3V4PH

Crystal structure of a4b7 headpiece complexed with fab act-1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
218
structure length
211
Chain Sequence
b'QVQLQQPGAELVKPGTSVKLSCKGYGYTFTSYWMHWVKQRPGQGLEWIGEIDPSESNTNYNQKFKGKATLTVDISSSTAYMQLSSLTSEDSAVYYCARGGYDGWDYAIDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 32
structure length 211
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4pH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4pH02
4L8BA 4NRZA 4G9FB 3DO7A 4LRNH 5JW4N 3GSVA 5EOTA 3AY4C 2VXQL 3C9NB 5B21A 3AAZA 2JELL 2YD7A 1MFEL 3FO2A 2X4QA 4FN0A 4M1CD 4S1QL 4YUEL 5EG6C 1GCFA 1RHHA 1QKZH 4I3RL 5CJOL 5GS3A 2NLJB 1D5MB 5D9SB 3MLRH 3TBVA 4TTDD 4AH2B 3DOSA 4K3HA 1BZ7B 2GHWB 3QDJB 4Q9RH 4M43L 1VPOH 4RIRB 1OCWH 3BH9B 4HKJB 3IXAB 4U1NB 1JGLH 3BKJL 4Y2DC 2YD9A 4OQ1A 4N5EC 1A7RH 3IVKB 4MQXC 4URTB 3UPRB 3T0EC 3EO1A 4U1IA 4KZEL 4R2GD 2Z35A 2C3XA 1B6UA 5IMKB 3FQUA 1SMOA 4GG6A 1YZZA 1I9RL 4QNPF 1M6OA 3VFNB 5A2JH 4X7SL 5TE6L 1Y6NR 1R0AH 2IQAB 3PQYE 2FD6H 5CWSB 5KW9L 4PREA 5EBLA 1MI5D 3CK0L 4PJHF 1QSFA 5J06A 4ZO7A 2A6IB 4IOFC 5FCSH 2ARJQ 5ICXB 3PGDA 2CPCA 4YFLF 1IFHL 2J12B 3H0TB 4J1UB 5IJKC 1KN4L 4Y8DC 2R2EB 1Y18B 3ARBC 5FAAA 1L6XA 3TFKC 1Z5LB 5ISZA 5A40E 1EGJH 1LO5A 3EYQC 3WS6C 3LY6A 2PF6A 4KK9D 2R69L 4IRJB 5FXCH 5K9JH 1M4KA 2VLRE 4G9FA 1J1XL 4P59L 4HWEH 1E6OH 5EO9B 4HPYH 1SHMA 2APFA 5I8EB 4IIQB 4S11A 5F71A 1AGEB 3SGKC 2VUYA 2WNGA 1Q94A 4Y4KC 3AUVA 4FFZH 4JFZH 5IK3B 3V7AE 1RU9L 5T33H 1AGBB 2CDFB 2FH6A 1RIUH 4TRPH 2NLJA 4F33B 5BZDB 1D5MA 5D9SA 4AH2A 5DD0L 1ZT4B 1BZ7A 2D2OA 1FZOB 3CSGA 2ADGB 3QDJA 5EOCH 4Y19E 3DXAE 1D5IL 1XF3B 2ID5A 1MHEB 4RIRA 4JR9L 4PPTA 4TVSa 2XRAH 3BH9A 4HKJA 3IXAA 1YNTB 4U1NA 4PJGB 1S7SB 3VGEA 3U79A 3IVKA 3O3BB 3UPRA 4EUPB 5MP6L 5IMKA 1DQTA 4MA7L 4ZS6C 1MCOL 1KCSL 3SPVB 3PWUB 4M5ZL 4PGJA 3D0VB 1FVDB 4JVUA 2F19L 3VFNA 4HS8H 1S5HA 1WBXB 4HT1L 2EYSB 5DHYB 2IQAA 4ZUTB 1Y0LB 3SJVE 3THML 5CWSA 1QLEH 3SE8L 4Z7QE 1MRFL 2D03L 2A6IA 5ICXA 4P46C 4HJJH 4XPFL 3KPLB 2IPTH 3MRBB 3H0TA 4J1UA 3EIFA 2W07A 2RFXB 2R2EA 1Y18A 1Z5LA 2IBZX 5HD8C 3MMEB 3OWEA 4QNPE 5DMJB 3SE9H 4IRJA 4PGBB 1ACYL 4KRPC 4HCRH 5HYSB 3NFSL 5EO9A 1A6VL 4DZBB 5I8EA 3LH2L 3NCBB 1SQ2N 1AGEA 3HNSH 4KPHH 2FB4H 3BGFB 1Q1JL 4KHTL 4I1NB 1JYNA 4PJHE 1MAJA 3NH7L 3UYOD 2ICEB 5IK3A 2HT3D 1B3JA 4GKSB 1AGBA 2CDFA 4S1RH 4JM4H 4F33A 4OLUL 5BZDA 2ZPKH 3H2WA 1ZT4A 4LP5A 1FZOA 2ADGA 4XC1L 4WW1A 3HE6B 4OJFL 2BVQB 2H26B 1T04B 1FDLH 1XF3A 1MHEA 5GRVL 3UTTE 1A0QL 1GC1C 1YNTA 3MCG1 3MQIA 2PXYD 1S7SA 2VC2L 3EOYG 4PJGA 3QA3B 3O3BA 4H0GA 3PWLA 4I77H 2HP4A 1YQVH 5DJ8B 1ZLUK 1QQDB 4HUUB 1MHPL 1I8KB 1OTUC 1AO7B 3C5ZC 3SPVA 3PWUA 3D0VA 3MCLL 1FVDA 4KK6D 3SCMB 3T3MF 1I8LA 3V4VL 1WBXA 2NR6C 2EYSA 3HAEH 4F2MB 1PBYA 5DHYA 1F13A 1YNLH 3NN8B 4ZUTA 1Y0LA 4GH7B 2XT1B 4R97C 1T6WA 1A4KB 5E2UH 4OF8A 5CFHA 3KPLA 3I2CH 3MRBA 1S3KH 1P4BH 2RFXA 3WJJA 3C5SB 5B8CB 1JZ4A 3O4LE 2R0LL 1SEQH 3BPLC 5D1ZB 3MMEA 3O4OB 3D0LB 3RRQA 3MJ9H 3RY5A 1RV6X 4PGBA 2EDFA 2RB8A 5DGQA 3SGEI 1MCPL 1TFHA 2VERN 5HHQB 5HYSA 4ZOEA 4BFIB 1OY3B 4DZBA 1VEPA 2YA0A 2IBZY 4N1EA 3MBED 2ICEA 2YD6A 5F97E 5E5RB 4GKSA 5IMMB 2NXZB 2E7CA 2EDEA 1XGUB 3FOLB 4GG8B 3WFBH 1XGQB 1XEDA 2RAMA 3DUHA 3HE6A 1KYOJ 4ZFGH 2JCCB 2OZ4H 2BVQA 1RJLB 2H26A 3IDJA 1T04A 5C2BL 3P30H 1X4YA 4UV4L 3STZB 3E2HB 4JRXE 4WO4C 3P4LA 3NZHL 1S9XB 3QA3A 4EKXA 4QRPB 2HFEB 4X99B 4EN3B 3KLAB 1VSCA 3N1QC 5DJ8A 1QQDA 4HUUA 1B0RB 1ADQL 3CH8A 1I8KA 5FYLD 3PGFL 2JIXD 1AO7A 2OXHA 3VW3L 5GJTH 3QUMB 1CLYH 1AGFB 3SCMA 2IAND 3EDEA 4F15B 3F7PC 2K7QA 4DGVH 3SY0B 5FB8B 3NN8A 2O5XH 5IG7B 3V6OC 1TXKA 4HF5H 4HUKB 1A4KA 1I3GH 4ZPVB 4PGDB 4M9PA 2D7OA 1Q72L 5IROC 3UJIH 3ULVC 3C5SA 1BBJB 5B8CA 3RWCB 2XACC 4M1DH 5D1ZA 2FHFA 3QG7H 2VLKE 3D0LA 4H25B 3IDNB 3T3ME 5BZWB 1TETH 3IDMB 3S35L 5HHQA 3S97C 4BFIA 4DK3A 2YR3A 4OI7A 2NXYB 2VISB 4A6YL 1MHCB 3VFMB 5EUOF 1J0YA 1SY6A 1C12B 3LEXA 5IMMA 1ZA3B 3T4AB 2KL6A 1Z0MA 1I3VA 3BXNB 1XGUA 2YHGA 3FOLA 5KTEL 4GG8A 4MX7B 5ANMB 4OZGF 1XGQA 3G9AB 3FKUS 4YPGB 1RURL 2JCCA 3ULUC 1RJLA 4MD5B 2QQLL 3NACL 3TIEB 1FLTX 3LKQB 3STZA 4MA1C 4LBEB 5DWUH 1WBYB 4PRPB 4BZ2H 3PJSB 5H2BA 1S9XA 1CL7L 2ZUWA 1M05B 5EOCJ 3T0XA 4QRPA 4JG1H 5FKAB 4XP4H 1TVDA 2HFEA 3NIFE 3DVFA 3KLAA 4X99A 4EN3A 4FFYH 1B0RA 3PWNB 4JZJB 2N7AA 4WCYL 3D6GA 4PY8J 5C09E 3QUMA 5CEXB 1AGFA 1VKXB 5I73C 1U9KA 1JF1B 2IFGA 5HI5C 4X7TB 4MCZB 3SY0A 5FB8A 1Y6KR 5F1IB 5LGJB 4MJIB 4P2OB 4RGMC 4DAGL 1EHXA 5IFHL 1I75A 3PWJB 4U6TA 3ZKQD 1NAML 4ZPVA 4PGDA 3KHQA 2HLAA 2DQTH 4WFED 2DI8A 2NTSP 5E5UB 3MXVL 3L5JA 5CKAA 1BBJA 3RWCA 4DN3L 2VDLL 1GPOH 3B43A 3IDNA 5GGSB 3HUJB 5M7QA 3MACH 1AD0B 5BZWA 3IDMA 3CFCL 2G9HB 4PJ9B 1NFKA 4UAOB 3W0WD 2VISA 1MHCA 3VFMA 3WXVL 2FO1A 4LGSB 4HKXB 1WIOA 1C12A 3TPUB 4P5TC 4ERSL 5KOMC 1ZA3A 3T4AA 4WY7L 1IT9L 4TVPD 1MH5B 1HZHH 3BXNA 4M62L 4P2QE 3WFCL 4MX7A 1T2QH 5ANMA 1OARL 3OPZL 4WV1C 1LDSA 5T5FH 4YPGA 1RIVL 4MD5A 3TIEA 4OCNC 3W9DB 1XIWB 1QPXA 1T80A 4LBEA 3OXRB 2BNRE 1WBYA 4PRPA 4DFIA 3UO1H 5HDQL 3MLXL 3I6GB 3PJSA 1M05A 1EBAA 3EUUA 4S0SD 5FKAA 1OAXH 2K9UA 1I1AC 1HINH 5C3LD 3FCTB 3PWNA 1BGXL 4JZJA 2YWZA 1S7XB 1S78D 1E4XH 1ED3B 1PKQB 5CEXA 1T89C 3L3JB 1BVKB 4UZGA 1VKXA 1JF1A 3EYVB 4LLMB 4LIQE 4X7TA 4MCZA 5IV2B 2CRMA 3UP1A 4LARL 5F1IA 5TE4L 5LGJA 4MJIA 4P2OA 4P2YA 3VG0L 3WUWB 3PWJA 2HT2D 3AGVA 1QTYT 4JREC 3OR6B 4OTXH 1CG9B 3O3AB 2IJ0C 4RGNB 4OCXL 2JK5B 4IDJL 3U1SL 1OAQH 3D3VB 5D70H 4XWOC 1FGNH 2F5AH 3PWPD 3J8F7 2UZIL 4U3XA 3HUJA 3O45B 5GGSA 1AD0A 2VR4A 2G9HA 2Y07L 1MJUL 4PJ9A 3NCCB 1G0XA 5J11C 3E3QE 4KJYB 4K8RC 2ORBH 4HKXA 4XXDB 5L0QC 2AXFB 3TPUA 4JRYD 2R1XB 5EO0A 3G6JE 1NGYB 1ZLUH 2FGWH 5JIHA 1MH5A 4AJ0A 4OFYD 2APWA 3HLAB 1L7TL 1EX0A 3DGGB 3P4OB 2XWJB 1Z3GL 5A16B 5CLWA 4F7EB 3QT2A 4KTDH 3W9DA 1XIWA 1N7ML 3RX8A 3BEWB 5FYKL 4PG9B 5IB2B 3OXRA 5BVPH 2EIBA 4JM2D 2X4OB 3I6GA 3GBNH 1J8HE 4QRRB 4UTBH 4FQ1L 3FCTA 1S7XA 4X5XB 1A1OB 1ED3A 1PKQA 3L3JA 1BVKA 3MRDB 3LOWA 2WBJB 3TJEH 2W9EH 3EYVA 1FC1A 3VXQB 3QDGB 5IV2A 1AFVH 3HC3H 4FTVB 2Z91A 3WUWA 3MA9L 5ADOL 1DBAL 5D4QA 4XCCL 3S4SB 1NCCH 3QDMB 3KXFB 1J0HA 3OR6A 4Y1AE 1J18A 1CG9A 3O3AA 4NUGL 4QRUB 4WFFE 1JYWA 4PJEF 5I1GH 2JK5A 1CDBA 3D3VA 5E1AB 4MJ4A 1KGCE 5JXAL 3WLWD 4ZSOE 4APQB 2YD3A 5H94B 3O45A 1MCFA 4F7PB 1YC7A 1ULVA 3MOAH 1T5XB 2CQVA 4TULL 5KSAB 1KJ2H 1F5WA 1ZHLB 3RAJH 1DUYA 2LFGA 4KJYA 2FX8L 4FFWD 4G5ZL 4YPJA 4XXDA 3ETBF 2AXFA 3WSQL 2R1XA 1KEGH 5FHAL 3TBTB 1NGYA 3OKEB 1A02N 5DEZA 3S7GA 3HLAA 4HGKC 3OKNB 5HPOA 3NVQA 5C0AD 5FEBA 5GRYA 5TH2B 3DGGA 1A47A 1J1OH 1N5AA 2XWJA 3P4OA 2XNAB 3VH8G 5HHNA 4QHNB 2BMKB 5A16A 4F7EA 4MYWB 1HYSD 3BEWA 1R3IH 5KS9F 4PG9A 5IB2A 2H32H 2XTJD 1OM3L 3BSZH 2X4OA 3MLVH 3O6KL 1A64A 3VD5A 2O5ZL 3NABL 3B8SA 1E4WL 3BP6B 1MLBB 4Z95H 4QRRA 2AEIT 3ZKXC 4PLOB 2AGJH 5FGBA 1DVFC 2P8LB 3ZE2E 4X5XA 1A1OA 4EIZC 3VXRB 1P53A 3MRNB 2XIDA 1B4JL 3MRDA 2WBJA 2WP3O 3U4BL 4J3WA 4QHKJ 3VXQA 3QDGA 3L5XL 3P0VL 4GMTH 3TV3L 5D5MF 1CS6A 4X80H 4FTVA 3GHBL 3S4SA 1BF2A 3QDMA 3KXFA 3N1PC 4ZFFB 4WEUD 4QRUA 4XVJH 3VRIB 3V8OA 5DQDL 3T8XB 3JZ7A 1G6VK 1MI5E 2CK0H 4P9HL 3HRPA 4PJGF 3S5LG 5K9OB 4BA8A 2I60L 4APQA 5H94A 4F7PA 2H2SD 1YC8A 4YE4H 5KSAA 1T5XA 3MSPA 1ZHLA 3NOIA 1S9WB 1WEJL 3QEQD 2AKRB 1DDHB 4LFHD 5DEFB 4LKXB 4MD0B 5DK0B 3MV7D 3CJJA 4EZMA 4Q0XH 1A3LH 3TBTA 2Y4SA 3OKEA 3FRUB 4PJEE 4QXGL 4WU5B 3OKNA 5CGYC 4YXLL 1HNGA 2F5BH 3IFPB 15C8H 2J88H 3O9WA 4XWGH 3OL2A 5TH2A 3SDCD 2XNAA 1I1FB 2BMKA 4QHNA 5T3ZH 3WIHA 2IH1B 1CLZL 2EC8A 4JPWH 4IM8A 4CUCA 3IFLH 1RK1B 2YD1A 1KTDB 4NZDA 4XMPH 5KVGH 1JF6A 5D1QC 5D2NE 2X05A 4KRLB 1UZ6F 1BEYH 3BP6A 1JNNH 4CMHB 1MLBA 4TPRH 1U8HA 5E95B 1T03L 4OQTA 4OD3L 4LK4A 2P8LA 4H1LH 4R6UA 1L9MA 1UM5L 1MFAL 1AHWC 2IPKB 3UTOA 3VXRA 2HWZH 3MRNA 1C5DB 2DLFL 1CR9L 2GAZB 3RY6C 3BO8B 5BRZD 4LCIL 4NKIL 3MV8D 1QHOA 3O8XD 3FAXA 1GIGL 2HJKB 3SOBL 5FUOL 1FGVL 1TENA 3CMGA 4ZFFA 2EDOA 2JJSC 3PUCA 1JV5B 3U9UB 4RFOH 3VRIA 3T8XA 1FZJA 1E27B 5DC0A 1RUKH 2EDHA 3DVGB 4H20L 2Y9RT 3U7YL 5K9OA 3GJEB 1JRHH 5J1AB 1FL5B 2CLRB 5D5ME 3S35X 3BGMB 5C86A 3VDAA 1H0DB 3AM8C 4DFHA 4CU8A 2AKRA 1DDHA 5F3BB 1EIBA 3DX9B 4LKXA 5DEFA 4MD0A 4NQEB 4P23A 5ALBH 3UBXI 4GAFB 5DK0A 3U2SB 5GGUB 3FRUA 4WU5A 4ZNEE 1I85A 5EU7E 5DD3H 4Y5XB 3IFPA 2HH0L 3MO1B 1QFUH 3LQMA 4LIQH 1T1XB 1I1FA 2X89D 4UIKL 2IH1A 3MLZL 1ACZA 1RK1A 2AK4D 1KTDA 1XF2B 5C08B 4WWKD 5IMOB 4GUPB 2CKBL 3DV4B 3FO0H 5TDOA 4JJ5B 3QULB 2VJXA 5SWSD 4M1GH 3GJFB 2BHYA 1MWAH 1E4KC 2IH3B 2IPKA 1QLFB 1C5DA 1T0PB 3GMQB 2GAZA 3LPFA 3OXSB 1CTOA 5EPMB 4S1SL 3C60A 3ZHLA 2R23A 3NMEA 1JN6A 1RK0B 4ODTH 3VGGA 3OZ9L 1TVBB 2HJKA 1UZ6E 3SO3C 2HVKB 3ZL4H 3QZWG 1NBQA 4JGJA 1JV5A 3U9UA 1KF9B 1OSPL 1XCTB 2B4CL 1E27A 3I3EA 1NFIB 5MI0B 4H0IA 3GJEA 1SBSL 3QUXC 4POYA 3L5HA 2XZCH 3OHXB 4RMTA 5J1AA 1FL5A 2CLRA 1G9MC 3BGMA 1H0DA 1EO5A 4XP1H 1DBML 5F3BA 3DX9A 3IAPA 4NQEA 4OFVA 1I7UA 3IF1B 3U2SA 3E8UH 5GGUA 2BHZA 4K71C 2FX9H 4E9LA 4GXVH 5L9DL 3LD8B 4Y5XA 1A6AB 3BP5B 4LVOB 3MO1A 4PJDB 1KEML 3SKOA 1F3DH 2UY6A 1T1XA 2NX5D 4S1DC 2QHLA 3BQUD 4O9HL 4XP6H 3L5WB 1JYXA 1KXVC 1XF2A 4KUCD 5C08A 4KJWC 1RUAH 2ZKHL 4GUPA 5IMOA 3DV4A 4NRXB 4N9GB 4JJ5A 5DRWA 3QULA 4FA8A 1HI6B 5I18H 1WWWX 3B2UC 1J87A 1UKQA 4CKVX 2GJZB 4N8VG 5IBUG 4XNUH 2ED8A 3I9GH 2IH3A 1QLFA 2JJTA 4MQ7B 3GMQA 3TVMD 3OXSA 5EBGA 5EPMA 1TJGH 4KROB 5IB4B 1RK0A 4YHML 2IANE 5FYJL 4I0KA 1TVBA 1R6VA 1BD2D 2HVKA 5HY9B 1N6VA 4FXGB 4YBHA 4K7PL 5DSCB 1QRNA 1XCTA 4NWTL 2ADIB 3D69B 5DFWH 1NFIA 3M17B 1KFAL 4PJIB 3U7WL 4KV5F 3NCJH 1EFXD 2HKFH 3LMJH 2NY5H 5C0CB 2B5IB 4JQVC 3OHXA 2M8XA 1GGTA 3KPMB 4JG0H 3WKMH 1GJIA 3B9AA 4ZO8A 4JQXA 2Q1EA 1OVZA 3IF1A 1BQHB 1KPRB 1U3HD 1TZHB 4G7VH 1A6AA 1W72B 3BP5A 4Z78B 1NGQH 3SEPA 4NN6B 2DQEL 3K4DA 1K3ZA 3VWJD 4F8QA 4PJDA 4ELMB 5JHLL 4GW1B 2Z8RA 4OKDA 1JHKH 3U82B 3EDFA 2VL4A 5J57B 3L5WA 5AZ2L 3LKSA 1UENA 3JWOL 3CSPA 4NRXA 4N9GA 3EYOB 4KI5C 4Q9BA 1A7QL 1RUPL 3UDWC 5F7YC 1HI6A 3KPQB 2GJZA 1QBBA 3FRPA 5IF0B 2DJSA 1A6UL 4DTGH 4MQ7A 1CE1H 1AJ7L 3G9VA 1FORH 3QXWA 5E56A 1DL7H 5IB4A 4EJ1C 1NCWL 5LXGH 5D8JL 2AJVH 3GBLA 5CJXC 5HY9A 1N26A 1QFWM 1KG0A 4FXGA 4UTAL 5DSCA 1GVIA 1KCUL 2ADIA 3D69A 3M17A 4PJIA 3HAEG 3VGHA 2H1PL 2NY2C 4HIHB 4JJHA 4WFEE 2IGFL 3EYSH 4POUB 4CNIB 5FKPB 3KPMA 5HGHB 1AE6H 4M7ZB 3MOBL 1BJMA 1P2CB 1C5CL 2EIEA 1ZKAA 3MNWB 2UWEB 4R8WL 4MAUL 2NY0D 5HHOD 5HYJD 4M93B 1HK6A 3BMWA 1UEMA 4Q58C 5ILTL 3W0WE 4BH7B 1KPRA 4ZD3H 4G6FB 1TZHA 3NGBC 2Q7NA 2X1XR 1W72A 4Z78A 4I0PC 1VGEL 5GGQH 5LAXB 4I3GA 4KV5E 4H8WC 3LRGA 4TVPE 4ELMA 1OAZH 2FZ3B 4I4WB 4GW1A 5I1EL 2F8XC 3O2VL 2FECL 4HWZB 3K3QA 1OOAA 5JXEA 4I3SH 3VFPB 1Q0XH 5I8CB 2BY1A 3NZ8B 1LO4H 2EC9T 2AJ3B 5I1JL 4M4PA 4NZUL 1WIUA 2DM3A 3EYOA 3KPQA 4LDOB 2NY1D 2MQCA 1INQB 3DMMD 2QQKL 4QXUH 3MV9B 1B2WL 5IF0A 2Q87A 4FZ8L 4YHPA 2IPUG 1Z9MA 3MRGB 5IVXB 1F3RB 1L7IH 4DVBB 5KVDH 2F8OA 2BNQA 4PJBB 4UIMB 4JFDD 1IAMA 4K7FB 4P4RA 1KJ3H 5C9JB 1T1WB 4TSBH 1OQXA 4OZFB 1P6AB 3MJ7B 5DMIH 5TE7L 4KVCH 3TYGH 4NDMB 3D9AH 5SWZD 2R15A 1MCIA 4YHIB 1MAKA 4HIHA 2VE6B 1VDGA 2AW2A 2VWEE 4CNIA 5FKPA 5HGHA 3B9KB 4KC3B 1IZKA 1DEEB 3BPOC 3PWPE 4FS0A 1P2CA 5KJRL 4OCMC 3MNWA 4W4NA 1ZTXH 2UWEA 3MC0A 2Z8WC 4MXWH 4A6YA 5GS1B 4OLXH 4LVNB 4BH7A 3V0VB 3AU1A 1WZKA 1WZMA 3OAUL 5FK9B 3S98A 4JFYB 3MPCA 1RZKH 5HGBB 4JRYE 2AJXH 3HCVB 5LAXA 1LO2H 3P9LB 5IW1B 2FZ3A 4I4WA 3GMOB 2FBJL 4HWZA 3X13B 2ESVB 3VFPA 3GSNL 2M26A 1MQ8A 3NZ8A 5FHBH 2ZG2A 2AJ3A 4X6DF 1ZEAH 3UAJC 2ZNXA 4DJMA 4M3JA 1F3DJ 4LPYA 5TPWL 4HPOH 3ROLB 5ITBH 2CXGA 5I2IA 1AR1C 1INQA 4QRQB 4WW2C 3F58H 3MV9A 5F1SA 3QPXH 4KU1A 4X6CB 4NBXB 3MRGA 4TQEH 5IVXA 3TN0C 4MB4A 4DVBA 3WLBB 3HFML 4ISVB 4PJBA 4UIMA 1BVLB 4ZXBB 4K7FA 5F89B 3RVWD 1F8TH 5C9JA 1T1WA 2XKUA 3C5JB 4OZFA 4RISH 3MJ7A 5CILH 2APXA 5JQ6H 4KKAC 4MGXA 4NDMA 4FQXC 4JKMA 4LHUG 3EFFB 3W2DH 1OP5K 3MRKB 4BYHA 4WI4A 5D72L 1A3RH 1F90L 5HGGS 1AR2A 2VR9A 4JO3L 3KLHD 4YHIA 2VE6A 1UM6H 4TUOB 3B9KA 1DEEA 5BS0E 4B50A 3VGAB 1MIMH 2OCFD 5CP7B 2KZ1B 4DEPB 5GS1A 3SKNB 3TBWB 1MFNA 3V0VA 3ZYIA 4R3SB 4XMLH 3GRWL 2PYEB 2J8OA 2YS4A 1AKJD 4JFYA 3N9GH 4YDJB 5HGBA 3SDAB 3HCVA 2YPVL 2D0HA 2RR3A 4RGOH 1EHLL 3P9LA 5IW1A 2EXYD 4PB9H 1OWRM 1UEYA 3GMOA 4Z7UE 4C56B 1W0WB 3CDCA 4XPGL 3X13A 5C0AE 2ESVA 4ODWB 3QUZC 3WUZA 1CLOL 3V6ZA 4JN2B 4PIRF 2BY3A 3F62A 2QQQA 4F3FB 3B9EA 4ZTPL 3ROLA 4NPYB 4IMLB 2XTJE 1DQDL 4ZFOL 5EZLA 1SY6H 2IQ9L 4QRQA 2OR9H 5DUPL 3ARFC 4X6CA 1YECH 4XMKL 4Q2ZB 1RSFA 3WLBA 2PNDA 1JGVH 4ISVA 2R4SH 4ZXBA 1BVLA 3ORJA 4D9LL 1G7HB 5F89A 1SEBB 4X6DE 5D7JC 5E08H 3LQAL 4KY1L 3C5JA 5C0NC 2R0ZL 3HI5L 3TZVD 1N59B 3RY4A 2ZUTA 4XB8A 3EFFA 5HDBF 3QCTL 3MRKA 1F6FB 3W11D 2EDDA 1VFMA 4FQPA 3X11B 1IC1A 1TZIB 4ZNCD 4JFOB 5DMGC 4LKCB 4NHCH 3PIQB 4IRJD 4TUOA 1BZ9B 5T3XL 2ITDB 4FG6C 3QUMH 3CFBB 1CFQB 3WS3B 3K2UH 1CTNA 5CP7A 5CZVH 1A6TB 4WUKL 5L7XL 3S36H 3SKNA 3TBWA 4EOWH 5K9KB 4NQUA 3QEQE 3RWIB 4KKBD 1UWGL 4R3SA 1BBDL 5CIPB 2PYEA 3PL6C 3WIIL 5T1MA 4YDJA 3S8WA 2A6KB 4HV8B 3MV7E 3SDAA 2D4DA 4HGWB 4NQCB 5EZJB 3P9MB 1UM4H 4RWYL 5EULV 3GMMB 4C56A 4KAQH 1W0WA 3BDYH 3NIDF 4ODWA 1DLFH 5HI3D 4DOHB 2KUTA 1AP2A 1U36A 3JVGA 4OV5B 4IOIB 4NJ9L 5E2VL 1GHFH 4JN2A 4BM7A 3IU4H 3H3PL 4F3FA 4YHYB 4KK5C 3N0PB 4OLEA 1ZK9A 2P46B 1AIFB 3FJTA 4X6BB 3BX7C 3DARA 4Y2DB 3CLEL 2AJUH 4Q2ZA 4GMSL 1IM9B 2VABB 2VXUL 2DQHL 4UV7H 3HE7B 5D6CB 1BWWA 5AD0B 1CDIA 2IG2L 2D4FA 1G7HA 4U1HB 1SEBA 1F42A 5BRZE 3O3UN 4X8JB 4D2NA 4EI5B 3MV8E 5I8KL 1N59A 4PJXF 1QBMH 2VXSH 4TVPH 1U8LB 5CUSL 3X11A 1TZIA 4JFOA 4LKCA 4NP4H 3PIQA 2BDNH 5AYUL 1BZ9A 1CXIA 2ITDA 3ARPA 3CFBA 5I1DB 1CFQA 3WS3A 2D7NA 4HK3J 4OSUL 4OLWH 4BFBD 1A6TA 4Q9QH 3SKJH 3RWIA 5CIPA 3S6CA 1SM3H 1X5XA 4KUCF 5HDBE 4UNTA 2A6KA 4JO1L 4HV8A 2N4IA 4HGWA 4NQCA 5EZJA 4TOYH 3P9MA 5LGHL 1U58B 1U8QB 1HXMB 3UTSD 3GMMA 4Y4KB 4J12A 3V0WH 3HE6D 4RRPA 1IAIH 3ZKMD 5IR1B 4OV5A 4R4FL 4IOIA 3MCKB 3ARGC 4F57L 1Z9OA 1QFWI 3QIUC 3ARVA 4JB9L 3IKCB 2AK4E 2QV2A 1OAKH 1O5DT 1IGFH 1NAKL 1AIFA 4J3UA 4X6BA 3ARWA 5SWSE 1FFNB 3BAEH 1IM9A 2VABA 2IFFH 3V4UL 3HE7A 1F4YL 5D6CA 2FEDD 3NIDE 5AD0A 1GGIL 1NDGB 1IGML 3U0WH 5D2LF 2CR6A 3IFOA 3CFIC 4U1HA 3WMSA 4WEBL 1UJ3C 5SX5H 5BV7L 1A5FH 4ZUSB 4M48H 5ERWB 4EI5A 4EVNB 4JPKL 4LCYB 2MKWA 3QI9B 2F53B 3ZE0F 1IKNC 4HQQL 4ZO6A 3GIZL 1T0MB 3C87A 4K7PY 4XB7A 4PJCB 3K81A 5B39G 3V5DB 3UJTH 5GISH 5I1DA 4CMMB 1MQKL 3NA4A 1NLDL 4ZAKC 2Z8VC 2QEJA 3WS6A 3IDGB 4NKDB 1KCRL 3MUY1 2OI9C 1IC5H 3UROR 4W70A 4PJXE 1TTFA 2X4NB 4ZUVB 3OB0K 2R0WL 2R2HB 2NNAB 4UB0L 4PBXA 1U58A 2YMXH 3MRPB 1HXMA 2NY7H 5B3JE 3RTQC 1C8PA 4CDGC 4KHXL 4HC1H 4P49A 5E2WL 1XF4B 2LAAA 3ALXA 5IR1A 3MCKA 2B7DT 4YBQD 3RVXC 2NX5E 3IKCA 3FN0H 4Z18A 2CKBB 2G60H 4GKOA 1INEL 5AZEL 3GK8L 5JW3L 1FFNA 1CZ8L 4LGRB 4P9MH 3STLB 1BVZA 3E6FB 5F93C 1NDGA 1FLRH 5IP4A 3BYTA 4RMVA 5TQ0H 2VUOA 4JO4H 5DLML 4H1LG 1QOKA 2FX7H 3B83A 5ERWA 5A1AA 2XQYK 1RZFL 4KRNA 4LCYA 3CVHB 3ARDD 3QI9A 1BD2E 2F53A 3J7HA 4YJZL 4MNGE 3N1MC 4K3EH 4R97B 2DYPB 1DQLL 5ALCH 3ZE1F 1T0MA 2VDOL 4PJCA 4MDIB 4OGAD 4KDTA 1N4XL 4MZ2A 1SBBA 4NWUL 4YR6B 3V5DA 3ZSTA 5D2LE 1KB5B 3WXWL 4CMMA 5I1HL 2JJVA 1FL3B 1A7NL 3PP3K 5KANI 2P45B 3QDHA 3BDXA 3BPLB 3IDGA 4NKDA 4WUUD 3N1FC 1MCBA 1JP5A 2MJWA 3OKYA 4NJAH 2F15A 1S5IL 2X4NA 4ZUVA 5GRVK 4OF6A 3ZE0E 4PFEA 2R2HA 2NNAA 4S10A 3FO1A 4NRYB 1K85A 1VESA 2PN5A 3MRPA 3QBTB 3N85L 3L7FB 5C6TL 3BN3B 1U2CA 4LSQL 5F9JB 4KUZH 1XF4A 1X6LA 4HIEB 2X4PB 1WT5A 4QWWD 3DX8B 4OAWB 4QOKD 2R0KH 4PRPD 1OGAB 3IDYB 5TQ2L 2CKBA 3O81A 5CSBA 4FQ2L 1ZLSH 1CF8L 1PG7H 2L7JA 1J0ZA 4AYFA 4R4NC 3STLA 2DLGA 3NTCL 2VXTH 3QJFA 5GS0H 3E6FA 5BO1L 3DGCR 4D94A 4YXKH 1BAFH 5EOQH 5B4MD 1ZGLB 2XA8H 5IBLD 3WIHH 4WU7A 1SVCP 2XA3A 4PGEA 4ZFZB 3OJMB 4F7CB 3CVHA 4ZUWB 4BZ1H 3MRCB 4K3JL 1WZLA 2DYPA 1RZ7L 2XFXB 5F96L 4MDIA 4YR6A 4DUXA 1KB5A 1FL3A 5I19H 3B2VL 3QEGH 4X7FC 5C7XH 4N0UB 2NY4D 3IU3B 1INDH 4ONOA 5F7FA 5KSBB 2ZCKL 4M02A 4NQDD 4RBPK 5HHOE 5HYJE 4AL8H 1TJIL 5GRWA 4NRYA 3JSSA 3CX5J 4N1HB 2NW3B 3LEVL 3ZYOA 3V5HB 3LEYH 3K46A 5SV3A 2YUWA 3ZE1E 3HMXH 1ONQB 3HZKB 3M45A 2MCPL 3VXMB 4OLZL 5F9JA 5SWQB 3BESR 4HIEA 2X4PA 5CJ5A 3R8QA 3DX8A 4OAWA 4LNVA 2GJ6E 1OGAA 5C0BD 4NGHL 2DB8A 2IF7A 1ZHBA 2VXQH 3TT1L 1MFEH 4G6JL 4S1QH 4YUEH 4I3RH 4X83A 5CJOH 4WI3A 2ATPB 3V8CA 1JIBA 2AXGA 1QD0A 2FLBT 4POZC 1ZGLA 1EBPA 4JHAH 2EC9U 4M43H 4ZFZA 5C3TA 4J4PC 5JHDD 1T66D 4F7CA 4ELKB 4ZUWA 3WL9B 4LCWD 4RGMB 2F54D 5H35B 3BKJH 3NPZB 2WIIA 5SWZE 2XFXA 3JTSB 4XPBL 1T5WB 4WI8A 5CMAB 1AGCB 3QQ9D 5CJ8A 1I9RH 3L7EB 5I1CL 4N0UA 2V2TB 3IU3A 4QRSB 4X7SH 5TE6H 1NANH 4CL7A 4GSDL 1MEXL 5KSBA 1FP5A 1H9VA 4YEFA 3CK0H 2D7TL 4G8FB 2NW3A 3MJGX 4PTTB 3V5HA 1ONQA 3HZKA 1I8LC 1P7QD 1IFHH 3D2UB 3VXMA 1KN4H 5SWQA 1FRGL 3IJSB 4FQIL 2R69H 3HI1B 2ITCB 4XHJD 4PLJC 1RZKC 2BRRL 4U7MA 3VD3A 1J1XH 4P59H 2Y5TB 3VH8B 5FM5M 4I2XB 4MLSA 3RGVD 3WJJC 4YIQB 5HYEA 1J5OL 4RMSA 2A6JB 3QHZL 1RU9H 1AGDB 4LPWA 2ATPA 3VA6A 3FQTB 5IIEB 5C07B 5DD0H 4X4ME 4MQSB 1BREA 2FGZA 3Q3GB 5DJCB 2JKXA 5AAWA 1D5IH 4IMKA 4ELKA 5FGCE 5D7LB 4WGWB 5HPMB 2X09A 4JR9H 1ODAA 3WL9A 5H35A 3LPWA 1EPFA 5LJYH 3JTSA 4JREB 1T5WA 5MP6H 4ZG1A 5CMAA 1AGCA 4AG4L 4Q7DA 4MA7H 1MCOH 3ES6B 1KCSH 2DTML 4M5ZH 2AABL 3L7EA 2WV3A 2GCYB 4F58H 2V2TA 2YD5A 3PXJA 1A2YB 4OLYL 5A2LH 1FBIL 4AZ8A 3OR7B 3THMH 4G6AC 3SE8H 2YPLB 3LDBB 1MRFH 2D03H 4G8FA 5CEZL 3QIWB 4EDWL 1IRAY 1OT2A 3SCMC 4XPFH 4P3WA 1RI8A 3DVIA 1BOYA 3D2UA 4M9OA 3BI9X 5IJVB 4AEHL 3IJSA 5C9KA 3HI1A 2ITCA 3NCYP 1ACYH 4XP5L 1RZJH 4OB5L 3NFSH 2NQCA 1A6VH 2Y5TA 4H26B 3VH8A 3LH2H 4I2XA 3TC9A 4KHTH 4YIQA 4PJFB 3NH7H 2A6JA 5D1ZC 4HG4K 3O4OC 2NY3B 3VXRD 1AGDA 1YDPB 3ARRA 4G6KL 3U48A 3VCLB 2FATL 1FO0L 2BFVL 4OLUH 4YHOL 1U3YA 1NMBL 3FQTA 4OGYL 5IIEA 1WUNT 5C07A 4RSVA 2YA1A 1WWCA 3WFZA 4XC1H 4OJFH 1GOFA 3Q3GA 5DJCA 5EA0L 2NMSA 2NXZC 4B5EA 1A9EB 5D7LA 4GRLC 4HMCA 2HMIC 2VC2H 5K59E 2BCKB 1KJVB 4HUMB 1UC6A 1BHGA 1G0YR 1VFBA 1MHPH 3ES6A 2DBLL 3NFPB 1PW3A 3MCLH 4O2CB 2GCYA 1RHFA 1A2YA 2G5RA 5E99L 1S7TB 4EN3C 1A4JB 5E03A 3OR7A 1EEUA 2ZJSL 2YPLA 3GUTB 3QIWA 1XT5A 3EOBB 2DKMA 1FSKB 1EO7A 4KKCC 1OGTB 3IXTB 3ARED 5IJVA 1Q9KB 2R0LH 2A9ML 3LVEA 4MXQC 1IC4H 3GKWL 1MCPH 4YDIL 4H26A 4M5YL 1HHKB 3FAWA 2EYTB 3PP4H 3QXAB 4NQVB 2SEBB 4ZFOB 4PJFA 5AWNL 3NIGF 2VQ1B 8FABB 1YDPA 5E8EB 4XPTL 3VCLA 1LO0L 1VERA 1JPST 2XZQL 4V2BA 2NXYC 2ZWLT 4JQIL 4HAFA 4PJ5B 5J0BA 2QTEA 4HMDA 3BKYL 5FOBB 2Z93B 5C2BH 1FN4B 3CVIL 4UV4H 1W0YT 1A9EA 2VKXA 1ZLWK 2BCKA 2DQDL 1KJVA 1KIPB 3CDGB 4HK3N 5T5NF 5GRXG 4PYHA 1M71B 2UV3A 1ADQH 3CFKB 3PGFH 2YEZB 3VW3H 1IGTB 3LN5B 3U4EB 3NFPA 1MCJA 3T2PA 4O2CA 2WW8A 4PRIB 4NQED 3SGJA 1BJ1H 2GY7B 3C6LC 1S7TA 5H8DA 4RMQA 4U1GC 1A4JA 5K93A 4P0DA 4KFZC 3GUTA 1H5BB 3EOBA 3EOTL 4NZTL 4ODXB 5BW7A 3MGAA 1Q72H 1OGTA 3IXTA 2BVPB 5CZXD 5C0RL 3UTSE 1Q9KA 4P2OC 1H3WM 3HB3D 1KULA 1MUJB 1DEDA 2EDJA 3MZTA 3S35H 4AQ1B 1G7MB 4A6YH 3SBWA 1HHKA 3MRMB 2BNUB 1O0VA 1ZMYA 2EYTA 5MEQB 4NQVA 2SEBA 4ZFOA 4E41D 4G8GA 2VQ1A 2ZUVA 1MCRA 1RPQA 2DF3A 5DUBB 8FABA 5E8EA 3LB6D 2K1MA 4PJ9C 4UAOC 5KTEH 1XR8B 2XN9B 1QEWB 4J3SA 4ALAL 1AXSB 4PJ5A 3ZTJH 1AHWB 1NBYB 5IBUB 5T3XD 2EH8L 2DM2A 2QQLH 3NACH 3F5WB 5FOBA 2Z93A 3F12B 1FN4A 1WIPA 4YH6A 1G6RL 1CL7H 3NIGE 5GHWL 5KG9A 3CDGA 1KIPA 2QQNL 1M71A 1XIWC 3CFKA 2YEZA 4WCYH 1UH3A 3LN5A 1RAMA 4KZDL 3S37X 1IZJA 4PRIA 1GL4B 4L3AA 4DAGH 3VXPB 1QFPA 3ILQC 5IFHH 4NN7B 1M7XA 5ICZB 1H5BA 3RWDB 1WBZB 1NAMH 2Q3ZA 3NCYS 4ODXA 1NCAL 3MRHB 1F4XL 2YN3A 2BVPA 3MXVH 3QISA 4DN3H 2VDLH 3LPGA 4UNUA 1MUJA 2H8PB 1AQKL 3CFCH 3VRJB 1T66C 4NM8L 1NGPL 2DI7A 4RGNC 1G7MA 3MRMA 2BNUA 3WXVH 4TUJB 5MEQA 3GI9L 4M6OL 1NGXB 1ROWA 3BRGC 5DUBA 4ERSH 2ENSA 4WY7H 1IT9H 4M62H 3HNVL 4LOUC 3WFCH 2CRZA 1XR8A 2XN9A 1QEWA 5F6HI 4L3EB 1OARH 1D3CA 3OPZH 1AXSA 2FIRT 3W82A 1AHWA 1RIVH 4C83B 3QHFL 2VZ1A 1R5WB 3F5WA 3F12A 5BV7B 1UKSA 1J1PL 3P40A 4P48A 2X1PA 4QHMA 5HDQH 4NO3B 3MLXH 4Q97A 3EJYD 1QYGL 4EDXB 1BF8A 4PD4J 2JJSA 5C0CD 1JTOA 2W91A 1BGXH 1YY8B 2RBLA 3DUUB 4CN6A 3CMOL 3HAEB 4RQQB 5TE4H 3VXPA 5FGBC 3VG0H 3RKDD 4ETQB 3KPTA 4WUUE 3RWDA 1DTUA 1CICD 1WBZA 2WBJC 4MJ5A 1IBGL 4OCXH 3VXSB 4IDJH 3U1SH 3MRHA 4Y16B 3VFGL 1H3UA 5ADPL 2IALB 3V6FB 3QRGL 4K94H 5D71H 4HCRA 1PEWA 2UZIH 2H8PA 3VRJA 2Y07H 1MJUH 3FQNB 2QADB 3QWRA 4QOKE 2A6DB 3JV5A 4PRPE 1J8KA 4TUJA 1G7JB 1T22B 1NGXA 4APQC 1TDQA 3AVEA 5KSBF 1E6JL 1GRWA 1P9MA 5JNYB 4O2EB 4PRHD 5KSAC 1L7TH 2VN7A 2LTQC 2A77L 1J0KA 4L3EA 4YO0B 1E28B 4AM0B 1Z3GH 5JA8B 4C83A 1R5WA 2CLVB 3QUYD 3DHMA 2HYMA 1D6EB 1N7MH 5FYKH 4UMGA 4ENEC 3UZEA 3NA9L 1QZ1A 5F44A 4NQXB 1CGYA 5GS0C 4NO3A 3O9WC 3WNLA 4EDXA 2ZUUA 4FQ1H 5DD1L 2W59A 1K3IA 1GGBL 1YY8A 3DUUA 1UFUA 5KVFH 3HAEA 1TTGA 1U8OB 5HI4C 3WFEL 3KJ4B 3TA3B 1MCQA 1FFRA 4ETQA 3QPQD 1DBAH 4XCCH 3RHWK 4NQDE 4NUGH 3VXSA 1BJ1J 4HDIB 4UUJB 3TJHD 4Y16A 1B0WA 3X3FL 3WUWG 4N0YH 2IALA 3V6FA 3WN5A 3MJ9A 5JXAH 3TO4B 4ONFL 2WIMA 5GSVB 2ZSVB 3ALWA 4KH2A 3T08A 4PP1C 5F9DC 2J1KA 1KB9J 3G5VB 3FQNA 4TULH 3VA2C 4LDEB 3WNOA 2A6DA 4K8RL 5C0BE 3QQ3B 2FX8H 5CIPH 2KPNA 1G7JA 4G5ZH 1T22A 2QJDA 5F9OL 3TM6A 3WSQH 2BVTA 4LCCB 5D96B 5JNYA 1HCFX 4O2EA 4MB5A 3T4YB 4NUJA 3H7BB 1P84J 2G2RA 3MRRB 1PKQE 3TT3L 1V3MA 4YO0A 3TLRA 2R4RL 4AM0A 1IAKB 4Y4FD 1F00I 2R2BB 4P23C 3PQYB 2EH7L 4PGCB 2B8OT 4MS8C 2CLVA 1R5VB 1D6EA 1I85C 3H9YA 1OM3H 3EO9L 3SE4C 3O6KH 3DETD 3QNZB 5JHDE 1YEFL 3NABH 1E4WH 5E1HB 4Y4HB 1WLHA 1WC7A 2OTPA 2GFBB 2F54E 4HXAL 3D87B 4LCWE 3B9KD 2VLRB 5C0IB 5IQ7L 3Q0HA 4LHUB 2HTLC 4LHJB 1B4JH 1I3RB 3U4BH 3QXVA 1UH4A 3P0VH 4CMHC 3VFOB 5JPNA 3GZKA 3SGDH 1PGRB 5DURD 4Z76B 3TA3A 2DOCA 4F80A 3RZCD 5JQHC 3C8HA 3A6OA 5FGSA 1F11B 4HDIA 3WDJA 3C60C 3OKKB 5A3IC 4P9HH 4Y19B 3DXAB 3TO4A 3WFHB 2PO6D 5GSVA 2ZSVA 2XZZA 3G5VA 2J7LA 4DZ8B 4HWBL 1WEJH 2FDBP 4U0RB 3QQ3A 4U7SA 2R1WB 2P5WD 3MLTB 4LCCA 1MSPA 4QXGH 4KJQC 3EAKA 5JW4Q 4GRWF 3T4YA 4S0TD 3G5XB 3H7BA 4YXLH 3MRRA 4QTIL 4XAWL 3JUYA 4C4KO 5DS8B 1IAKA 2R2BA 3PQYA 4PGCA 3SJVB 3GIVB 1C7SA 1UWXK 3FB6B 1CLZH 4P57B 2V2WB 1R5VA 2V9TA 2XI9A 4Y5XC 2DLIA 4M3KB 3QNZA 2VQUA 4BUGA 2FJFB 4Y4HA 3OG6B 1XGRB 2GFBA 1T03H 4OD3H 2VLRA 5C0IA 1G7PB 4PJFF 1MFAH 4LHUA 4W6YB 4X0KB 4YHKH 2GITA 1I3RA 2DLFH 1MRDL 3KYKL 4HBCL 4WFHD 4PJHB 3VFOA 4LCIH 1X5LA 1W0VB 2BP3A 3C2AL 4NKIH 1ZGLM 1T0NB 2A9NL 4ODHL 4Y8AA 4Z76A 2AXJA 3SOBH 5FUOH 3TCXA 1FGVH 3RNKB 2JJTC 1LP9F 5LCVL 1P1ZB 1F11A 4O2FB 1FNEB 3OKKA 4Y19A 4H20H 3DXAA 3TH4T 4PJ7F 3WFHA 3E6HA 3U7YH 4FZEL 3QEUB 3UTTB 3IAQA 4DZ8A 1JWMB 4Y2OA 1P4IL 3K2MC 2R1WA 5FCUL 5MI0C 3MLTA 2GTZB 5F70A 3SDDD 5I8OL 2ADFL 5FYLL 3KGRA 1NDMB 2NY6B 3G5XA 3M07A 1H3PH 1RZJC 2MSPA 5DS8A 4JQXC 1U8IB 4NCDA 3TCLB 1DQQB 1D9KB 4H0HB 3SJVA 5EO1B 3GIVA 3FB6A 4UIKH 3O6FB 5EU3B 4P57A 3VMOA 2V2WA 3MLZH 1F4HA 1S7VB 4TRPL 3LD8C 4NYLB 4RNRA 4LVOC 4PJ8B 2CKBH 2OXGA 2R9HC 3FOMB 2R56L 3O4LB 2FJFA 3RI5F 5DD5H 1XGRA 1N0XL 3S88L 4GRWE 3O11B 4FQXB 4Z77B 3LIZH 5GRUL 1BQLH 2YZ8A 4X0KA 1S9KC 5I16B 1BFOB 2X4UB 4S1SH 3M1BB 4PJHA 1W0VA 3LSOB 1T0NA 1K6QH 3OZ9H 3BISA 4CN4A 1KCKA 4NQCD 3RNKA 2E9JA 3K1KC 4HK0B 3BIBX 3LCYA 3MRIB 1P1ZA 1OSPH 4O2FA 2B4CH 1FNEA 3U83A 4KROC 3QEUA 3FN9A 3UTTA 1SBSH 4JRXB 3ARXA 2ICCA 1DBMH 1BQUA 5I9QC 4NFBA 2GTZA 4X9HA 2Q3AA 1LP9E 4Y2DD 2B5IC 4PR5B 1NDMA 2ZUSA 4N5ED 4FXKB 5GGVL 4MQXD 5L9DH 3T0ED 2VNCA 4PJ7E 1FO0B 1RMFL 2PR4L 3A67L 4MA3B 4KPHL 1KEMH 5FUZL 3ARFB 1U8IA 3TCLA 1DQQA 1D9KA 2IAMC 2AQ1A 1CVRA 5CJQH 4DGIL 4KKLD 2OYPA 3O6FA 2KQNA 5EU3A 1A7OL 2H32B 4O9HH 1N3NB 1KIQB 1S7VA 5DJ0B 1Z9SA 2VQTA 2DMCA 5DR5L 4NYLA 1S7WB 4P2RD 4PJ8A 4M7LT 1YYML 1HDMB 5D7JB 4U1SB 3FOMA 1HKLL 3DI3B 3O4LA 4DQOL 2Z31B 2YD2A 2VLKB 4W6WB 4IOFD 5JXEC 3NAAH 3O11A 4FQXA 4Z77A 3TH3T 2HFGL 2Q8AL 2KDGA 4LPXA 3ARBD 4BJLA 3TFKD 3KLDA 1BFOA 3EYQD 2X4UA 3M1BA 3LSOA 4YHMH 3KPRD 5FYJH 5B39B 1KSRA 1BIHA 4OZ4B 4HK0A 4K7PH 3MRIA 1S7UA 1TZGL 1KYOK 4Y4KD 4NWTH 3ZDYF 1CFNB 3PL6B 2CGRL 4XNYL 3U7WH 3VWKC 1A21A 4XX1E 4JRXA 1G9ML 4RX4A 5GZNC 2MFNA 1VGKB 3WO4C 2GSGA 3VJ6B 3JV4B 3QIBB 4I5BB 4XCYA 2XG5A 1NMCC 5C09B 4PR5A 1XGYH 4FXKA 2CUIA 4HS6B 4PBVC 4E41E 3UC0L 1FO0A 2XOTA 2DQEH 43C9B 1ITCA 4MA3A 1QSEB 3BW9B 4TN9A 4ZS6D 4BKLB 5JHLH 4M93C 1UB5B 1FV1B 1CD8A 1FIGL 2H32A 4MAYB 1N3NA 1U8NB 1KIQA 5DJ0A 3QNYB 5T3XE 5AZ2H 1S7WA 5DYOB 3JWOH 1YA5A 2AEQL 1HDMA 2ILLA 4U1SA 2EKJA 4OF5A 5DQJB 1N0LA 1A7QH 1CFVL 1RUPH 2Z31A 2QSVA 2VLKA 2OZ4L 3PHSA 4P46D 3KPNB 5FDWB 1LK3H 4U6XB 1A6UH 3L6FB 5HHXL 1AJ7H 1XZ0B 5HD8D 2C26A 2JLLA 5E5MB 3TWCL 4KRPD 1NCWH 4TSAL 5B39A 1ZT7B 4P2QB 1BM3L 3BP4B 4OZ4A 5L8KB 4UTAH 1DJSA 2Q86B 3B9DA 2I07B 1CFNA 1KCUH 2APBA 5F7EL 3PE9A 1AC0A 4KMTL 3VI3F 1MFBH 4L9LB 5BMFL 2H1PH 4WENB 2QSCL 3QXTA 2FLRT 1U8PB 2BNRB 2IGFH 4QHLB 5EUOB 1BFSA 2ZOKB 4BFGA 3VGFA 3OV6A 3MOBH 3BRFA 1C5CH 1VGKA 4R8WH 4MAUH 5I15L 3VJ6A 1J88A 2EE6A 3JV4A 3QIBA 4I5BA 3GHEH 5ILTH 3QIUB 5C09A 5JW5B 4M8QB 2P49B 4TNVF 1CD0A 3ZDYE 3B9KC 4HS6A 3RWHB 5EBWB 1VGEH 4GOSA 3ISWA 43C9A 3BW9A 3ABZA 4BKLA 3MUHL 1OTUD 1UB5A 5GS1C 3C5ZD 1FV1A 3O2VH 3P73A 4XTRC 4MAYA 1U8NA 4RZCB 4JFEB 3QNYA 2NR6D 3QWOB 1IGCL 2P48B 4NZUH 5DYOA 1F02I 5DQJA 2YRPA 2OX5A 4D0DB 4O00A 3V5KB 3T0BA 1MWAB 3H6JA 2QQKH 2OL3B 2MPAL 5FDWA 5E00B 5MERB 3FB5A 1CD1B 4U6XA 4XPAL 4FZ8H 2IWGA 3L6FA 5DWUL 5C0CE 1K8DB 4JCMA 1XZ0A 5KSUB 2OJZL 1MREL 3WBDA 5E5MA 4KDWA 1WF5A 1ZT7A 1UYWL 4HH9B 3OF6D 4WFGE 4P2QA 5TE7H 3BP4A 4OM1L 2Q86A 2I07A 2VDRL 5DJ6B 1LEGB 4ZXBC 4L9LA 2Z0BA 3PV6B 1M7DB 1B0GB 3T2OA 4OIBA 1U8PA 2BNRA 2EDWA 4QHLA 5EUOA 3CZFB 1JWSB 2OR7A 5IHUL 2BERA 5KJRH 1SMAA 5EBMB 4Y0GA 5DJ2B 2DD8L 2AXHA 5F8QC 4WO4D 5JOFB 3QIUA 4CDHA 1J86A 1GPOL 4GRWH 5JW5A 3OAUH 4K94C 2GY5A 3ARTA 1WZ1L 5IHZB 3RWHA 3O6ML 3DI2B 4H8WL 5EBWA 5HBBA 3VGAC 3GO1L 4CVZB 5FOJA 1FZKB 1X5IA 4PRHE 2FBJH 2O5YL 4L8BB 4ZMAT 4V1DD 2BY2A 4RZCA 4JFEA 4Y1AB 4HFUH 1ZE3C 3SDAC 3QWOA 1P69B 2E3VA 1OQOA 3RIAF 4YLQT 4YXHL 5TPWH 4TNVK 4ZSOB 3ZTJG 1G6RA 4D0DA 3V5KA 1GYAA 2OL3A 5E00A 5MERA 3VXTB 1CD1A 3JVGC 3UTQB 3ULVD 3PWVB 1K8DA 5KSUA 1J7VR 1DUZB 5JOPE 4L4TD 3HFMH 5E2TL 4XP9L 4HH9A 5CBAB 2C5DC 3RFZC 3H42L 2WUBL 3ELAT 4JFFD 1UB6B 1NCBL 5D72H 5DJ6A 1F90H 1LEGA 4NC2B 4KVNH 4JO3H 3PV6A 1M7DA 1B0GA 3GBMH 4BH8B 3CZFA 1JWSA 4XNXH 2GUOB 3ULUD 5DZOA 1V5JA 5EBMA 5TJWK 1J8HA 3U46B 5DJ2A 4A2MA 2EXWC 3BUTA 5JOFA 2IPUK 1OTTC 3I6KB 1QO3B 1RJCA 2GI7A 3GRWH 4R2GB 4YDKL 1VB9A 5DQ9B 4ZQKB 5IHZA 2YKLL 3K1DA 4PGZA 2YPVH 3FTGB 5E2JA 1FZKA 3ZMRA 1EHLH 2X41A 5IVXE 1X5GA 4HUVB 4L4JA 4HSQA 4QXTB 4U31A 1FCGA 4WHYH 2ORBL 4XPGH 1AY1H 2GK0B 1AD9B 4G6ML 2W92A 3SQBA 4Y1AA 5HI5D 3FQWB 1CLOH 4RCAA 3ZKNC 4LVEA 1MI5B 1BECA 3IFNL 2LU4A 1Q94B 4ZTPH 3RVVC 4ZSOA 1DQDH 1GZPA 3ARZA 2IQ9H 5F7MC 4YWGL 2H3NB 3VXTA 5GGRB 3UTQA 3X12A 1WFOA 3LHPL 3QWQB 3PWVA 4XMKH 3D48R 1H3XA 2VDML 1KACB 4YHYC 1DUZA 5I6XC 4UQ3B 4ZUUB 4PJEB 1MNUL 2BOCB 4LQ1A 2E9WA 2FSEB 3LQAH 4KY1H 4Z7QF 5CBAA 2R0ZH 3HI5H 4O4YL 3GSQB 4K9EL 2QBWA 3HE7C 3QCTH 1UB6A 25C8L 2WUCL 4P5TD 4NHUA 4JGUA 4IRZL 3V95A 4KKLC 4BH8A 3R0MA 1I1YB 3TBYB 5T3XH 4EI5C 3LQZB 2GUOA 3P0YL 1S5HB 4UBDC 1FVCB 3U46A 3I6LD 5L7XH 3P9WB 1QG3A 4P9HC 2DQIL 2DIAA 1UWGH 3I6KA 4K07A 1QO3A 4FQQB 3DPBA 4N8CL 5DQ9A 3WIIH 2DAVA 2Q76B 2P5WE 4ZQKA 1KTKE 1I1AD 3RP1A 1KJ2L 1A7PL 2O26U 3RAJL 3OJVC 3FTGA 4H88L 1J0IA 3VFSB 5C07D 1OWWA 4RWYH 4HUVA 1W2KT 5KS9B 4QXTA 4GW4B 4OI9A 1E4JA 4P3DB 3MNZB 4MNQD 2GK0A 1AD9A 3UPAA 1UG9A 1U2HA 4DGYH 4G8IB 5E8OB 3FQWA 1JCKA 5D7LD 3B6SB 4OGZA 3H3PH 1MI5A 1PZUB 3UMTA 2MQ0A 3ARSA 2H3NA 1HWGB 5J56B 3RU8L 5GGRA 4XPHL 5D5MB 2RCSL 2UZYB 4XWOD 1V7ML 3CLEH 4GMSH 1CXLA 2VXUH 4WW1B 3BHBB 2IG2H 1U0QA 3QCVH 5KAQF 4UQ3A 4L8SC 4ZUUA 4PJEA 4HD9A 5D7IF 2BOCA 3LS5L 2FSEA 2YPLD 2DLTA 3DV6B 4K8RD 5GRJL 5I8KH 1ZHKB 3GSQA 2Y6SC 1DQJB 5DHXB 1AH1A 3PWLB 1FFQA 1I7TB 5CUSH 2ERJC 5FV1L 1EXUB 2D9QB 1I1YA 5D2NA 5AYUH 3TBYA 2HRPL 2HT4C 3LQZA 4R7NA 2AVGA 3QI9C 1FVCA 4OSUH 2VLJD 4LSRL 2PXYB 5J8OA 3K0WA 1ND0B 1PZ5B 4PV9B 4FQQA 2RIKA 3KYMB 2Q76A 4KDTC 4WI7A 4JO1H 5LGHH 4IOSD 3VFSA 4JFHD 1F58L 1ZT1A 5KS9A 4GW4A 4HBQA 2OP4L 3MNZA 4P3DA 5I17B 5GGVY 1ZSDB 1L4IA 1N64L 4G8IA 4P4KC 5E8OA 4R4FH 3QFJD 3SN6N 3B6SA 4F57H 4XWGL 5E8NB 4JB9H 3MA7A 4RRPG 2YUZA 4KQ3L 3DLQR 5IVZA 3REVB 3EJZC 4J4PA 3V0AC 1UWEL 1NAKH 1HWHB 5D5MA 1WT5C 4MLIA 1T20B 5F6IB 3V4UH 2C1PB 2YRLA 5C0DB 1F4YH 4UT9H 3BHBA 5K33A 1H8SA 1IGMH 3IDJB 4ODVL 2AP2A 3RWJB 4AK1A 4WEBH 4ZNEA 1JBJA 5BV7H 5ID0B 3MBEB 3DV6A 3FQRB 1ZHKA 5ITFB 2P47B 1JMXA 4JPKH 1DQJA 4XNZC 4NQCE 5DGRA 1KXTB 1RIHL 5EU6D 1I7TA 4HQQH 2J6EL 4HIXL 2ZSWB 1EXUA 4GQ9L 5D7SL 3GIZH 1CGVA 4DOHE 4U3HA 1OPGL 1A9BB 3EDDA 5DDHB 1ZVSB 4X9IA 3S3JA 5IFAH 4Z7WF 1G9NC 4PP2B 1MQKH 4HWBA 5D7IE 4M7KL 1NLDH 2WWKO 5JIIA 1NPUA 4XVSL 4PY7B 2PXYA 3FZUC 1KCRH 3PHQB 1ND0A 1PZ5A 4PV9A 3KYMA 4C54A 4F7TB 4OZIF 4LSUL 2R0WH 1JMZA 2PYFB 4UB0H 2JIXB 1DVFD 1PAMA 4HJ0C 5T1KD 1T6VN 2VDNL 4LASL 4PJ5D 5ACLA 3T0EE 4KHXH 2DQCL 5I17A 3MJ8B 1IM3B 1ZSDA 5E2WH 2V7NB 1FPTL 5E8NA 2F9BT 2F8VA 4C4KT 4LEOB 2FYYB 3TNNA 3REVA 1CI5A 4BQBA 3LEXB 1G0DA 2QR0B 1I4FB 4P2RE 2HRLA 3NIFF 1INEH 5AZEH 2ICWI 4GRLB 2ATKB 3GK8H 5JW3H 3GM8A 1DBKL 1CZ8H 1T20A 3D39D 2C1PA 5CEZE 2DL9A 5C0DA 3IDYC 5T5NG 2NTFB 3TIDA 1CWVA 2C9AA 5BVJB 3OGOE 5EIVA 3RWJA 2HAZA 4PBWD 2DBJA 5DLMH 1SJXA 5ID0A 3MBEA 5KVMC 4J7RA 32C2B 5H2BB 1NGWB 3FQRA 1RZFH 3KPRE 2EEDA 5ITFA 1YQ2A 3D85D 1KOAA 2E27L 3QO0B 3HR6A 1YPZF 2ZSWA 5MEPB 5DZNA 5CGYD 1DQLH 4Z9KB 3EZJB 1WICA 2VDOH 2WSKA 3EHBC 5F9AC 3VXUD 1N4XH 1KCVL 1A9BA 3WHE0 4IJ3B 4NWUH 5DDHA 1ZVSA 3WXWH 5I1HH 5LKNA 4C55A 4PP2A 1A7NH 4PY7A 3DYOA 4YC2B 3BKCL 5GS2D 3PHQA 5D1QD 1CGWA 1S5IH 1TIUA 4HW6A 4UU9B 4F7TA 1MLCA 2HLAB 2LQRA 2PYFA 2JIXA 2EO1A 3N85H 2IANA 1HH9B 3HRZA 5C6TH 1LEIB 5DMKB 2RHEA 1ETZB 3EBAA 3G6DL 3ZHDA 3MJ8A 1IM3A 4LSQH 2DQGL 1X4ZA 2FX9L 2V7NA 4Z7WE 4AEFA 2QL1A 4Y7MA 4FFVC 1HOCB 3RQ3A 1A14L 5KANG 5JMRA 3L3HB 4LEOA 2FYYA 5TQ2H 3LKPB 1NC4D 2QR0A 1I4FA 4OZIE 3MBXL 1WSST 4GRLA 2ATKA 4FQ2H 1H8OA 4HUNB 1CF8H 4MHHI 5INCB 5JO5B 5CLTA 2VZUA 3NTCH 2NTFA 5BO1H 4E42B 3JWOC 5HHMD 3W0WB 3PF2A 4AMKL 5BVJA 1G9EA 1HCVA 4W4OA 4L1DA 1MCDA 4AT6A 4Q6YA 32C2A 1NGWA 3C6LB 4OFPA 5CSGA 2XTLA 1CYGA 4U1GB 3QO0A 4N0RA 1T7YA 4K3JH 5MEPA 1NUNB 5F7KC 3GMLB 5HYQB 1RZ7H 2X40A 1K4CB 1JK8B 5F96H 3JBG7 1X5FA 4MXVE 1TQCB 4YDVB 4IMKC 5F6HJ 3O2WL 3DO3A 3B2VH 5C92A 3B9VA 5F7DA 1CBVL 2RGSA 1A1MB 2ZCKH 3H3KA 3G6JF 4UU9A 1TJIH 3G5ZB 3GM0A 1YPZE 3TBSB 1YY9C 2G5BB 3T0AA 1EO8L 4MJ6B 2FCBA 3LEVH 1QLRB 1HH9A 1LEIA 5DMKA 5TF0A 1ETZA 3IT8D 2EE9A 2MCPH 2EDRA 4OLZH 4NNYB 3HG1D 4XBGB 3MUZ1 5GRZA 1HOCA 4XVTH 1J9CT 1SVZA 5EU4B 1KUMA 5IHBA 3ZKSD 3L3HA 1PDKA 3EFDL 4NGHH 5EO0B 3LKPA 4OV6F 4R9HA 1A7BA 4LSPL 2EDYA 3TT1H 4BSWB 4JLRB 3PWPB 3X3GL 4G6JH 3IDXL 5INCA 1G84A 5K9QG 4Z0BL 5JO5A 1X44A 4X6EB 5DF0A 3WD5L 4E42A 3QUXD 3W0WA 4N0CC 1XGPB 4X9GA 1DSFL 1IGYB 2DIJA 1I9JL 4JRYB 5J3HC 2AEPL 1CE1L 1FG2B 2AV1B 1JI1A 5JDJA 1WCQA 3C6LA 3IS0X 4FQHB 5DRZB 4QO1A 1KJMB 3GMLA 5HYQA 2D9CA 1K4CA 1JK8A 3FL7A 5I71B 4L4VD 4RAHA 4YDVA 4HJGB 4S1DD 3ALPA 4X4XB 4LVHB 1YJDL 2Z91B 4OGXL 3RJQB 4KJWD 1X3DA 1A1MA 4GSDH 3MLUL 2X5PA 2Q8BL 1KC5L 2WQRA 1AE6L 1H8NA 1T4KA 3G5ZA 3B2UD 3TBSA 2G5BA 5SX4I 2D7TH 4FQLL 2JJWA 4MJ6A 1QNZL 5MEND 1UVQB 1QVOA 3G6AB 1QLRA 1QFHA 4UDUB 2UVFA 4FMKA 4R90L 4NNYA 4UOW1 4CBPA 1OAYL 1NFDF 4XBGA 1FRGH 1DUYB 4Y5VB 3LDBC 2X9YA 3BVNB 3CSBA 4V1DE 3QIWC 5EU4A 3QP3A 5GGQL 2AS5M 2BRRH 5DFVD 1YMMD 1OLLA 3FFCD 4YBLB 3V6OE 1MIEL 4BSWA 4JLRA 1DCLA 4U3CA 3PWPA 5BS0B 1J5OH 3ZE2F 3H8NA 3QHZH 2MQ3A 3ZLQC 1XH3B 2P8MB 2B20A 1N5AB 2J3SA 4NKQB 1PLGL 4X6EA 1FNLA 2DICA 5HHNB 4AEIL 3ULVE 2B1AL 3V6BR 4F7MB 2P1YA 1XGPA 4OZHF 3L5IA 4L4TE 1FJ1B 2YK1L 1IGYA 4NC1C 2NY3C 4JRYA 1UT9A 3LKNB 1FG2A 2AV1A 3GI8L 5D6DA 4Z7UB 4OFYA 4FQHA 3QAZB 5C0AB 5DRZA 1WISA 1KJMA 1KJ3L 4JFFE 4U2ZA 2LAGB 3RGHA 4HIJB 3O6LL 3H9SD 4AG4H 3R0NA 4BSVB 3TYGL 4HJGA 5DEGA 4WI5A 2DTMH 2XTJB 4X4XA 2X1OA 3R8BB 5I1IL 2AABH 1ZHNA 5FUCC 5EIIB 1CGSL 1T21B 3ROOB 1LDPH 4OLYH 1FBIH 1DE4B 2GJJA 3MGOB 3R1GL 4KI5D 4J3TA 4BZYA 3DX6B 2AJYH 4PB0L 2OTUB 5CEZH 1UVQA 3G6AA 4HC1A 1YEEL 5LBSH 4X6DB 4UDUA 3SGJC 3OAYH 4X5LA 4ZTOL 4Y5VA 2LTQB 4R4BB 4AEHH 1R3HB 2R29L 3BVNA 4XP5H 1LO2L 4OB5H 1FSKC 5FGRA 5BW7C 2OMNA 4JKPH 4LQFL 3FHQA 5CEYB 2VLRD 5BS0A 2AK1L 3O9WB 1XH3A 2P8MA 4G6KH 1ZEAL 2FATH 2NY2D 1FO0H 2BFVH 4YHOH 4Q74A 1LHZA 1NMBH 4F7MA 4LPTA 1NFDE 3QEQB 4OGYH 3SBWC 1WWBX 1JZ2A 1QA9B 1FJ1A 3MV7B 5CKGA 4P3CL 5EA0H 3LKNA 5EWIL 2B1HL 4FQCL 4Z7UA 1NKOA 1U8HB 2YWYA 3P11L 1B88A 5C0AA 2PKDA 5DHVB 5GGTL 4I0PD 1QFWL 3K4AA 4HIJA 1TPXB 3PGCB 2P5ED 3LQAC 4BSVA 3KPPB 5IB1B 4TNWF 4OZHE 2DBLH 1JTPA 1A3RL 1CE6A 1HN1A 2VITB 1T21A 5EIIA 1K4DB 3ROOA 1JPSL 1RUMH 2FNBA 5L2KD 5E99H 1DE4A 3MGOA 3I6LE 1EJ6A 3CAFA 1U91B 3DX6A 5HGAB 2ZJSH 1FZJB 2Y25A 2OTUA 4QXWA 3U36B 5IQ9B 2PTVA 2E7BA 4X6DA 2UYLB 1R3JB 3PHOB 5BRZB 5DJAB 3U30B 1BLNB 4DUVA 3MV8B 4YX2L 2A9MH 4R4BA 3O8XB 1R3HA 4KTEL 4MNQE 4MVBC 1H5BC 3GKWH 4P23B 4YDIH 1HKFA 4GAGL 5KN5B 4M5YH 3VGDA 1OHQA 1UADC 5CEYA 5AWNH 2Y72A 3F7QA 1JNLL 1E4XI 1LO0H 4OFDA 5DFTA 2BSSB 4OFIA 4JPVL 2XZQH 3UBXB 3QEQA 1Q0YL 1SY6L 3GSWB 3VFTB 2E8YA 1UGNA 3T65B 1WFNA 2Q7YB 1QA9A 3MV7A 4NNXA 3BKYH 1YECL 4HKBB 3CVIH 4YFLI 2W60B 5TDOB 2DJUA 1GAFL 2YPLE 4MA8L 1FNFA 1AXTL 1P7KB 3MLYL 4JY6B 1GGUA 5DHVA 3QEHB 4V2CB 2DQDH 2OMBA 1A1NB 1IKFH 1ZVHA 1EZVX 4U33A 5I1LA 3PGCA 3U4AA 4FABL 3HC4L 4G43B 3KPPA 5IB1A 3C60B 1B90A 2AK4B 2R23B 5AG8A 1JN6B 4GO6B 2VITA 1K4DA 3JV6B 1RULL 1EH9A 1JE6A 2CIIB 3UAJD 4G7YL 2W0FA 5SWSB 2VLJE 2PTUA 4YNYB 4GLRH 1NBVH 1U91A 5HGAA 3CDYA 5BJTB 1AR1D 4DW2L 3HMXA 3O2DL 3U36A 5IQ9A 3EOTH 4NZTH 1MFDL 5D93B 3UX9B 2UYLA 1R3JA 4Z7OE 3UJJH 3E1F1 3PHOA 5BRZA 3TN0D 5DJAA 1BLNA 4JFHE 5C0RH 1P6FA 3MV8A 1RZ8B 3Q48A 3O8XA 5ELIA 4NN7C 4R26L 2PCPB 1RZGB 1I7UB 1UM4L 4J6RL 3QFJE 4K2UL 4WHYG 5KN5A 4KKAD 3WDIA 1KNOB 5CSZB 4FQXD 4W6XB 5JUEL 5DD6B 3SE4A 3TH2T 5IW3A 3SKOB 2CLZA 3KPSD 4XT1C 1CFSB 2BSSA 3UBXA 2DN7A 4OF7A 3CXDL 4ALAH 3VFTA 2BJML 3GSWA 4X4ZA 1P7HL 4WI6A 1VACA 4PJXB 2Q7YA 4XX1G 3T65A 1ZXQA 4Z0XB 4KK8C 4HKBA 2R2CA 2W60A 2BK8A 1P9MC 5DRWB 5FDYA 2DIBA 4XCFL 1P7KA 3RL1B 1NCUA 1PY4A 4JY6A 1G6RH 1MCNA 3QEHA 5GHWH 3RVTC 5IWLA 4JDVB 1A1NA 2OL3H 2A38A 2V5SA 3RWEB 5EU6E 1AXIB 2NX5B 3BQUB 4G43A 3UTZB 5BV7C 4NT6B 4JAMB 2AK4A 4DCQB 3QUZD 4WWKA 3AS0A 4KZDH 4NO0D 4OCWL 1NBZB 3JV6A 2MHAB 1EZVY 4LLQB 2CIIA 5SWSA 1YEHL 4YNYA 3RIFF 2A74B 4OBSA 1QRNB 1UZ8A 5BJTA 5HDOA 4Q9CA 1EVTC 3ARFD 1MY5A 2CIKB 2ZUQB 3TVMB 1NCAH 4PUBH 4NKOB 1F4XH 5AG9A 4G42B 4PLKC 4HEME 4PJ5E 1RZ8A 3ZO0A 5DRNB 1JHTB 1ZA6B 1BD2B 1AQKH 2DM4A 2G75A 2PCPA 1RZGA 5D7JD 5JTWA 4MNGB 4NM8H 4R96B 3BT2L 1EEYB 5C0ND 4Y16C 1KNOA 5CSZA 4UT6L 3WN5C 4FQJL 5FO7B 5D2LB 3GI9H 5DD6A 4M6OH 4LPUA 4OCYL 5DMGD 2QADC 4ZDHB 3HNVH 3MXWL 1CFSA 3RDTB 4YHNB 3D39E 4FG6D 4PJXA 3LKSB 4Z0XA 1YEGL 3BAEL 1J1PH 4WJ5B 2IFFL 1NLBL 4KJPC 3PL6D 4R0LB 1EMTH 3RL1A 2AERT 3EYUL 4M00A 4JHZA 3GEWB 3VWJB 2CRYA 4JDVA 1QYGH 4NIKB 2YPKB 3RWEA 1A5FL 1U3JA 4O5LL 2NX5A 3BQUA 3UTZA 5FYLE 1GOHA 4NT6A 4JAMA 4DCQA 2B39A 4U1LB 3VXUE 1OL0A 3CMOH 1NBZA 2MHAA 1KIRA 4LLQA 4U05A 5DFVC 1KG0B 5C09D 2DQJL 2A74A 3C6SB 4KK5D 5I9QB 4OBRA 4AQOA 3DNKA 1KCLA 1QSED 5T3ZD 1IBGH 2CIKA 3TVMA 3NCEB 1YEJL 4M6NL 4NKOA 5ADPH 4B7LA 3Q5YA 4G42A 3KJ4C 2A83B 5DRNA 3TA3C 3QRGH 3IAGC 1JHTA 1ZA6A 1BD2A 4MNGA 2IAMB 4R96A 1IQWL 1EEYA 4PJAE 1J10A 1FYTB 1KV3A 2AJZA 3TO4C 5FO7A 5D2LA 2WK2A 4JGMA 4HUXB 1EFXA 1E6JH 1WTLA 2F58L 1IEBB 1NCNA 1T3FB 2DLHA 2VDPL 5TDPB 1CQYA 4OCSL 4ZDHA 4YFDB 3RDTA 4YHNA 2A77H 4JZOB 5L8JB 5HHOB 2G60L 4HGMA 2NY0B 3V4PL 5HHME 4LCCC 5EZOH 5D96C 4BUHA 4WJ5A 4AIZB 4GBXC 3NA9H 2WWMC 5EB9A 4R0LA 4U7KA 2XYCA 1JZ5A 3N06B 3VWJA 2HTKC 5TQ0L 2A73B 2YPKA 4YHPB 1NC2D 4BELD 1HE7A 2GTWB 3L3KB 1JRHI 2GJ6B 5DD1H 2AAVA 1GGBH 2BNQB 2Y7QB 4U1LA 1PSKL 3VWKB 4P4RB 4PRNB 5CCKL 3ARGD 5IEKA 4N8PA 4G9DB 3QIUD 4Y4HC 4X6FB 4LU5L 5ALCL 3WFEH 2NZ9C 2DM7A 3C6SA 1JHLL 3MLWH 3WO4B 2EDLA 1R5IB 4OUUB 2WWKT 4F37F 3OGCB 4RFNB 1NMCB 4UOJA 3OKDB 1JGUH 4PRAB 4JFPB 4MDJB 3BE1L 3L3IB 4JFED 2A83A 4LRIA 4GAJL 2J8UE 1IL1B 4A6YB 3HG1E 1GH7A 2IAMA 4NN5B 4PG2A 4PS4L 3AU1B 2B0SH 5E9DD 5SWZB 4K8RH 4LMQI 4JM2F 3DRTB 1FYTA 4HHAB 4KUZL 4NCC2 1RFDH 5TFSL 5F9OH 4HUXA 4X5WB 3HZYB 3KS0H 1IEBA 5TDPA 1T3FA 2ZUXA 1WFUA 2AI0L 3AC0A 5CAYB 3TT3H 4JZOA 5HHOA 4U0RC 2R4RH 5DO2C 2MNUA 2EH7H 3I02B 3CX5K 1MPAL 4ZAKD 3KAAA 2EICA 5DUML 1JPFB 1WITA 3IJHB 4AIZA 5GS0L 5I2IB 4YFEA 4P5KB 3EO9H 4WHCA 4HKZB 2J5LC 4YXKL 1RUQL 5FA4B 3MLSH 3S9DB 3Q6GL 1YEFH 1MF2H 1CVSC 2A73A 5KVEL 1QBAA 1DN2A 4KI5F 5F7HA 1ADQA 2GTWA 3L3KA 3L95B 3P3YA 1OB1B 4HXAH 2GJ6A 3RTQD 3HZMB 4P99A 5IQ7H 1X5AA 1JTTA 2Y7QA 4N0FB 1NSNL 1JZ6A 4JY4B 3VWKA 4L4VE 3HKFA 3ECBB 4PRNA 2L0DA 2KBGA 1A6PA 3RVXD 4G9DA 4OQTL 4X6FA 1MRCL 2VMFA 1BPVA 1B4RA 1NAMB 4EBQL 4IHOB 1O7SA 2AQ2A 1R5IA 4OUUA 4D3CH 5C7XL 3V7MA 3OGCA 4Z7UF 3PDGA 1INDL 1WAAE 3RPIB 4ESKA 3OKDA 5MENE 4PRAA 3GGWB 2EDXA 4JFPA 4MDJA 2O61B 3L3IA 3KJ6L 4Y1AD 4LCUB 1OP9A 3SQOL 4JPIA 5FGCB 2XKSA 1LMKA 1IL1A 1OD7A 3RUGE 1UQSB 2VSCA 5SX5K 4HWBH 1QRKA 5IESL 5SWZA 2VOTA 3DRTA 3DSFL 4HHAA 5IHLB 1BOGB 4ZS7L 1YMME 4X5WA 2OLDA 3HZYA 3FFCE 1MFCL 2BOBB 3BP7B 3RZWA 5ESQB 4HH8A 2VRAA 4U6VL 4QTIH 4XAWH 1Y6MR 3V6ZB 2HLFC 4X9BA 3I02A 5DJZB 1HIML 1JPFA 3IJHA 1AKJB 2NY6C 1BZQK 3BN9C 4P5KA 5EZLB 4HKZA 2I9TB 3CFEB 3L3DB 4KGJA 5DJDB 5FA4A 4JHAL 1D9KC 3WNMA 5L6YL 3SGEH 3L1OL 3L95A 2YOCA 1OB1A 3O6FC 4ODSL 4JHWL 3HZMA 2JB5L 4MSWB 4NNPL 4N0FA 4Z7VF 4JY4A 3D25B 3H9SE 1MRDH 3ECBA 3KYKH 4HBCH 4PJ8C 5J89A 3T2NL 4Z5RB 4L8DB 3BJLA 1G1CA 1QSFD 2IBGA 4PTUB 3C2AH 4LSVL 4TSCL 2A9NH 4ODHH 5BCAA 2VR5A 1B9ZA 1NAMA 4IHOA 5LCVH 4KI5E 4MD4B 4X4MA 5ISZD 3V7AG 4DKFL 1WWAX 3S36X 3RPIA 4R4ND 4G9FD 3GGWA 4KWUA 6FABL 2O61A 3QJHB 1OD9A 5I76A 4LCUA 4FZEH 1X5ZA 3DVNB 1UQSA 2ADJB 2DMBA 5F88B 5H37G 3TZVB 4GXUN 1P4IH 2A1WL 5T1MB 1CGUA 1T2JA 5FCUH 1II4E 1BOGA 3BPNC 2Z92B 4HWNA 3Q2CA 3G5YB 2DKSA 2BOBA 3BP7A 2ADFH 3HHRB 1A6ZB 3KYNB 5DJYB 5ESQA 5FYLH 5I8OH 3CNKA 3QDJD 5DXWA 1M7IB 1L9NA 3BRDA 1W8OA 5E6IC 1IAIM 1AP2B 1TQBB 3C9NA 4K55A 5DJZA 4QRTB 4OCRL 2X2YA 3RVUC 5GS2H 1AKJA 4OCLC 1N8ZB 5I74C 2I9TA 3CFEA 3L3DA 2YXFA 5DJDA 3PNWB 2E6JA 1EJOL 4XHQA 2R56H 1H3VA 3KPOB 4NQTA 2X6MA 1N0XH 5D7KD 4JVPA 3S88H 5HVHB 2FEEI 4MSWA 4WW2F 3WNPA 4LAJH 5GRUH 3U9PL 1NUDA 3D25A 1DBBL 2P5EE 5C0FB 5IFJB 1OF2B 1DQMH 4JDTL 5I75C 4Z5RA 4L8DA 2Z31C 3Q1SL 2VYRE 4PTUA 2ZCHH 4JRWA 5L2KE 4MD4A 3V52L 1LVEA 1B6DA 4F58L 4MCYB 2CO7B 4M7LL 2D0FA 3MYJB 3QJHA 4Z7VE 4GW5B 3HR5B 3KR3L 4POZD 5ICYB 5DJXB 3DVNA 1CXKA 2ADJA 5F88A 4QKXB 3TZVA 3EW3B 4U0QB 4FXLA 4J4PD 3B3IB 1TLKA 2PETA 3VI4F 1MCWM 2AEWA 1GGCH 2Z92A 1DANT 3G5YA 2LVCA 5DJYA 1A6ZA 3KYNA 5GGVH 1RZJL 1M1SA 1M7IA 2EIZB 7FABL 2CUHA 2VTFA 3WEXB 3LKRB 1KBGL 2PR4H 1RMFH 3A67H 4IIQA 1F2QA 3INUL 5FUZH 3QIBC 2EYRB 4QRTA 4WTXA 3RJDA 3SDXF 4DGIH 3KS0J 1A7OH 4X4YB 3QHTC 3VXNB 3QCUH 5KAQG 1RZIB 5I6XB 5DR5H 1N8ZA 4XZUB 3PNWA 4RAVB 1YYMH 4TUKL 5CD5C 3RBGA 1HKLH 3UTSB 3CZJA 4DQOH 3KPOA 2KH2B 1LILA 4MAYC 4LSSL 2IMMA 2HFGH 4HZAA 5J13B 5GZOC 2Q8AH 3IFOB 4MJ2A 4HWUA 5C0FA 5IFJA 1OF2A 4F9LA 5C6PB 4PLJD 1X6NA 4EUPA 3MGTB 4C58B 1OP3K 4LLDB 1FE8L 1UXSB 1TZGH 1DZBA 5B3JF 4I8DA 5JIPA 5GJSL 4MCYA 4DK6A 2CGRH 3MYJA 1OTSC 4XNYH 4JO2L 1BQSA 4GW5A 3HR5A 1G9MH 2QSQA 5ICYA 5DJXA 1QSVA 1ZWIB 4L3CB 1HNFA 1N5YL 1FVEB 4EXKA 3B3IA 4UT7L 3JXAA 4L9LC 1L0YA 2FHCA 3CX2A 4BK4A 1IC4L 3S34L 4JY5L 1FAIL 2EIZA 3UC0H 3WEXA 3LKRA 1T1ZB 5GGSY 3PP4L 3KPSE 2EYRA 2X10A 2CRIA 5EZIL 5B3NA 1R3LB 1FIGH 4X4YA 1W72L 4UILL 3VXNA 3CXHJ 5GSRB 1MJ7L 1RZIA 4L29B 4XZUA 5SX4H 3SHSA 4L8SB 3VI4E 1R24B 4RAVA 2AEQH 4G6AD 3UTSA 4J2XA 3GNML 1AO7D 2ZZUT 1CFVH 4IRSC 4JFXB 1IGJB 5GGTA 5JMOC 1A6WL 3SCMD 4PYGA 2OSLB 5JZ7C 2ERJB 5HHXH 4NZRL 3SDXE 4QCIB 2CR3A 3TWCH 3T1FB 1KN2H 3ET9F 3ZHKA 2WP3T 3MGTA 4TSAH 2H2PC 5D1XC 1UJTA 4OF3A 1BM3H 4LLDA 3E3QC 4HXBH 1C1EL 1UXSA 4NBZB 5D1ZD 3A6BL 5F7EH 3BWAB 4LAQL 1H3TA 2W9DL 4KMTH 2BZDA 2ICWJ 4F2MA 5BMFH 1JVKA 3JWDH 4OIAA 4M8VA 2QSCH 5L88L 1FNAA 1ZWIA 4L3CA 1YN7B 4Z8FH 1FVEA 2FHBA 1TJHL 2EIDA 3UYRL 3ARDB 1XF1A 2E9IA 4P4KB 2NXZD 5I15H 2WLYA 2VB5A 4GRLD 3FO1B 2HMID 9CGTA 1JGEB 4XI5C 4LSTL 1T1ZA 2YSSB 4Y89A 2A0LC 2FJGB 4L1HA 3PG2A 1SYSB 4H5SB 1RVFL 2E7LA 2LU7A 1R3LA 4WUUB 1PG7X 1UXWB 4ODBD 3C08L 1UCTA 4QRPD 5GSRA 4LLUB 4L29A 2UVEA 2WAHA 1IGCH 4L8SA 4EN3D 1R24A 5J6GB 4KKNA 4YHZL 2WANA 1IGIL 1YEKL 5LGKA 2NCMA 4JFXA 1IGJA 5HVFB 3QJFB 5AEAA 5T1LB 2MPAH 4XNZB 2VSDA 2OSLA 4XPAH 4KKCD 4Q6IB 4QOKB 3T3PF 4QCIA 1G7QB 4WU7B 5HVWA 5CHNB 4MXQD 2OJZH 1MREH 2OM5A 2BXYA 4PGEB 3T1FA 1CFBA 1KELL 1U8KB 2YD4A 1UYWH 5EC2B 2BXZA 3TGXA 2X4SB 5C0GB 4OM1H 3O2DA 1FNSL 2VDRH 1ZVYA 3BWAA 4MMXC 1Z9LA 1QSEE 5T3ZE 5IG7A 1IILE 2NXYD 3OX8B 5DVMA 4M1CC 1YN7A 3RWGB 5IHUH 4M6ML 1C5BH 4PD4K 4EQ3A 1U6AL 3ARDA 5TF1L 4P4KA 4TTDC 2DD8H 4HEPG 3P2TA 2NY5C 1KTLB 3T77B 5A2IH 1YEDB 3GSUB 4H25A 3UXFA 1JGEA 1WZ1H 2OK0L 3O6MH 4NFDA 4H8WH 4D9RD 3GO1H 2YSSA 4EIGB 2FJGA 1SYSA 2NY4B 2L7UA 4H5SA 1HQRB 4WUUA 2O5YH 5CINL 4I18B 1UXWA 3DUSB 4R2GC 5DVOA 4NQDB 4DKAA 1YEIL 2GQHA 2CH8A 4LLUA 4X7DC 3C6LD 3T1WA 1ZHBB 1FG9C 1QBLL 5J6GA 4X7EC 1YYLL 2EZ0D 4YXHH 3B5HA 1ZOXA 4GKNB 5SV4A 1VHPA 1OT1A 3I84A 5T1LA 3BH8B 5F72S 3LKQA 2AXGB 4Q6IA