4YX2L 1CF8H 4L4TB 4OZIB 3GEWB 1YYML 5C0BD 1J8HA 3MXWL 3GIZH 1JE6A 3SDDB 3S88L 1SBSL 3MNVB 2V5MA 1HIML 4CKVX 4M43H 4ZO9A 1S7XA 5DA0B 3MRMA 1MLBA 1KPUB 3WL9B 4HEME 3H0TA 1B6UA 5IB1A 3V7AG 4S1SH 4UDTA 4LCUA 4L3AA 5H94B 1DQMH 4X80L 2DTSA 2UUDK 3W81A 3ECBA 6CGTA 3NTCH 3VXUA 2BY1A 4UIMA 2CLVA 5I76B 5F7NC 4YDVB 3OXRA 4C56E 1T7ZA 3CAFA 1F00I 1KJMA 5HGBB 1H3TA 5EUOB 1CBVH 1U58A 1YNTB 1EEYB 5IGXL 4OSUH 3RWEA 1IGFH 3KLHD 5BZWA 5CGMA 1U8OA 5GGSY 1EFXB 5LAXA 2V5YA 2R0LH 3E3QE 4WY7L 2CIKB 4KK5C 3MROA 1IEBA 4X9BA 4OD3H 3RJDA 1AGFA 2DIAA 1FLTX 1TZHA 1ROWA 5FUCC 4GS7B 1UCBH 3UEZA 1FYTA 4JO4H 4XCCL 2F53D 2G75B 1U95B 2GJ6A 4OGXH 3U36A 1KF9B 3BO8A 3TN0A 1CTOA 5D2LE 2AQ3A 1Z5LB 5HD8D 5D1XD 1TCRA 4KZEH 4RFOH 1MLCA 4P4RA 3PHSA 5KVGL 3FQTB 4LPTA 3ZYIA 4R8WH 4X7DC 4JG0H 1S8DA 1TETL 3QNXA 4NQDB 4YXKL 3NABH 4LRIA 2X4PA 2Z92A 2PXYB 4Y4KB 1NDGB 4D9LL 4APQB 1QLRB 5DD0L 1EBPA 1RIVH 1I9JH 3S9DB 5CILL 4O9HH 5FYKU 2JB5H 3O9WA 1HI6B 3VFTA 4HGWB 1NDMA 1G84A 4JJHA 1U3HB 1A1MA 4GKZA 3CFBB 2C26A 5HJ3B 3OL2A 1BFTA 3LRGA 2YR3A 3SKUD 4PFEA 3PQYE 3VDAA 4BQ9A 2Z31C 4OZIE 3EYQD 3T77B 3BGMB 4DVBA 5JO5A 4HFUL 1UWEL 5IK3A 4XAKD 3U1SH 3WNNA 3JXAA 1HWGB 1SQ2N 2WBJC 2FX9H 4N8PA 4WGWB 3O4LD 3LPWA 5DQ9A 4ZTPH 1P6AB 1FNSL 3FQNB 4OD1H 1O5DT 2XTJE 4RMSA 2JJTC 2Q20A 5I2IB 3FO2B 1ZA3B 3P73A 4NQXA 4KK8C 4PJ5A 2OXHA 3R4DA 1AH1A 3HMWH 3DVGA 4NQVA 2J4WL 3BD3A 1QZ1A 1UYWL 4AQ1B 1UB5B 3ARTA 4UU9A 1D9KA 1E6JH 4G6AD 1ORQA 5KG9A 4QXUH 2H26B 4WNQA 2ARJB 3ULSB 4P5TD 4OGYH 4XCCH 4OF6A 3CFKB 1CE1H 3IAGC 4YFDB 5ELIA 3C60D 5F3HB 2J5LB 1OCWL 3QRFM 1X5XA 3OAUH 4LLYB 2YUWA 3T1WA 3VWKA 1OQXA 2OTUB 5DQDL 4AT6A 4FZEH 4ZAKA 3BJLA 3V5HA 5SX4H 2Z35B 3NZ8B 2R29L 2AEIT 2XPGA 1XF4B 2Q76B 5DHXB 5ANME 3BPLB 4S0TD 3CDYA 2J6EH 4R97B 4XP4L 4JFDD 5D7LE 1CICA 4N0YH 4NO2A 5E5MA 3HE6A 4FFZL 4Y16C 5INDA 3NN8B 3VXQB 1IT9L 1EJ6A 2P5WA 2DQUL 1FYTD 1O7SA 3WIFB 4JY6A 1MFBL 2W0KA 3IU3A 4J7RA 4GBXB 3HAEA 1TVBA 4AK1A 4HKXA 3DNKA 4WTWA 1MHHA 4P2RA 1IAII 5FHBH 5KS9B 4NN6B 4DOHE 4O2EA 1JZ2A 2DM4A 1LDSA 2YZ8A 2ZNXA 1JPSL 1MCWW 2ICWA 4KQ3L 5IP4A 1YYMH 4YWGH 3VFOA 1MVUA 2IANE 5A2FA 2ZP0T 4PGBB 3PGCA 4YBLC 3CX5J 4GH7B 3MRPB 4HD9A 3MREB 1JJUA 1CGUA 5KVFH 3DLQR 3L1OL 2BNRA 4DGVL 15C8L 2K7QA 5I8EA 4P9HH 2PXYC 1F4AA 1N2RA 4NNYA 5HGHB 3MGTA 2I25N 3GGWB 1R3JA 2XNAA 5I9QC 4P48A 4XPAL 5CZVL 2XY2A 1GHFL 4KZDH 1HEZB 1FE8L 4PB0L 4PJHE 4CNIB 3KPMB 3QFDB 1V3LA 1D6EB 2R29H 3L95B 4XAKE 3EYFA 1RJCA 3W39B 1JK8B 4FQXC 2NYYD 3MLWL 4QEGA 4FQQA 1GZQB 3ZKQD 5IF0B 4X6DF 5KVMC 5T5FH 5IQ7L 3MZGB 4WTZG 1RZ8B 2XYCA 1MCPH 3ZKSD 1LMKA 4N8VG 3HPJA 3NCYS 4HIJB 2XIDA 3BZ4B 5ICYA 2DI7A 5KVDH 1TQBB 4P23B 5BV7L 3V5KB 4KRLB 2VDNH 3L5WA 3RRQA 5DURD 3WLBA 1RSFA 4TSCL 4PJGF 2FJHB 3BI9X 2WV3A 2HTKD 2YPKB 4BH7B 3MOBH 2A9ML 4U1JA 2P24B 5D5ME 1PVHA 4F7CA 4F7PA 1ZLVH 3W11C 4WV1A 3MFFA 1Z3GH 3OJVC 5FGRA 2GTZB 1MHPH 3CSYB 4K94H 1CBVL 2PO6A 4X4ZA 1HQ4A 3GBNL 3MC0A 3HLAB 1NGPH 5KS9F 1UM4L 3KYMB 3CFEB 3LAFA 5TDOA 1OPGL 4WWID 3OB0K 5HI3D 1LO0L 1A7QL 5F1NA 4Z95H 1KT2A 2FL5A 5MENE 4MVBC 1KXVC 1MI5B 5JW4Q 4FMKA 1OM3H 5HYJE 3NPSB 2VO5A 4IMKC 4F7TB 4YHNB 4GG6E 1RAMA 1KCVH 1WT5C 4N0CC 4CU8A 3RQ3A 1J05A 1TZIB 3ESVF 1QLEL 2DBLL 3G04A 5HBBA 5J9PA 5KSAB 3L7EB 5IW1A 3FOLB 2XOTA 3KYKL 4PJ9A 2O5ZH 3GIVB 3EJYD 4KRMB 4O51B 4ZFFB 1MEXL 2YKLH 3P4MB 1JWSB 4JG1L 3KGRA 5I18L 4MB5A 3S34L 1G9ML 2HG5B 5I1JH 1Q9KA 1NAMB 3UZVB 2BNRD 4GRLB 3C5ZB 3CK0H 4JRXA 4BK5A 4P57A 5CJOL 3SPVB 4S0SD 5J57B 3DTXB 1LE5A 4PJAB 1IAOB 2X70A 3EO9L 4U1HB 4K3DH 1P5UA 3CMGA 1A47A 1UH3A 5J1AA 3WXVH 4TQEH 2YZ1A 4X7CC 3GSVB 1T7XA 5MI0C 3UTQB 1QR1A 3B9EA 1CVSC 2R1XA 5SWZB 4JHBA 4HUKB 2CSPA 4MA1C 1XR8A 1E27B 2QQLH 5F6HI 5HHQB 2CKBL 4HH8A 5DQJA 1L9NA 3BHBA 3CZJA 3MV9A 3QDGA 4XVUD 4RISL 4R0LA 2VIRB 3BW9B 2VXVH 4KWUA 4DGYL 2D0GA 1ACZA 6FABH 3AREB 4EI5A 3IS1X 3ZE1E 4GXVH 1C5DB 2PCPB 4MXVF 5F8QC 4P5KB 3MJ7A 4K3JL 1MFAL 5FDYA 1PKQA 1NCCH 4NQSA 1C5CL 4KI5D 4PJXB 4KK8D 4DTGH 1X6LA 4HWBA 4LARL 3GUTA 1FZMB 2W9LA 5EOQH 1CFVH 4Y4HD 3UTZB 1EX0A 3P77A 3GSRB 2PYEB 3VFRA 5H35A 3DUHA 2CDGB 1NCWH 5C0GA 1U93B 4E41D 5D7JA 2AJXL 1J11A 4DEPC 4PBVC 1DE4A 2NXYD 4HCRH 3PQYD 4O00A 3MMEB 2ITCB 5AEAA 2OTWB 4WWKC 2GUOA 3FB5B 1A3QA 4OZ4B 2X4NB 3I6GB 4HWZA 2AJVL 5EOTA 3PWPB 4POUB 3ARFA 2X4SB 5DJXA 5C0AD 5EZLB 3I75B 4DKEH 4K94C 3UCRA 1U9KA 1TPXB 4J12A 4JFOA 4M9OA 3NIGE 5KW9L 1OGAA 2WBJD 3MRLA 4PJFF 5D2LA 1BGXH 2HT3D 4HJJH 4L4JA 5JUEH 1OAYH 1BVKA 1FFQA 4HUNB 4PJ8B 4KVNH 1QR4A 3FQXA 3DHJA 3P30H 2H3NB 5IB3B 4KROC 1QBMH 4HKBA 3GK8L 1ONQA 1UH4A 1J7VR 3RWHB 3B83A 1HQRB 3VH8B 1DJSA 1MFDL 5C2UB 1SYSA 5IMKA 4R26H 4Z76B 1MELA 1FFRA 2A83B 5E9DD 1GJIA 1CFQA 3QWOA 5C2BH 3RVTC 3RU8H 4X4XB 4Q97A 1JUFA 3S36L 1J1PH 1BQHA 3HAEG 1HINL 2XWJB 5DJ6B 4HIIA 4YHPA 4M6NH 4OB5L 3MXVH 1EUTA 3LH2L 2E8ZA 3GMPA 3OR6B 2P7TA 3O45A 3RGVA 4IRJA 4JEGB 3QUXD 2EXWD 5DHVB 4NHCL 4G7VL 4H8WC 4U1GC 3QDGD 3F7PC 4MAYB 3LEYL 1FV1A 4MD0A 3RWFB 5I8CB 5HVGB 2C3GA 4U1LA 1E28A 5TE7H 1NKRA 4HC1A 1OPGH 2OS7A 4BZYA 1FSKB 4QYOA 1N59B 5AYQA 5JHDE 3SDAB 4JAMA 3DRTB 4X99A 4CMMA 1Y0LA 3W2DH 3DXAB 3ZTJH 5C0IA 5T5FL 1BZ9A 4MJIB 1CTNA 4PTUB 3AM8C 2X4UA 4L3EA 5CJXA 4XTRC 4MXWL 1FFPA 5DFVC 4M02A 1K5NA 1T1WB 4LFHD 1WFNA 1IC7H 1Y18B 3TH2T 2A77H 1FL6B 2HFFA 4KKAD 1KBGL 4NN7C 4HJ0C 3RI5K 3O9WD 1Q94A 4IRSB 1A1OA 1F4YL 2CO7B 4IS6B 4PRPD 4OF5A 3RIFF 1XR9B 3IJHA 4ZTPL 1AKJB 3U9PH 1JF1B 5DJCB 2F53A 2NW3A 1AFVL 1IAMA 2EEDA 3VWJD 5I8OL 1SJXA 2DI9A 1FPTL 2BHZA 4NQED 3OJMB 4NKDA 4H88H 3PWLA 4OAWA 4UTAH 2D4FA 3LQMA 4NRXA 5D1XA 5E8PB 3VE0B 3TV3L 2I07A 4QGYA 3TYGH 4HG4K 3MRJA 4S1SL 1QEWB 1OVZA 4ZMAT 3QUYB 1IAKB 4MDJA 4C56D 1ZEAH 4RRPG 2H2SD 1P7KA 4WW1A 2Q6WB 2EYTA 1CK0H 3P11L 3ZDXF 1CIDA 1XGRB 4XPBH 3C5JA 3LN5B 3MRCB 4MYWB 4HJGB 1BZQK 2R0WL 2CKBH 4BSWA 2PUQT 5C07A 3OGOE 2F74B 2PETA 1KLUB 5FKAA 1OARH 2IG2H 4G7VH 3UTSD 1R3HA 3BP7A 1I8KB 1CL7L 1UZ8A 2XWBA 4JM2B 3QZWB 4DCQB 3R06A 5HSFA 4MA7L 3DMMD 2WZPD 2UUDH 1U8JB 2Q3AA 3X13B 2ZKHL 4PLNC 4J8RB 4MD5B 3MGAA 5JQ6L 4LNRB 3BKYL 5JPMB 2KZ1B 1MCRA 2BOBA 2NY5L 3D0LB 3CDGA 1EMTH 1RK1B 1ED3A 5L2KB 5JIPA 4XP5L 5T3ZD 3C6SA 3GHBL 5I18H 3ISWA 1AHWC 2K7PA 1DFBL 5ESAA 3HNSH 3MV01 4XP1H 3SCMA 4RGNE 2E6JA 5EIIA 4GG8B 4ZDHB 5IVNA 4JRXE 1NGXB 2XFXB 5AG8A 3QJHB 1ZLVK 1HCVA 4IMLA 4EXPX 4QRSA 5IEKA 2DQEH 4PJ5D 2VC2H 5CBEA 3RUGE 1XH3A 3MODH 3OGCA 3IJYB 1XGYH 1X5AA 2D9QB 5ESVA 1LO2L 4ODHL 5K59E 5FHBL 2PN5A 3MV7D 3VGDA 3HI1B 5TE6L 3M45A 4OQTH 5T1LA 3DBXA 3PL6B 1HH6B 4TTGA 4YXKH 3HE6C 1P4LB 1KENL 4X98A 4XWOC 3TFKC 2VH5L 4WI7A 1F6LL 1F97A 1CFNB 2E7BA 3BKJH 5FYJE 2N1KA 1CXKA 2NY0D 4RISH 1UQSB 4XXCC 3BPCB 1VFOA 3C2AH 4KJWD 3LB6C 4RGMC 5D6CB 4TPRH 4U1SB 2R0LL 1T21A 4XI5C 4ERSH 4KJYB 4L8SB 1RZKH 3IXAB 4G6JH 3BT2L 3H9SB 3ZDYF 3TVMD 4XMLH 2ADJA 3KPQA 4R7DB 3V4UL 2MSPA 2FX9L 4OTXL 3RVTD 3IF1A 5JOFB 1XMWA 3EJYC 5CIPB 1PW3A 4NJ9H 5F7LB 4DUVA 4NZRL 5MEOA 3ZO0A 1NCBH 1J0JA 4ZO8A 3FCTA 4OZHF 1IC7L 3MLUH 4ETYA 3BPNB 5F9WB 4JPKL 3MUJA 2FZ3A 3I6LD 4HKZB 3VWJA 2MQ3A 4HS6B 3F5WA 4PRPE 5MP6H 3WFDH 5GZND 1HINH 5GS2H 4PJGA 3SEPA 3SY0A 1JPGB 1QSZA 3ES6A 1YYLH 4JRYA 4NQEE 3TJHD 2DD8H 3PGFH 4OBRA 5LG1A 4CW1B 3BOVA 1FNEB 5FHAH 4RFNB 3P4OA 1YUHB 1KYOJ 5JW5B 1TZGH 3IDIB 2ICWI 2ZUTA 2ADIB 3ROOB 1CGSL 3X3GH 5A40E 4WDIA 5SWSA 5IR1A 4MCZA 2F19H 5IVZA 2AK4D 1MRDL 4LASH 3RVVC 5IMOA 2GK0B 1SYVA 3QJFA 4ZD3L 5KJRH 5TPWH 2XT1B 3LHPL 2WLYA 3U30C 2QKIA 1PD6A 5LGJB 4JLRB 4Y19B 3C08H 4F58L 3BN3B 3GSQA 5FYLE 1S7RA 3O4LE 5D6DA 3VXUD 3HI5H 1XF3B 3CPLA 1FYTE 1FVEA 1IC5L 4QF1B 2GITB 3MCLH 1J18A 4LVEA 1OAUH 3LS5H 4U1KB 2NY4C 3WN5A 4CU7A 5IEHB 3VFWB 1UEYA 4NUGL 3GJEB 3O6MH 2AW2A 1E4XI 5IKCA 1OAZL 5F44A 3D87B 4F2MB 1EXUB 4YNYB 3TO2A 3FN0H 2OX5A 1V5JA 5L9DL 2BOCA 2VAJA 4L5FL 1D5ZB 1YY9D 4TUJA 3TBVB 1XGQB 3MV7A 3QEQE 4K7PY 3RFZC 4NCC2 4HX1B 3SKOA 5EU7C 2DQCL 1EFXD 3LRSA 2BVOA 3O6KH 2P44B 1LO2H 1FO0L 2CUIA 3M17A 4ODSH 1NBZA 4QHNB 4QRTB 5HHNA 1P1ZB 2JCCF 4KHXL 1FYHB 1XZ0B 3W82A 4FFVC 2H6PB 1KJ2L 1N4XL 5TE7L 1AD0B 3IU4L 2XWTA 4M00A 5KVEL 5BVJA 2D7MA 5H2BB 4JN2B 1AI1L 1ZANH 2BNQB 3BKJL 2MKLC 1A7PL 3X3GL 1U8MB 3T0DA 2WAHA 4X7TA 3T65B 2XZQL 2FGWH 1DBBH 1FGNL 3CFCL 4PGZA 3VXMB 5FA3B 5CD3A 2NX5D 4PGDA 5GJSL 3D48R 4QTIL 2Z93B 5BVPH 1X5LA 1AGBA 1JZ6A 5EO1A 3VI4F 2V7HA 1LO3H 3T0EE 4LCWD 1UM6L 5D7IB 1FVCA 4MDIA 5D7JC 3U7YH 4CADA 1WIOA 2P5WE 1F4YH 3HTLX 3S35X 3T3MF 4XP1L 2GY5A 5HHXL 1HNGA 5DYOA 5FXCH 4WO4B 4LRNL 4JCMA 5HY9B 1M7IB 2H1PH 4LBEA 1B88A 2LV4A 3V0VA 2VZOA 1EO8L 4U49A 5D7KE 4MNGA 1A6PA 5F88A 2OJZL 5K9QI 5JPNA 1BJ8A 1WBZA 5CP3A 4PV8B 5CEYA 3VCLB 1EEZB 4MA3A 3TYGL 2QSCL 3QH3A 4M7ZC 3SKJL 4F7MB 3ULVD 3FJTA 3QWQB 5DT1L 3HMXA 2DD8L 3PGFL 3FQRA 4QHLB 3QXAA 4JFFD 4D8PB 4CL7A 3M1BB 3JUZA 1RUQL 1JGEB 2DLHA 3NACL 5IESL 1IILE 3FTGA 2ESVE 3QULA 1I7TB 4X6EB 1PZ5B 5FGSA 3ZTJG 4JANA 3GNML 4ELKB 4BFBD 5LCVH 1A7NL 3KYOA 3T2QA 4C4KT 4PRDA 3U48A 3BEVA 1U8HA 1YMMB 5BRZA 2GJZB 3L7FA 2EIZB 4Z78B 3QPQD 3LKRA 2ZZUT 4JZJB 1LWRA 3E2HB 5FM8A 3X11A 4N68A 2HFGH 5B39G 1XF2A 2BSRB 4Z7OE 5E08L 3QNYA 4UNUA 4JFDA 4EIGB 5FEBA 1XGTB 4PB0H 4E5XA 5T3ZH 2ZUVA 1U91A 5DHVH 2DQJL 2AABL 5HDQL 4KUZL 3TWCL 2WQ8A 3LQZB 3AB0C 1K8DB 3ARGB 1R3IL 1BX2B 4M7KL 5MI0B 4X5XB 1MRFH 1EV2E 3CJJA 1NEUA 3F12A 3VGBA 5C7XL 4JGMA 3VI3F 3LN4B 5ALCH 3L3OB 2OSLA 2BY3A 5JIIA 5F9JA 2BMKB 5I1LB 1WV7T 2V7NA 1I9EA 1QOKA 4G6KH 2APBA 4P2RD 4YO0A 5L88H 1A6UH 5EUKB 1K3ZA 4IRZH 2IAMB 5BJTA 1HDMB 2BFVH 4OFYD 3MACH 3TF7C 1HK6A 1KIQA 2XQYK 3EO9H 2ADGB 3O8XC 2YD7A 4J4PA 4O5LH 4Y1AE 1CGYA 4GKNB 4I8DA 5EN2B 3TCLB 1B90A 4TQEL 4R9HA 1PYWA 4OF3A 5J4MA 4JFYA 1ZWIA 1D3CA 1CZ8H 5DGQA 1MQKL 4EVNB 1TTGA 3L6FA 5I6XC 2CD0A 1OL0A 3F7YB 5ACZA 2AK1H 5IB5A 1MCJA 1I7UB 3QUML 4YHLL 3G5XB 5F7DB 4JREB 5GS1C 4S11A 2OLDA 4NZTL 1P4IH 4FTVD 5GSVB 1EBAA 4WFED 3BZEA 2VYRE 5DUPL 2JB6A 3HI6L 4I2XE 4M6MH 1QLFB 5KOMC 4ELMB 3W9EB 3BWAA 3NPSC 4ODVH 2YPLD 2Y07H 4CVXA 1Q9WB 4LLWB 5ICXA 1S78D 1XF5B 2X7LB 1Q9OB 4JZNA 3WHE1 4ZS6C 2YKLL 3MSPA 2XKNA 4M03A 2HFTA 2VLRD 4CN4A 3H9YA 1DVFC 1I75A 3RWJB 2YD4A 2YBRA 2BVEA 4OZFA 3DO3A 5DTFA 4E41E 2R56L 3DRQB 5E9DA 4WY7H 4FFVD 1LNUB 3EO0B 5C08A 1YEGL 5I66B 2N7AA 4N90E 3EFFB 1I3GH 4UQ2A 4XWGH 3LKSA 4YE4L 4E0RB 4RFOL 3H9ZA 1I7RB 3D18B 3O6FC 4JPIA 5D6DC 1INDL 5BRZD 2MKWA 4KU1A 1VGEH 3DUSB 3NA9H 3OTTA 5EBGA 1ZGLB 3HRZB 5DMKB 1E4KC 4P23C 2YA2A 4GG6A 4WI8A 3D3VE 1MCOH 2NX5B 4QRUA 4QNPF 1N64H 3H3PL 4X7SH 3I6LE 3TPUA 2EH7H 3BXNB 1Q1JH 4MCYA 4JRYE 4NQEA 3Q1SH 3ZDZF 4PLKD 1ZS8B 1O7VA 1NC4B 1LE9B 2HMIC 2ZOKB 4FQXA 5BXFB 2Y23A 3CGTA 2IG2L 3WS6C 5JOPD 5E8NB 1OSPH 2JK5B 4DJMA 2LU7A 3Q6GH 4F37K 3REVA 2IPUG 4QRRE 1P7QB 4L4TD 1QSFA 2QR0A 2AJUH 2J6EA 3NCMA 4N0RA 5CGYD 4PP2A 4WUKL 1S7WB 2IPKB 3QAZC 2DLFH 4M8QA 3IJSA 4PJCA 5HGGS 4PRNB 4UUJB 5DJ0A 3QI9B 4PJ9D 5B8CB 2L0DA 4QXTA 2FX7L 3EFDL 25C8L 5FK9B 3AY4A 1MCFA 3HNTH 3FMGH 1NMCB 3BDXA 3U30B 2X41A 4P5MA 1ACYH 4M6AA 2BCKB 4I0CC 5K9JL 2DLEA 1DDHA 4H0IA 1ZVYA 4YDLB 2XZQH 4ELMF 2Q8AL 1RZIA 4XB7A 2BVPB 3U9UB 3WFHA 2EDYA 3O6LH 4H25B 3BYYA 4PJDA 3QEQB 1A9BA 1H3VA 2X5PA 1I1YA 2G2RB 4OFDA 1RZGB 1JI1A 1T7VA 5AAWA 4B5EA 5CINL 2VR9A 3W0WA 4DQOH 4EUPH 1H5BA 3O3AA 5F7EL 2NPLX 2R39A 5EA0H 4LIQL 2RCSL 5AD0B 1G7LA 3B9KB 4PJFA 4WUUD 5DUMH 2VDPL 3EDDA 5E2TH 5HHXH 5DVMA 3MR9A 1DQDL 4X4ME 4LU5H 1HH9A 3BQUB 3HG1E 1D5XA 5TGBB 1FFNB 4Y5YB 4ORZC 5EZJB 2YPVH 4K8RD 1HZHH 1I3RB 4XMPL 2MJWA 1FO0B 4Y5YC 5TF1H 2W9DL 4NPYB 5BMFH 1PJ9A 3KR3H 4JPVH 4NQTA 2NY0C 4HWNA 1IBGH 3QWRA 3U9PL 1UB6B 4PY7A 3DVIA 4NRZA 5I0DA 1HSBB 2HJFA 5C0RH 4MZ3A 1U3HC 4PTTB 3N0PB 3MLUL 4ZAKC 3TVMA 4E9LA 1A6AB 3QDGE 1XGUB 5C0CE 3WEXA 3UZQA 2DDQH 3BGFC 5FGCB 3L3GB 5CSGA 2WBKA 5D2LF 5L7XL 3LH2H 1CFTA 1G7IB 5E5RB 2AERT 4YZFF 1BBJB 5CKAA 5IMMB 1RHFA 4N1EA 4LCYA 3ARED 3VFPA 2DL2A 4XNQA 1SVCP 5J89A 3RI5F 2FO4A 5E6IB 3MRGB 4CU6A 4ZXBC 4RDQG 4Q0XL 1WSST 3LDBB 4K9EC 5B39B 3WSQH 5D1XC 5GGRA 2DJUA 4HQQH 2QEJA 1R24A 4K71C 2WBJA 5T3ZE 2A0LC 4XC1L 3IETA 4XNXH 3H9SE 1KELL 3LMJL 2Z31B 5K9KA 5DJZB 2VISA 3UAJC 3LS5L 1A3LL 1A6UL 2LQRA 4GO6B 3Q48A 1K4CB 3QEHB 2UY7A 3DX6B 1WVZA 1BFSA 3GDBA 4LEOA 4PREA 3MLWH 3OAZK 4KXZH 1AHWA 3SCMC 1I8MA 3DYMA 4KZEL 1UXWA 5CEXA 1W0WB 1G7MA 1G9MC 5CJBA 2PR4H 4LQFL 4WHTB 2DF3A 5FB8B 3KWWA 2XV6B 2DICA 2DS4A 1CZ8L 5D7LD 3MBEB 1OF2B 1GZPA 3KYNA 5IMLA 3G08A 1ACYL 3MUGB 4LHJB 5ENWA 2HKHL 3D0VA 4HUWB 2H32H 3LKPB 2Q7YB 1NGZA 3ULUC 5E5UB 2Q86A 1ZVHA 3SN6N 1CDUA 3X3FL 4Y7MA 4ONHB 3P4NA 1KB5H 1IMHC 1EHLH 3SDDC 4Q6YA 3IGAA 3FB7B 1H0DB 2IFFL 2CDEA 4ORGB 2NXZD 1MCCA 1ZT7A 5DRNB 5F3BB 3HUJF 3OKEB 4HFUH 1P9MA 4AENB 3ZHDA 2V5SA 1A1NA 2HFEB 4EKXA 1F4WL 5HHVH 3S5LG 2CDFB 3HC0A 5TH2B 2X2YA 1URLA 2CLRB 4XBGA 1J1XH 2WIIB 4WO4D 4P5TB 2FEEI 4OD1L 3S96B 4PS4H 5MEPB 5J11B 3PHOB 3SDAC 4HUXB 5T33H 4DAGL 5LXGL 1KACB 3P40A 4J3UA 1OLZA 4MGXA 4ZSOB 5GPRA 3HE6D 1RUMH 5IBUG 5I1JL 3BKMH 3FONA 2WINB 5KSBA 5TFSH 5EOCH 2HYMA 3EOAB 1LD9A 3KYKH 5JDJA 4PJEF 4F80A 5GRYA 2WWMD 1T2JA 4NGHH 4FG6C 4IRSC 2CRZA 5I73C 5I15H 3QDJB 1LP9E 3QIBA 3S5LA 2IMNA 3UJJL 2VN4A 5IG7A 2DMKA 4BUHA 4GLRH 1YEEL 5TPWL 4MNHB 3BESR 5D2NA 1SBSH 2NR6D 2XY1A 2J7LA 2FNBA 4F58H 2X1PA 3MCKB 4NOBA 4FFZH 4Q9BA 2R2BA 5A16A 5ID1A 4MQXC 4L8BA 4MNQA 4NM8L 1GRWA 1DVFB 3QEUB 4NWTL 2IEPA 5TF0A 4HJ0D 1F2XK 3D6GA 3GMMB 1K8IA 5IW3A 4G6FB 1BVLB 4IOIA 4KAQH 2WNGA 3VXRB 5I19H 3K1KC 4LSTL 5D96C 2OR7A 2Z91B 5BRZE 1N6QL 3GSWA 4QO1A 3SCMD 3RTQC 5GHWL 5GS1B 3HZYB 3O6FB 5B3JF 1G1CA 5HHOB 5C7XH 4PGEB 1JPFB 2O5XL 4YAQA 3DV6A 4YXHH 3IXTA 1KB5B 1BZ7A 1UVQA 4KJQC 1CF8L 2I24N 2Z31D 1LEGB 5HD8C 4MMZC 4DTGL 4K3EL 3GKWL 4N0UB 4XB8A 4JFPA 5EC1A 2GFBB 1LK2A 5E00B 2EH8H 1QG3A 1MNUH 1T5XA 4P2QA 4XNZB 5F71A 3WNOA 2X4QB 4H20H 5JXAH 1GL4B 1TJHL 1JPST 4KDWA 1QSEA 2YUXA 1GOFA 2OK0H 1WBXB 4U7SA 4C56B 3WHXA 4JFXA 3LS4L 1RJYA 3EIFA 3IDGA 3FHQA 5DUBA 3DI2B 2DWEA 2V9RA 2X1WL 5KSUA 3UDWA 1JN6A 3KPSA 5C0EA 2ZG3A 2BNRE 5CILH 5TDPA 4MJ6B 3S8WA 2FRGP 1XCQB 4HPOH 3CVIH 3CIQA 4OD2A 5DUPH 4J6RH 1YQVL 3ALXA 3MO1A 5D9SA 2CLZB 3RNKB 3F62A 5AWNH 2MCG1 3CSGA 3P0YL 3MRNA 1JNHB 1AGCB 4FQJH 3U1SL 2A38A 4HH9A 4M6OH 3IDJB 5GIRA 2NW2B 5SX5H 2ATPA 2QSTA 3TFKD 3BKML 3DWTA 1WBYA 5JORB 4LARH 3TIDA 4O4YL 4V1DD 4NYLA 2NY6C 1IM9D 2HTLD 3MLRL 4OLWL 4PJHB 3UPCA 5IESH 2MNUA 1NBYB 2HRPH 4OFYA 3ILPB 4HGKC 4KPHH 1ULVA 2AEPH 4S2SB 4XPGH 2E7MA 4ZUSB 5DR5L 3UJTL 4J3WA 4R8WL 1JHTB 4ACPA 3BIKA 1QSFE 3JVGC 2YEZB 3PIQB 2C4FT 2VABA 3L3HA 3P9LB 4Z7NF 1A2YA 4K3EH 1NFIB 1KJ2H 1N4XH 2A6DA 2X1XR 2AK4A 4MNQD 1PX3A 2ERJC 5IIEB 1A4JA 5C08E 3E1F1 1ND0A 3P0VL 4L9LC 3MOQA 2A73A 3QQ9C 4XNXL 1G6RB 4MQTB 4U1NA 1Q9LA 3FO1B 1CXHA 5GSRB 5EU3B 4KUCD 3ULUE 5C6PB 1QBBA 1A8JH 3SGKA 5D2NC 2XI9A 4YIQB 4LMQE 5FCUL 5F70A 2HLAB 3KPNB 3ARDB 1TVHA 3DROB 5DD6A 4LLDA 1WIUA 4UILH 3R8QA 1CT8A 3GMNA 4KRPD 3C60B 3SDYH 1FNGB 4GRWH 2CKNA 4WFFE 2VLJB 1WWAX 1D5IL 2IH1A 1AR1D 2VLRA 1FC2D 3QCTH 5FKPB 3WFBH 1AQKL 1MJ8H 4PJ5E 5A2JH 1B6DA 2B1AH 1WC7B 3GIZL 4I0PA 1R5IB 2XKUA 5FM5M 4X7EC 3JWDL 1T80A 5J6HB 1IEHA 1MIMH 4GW1A 4X6CB 3PABA 4P2QD 5IWLC 1KBGH 1CQYA 3R0NA 3PWPD 2NY5C 4L29B 3T8XA 2VE6B 1UYWH 3DUUA 5T1MB 2VLJE 1EA9C 4NWUH 3QPQC 3NH7L 4DKFH 2PTVA 3BZFA 1DQML 1T4KB 3UJJH 2VZVA 4L4TA 4BSVB 5EU4B 5KSAC 1NL0L 3DX7A 4FQCH 1AFVH 4ZXBD 3G6AB 2QQLL 4O2FB 3MNVA 2ARJQ 1F3JB 1KPUA 2VLMD 1SY6H 4U1MA 4JB9H 1KTDA 4L8DB 5JNYB 4UDTB 5HVFB 5HDQH 1B4JH 4LSVL 2R0ZL 4YBLB 3SE9L 2VDRH 3JV6B 2VDLL 5IFJB 3BKYH 2A2QT 2CLVB 1SBBA 5E08H 3ARFD 2VXUH 4FQXD 1DN0A 3ZDYE 5KBNC 1OAQH 2NNAB 1JPTH 5EUOA 5F93C 5ALBL 5GGVH 4CJ0A 3RWEB 4HK0B 4OLUL 5CBAB 3RPKA 1KG0A 4N8CH 5LAXB 4MQ7A 3MROB 1IEBB 1ZSDB 3FN9A 2NY7H 1KUMA 3N1PC 3EO1A 4EI6B 4LFHG 1AO7E 4HZLB 4OQTL 3U4BL 1L4IA 5T1KB 1T04A 2EZ0C 1TNMA 4RAHA 1OTUC 1RVFH 2I27N 4Z7UB 5EU7E 1S7QA 3QYCA 5TQ0H 4K71B 3WXWL 2IBBA 3U36B 4YBQC 5JMOC 3MODL 2R9HC 2BRRH 3SDAD 4OCMC 3CLEL 1TCRB 4RZCB 5CUSH 5B38G 5BO1H 4BSJA 1A5FL 2YUZA 4WHYG 4D0CB 3GI9L 2BHUA 1QRKA 4NQDA 2APWA 2X4PB 3U2SA 4DZ8A 1HN1A 5KANI 2I9TB 1QBML 3RP1A 3O2VL 4R96A 5AUMB 1T20A 3SQOL 4NZTH 4R3SA 3WFCL 1HI6A 3FT3B 2J88L 4HPOL 2QADD 4OZHA 2JJWA 2ZCKH 4AH2B 5CS7A 5F7FA 2PO6D 4B50A 5DK3A 1KB9K 2BXZA 4ZFOA 5E56A 4JO3L 1FG2A 2WWMC 1T1YA 1IVLA 3MRHA 2B1AL 4Y2DC 4I18B 1SM3H 1HHKB 2R56H 4C83A 3FO2A 1ZA3A 3P73B 1I1FB 2AEPL 4XPGL 5INCB 1AD9B 3DVGB 4G80B 3QQ9D 5TE6H 1FZKB 3BPOB 1D9KB 2ZSVB 4OLZH 1KYOK 1ORQB 3T2NL 4LCCA 2ID5A 2AV7A 4G6ML 4WNQB 2ARJA 5DDHB 4Y88A 1C08A 1DUZA 3CFKA 3TO4D 1AXTL 5F3HA 4ODWB 2YD5A 3VMOA 2Y7QB 5JOPE 2VTFA 4N0YL 3CNKA 1CD0A 1WFOA 2B5IC 3MYJB 3UBXI 4RWHA 4JRXD 1OTSC 2LVEA 2YD2A 3GBLA 3MCLL 4ZAKB 4NUGH 1JGUH 1N7ML 2DIJA 3ARSA 4TPRL 5IJVA 1S9WA 3GSOB 2CQVA 3QXTA 5C8JA 5F1IA 2DLFL 4HDIB 4GKSA 4NO2B 1TDQA 1GIGH 2Z9TA 1IAIL 5INDB 3N06B 2HJKA 5IGXH 1KTLB 3N85H 4FTVB 5E99H 3B9KC 1QYGL 1KNOB 4N8CL 4NUJA 3HAEB 1F58H 5HVHC 3UJTH 4QT5B 1BMGA 5DD5H 4AMKH 2O26U 4UOW0 2YC1B 4HUUB 2FWOA 4P9HL 4DVRL 2GJJA 5CGTA 1RD6A 3VFOB 2VZ3A 4OGXL 4PJBE 1AY1H 1HIMH 5SX4I 1DUYA 3EHBC 3QIWA 5FECA 3Q5TA 2OR9L 4OV5B 1GHFH 4Y4HA 1WCBA 1Z3GL 4JKWA 4KTEH 1CLYH 1SHMA 1I8LA 5J1SC 2IADB 1D5MA 3GBNH 3W9DA 4G9FE 1DR9A 1K9TA 4QTIH 2ZKHH 4NNYB 5HGHA 4KC3B 4XH2A 2APXA 4XRCA 3QI9C 4ETQB 2NLJA 2XNAB 4NJAL 2CMRH 1JGLL 1OAXL 3K2UH 3KLHC 5IQ7H 1T7YA 3RGVC 5GZOC 1PEWA 1IC5H 3GSUB 4JFQB 1HEZA 4TVPE 3VJ6A 3OG4B 5BS0B 1T0NA 4LSQH 4NM8H 4Y4KC 4Z0XA 2ORBH 1D6EA 2JLLA 4JY5H 3W39A 3EYFB 5CP3H 4HJJL 1R5WB 1EPFA 4YPGB 3DGGA 4X9IA 1QSFD 1A7OH 5KSVA 2M1KA 5HYEA 5C0ND 5IHZB 1NGWB 2PW2A 2QQKL 2EE3A 4YFEA 2VXSH 3MFGB 4YDJB 4CUCA 3V5DA 3WHE0 1J8KA 3V2AR 1TJIL 4HFWA 3JVGA 2DAVA 5A2KH 1I3UA 1T83C 3HPJB 4XNUL 1MWAA 4HIJA 1RUAH 3RBSA 1QQDA 2WWKT 3BZ4A 1ZLSL 1BBDH 5E2UL 1NCWL 2R69L 2GIYA 3MZTA 4ZNCD 5HPMB 1JNJA 4PJEB 3V5KA 2O5XH 3L9RB 2F8XC 3WLBB 2J8OA 3UYOD 4PG9B 5JLZB 4CBPA 4FRWA 5KVEH 1UWGL 3GM0A 3O4LA 2YPKA 5DD0H 2ED8A 4Z7VB 3KG5A 5L6YH 4F7PB 4F7CB 3KLAA 3H7LA 3WDIA 3JWOL 1XFPA 4W4OC 3SDXB 1INEH 4JZOA 5FM5O 1EZVX 4KV5E 3CSYA 3QNZB 1HHJA 4JM2F 4WWKB 5EC2A 5C6WH 1GGBL 1H8NA 1HQ4B 4P2QE 1K6QH 4W4OA 5BZDA 4U6YA 3ET9F 3LEVL 3KYMA 4J23A 4K7FA 1OAYL 5FA4A 4DAGH 5D96B 3FOMB 4XTRD 3ALWA 1J5OL 1MRFL 3JTTA 5BV7C 5I1CH 1WWWX 2XA8L 1HHIB 3LMJH 5ALCL 2XQYG 3F7QA 2ADFH 3VWKD 3QQNA 2HMID 4RRPA 4LSQL 4MXQD 5BQ7B 5TFSL 1TZIA 2DQUH 5JZ7D 3G04B 5EU6B 5AWNL 2F54E 2OP4L 3L7EA 3QWRD 3D85B 3FOLA 4Y4FC 3I6KB 3ZYJA 1EK3A 1MCWM 4XNZC 2AJXH 2XN9A 4MD4B 1JRHI 2C1OA 5FO9A 4I9WE 2DMBA 3WUWB 4HCRL 3BH8A 5HGDA 1KPVB 2ATKB 5B4MC 1NAMA 3RY6C 3HG1B 2CH8A 4TUKL 4GRLA 2P5WD 4LL9A 4GW4B 4OFIA 3MRBB 4LSRH 2HKHH 5SX5K 5FUOH 1JMZA 4P57B 2F53E 1XAUA 2J8UF 4WO4C 1T22B 5I1IL 4EN3B 5IM7A 2W65B 4ZYKB 3U83A 1DBJH 5J1AB 2F58L 3OKNB 12E8L 1QFWH 2VITA 4PRPB 3UTQA 1RPQA 4GXVL 4K23L 1V05A 5IHBA 1AGDA 1H3PL 1PG7H 2RQ8A 4XCEB 3CXHJ 2A74B 3MNWA 4TVPD 5ILTL 1A6VL 2QADC 4LLAA 1QFWI 3JWOH 2G9HA 2NY1D 1V7NH 2YK1L 4QLRA 3QDGB 2BSED 3WIHL 3BN9C 2VIRA 3WKNA 4YUEL 1R5VB 3SGJA 4U0RB 1CGTA 3MNZB 1SM3L 4R2GB 2G5BB 3B9AA 2F5AH 3QXWA 4OCYL 4EI5B 2BNQD 5KAQG 1OSZB 3MV8E 4M7KH 5IHUH 1C5DA 1NJ9B 1FZJB 1T0PB 4JE4B 3P3YA 2BNUA 4PJDE 4GQPH 1NANI 5J1TC 5LKNA 1MUJA 5DMJB 5EWIL 3DECA 1NGQL 1T66D 3N50A 3WS3A 4CDGC 2R8SH 2QQNH 1EFQA 5E8DL 1FZMA 5CJ8A 9CGTA 3QG6A 1W0VB 4D9LH 4PRAB 1KEGH 2V2WA 1L0QA 3MRDB 4X8JA 5JDSA 2EICA 3SKMA 1YEIH 1DTUA 1DBBL 1FGNH 2JB5L 2D4DA 3B4NA 4O5LL 4WV1C 4F8QA 3SJVA 4ZOCA 2RAMA 3CFJB 4MS8D 2BSSB 4L3CA 3FQUA 2V17L 4I0PD 2FHCA 3MBEC 3DV4B 3UBXG 3ULUF 4OZ4A 1Q72L 4ODXA 4JFFA 2Y5TB 4TULH 3Q1SL 5T1LD 3PWPA 4EJ1C 1A6ZB 2XKSA 5DJXB 1V3KA 4Q58C 3K2UL 3I75A 4J3XA 2DTML 1B0GB 4G8GE 1CL7H 2VLKB 1FN4A 3ULUH 1OOAA 1BIHA 4NNXB 2E9BA 1XEDA 2HP4A 2ZUYA 3QIUB 5DRZB 1U42A 3RWGB 4AL8L 2OJZH 5DS8B 3NCEB 4M1GH 4IM8A 1MJ7L 4HBQA 2J4WH 4X5WA 1H8OA 2Y6SC 3WFEL 3WJJA 2EC9T 4YXHL 4GXUM 4QHKJ 2H3NA 1KJ3H 5IB3A 3HMXH 5DURB 4XMKH 3AS0A 2CK0L 3AXLA 4GAGH 4HKBB 1IGML 4LVOB 4QWWC 5HHPA 5J6GB 1FFOB 5D70L 5DJYB 3STLA 4Q9CA 5CJQL 3OKLB 1U8LA 5ABDE 3HR6A 4M7LL 3BP6A 5D93C 1EO7A 5DZNA 1I3VA 2GY7B 3V0AC 4PGJA 2O5YL 1P5VA 5I17B 1KOAA 3VD5A 3AVEA 3BYTA 1XIWB 3FB8A 4W70A 2P7TB 1QNZH 5F9OL 4KJPC 4X6CF 4XP6H 1B4RA 2OR8A 2B0SL 2E7LA 2IALB 5H37H 2IAND 2RGSA 2F19L 1A6WL 1JHLL 2VKWA 1Y6MR 1YECH 5B3NA 1ZLWK 3C2AL 1WQVT 2EDNA 4HWEH 3J7HA 2I60H 1MFBH 1E28B 3ZKMC 5K59F 3K2MC 4X7FC 3V0WH 8FABA 5IROA 3SDAA 4JAMB 4CMMB 1Y0LB 5F89B 3X14A 2E7HA 5C0IB 1H3GA 5E94A 3VDCA 2VLKE 1VERA 2HVKB 3GHBH 4RX4D 1CDYA 3MJGX 1WTGT 4MJIA 3WO4C 3LEXA 2P8LB 4X83A 2DQDL 1I1AA 3G5YB 3OX8A 3UPRB 4PTUA 1S7VA 3ILQC 2V5TA 1FFPB 1PSKH 3PDOA 2Q8BH 3MLTA 1BBDL 5I71C 4Q9QL 5FUZL 2VC2L 3HC3H 4FQJL 3VXOA 3FT2B 1YEHH 1M1SA 1Y18A 4G6FD 3AS3A 5FDWA 1G7QA 2JKXA 4YHYB 1WLHA 4OLXL 3T1FB 5KVFL 1CE6B 1N26A 3KPRE 1MAJA 1A1OB 2ENSA 4XMKL 5DLMH 1YPZF 3BRDA 1KN4H 2E27H 3BVNB 1KV3A 1AKJA 4NSKA 1QPPA 2QLVB 4QRPA 2D7QA 2YPLB 3ALPA 4U3HA 3FZUD 1U8NB 1PG7X 5I75C 3D25B 4I18C 5DSCB 3O41A 4U6VL 4R97C 5I8KL 3OAZH 1OD7A 4GOSA 4LASL 4J1UB 4M7LT 2V2XA 1K6QL 1FNFA 4MDJB 3E0GA 5ACMA 4LGPB 4OI9A 3T2PA 4RMTA 2VUYA 4FXKB 2MFNA 2X40A 4LKCA 2VZSA 3O6FD 3OZ9H 4XX1E 2J5LC 1R3LB 4HS3B 4RIRB 5C07B 3U6RA 1CGVA 4PRHB 1KLUA 5FKAB 2JCCA 3IRZA 3CLFH 3E6HA 5D7JD 4E41A 3GMOA 3QZWA 3FRPG 5GGVL 1EUUA 5A2IH 2CXGA 5CZXC 3BGFB 3X13A 1DBAH 4J8RA 5FIEA 1GAFL 4KI5C 3U7YL 3HPLB 2ILLA 1MEXH 3CDGB 2IWGA 4NC1E 3VFVA 4FQPA 1SJEA 3VDBA 5ERWB 1NGYB 3CH1A 3L3IB 4KFZC 4Z7WA 1IQWH 4DGIH 5EOQL 4M93B 2XFXA 4H1LG 2K1MA 4RGMB 4RMRA 3WCYA 4IMLB 2PNDA 4QRSB 2A9NL 5CBEB 5C0AB 4N9OB 1FORH 3IJYA 3PGDA 4I77L 5FAAA 3G6DH 5KN5A 1NMCC 4TN9A 5F21B 3CZFA 3V79C 2C7UA 3CXDH 3KJ4C 2W0PA 3C6LA 3ZT5A 5T1LB 4N8VA 3EOBB 1H15A 2OL3A 3TBSB 7FABH 5JA8B 1P4LA 4X98B 3RVXC 3HKFA 3TO4A 3OV6A 3VRIA 4P9MH 1Z2KA 3N1QC 3DO7A 4YK4B 1NSNL 1AGEA 4HZAA 3TBWA 3IFPA 4S10A 2CIIB 4JHWH 1A14L 4OM0H 2EKSB 5EDXA 1KCVL 1UQSA 2HT3C 2VXVL 1C5BH 4MJ2A 1KB5L 3MRIA 4RX4A 5HPOA 4WU7B 1WZKA 3LY6A 5FYLL 1NEZB 3K4DA 4LSVH 3A6BH 2GKIA 1N0LA 3FO0H 5D6CA 3HFML 2IPTL 1RZJC 4W68A 2EDKA 1UM6H 3MA9H 4KJYA 4L8SA 5GGQH 3GB7B 1BOYA 2DRUA 1TENA 3BX7C 1UCBL 5C0CB 4QCIB 3WJLA 3IF1B 4HSQA 5JOFA 4ZUTB 1HHHA 3ZYZA 4FZ8H 3ZKXB 4RNRA 4EUPB 1S3KH 2AKRA 3HB3D 4R4FL 1IE5A 3D69A 43CAA 5T33L 1FDLH 3FCTB 4PY8I 3AAZA 4WEBL 3HNVH 3RVUD 3S36H 1NCDH 2W0FB 3F5WB 4I0KA 4UT7H 5DHYB 5B3JE 4UINH 1XIWD 4KHTH 1T89C 5GISH 5KJRL 5BCAA 4WJ5A 4FN0A 4UAOC 4LVNB 1HYSC 5TDNB 5CKGA 3IDIA 3QIWD 4XPHL 4MLIA 4WI3A 5EO0B 2XG4A 3GMRB 2BNQE 1J10A 4ZFZA 3SQBA 4X80H 1FSKC 5IMOB 2GK0A 1KIRB 3EYVB 3LIZL 5LGJA 1N3NB 5FO7B 3GSQB 1OQOA 4NO0A 3MX0A 4LRIC 4H26B 3T09A 1ZGLP 5C0AE 4LGRB 4KI5F 4RBPH 4KTDH 2GITA 5ITBL 1T1ZA 1FJ1A 5IEHA 1I85A 4JDVB 5LXGH 3IDXH 4WEMB 4TSAL 1J8HD 3T4AA 4YNYA 4LSTH 2AJ3A 2F15A 1IZKA 2MOVA 4JPWH 2WMPA 1FAIH 1Y6KR 1FNAA 3O3DB 1AO7A 5L8KB 4CN1A 4OGYL 1QO3A 3U7WL 3H3BC 4NQCB 3VG9B 1QFPA 3RL1A 1ZANL 2VR5A 5MERA 1G0XA 5L8LB 5LWYH 4AM0A 1QRND 4NHCH 3J8F7 4TSBH 5C0FA 4O58L 2UWEF 4UT7L 1F3RB 2E8YA 1NH6A 3UTSB 5C08D 5HHNB 1SY6A 5L2JA 4BUGA 1VFAB 1S9VB 4L1HA 3HR5B 3MOBL 4NDMB 4LNVA 2FH8A 4WI4A 4XBPA 5H2BA 4JN2A 5ITFB 5MEQB 4NQDD 1IGJB 4OF7A 4X7TB 4YH6A 3T65A 3GSNA 1ETZB 1EHNA 1FL3B 3FRUA 5DJDA 4M5ZL 3RZCC 3CC5A 4NIKB 3IDYC 4NM4H 5DA4A 1TLKA 3L3JB 4RMWA 3ZHLA 5EO1B 3RTQB 3U4AA 4UZGA 2X4RB 3SJVE 1FVCB 2VR4A 3JSSA 3V4UH 4CADB 3KPLB 2IH3A 4P3WA 3GMLB 4TNWK 2QSCH 1VFUA 1OTUD 5IUSA 4F7EB 5HYJA 3ARFC 4G9DB 2N56A 4OCRL 5DYOB 3S4SA 4WO4A 5F6IC 1OCWH 1RY7B 4LBEB 2DQEL 4RDQF 4G7YL 2HVJB 1WZ1L 3JV0A 3OG6B 2HN7B 4WVRA 3TV3H 1EEZA 4MSWA 4XWOD 4OZHE 4XNMA 2J8UE 2IC2A 4G3YH 5D2NE 1DLFL 4PJEE 3V4VH 1DEDA 1KENH 2YRLA 3FQRB 4QHLA 3OKMA 1QBLH 1T0MB 1RZFL 1TZGL 2DQGL 2G60H 3KJ6L 4NRYB 4LPUA 4GAFB 3PNWA 4K3DL 2HH0L 3VW3L 2E6PA 5CHNB 1IKNC 4ZNEA 4GT7A 4LVHB 2NXYB 2ZOLB 3FL7A 3L7FB 1X4ZA 3HA0A 3LKRB 2J8UB 4BM7A 4M61A 1C12B 3X11B 4MHHI 3MLXH 4EIZC 1UM5H 3F65A 1FVDA 4WIQA 3ULUL 4PJDF 5IB2B 2DM2A 1U91B 2FIKB 3T4YB 1N6UA 2FBJL 2DM7A 3QHFL 4R4FH 3LQZA 1K8DA 2NY3D 3RY4A 3TLRA 2IF7A 2XTJD 1BX2A 4JQIL 1J8HB 5ADPH 2W59A 3WFDL 5BV7H 5L2KE 3WFEH 3FO9B 3EUUA 4RFEB 2BK8A 2BMKA 4BA8A 3MRMB 1WTLA 3WL9A 4JKPH 1OT1A 3FQWB 5IB1B 1RU9L 1TQBC 4TUKH 3BKCL 4LCUB 3QIBC 2QQQA 5H94A 1K3IA 4X9GA 3S36X 4YHLH 2IBGA 1KIQB 1P53A 4Y5VA 5SWSE 4ENEC 1WFTA 5I76A 1G9EA 4YDVA 3OXRB 1MFEL 3X12B 4JFYB 1U36A 1B4JL 1PAMA 1JFQL 2E9IA 1IFHL 3WLWC 5ACZB 1U8OB 3IFLL 2VWEC 1EFXA 4TNWF 1I7UA 4OTXH 1AGFB 3G5XA 1DFBH 1BFOA 4OZIF 1TZHB 5T3XH 4ISVA 2ESVB 5GSVA 3I84A 1VFMA 2EDQA 1KN2L 5F96L 1BIIB 3LEVH 3RKDC 4QRRA 4HQQL 1QLFA 4D9QD 2G75A 5DJ2B 1GPOL 5ICXB 2GJ6B 3BO8B 4CRPA 1Z5LA 1Z9SA 1YY8B 1TQCB 3ZKXC 1OB1A 2N7BA 3NCJL 1VESA 1IGTA 3GMQA 1IGYB 1W72A 2ICEA 3PWJB 4ONGH 1S8DB 3S88H 2RBLA 3QNXB 3TGXA 1NAMH 5J13C 5JIHA 1LNUA 3EO0A 3LSOB 3TM6A 1GGCL 2VNCA 2Z92B 4XX1G 5E4IA 4Y4KA 1NDGA 1KEML 3EFFA 5KAQF 1QLRA 1OT2A 1DSFH 4MJID 4B0MM 2SEBB 3F7VB 2FEEL 4K23H 1NUDA 4HGWA 2NTSP 1NDMB 4FXLA 2DLGA 3CFBA 3QCUH 1DQJB 5FO8B 3PV6B 5I1IH 4OCSL 1J12A 2ZCHH 3RIAK 1C7TA 1A0QL 4BZ2L 1OSPL 4HWUA 3HN3A 4YDIH 4WU5A 1D9KC 2DOCA 4G8IB 2PTTB 4HF5H 4X0KB 2H41A 1JCKA 2C9AA 2GAZB 4Q6IC 4FQ1H 4NZDA 4AEIL 5BXFA 4ONOA 4YGVB 3GFUA 3SOBL 1FAIL 5FYLD 5LBSH 2J88H 5CD5C 1NGQH 5C6TH 2BXYA 3BUYB 3SO3C 4A2LA 4GRWF 2FBJH 1P7QA 5GS0H 1BLNA 4UV4H 3TA3C 5KG9B 5ISZD 1JF5A 4TVPH 3AROA 3DIFB 3QA3B 1X3DA 3OSKA 4M8QB 2H8PB 1RURH 3G6JF 3MA7B 4LLYA 1QA9A 4BFEA 4RGOH 4YX2H 3VWKB 3PDDA 2B2XL 3SGDI 4MWFA 5E8OA 2CXKA 5L2KD 4XXDB 3B9VA 2OTUA 2E6QA 1AXTH 2Z35A 3NZ8A 3MRFB 1XF4A 2Q76A 2FLBT 4C57C 1E4WL 1CLZL 2EXYD 4X8XA 1LO4H 4JFEA 3VI4E 2FATL 4IBLT 1IZJA 1CICB 1U0QA 1FBIL 3CXDL 4PJDB 3E8UL 3HE7C 4I48B 1MQKH 2RR3A 1YEKH 2G2RA 3SO5A 1S9YB 4GAYA 3VXQA 2EDOA 2P5WB 1IGIL 1QACA 1RZGA 4DW2L 1DEEA 5KANG 4KVNL 3W0WB 3WIFA 1H5BB 3O3AB 1MFAH 2X4TB 3IU3B 3UJIH 3OR7A 1GGTA 3KXFB 3O3BB 4EOWH 3IKCB 4PJFB 1KCSL 4PGCB 1MHHB 2MTPA 3QG7L 5KS9A 3VGEA 3O2WL 3NAAL 1MHEA 4Z77A 3T0AA 1WZLA 2DIBA 3G5ZA 1QD0A 3VFMA 1YMHB 43C9A 1HWHB 3OXSB 1MVUB 1MFCH 2D7OA 4Y5YA 4RGNC 3VRJA 3PGCB 4F8TA 4Y16B 1KJ3L 1WCQA 5HGAB 2FEDD 1FO0A 2KZWA 4LQFH 2B4CL 1G6VK 5I1DA 4NPYA 2FDBP 4K7PX 5EOCL 3MJ6A 3MJ9L 1B0RB 4ZPTB 5HYSA 1QYGH 2G5RA 4PY7B 2GK2A 1HSBA 4PTTA 4JM4H 3SBWA 4KVCH 3GGWA 1XGUA 4PBXA 1R3JB 1MCLA 3S35H 2O61B 2A6IB 2IQAB 4YHMH 2O93L 1QTYT 3KDMB 4XZUA 5HI4D 3SJVD 1DBMH 1G7IA 5EU6E 4CNIA 3CFDA 3MLYH 3TPKA 4FP8L 2JIXB 3V6OE 3L95A 3VFPB 3MLXL 4DKEL 5JQHC 3KLSA 3EBAA 1KXTB 1A0QH 4FQQB 1GZQA 1CLYL 1W8OA 3UX9B 4FHBD 1G7PA 3JV5A 5D5MB 4B7IA 2EH7L 1BGXL 2X09A 1PFCA 4ODVL 1LK3H 4M4RA 3QUZC 2GT9A 4Z7QF 3PWVB 4KROB 4NHUB 1JGVL 5D93B 3ULVF 5K9QG 1KCSH 3L5WB 2NY1C 5DK2B 2UVEA 4MLSA 4NOFA 2XQBH 1A4KB 1V8HA 4Y5VC 3P0YH 4S1RL 1ZVSA 4JJ5B 1HSAA 1A7OL 4BH7A 3DJ9A 4BFGA 2GCYA 2HTLC 2P24A 3WJJC 3P4LA 3Q3GA 4MJ5A 1MI5E 2DBJA 3L1OH 1UXWB 5CEXB 1G7MB 3ELAT 1IEAB 3GSNH 2JJSC 3T0XA 2EXYC 5IWLA 2PO6B 3G08B 2FJGA 3OAUL 1VEPA 4A6YL 5EPMA 4HIHA 4X6DB 3CFEA 4PJIA 1BP3B 1T6VN 3QCVL 1OARL 1P2CB 1KT2B 3SQOH 2YN5A 2BVQA 1FE8H 4ZSOE 2IANA 4PJBB 4NFCA 1MI5A 2ARWA 1Q0YL 4XAWH 3P4NB 4KKAC 3E8UH 3IGAB 3CUPA 3EOTL 2NZIA 4PRHE 2ICWJ 4MAUL 4Q2ZA 1IQDA 5DRNA 4FP8H 5J9PB 1WWCA 4TNVF 5KSAA 5DMGD 2HFEA 3OZ9L 3LRHA 4OCLC 3IAQA 3RKDD 1NBVH 4K8RL 2VQ1A 4D9RD 4DUWA 4XBGB 5LBSL 4ZFFA 3D39E 3P4MA 3NAAH 5I8OH 1JWMB 3IDYB 4HXAL 1Q9KB 1SEBB 1OAZH 1S7UA 3NIFE 4HUXA 5I6XB 3CU7A 4CVZA 2R2CA 2PW1A 4QOKA 1CFSB 2BSTB 5MENA 2YPLE 5D1ZB 4MNQE 1LE5B 1MQ8A 3QUXA 2R2HA 2OBGA 2X70B 4U1HA 4KHTL 1NEZG 1PG7W 1TJGL 4TSCH 3FONB 4AIZA 1IBGL 4WUUA 3EJZC 1LEKA 4EDXA 4PRIB 5C0RL 2MCPH 4LDEB 5ID0A 1C1EL 3MJ9A 1QR1B 2NY6B 4H20L 2R1XB 2Y1VA 5SWZA 4P4KD 1UKSA 1E27A 3B9KD 3RDTB 4N90D 3BHBB 4DK3A 5JHDB 5A3ID 5BV7B 1NGPL 3BW9A 3FO0L 3EYUL 5GGTH 1ZK9A 5ANMB 2Y07L 2C5DC 4NO3A 3H42H 4FFWD 3MPCA 3AB0B 3CDFA 2HTKC 3MCKA 4XP5H 1A14H 4OM0L 4QY8A 4P5KA 2R2BB 3QUMB 4YZFE 1C5BL 4OT1H 4JDZA 3VXTB 5DJ8B 4PUBL 4NQUA 2Y72A 3GMMA 1ZLUK 4BFIA 1FNLA 3RVWC 4DOHB 5CD5D 3GSRA 2Y36L 2PYEA 3VFRB 1E6JL 1R0AL 3TBTA 4PB9H 2Z91A 5D7JB 5HYJD 5ECJE 3NOIA 1QRNE 5EO9A 1DE4B 2YN3A 4R6UA 3U0TB 2ITCA 3HZYA 3QDMA 3RX5A 1NLDH 2GUOB 3FB5A 2X4NA 2O5ZL 3V9FA 4NKQB 4WEUD 4BQBA 4JG1H 4JGJA 4WFGD 3NBNA 1YNLL 1FL5A 5C07D 3F6LA 1CR9L 2EYSA 1MI5D 2NTFB 1BM3H 5D5MF 4KKBC 4N0UA 3S97C 4JVPA 3KPOB 1N0XL 1OGAB 4QXGL 1GCFA 3C6LD 3DMMA 4IDJH 5CP7B 2OZ4A 1NMAL 4LIQH 4DEPB 4K94L 5F1OB 4F3FA 3D9AH 3WXVL 1UJ3C 3KHQA 1WBXA 1II4E 1L7TL 3WHXB 2PYFA 3QDJD 1S9KC 2IGFH 4UDUB 1ONQB 1RJYB 3EYUH 4QHMA 3KNBA 5HI5C 3VH8A 4WUKH 1RIUH 1CG9A 4I9WD 4G6JL 1P9MC 1SYSB 5IMKB 2BC4A 1JN6B 4Z76A 3REWA 3UP1A 5IVXF 4I4WA 5DRWB 5GS3A 4HWBH 1JRHH 3RNQB 5MEND 1UA6L 1VFBB 1J1XL 1BQHB 2XWJA 2BVTA 2P5ED 1CFVL 4YHPB 4P3DA 3C5ZD 3GMPB 3OKOB 3OR6A 4KK9C 1I85C 5CZXD 1LDPL 3O45B 3RGVB 2AJYH 2WLZA 1FO0H 5SWZD 1PBYA 5GIRB 5DHVA 2D0FA 2ATPB 3K46A 5IB4B 2RJMA 2QQNL 2IQ9L 4N0FA 2YWYA 4WW2F 1FV1B 4K9EL 3UTPD 5CEZL 3BRGC 2G60L 3STZB 1K2DA 3ILPA 4GKOA 4I3RH 1JZ5A 2VLLB 1AE6H 3NCCB 1KEMH 4PLKC 1FZOA 2NY1B 5T1KD 3BIKB 4E42B 3OKYA 3T3PE 4GJTB 3B8SA 4AG4H 1J9CT 3VXSB 4MMXC 1LO3L 4L4VB 3OKDA 2OI9C 3P30L 1G6RA 4Q7DA 2VXUL 4P5TC 4NKIH 1ORSB 2HFFB 2KUTA 4M9PA 5CWSA 5EZIH 1BHGA 4IS6A 2HLAA 4K8RC 4X6FB 4WW2B 1TVHB 3DROA 4ZG1A 2FO1A 4L1DA 3IJHB 3RU8L 1JF1A 5DJCA 2F53B 3QQ4A 1RZKC 3OB8A 1NMBL 3B3IA 4JO3H 4NKDB 2X1OA 4KHXH 4OBSA 3L5XH 5FYKH 1M05B 3SKJH 4OAWB 3O3UN 2R0KL 4NRXB 5D1XB 1VGKA 5E8PA 4OCRH 4X9FA 1UC6A 1NL0H 3MRJB 3TZVB 3EGSB 1NCTA 1RUPH 1C1EH 5C0BE 1GGYA 4M43L 3O6KL 4I5BB 2VXTH 4GW1B 2EYTB 2XTLA 3EDKA 5J12B 4H5SA 4LCWB 4Z0BH 3C5JB 3LN5A 4Y4KD 2VE6A 5HDOA 2DLTA 3DUUB 4XCNA 4XI5D 2B2XH 3WDJA 4UBDC 3BZFB 2UZYB 2J1KA 3GKWH 3HZKB 1ADQH 3RWDA 1I8KA 5EU4A 4MAUH 3ARBB 1XT5A 2MHAB 3GI8H 3K8MA 4G9FB 4QXGH 4DCQA 3U0PA 1MJJA 4OJFH 3VFUA 4O2FA 5J56B 4KTYA 2AQ2A 3FHAA 1OAQL 1UACH 4NC1C 1BEYL 2EDWA 4C58B 2W1NA 4PR5A 1KGCD 3D0LA 5CFHA 5L2KA 2A0LD 2B20A 2CKBA 4HWEL 4L8DA 2IGFL 2OMNA 4UTBL 3QHFH 1YC7A 5KTEL 2DLIA 3V95A 4Z5RB 3KJ4B 4GG8A 1UWEH 2P5EA 3JV6A 4KMTL 4BJLA 5C9JA 4KY1L 5FV2A 1J1OH 3V52H 1N5AA 5IT2H 1GGIH 4Y5XA 5LQBH 3WUWG 1XH3B 4NBXB 1BVZA 1CYGA 2FX8L 2NNAA 3T3PF 2AXGA 4PV9B 5ESVB 1YN6A 5EZOH 1NBQA 1X5JA 4IRZL 4Y5XC 3HI1A 3NACH 4QXWA 5JTWA 2E9WA 4FTVE 3ETBF 1KEGL 3VWKC 4CDHA 1KG0B 1DBKH 2P49B 1ZHNA 4N1CA 2XZAL 4Z6AT 4ONFL 3C8KB 5D1QA 3EO1B 3MXVL 2EC9U 1NC2B 1YA5A 4Z8FH 3UTPE 4GXUN 5T1KA 4XNUH 1I9IL 3OJ2C 4LPVA 4OLWH 1OY3B 1FH5H 1S7QB 3MLZL 1WFUA 3ZT6A 1N8ZB 3T0EA 1T21B 2AXJA 3TA3B 3IXAA 1CI5A 3TT3H 5DQDH 2CUHA 1QHOA 2YRZA 5BS0E 4P46A 1CN4A 5BOZG 3S7GA 1Z0MA 3UO1L 4UT9H 4XC3L 5CIPA 4N5EC 2YSSB 3WE6B 5EULV 4HIEB 3C8HA 4V1DA 5AZEL 4FQHA 3U2SB 2OL3H 4Z7NE 3FAWA 5DRXA 2I9TA 4YHOH 2FZ3B 4HKZA 1HILA 3CCHA 3VWJB 5ISZE 4R3SB 2R2EB 3H7BB 4ZOAA 3SDXF 4UOJA 1F4XL 2J8HA 3V7MA 1ZT1A 5IVXA 4LKXA 3SY0B 5B8CC 3IB4A 1QBAA 3HFMH 4AH2A 2VRAA 4HLZG 4JRYB 1ZHLA 4LHUG 1J5OH 3ARQA 1NCDL 1YUHA 4G42B 4J3VA 1K4DA 2L4OA 5SWSB 5IR1B 1MCPL 4P4KC 5DJAA 4YC2B 3SDCD 1RQ5A 4YDLC 3VFGL 4ZFOL 5C1MB 1EJOL 2D7TH 1CDBA 4I18A 4OZGE 1HHKA 2VQUA 1AJ7L 3T0BA 1BQLH 4YEFA 2P47B 1XGPB 3QHZL 5INCA 4JLRA 4JO2H 1UT9A 3BAEH 5IOPA 1S7RB 4LSSH 2XN9D 4QF1A 4GQ9H 4N9GA 1LO5A 3OHXA 3P0VH 5DDHA 3ZE2E 5DMIL 1DUZB 4HLZH 1E4KA 3LIZH 4ODWA 5TE4L 1NUNB 2HKFH 3C09C 3MYJA 4OCSH 4TRPH 4F2MA 3GJFA 4JO1H 5FYJD 3ZKNC 3RAJH 3TO2B 4QRQA 4MA7H 3FKUS 2DL9A 5ITBH 2OCFD 3OJDB 3QUKA 2GTWB 1D5ZA 4TUJB 3TBVA 3HZVA 4OKDA 2IPTH 4KKLC 1FIGL 3GSOA 4U1IB 3QR2A 1M7DA 2EECA 5F1IB 4HX1A 2R1WB 1NAKH 2FD6L 3SKOB 5LQBL 2NR6C 4DN4H 4G8EB 5I30L 1CD1B 1NUFA 3NFSH 2BVOB 4K8RH 5HYSG 2NYYC 4GS7C 4NZRH 4RWYH 5D7SL 2HJKB 1ZTXH 4QHNA 4QRTA 1MNUL 2APVA 1P1ZA 3IDMB 3RUGF 1OGAE 3G5VB 1INQA 1QKZH 3AMKA 5F1SA 1PQZA 2AP2A 5GGTA 2XWTB 2EDEA 3QDJE 2BNQA 4YHIA 1MRDH 4QT5A 2YC1A 4I13B 4OIBA 2FWOB 4APQC 1MPAH 4Z9KB 5C9KA 1KPRA 4LF3A 3E3QC 3LD8C 4PGDB 2W38A 1JGDB 1KIPB 5F7UA 2AXFB 1QPXA 1F6FB 5FECB 1AGBB 3O8XB 1VADB 2V7HB 4OV5A 4HG4J 4Y4HB 1WCBB 3O11B 4WI5A 5D7IA 3SGJC 2VDQL 3QPXL 1RUKL 5ACLA 2AS5M 2IADA 3W9DB 1IM3B 1U92B 2AJUL 3LV3A 3L3DA 1WITA 3A0OA 4O02H 4TULL 4ZQKB 1DN2A 2UZIH 5HY9A 3WDHA 1I4FA 5C09D 2EDXA 1QP1A 3MGOB 4KY1H 1E4XL 4H0GA 1HXMA 3V6ZA 1MH5A 5L9DH 2CJUH 3FFCD 4BH8A 4YEEA 1WBZB 5GS0C 1QLEH 3MRRB 1AQKH 1MJ8L 1P84K 2DYPB 3PE9A 2GSIB 2LAAA 4XHQA 3D39B 2WUCH 3BZDA 3GJFH 3QH3B 4Z0XB 4F7MA 3JV4A 4LCIH 5L0QB 4PD4J 2A9NH 1P7QD 4D8PA 1W72H 4D0BB 4QOKD 2V2TB 4ONFH 5GJTH 2OJEA 1NGWA 2PW2B 2FX7H 4FFWC 1I7TA 2Z4QA 5GGSA 1PZ5A 4QHUA 4RMVA 4K2UH 3SHSA 3ARZA 2WUBL 3C5SB 3CH8A 2P8PB 1CXLA 2AGJH 1F4HA 5CJOH 4R7NA 3GRWL 4M5YH 4OLVL 3BEVB 1QQDB 5ICZB 5GGUA 5K9JH 5LWYL 1EAJA 1U8HB 2NY2B 3MLZH 4OF0A 4MB4A 2EIZA 4ZO6A 3NCBB 4G7YH 5HPMA 1MHPL 1BQSA 4PJEA 3L9RA 1XF2B 4JB9L 1RI8A 4RAUB 2EE6A 3FZUC 1T2XA 4M7JH 3T2OA 4JFDB 3VFNB 1XGTA 3ZE0F 4U4BA 3ARGC 3RWIB 1QUNA 3N1GC 4JREC 4NO5B 3I50H 3ZKMD 1KELH 2FYYB 1V7ML 4TNVK 3ZL4L 1R3KB 1EVTC 1G6RH 1ZA6A 2HJLA 3LN4A 4OIAA 3QUXC 1HHJB 5EC2B 3L3OA 2DBLH 1KJVA 5F9JB 2V7NB 4OGZA 2FECI 2QBWA 1FRGH 4JZJC 5EUKA 4AQOA 4LLMB 4NFBA 3ILQD 2EC8A 3CVHA 5HYFA 4LLQA 4HUVB 3LB6D 4LP5A 4LEXH 1HHIA 4YHKL 1AC6A 1WEJL 2ADGA 5EBLA 2F5BH 32C2A 1D7FA 4X6BA 4GRLC 5BQ7A 5M95B 3AU1B 4HKJB 2EDLA 3HC3L 1UKQA 4EVNA 4QWWD 3O4OC 3L6FB 2DDQL 4RCAA 5CLWA 2XN9B 1M6OA 4LOUD 2C1OB 5JW4N 2X1QA 4OGAD 4KRNA 3WUWA 3NPZB 3ME0A 3T2NH 4D0DA 2ZG2A 3BH8B 5HGDB 1KPVA 5D8JL 2F8OA 2VDOH 5F7DA 2ATKA 1OP5K 1AQDB 2OZ4H 3C9NB 1YN7B 3QISA 4FFYH 1T3FA 3BZEB 4GW4A 2DQHH 4IOFD 3JWNC 4ELMA 5KOVC 2YHGA 4IMKA 3G9AB 4QRPD 5C09A 5HDBF 1MAML 2H2SC 4TRPL 4EN3A 1JPTL 2W65A 1Q9OA 4OT1L 3BP4B 4DK6A 1MFEH 4ZYKA 3FFCA 1A6TB 4DGYH 3P0GB 1JGUL 1MHCB 2I5YL 3Q6FB 3A6OA 1KC5H 4KMLB 2YBRB 1AGDB 4OZFB 3BSZH 3DRQA 2NY7L 2UWEA 4XGZA 5E9DB 5HYQA 3G6JA 5C08B 1BOGB 3WBDA 3H2WA 5I66A 1OGTA 1MFDH 4RFNC 2R8SL 3DARA 3GRWA 1GXEA 4JY4B 4YBHA 3D18A 2MQ0A 4JQIH 4G6AC 2FH6A 1NJ9A 4DWHA 1J1PL 3C09B 4HCRA 4LSUH 3F58L 3NZHL 1KFAL 3TJEL 5CAYB 1ZGLA 1TCMA 3P9WB 4QXUL 3K8LA 3CVHH 1A5FH 2R0KH 1KB9J 3RVUC 1MCHA 5I1AB 3NTCL 4U2ZA 2D03L 3TPUB 2V2WB 3MRDA 5JDSB 4M3KB 4NQEB 5EU5A 1ZS8A 5J3HC 4F33A 2LAGB 2Z8RA 4FQXB 2ZOKA 3CFJA 4WTZA 4Y2DB 3FQUB 5E03A 4PUBH 3OAYH 2A6KB 4ODXB 4JFFB 5IBLC 2E3VA 1QSFB 4LLUB 1Z9MA 4UV7H 4XPFL 4PP2B 4AEHH 4JKMA 3QQ3A 1B0GA 2VLKA 3GKZA 4PRNA 1UA6H 1P4IL 2FGZA 4UUJA 3QI9A 3QO0B 4ZUWA 4LHUB 3A6BL 4LDLB 2YMXH 3BIAX 4NNXA 3MYZA 1X5HA 5DRZA 2EZ0D 1CDGA 5DS8A 4URTB 4PJ7A 2YA1A 3T0EC 1D5IH 5IQ9B 3UC0H 4YHKH 1JHKL 5ETUB 1U8IB 1WAAE 5HHPB 5J6GA 3WFHB 3STLB 2KBGA 4H25A 3UTTB 3WKML 1RK0A 5FOBB 1I1YB 1MFNA 1SJHA 3HNVL 1U3HD 1MRCH 2VERN 1JNLH 4O2CB 2VDQH 4X7SL 4Y2OA 1RIHL 4R4BB 5AD0A 1G7LB 5GZOD 5I17A 4M93C 3DVNB 3B9KA 3S37H 1RZJH 1XIWA 3FB8B 5CMAB 3VRLE 5DC0A 4JFZL 2KPNA 1I8IA 3BQUC 3INUL 3ORJA 4YR6B 3QSKB 1I7ZB 5E6IC 5D1QD 5HVHB 1BFVH 4LLVA 4WHDA 2B5IB 4BKLA 2F9BT 3TVMC 1HYRC 2OYPA 4M6ML 4Z18A 4FMFA 4HXBL 1Q1JL 3UMTA 4PJAF 2LABA 1G9NH 1RHHB 1B9ZA 4GRLD 5IFAL 3KS0H 2HJFB 3LQAC 1ZGLM 3U0WH 1MAKA 5F89A 5E94B 4P46D 5DMGC 2CR6A 2P8LA 3LEXB 3UPRA 1VPOH 4GUPB 1BD2E 1OTSD 4KQ4L 4QTHB 3L