3V4QA

Structure of r335w mutant of human lamin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
74
structure length
74
Chain Sequence
LAAKEAKLRDLEDSLARERDTSWRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prelamin-A/C
publication title Structures of the lamin A/C R335W and E347K mutants: Implications for dilated cardiolaminopathies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 32
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v4qA00
3HE5B 1H88A 1CSBA 3L37A 1CI6A 1MFZA 4HYTB 3VTPC 1MV8A 1CI6B 5CMZA 1MUUA 4I2LC 2WT7A 2P7JA 4DZOA 4I6MC 3M06A 3HE4A 2WT7B 4AQRD 2Z5HA 3B8EB 3HE4B 1GTWA 2W6AA 1GK6A 5AW4B 1FOSE 3LIDA 5AVRB 2E43A 4JYBA 2R5DA 4C46A 3L35A 5AW1B 1JUNA 2Q7CA 5AVUB 1SLQA 3M0AA 5AVYB 3VMZA 5AVXB 3M9HA 3O8ZA 3V4QA 3NFQA 4C7NA 5AVSB 2YNYA 3OAKA 3M9BA 2W27A 3V4WA 5AVTB 4C7NB 3LIEA 1CZQA 3V5BA 5AW0B 3A3YB 2JJLA 2R32A 1GD2E 2BASA 5AW9B 2ZXEB 5APSA 1YYCA 3A5TA 5AW6B 3M91A 4EOTA 1HBWA 3P7KA 1HWTC 2R3CA 2QM7A 2WPSA 3I5CA 2WPQA 4KHXA 4GT1A 2XV5A 1S9KD 3VN0A 2YO3A 1FOSF 2E42A 5AVVB 2WWWA 3KDPB 4B86A 2N9BA 3NXSA 1JNMA 4GKGA 1KQLA 5APXA 3TYYA 1NWQA 2QM8A 5AW8B 2WTYA 4AYCA 3A2AA 2IPPA 3M0DA 2KP8A 3SWFA 1OXZA 4LC1A 5APUA 1HUCA 3UIAA 5APVA 3TNUA 5AVWB 3TNUB 3L36A 5APTA 2H7HA 4XE5B 5AW5B 2R5BA 5AVZB 1H8AA 1X8YA 1J2JB 3P32A 1A02J 2XU6A 1DH3A 2Z5IA 5AW3B 2YO2A 3KQGA 2P67A 2XZRA 1GU4A 4AUWA 2Q3IA 2C9LY 2VRSA 5AW7B 2C9NY 1SP4A 3IR9A 2P2UA 3TK1A 1H89A 3MGNA 3MD0A 1GU5A 1HJBA 5AVQB 1NAFA 1A02F 1GZLA 5APQA 1G2CB 1T2KD 4RESB 2Q5UA 3VMYA 3NTNA 5AW2B 3HTKA 5APWA 2ZFCA 4JYCA 3T97A 1T2KC 3VMXA 1S9KE 3P8MC 1FAVA 2WPRA 1IO4A 3VYIA 1GK4A 1OWAA 3A7OA 3HE5A 4M3LA 3NMDA 5APYA
chains in the Genus database with same CATH superfamily
2IDBA 2WT7A 3L74J 3AE1C 2QEXP 1KZUB 5KAFE 2R5DA 1QVGO 2HPCA 1CW5A 1J1DB 5AVYB 1N7SD 2E74B 4C7NA 2Q3EA 2W6JH 2FKWB 3M9BA 5EFWB 1VQ8P 3LIEA 1JO5A 5AW0B 1OVRA 4YXDC 4ZKPA 5AW9B 1IK7A 5AW6B 1WT6A 1VF5B 3I5CA 4KHXA 2OYIC 2YO3A 2LR2A 2FYNC 1JEKA 3B5NC 1BGYE 1K8AQ 2WSEJ 4WY4A 1KTMA 1VQKP 1SQXE 3O6QB 3MD0A 2IX7C 4BRYB 4RESB 2NPSD 1SFCC 3PHLA 1AJYA 2XNXA 3L75G 3G71P 3S1KA 4IFFA 1S72P 1S5LX 1MFTA 1MUUA 2H43A 5KLIB 3HE4A 1GMJA 1BE3E 1RF1C 2WPVB 3L74E 1RF0A 3H1JG 1AV1A 1YHQP 1ZOYC 3AEAC 4H13C 2FYUD 2QG4A 2JDIH 1L4AC 2J59M 3V5BA 4N6JA 3GLMA 5TISE 3B5NB 3CI9A 2QM7A 2ZYDA 3CCLP 3RL0D 2N9BA 1KQLA 2P58A 4RO0A 1SQVD 2FXOA 2QJPB 1OW6A 3D6ZA 3A2AA 4JQ0D 1IFNA 3M0DA 4U7JA 1EZVI 1HUCA 5TJHA 3TNUA 1KB9I 3MZWB 5AVWB 4PD4I 2N9YB 2Q6QA 3FX0A 1K05A 3HUSB 1Y9BA 1DEEG 1LJ2A 3FWNA 3ABVC 1JY3N 4IL6E 1BSHA 1SP4A 5CCGC 1HJBA 1RY3A 1GZLA 3AEGC 2KI7B 2ZYAA 2OYHA 3L71G 3GHGB 4H44D 2FYUJ 3LW5J 3P8MC 1NTZD 3A7OA 3Q1MA 1PV3A 3OA7A 2D2CD 3CX5E 4IFMA 2KOGA 2Y0DA 1FS0E 1L0NJ 2Y9YA 3M06A 2E5YA 1IFMA 2JO1A 1JCCA 1GTWA 2A06G 3W68A 2E43A 1Y8AA 1PP9E 2NPSC 5AVUB 1SLQA 1LGHB 3E7KA 5B66E 3L70E 3V4QA 2B88A 1PGJA 1GD2E 1T6AA 2K37A 1NU1G 3Q5RA 3L72J 3P7KA 3H1HJ 4L74A 1SQPE 2XV5A 2O01J 1Z56A 4GKGA 1OW7A 3TDKA 3FXDA 2O1JA 4OGQC 3L4FA 3L36A 1M1JA 3L73G 1GL2B 1J2JB 1FDOA 2WVRA 3CCMP 2OGUA 2YO2A 4DT0A 1NOHA 1WRGA 2P2UA 1RH5B 1QLED 1PPJG 3IFMA 3CL3D 4TT3H 2IFMA 1M7LA 1SQQD 3JSVC 3HE5A 2AEMA 1N73C 1M90Q 4IOIH 1RHZB 2L91A 1JTHB 1CI6B 3H1KG 3R4YA 1KFMA 3IN6A 3B8EB 2K88A 1LWUC 2IYOA 1GK6A 1GW3A 2PFXA 2QJKB 1P84D 1EC5A 1YBKA 5AVXB 1SQBD 1NTKD 4ZMDA 4IL6H 1YJNP 3VP9A 1S3JA 2AXTE 4OGQB 4U3FG 4WVZA 2Y0CA 2E74D 2FXMA 5CCHA 4RJTA 4W80A 1H0TA 3L72E 2BEZF 1NTMK 3H1HE 2B87B 3O6QA 1VF5D 2QM8A 4ASVA 1UIIA 4BRYA 1PFIA 4IFDK 3CX5H 5KTBA 3BRVB 1IK9A 1KILE 1R8EA 4OH8B 1HH0A 4CPGA 1VDFA 2VRSA 3C9IA 1VQ6P 5GTIE 1NU1K 1LT1A 5B66H 1EDJA 5CCHD 2Q5UA 1URQB 1X9VA 2OYIA 3T97A 2XDJA 2K9YA 1SQBJ 3Q3DA 4M3LA 1MFZA 3VTPC 1KILB 4DZOA 3B5NA 2ZAEB 1KV4A 2IBZE 2J5UA 1BGYD 1SQVG 4D6TG 1GW4A 2Q1KA 3KHUA 5AW4B 2B9BA 1SQXD 1BCCG 1R5SA 1L0LG 1FZEA 3Q5PA 3O8ZA 3GF7A 2IZ1A 1M1KQ 1IFPA 2JWAA 1SFCA 1K04A 3CWBG 4MN4C 1FC2C 2CPBA 3N4XA 1YQ3C 1LT9B 3B5ND 5AW8B 2IPPA 5BU5A 2KP8A 4WB4A 3G3ZA 5APUA 5APVA 3RBXA 1BE3D 4YPCA 1RF1A 3L74D 3GMAA 1X79B 1J1DC 3TF5A 2A45H 1DH3A 1XTCC 3AE3C 1AVOA 3H32A 1JOCA 1L4AA 1IC2A 1BGYJ 3CC7P 2PAJA 1KMIZ 4UB6E 2SPZA 3BCCG 1VF5C 1YI2P 1QL1A 2WSSH 1IO4A 3I56P 4PV1B 1JB0J 3NMDA 1H88A 2JWDA 2V7QH 1N7SA 1IFJA 2KIKA 1ZRTE 5KJ7D 3WUUA 4JBZA 5AVRB 3G4SP 1LNQA 2QSIA 2YXRB 5CHXA 2QJYC 4I1LA 1HTLC 2YNYA 3KYQA 2H88C 5CCGA 1BE3J 2R32A 5GTIH 4N78E 3AE2C 2HR3A 5M1BA 3H1LG 3HD7C 2H89C 2MJZA 3L71J 1X22A 2Y0EA 1U7MA 2CK3H 3RL0g 3CX5D 5APXA 1JY2N 1UIXA 3L75E 4AYCA 1SQVK 4N3YB 1QX8A 1SQQG 5KLIC 5BU8B 1FZFA 3RGUA 1S2EA 3KZIE 1L0LK 2NPSA 1OX3A 4R4LA 5CCGD 2FFDC 2JR8A 2P67A 1VQ5P 3USSA 1NAFA 1GL2D 3H1JE 1SQPD 3HTKB 2M5AB 1T2KC 5KKZB 1P84I 1YTZI 4XFJA 2YKPA 3H1IG 2QJPC 3PTZA 5APYA 1K73Q 1NTZK 2QJYB 3FWLA 2BCCG 3WUTA 1RQVA 3HUSC 3CXHE 3HD7B 2KSJA 2K9JB 1NKZB 3L73J 5H2FE 1JY3P 5E79H 3IAOA 3OAKA 2ZT9B 5B5EE 4HB1A 4L75A 3CCQP 1PP9J 1HWTC 1FJPA 4UB6H 3GHGC 3L70J 3MUDC 5KJ7C 3SFEC 2NRGA 1N73A 3ZDMA 4OGQD 3WUVA 1W2BO 2FFDB 3L71E 1VQ7P 1SQPJ 2N1TB 1RE3C 3SWFA 1LWUA 3P8CE 1L0ND 3RK3E 5AVZB 1EZVG 5KLVG 3MP7B 1LP1B 2GUVA 3G6EP 1NO4A 2XZRA 1ZMEC 2A06E 3H6PA 3IR9A 3ITKA 2C0XA 1G2CB 1M56D 1T3UA 3VMAA 3VMYA 5AW2B 1KN7A 2ITAA 2W83C 3E1RA 3VMXA 2WZ7A 3L72D 1WMKA 2W8ZA 3H1HD 3RK3B 1NU1E 2OQQA 1EDKA 1VQMP 1URQD 1SQQK 3TGUG 1FDMA 5CMZA 1T8ZA 2OTLP 1S1CX 1GL2C 1IFDA 3M9QA 1KILD 3KZIH 1VPCA 2HFED 4Y28J 5AVTB 1NTMG 4I7ZB 3L73E 1SQBK 5APSA 2UWJE 2Q9IA 1NGMB 1NTKK 2YMYA 1KYOE 3FXEA 3AEEC 2WPSA 4GIFA 2YKOA 4KJMA 4OVNF 3Q2YA 1LTTC 4B86A 2ZJSE 1PPJE 3TYYA 2HODA 2OTJP 3AEBC 2IBZD 1AA0A 4LC1A 3UIAA 1KQSO 3VP8A 3OW2O 2V7QJ 2QJKC 3F5HA 4D6TJ 1KB9H 4XE5B 1ZN5A 1R5LA 3H1KE 4ZNCA 3CXHH 2Z5IA 5AW3B 3KQGA 4BXLA 1BCCJ 1GU4A 4AUWA 3JCUE 2C9NY 5H2FH 4OWFA 1GU5A 1DEBA 3MHVA 1FZCB 5APQA 2FY8A 1ZXGA 5B5EH 5L8RJ 2ZFCA 2KNCB 2GM4A 1S9KE 3CCUP 3CCRP 1U7JA 4WY4C 3VYIA 1GK4A 4U3FE 1G1JA 1JY3O 4I2LC 1PGPA 2WT7B 2OARA 2Z5HA 1E5WA 4PV1D 5KLVK 1FOSE 4JYBA 2Y9ZA 2PRRA 5CJ4A 1IJDB 4ZKUA 2K1AA 2HPCB 4H0LB 1SQXK 2QRXA 4K35A 4C7NB 3CX5I 4PJ0E 2I1KA 3Q5SA 3VOPA 5DJUB 5CBOA 2BASA 1URQC 4EI2A 2KYVA 1BDCA 3BCCJ 3G9RA 1FOSF 1J1EB 1KQGB 1RF0C 1N8RQ 4IL6X 3B71A 1JNMA 2HLOA 1KILC 1ZRTD 3OJAB 1N2DC 3CCJP 1TU3F 4WY4B 3AE8C 4L76A 2M0BA 4D6TE 1IZNB 3CPWO 2Q3IA 1A02F 4N78D 1BCCE 1L0LE 5C39A 1M57D 4EDFA 1HGVA 1W2EA 2HYNA 1KYOH 1LT9C 2LXBA 1NVOA 3GW6A 3QH9A 2Z4EA 3L75D 3CWBE 3RL0B 2E5TA 2JP3A 4AQRD 2JKVA 4HJGH 2FYUG 3HE4B 4YXWH 1YJWP 3AEFC 3L35A 3SFDC 1EXIA 3AE7C 2Q7CA 3CMAP 4LGDE 2FFDA 2DW3A 2ZVNB 3NFQA 3PP5A 1L0NG 2CPSA 2GA1A 2W27A 1ZR4A 1RE4C 3HD7D 3AEDC 3H1JD 3JCUH 3FGAD 1N7LA 1QL2A 2JEEA 2AXCA 2A45I 2ZT9D 5CJ0A 4PV1C 1NH4A 2E76B 2O3JA 3BCCE 3WMM0 1EDLA 3H1IJ 4QMAA 3C8VA 2BCCJ 2FYZA 1PL5A 4XA4A 3EFFK 3HUSA 1AQTA 1K9MQ 1NKNA 3SWYA 3CXHD 3TNUB 2XNDH 4JPZB 1H8AA 3L75J 2N1TD 3CMEP 1HGZA 2QE7H 2G8YA 3D71A 1NTZG 1SVFA 1T2KD 4PJ0H 3RBZA 3GHGA 3MUDA 5KJ7A 2OYHB 1QVFO 1USDA 5E79E 2ZXXA 2WPRA 2PP6A 4WWIA 2KZJA 2I1JA 1X0TA 1JY2P 3L71D 3H1JJ 4JF7A 3H1LE 4W7YA 1RE3A 2P7JA 2RN0A 3CCSP 4EIJA 1QGKB 3P8CD 3RK3D 2W6BA 3AE5C 1VQPP 2WITA 1SQQE 1KFNA 1VQLP 2KSEA 1YIJP 2A06D 3V4WA 3GF3A 1S5LE 3PH0A 1L2PA 1KC8Q 1OW8A 2KK7A 2G3AA 5DJTB 4EOTA 1FZGA 2IBZI 1ZLLA 5KKZC 3PLNA 2O1KA 1ZR2A 1NU1D 2OYOA 4Y99B 1NWQA 1MZ9A 2FYUK 2E75C 3RK2C 1OXZA 3CC2P 2R44A 2KLVA 4WBAA 2RMZA 3EQ2A 3H1IE 4GOFA 1GL2A 2BCCE 1LTJC 3P32A 1L0NK 3EWKA 2ZT9C 2YMKA 3L73D 1KORA 1OMIA 1NTMJ 1KYOD 4JYCA 3HRNA 3F89A 1NYHA 1PP9D 5KAIE 2M8RA 1HJ0A 3V6IA 1OWAA 1PPJD 3L70D 3U1CA 2V4HA 3HE5B 1JTHA 1CI6A 2N1TC 3AE4C 3PRJA 1DX7A 1SQBG 1NU1J 1NTKG 3H1KD 2IFNA 3WU2E 3M9HA 2KS1B 5AVSB 3U59A 1LTSC 2KB7P 1LTGC 2E75B 4HKZH 2RH0A 1EZVE 5KLVE 1YYCA 3A5TA 1KB9E 3RK2B 4PD4E 1PGQA 4EYYQ 4H0LD 1S9KD 3AECC 1LTJB 2WWWA 2P10A 3KDPB 2B87A 1H0TB 3RK3C 4U3FD 1NJIQ 1W5CE 1Q82Q 3AE6C 1GDTA 1RQUA 2QIWA 4UB8E 3H25A 1JCDA 2YIUC 2R3SA 3IF4A 1M8OB 3TGUE 4GOEA 3D70A 2J58A 1X8YA 1EDIA 2C9LY 5AW7B 1JY2O 4I7ZC 4BWNA 1URQA 1T3JA 2IZ0A 4W7ZA 1JM0A 1HF9A 3MTUE 1S5LH 3H1KJ 2ZYGA 4WY4D 1D7MA 2AEFA 2OYIB 2QA4P 3T97B 1ZP0C 2O01N 1NTME 1PIXA 1P84H 3BVHA 1Q86Q 1BGYG 3BATA 1KILA 3A0BE 3C1LA 2FYNB 1OVUA 3PJSK 3V2NA 1SQXG 1VL2A 4U3FJ 3V2PA 3BASA 3S9OA 4D6TD 2NZ2A 1KQFB 4DJGA 4DOJA 3CLQA 2KXPB 1CZQA 1N7SC 3JC22 1FZCC 1BCCD 1L0LD 2HG5D 2WSCJ 3M91A 2YIUB 1SFCB 1HBWA 3V2QA 3CXHI 2XKMA 1LT9A 5KAFH 5KAIH 1BE3G 2MKVA 3CWBD 5GTHE 3L74G 1LTBC 1FZAA 1AFOA 4RKUJ 2KUBA 2FBWC 2E76D 2H7HA 1RF1B 3R2PA 2R5BA 1MKMA 2WSFH 1A02J 4H0LC 4H13B 2LKMA 4HH2A 1RE4A 3H32B 3WU2H 1L4AB 3TK1A 4L73A 5AVQB 1VQ9P 1QEXA 3AE9C 1Q90D 1FJKA 2AEJA 1SQVJ 1J1EC 1S4XA 4PD4H 1U57A 1FAVA 2KZIA 1YTZT 3EFGA 3BCCD 2M3EA 1LTAC 3L37A 1L0LJ 1N7SB 1E79H 2WQYC 1Q81Q 3A0HE 2FXPA 3LIDA 4UB8H 5BVZA 4C46A 5AW1B 3CWBJ 3M0AA 2IYPA 1Q2NA 1JMBA 3KXDA 3A3YB 2OTKE 2L5GB 1NTZJ 1NAYA 2R3CA 2WPQA 2GUSA 3GG2A 5AVVB 1SS1A 1FU1A 3H1LD 1N86A 3RL0C 2WTYA 1PP9G 2WMMA 3A0BH 3II6A 3CCVP 3L70G 2P1JA 1KYOI 4DCKA 1OIPA 5K5GB 5TISH 2POHA 1AVYA 2M3BA 2W90A 2NPSB 2XU6A 3V2RA 4C7RA 2QVAA 1SQPG 2FYUE 1H89A 4NPEA 1YJ9P 1JMMA 3HTKA 5APWA 2M5AA 5CBNA 1L0NE 1IFIA 3SWKA 1EXJA 4GODA 2KS1A 2E76C 1PZQA 4H44C 2KLUA 1PGOA 1SQVE 1CSBA 4HYTB 1ZV8A 3I55P 3M0DC 3S4RA 5GTHH 2D2CC 2WSEH 1EQ7A 2H8PD 3H1ID 2W6AA 3HD7A 1AQ5A 2BCCD 1LTJA 4YTPC 2K9JA 2YKQA 3H1LJ 3VMZA 1BDDA 4GDOA 1DIPA 1OZHA 1USEA 2JJLA 4O9BA 4ASWA 1SQQJ 1XTGB 2OYHC 4GT1A 2K3RA 1DD4A 2E42A 4TLFA 3SSUA 1NTZE 2E75D 4A7PA 1N73B 1Y47A 3N7NA 2A45G 3RK2D 2N1TA 1Q7YQ 1FZBA 1FDIA 1DD3A 1LWUB 1YITP 3TSIA 3A0HH 2BEQD 1LP1A 1NTKJ 3E1IA 4H44B 1LTIC 3CCEP 1G2CA 1EZVD 5KLVD 2LXCB 3L72G 1KB9D 3H1HG 4PD4D 2ZVOB 3NTNA 2D2CB 4R4MA 1HVVA 3U1AA 3VN0A 4Y99C 2WSCH 1VQNP 1MV8A 4K3AA 4I6MC 1G1IA 1FE6A 3TGUD 1YQ4C 3KPEA 3B4SA 1SQPK 1M1JC 1JUNA 1VQ4P 4KT0J 1FBMA 1ZW0A 2WSFJ 3D6YA 1KD1Q 3LW5H 2ZXEB 1VQOP 4NPDA 1BSNA 3BRTB 1NTMD 1OVVA 2C0WA 2E74C 3NXSA 2IBZG 3CD6P 4LLHA 4NPFX 5KLVJ 1SFCD 3MIWA 2RKLA 3W67A 2HODB 1NHLA 1SQXJ 2AXTH 5APTA 2YXQB 2B89A 2PGDA 1P84E 5AW5B 1OFCX 1SQBE 3QWOC 1FZCA 3MGNA 1NTKE 4Z1MH 2O01H 3TGUJ 2KNCA 3CC4P 4H13D 5CCHC 2I8DA 1L4AD 1M1JB 3K5BA
chains in the Genus database with same CATH topology
1MFZA 1JY3O 3VTPC 1KILB 2WT7A 4I2LC 4DZOA 3B5NA 3V2NA 2WT7B 2OARA 2Z5HA 1E5WA 1GW4A 5AW4B 1KZUB 5KLVK 1FOSE 4JYBA 3V2PA 3BASA 5CJ4A 2R5DA 2HPCA 1IJDB 4ZKUA 1CW5A 1J1DB 2HPCB 5AVYB 1N7SD 1FZEA 3O8ZA 4C7NA 1SQXK 2FKWB 3CLQA 4DOJA 3M9BA 4C7NB 3LIEA 1CZQA 1N7SC 1JO5A 5AW0B 2I1KA 3VOPA 1FZCC 4ZKPA 2BASA 5AW9B 1SFCA 1URQC 2HG5D 5AW6B 2KYVA 3M91A 1WT6A 1SFCB 1HBWA 3V2QA 3I5CA 4KHXA 2OYIC 2YO3A 1FOSF 1J1EB 2CPBA 1RF0C 2XKMA 3N4XA 1LT9A 1JNMA 1LT9B 2HLOA 3B5ND 1KILC 5AW8B 1LTBC 1FZAA 1AFOA 2IPPA 5BU5A 2KP8A 4WB4A 3G3ZA 3B5NC 5APUA 5APVA 3OJAB 1RF1A 1N2DC 2H7HA 1X79B 1RF1B 3R2PA 2R5BA 2WSFH 4WY4A 1J1DC 1A02J 2A45H 1DH3A 1XTCC 4WY4B 3H32A 1JOCA 1L4AA 2Q3IA 2LKMA 4HH2A 1RE4A 1IC2A 3H32B 1L4AB 3TK1A 3MD0A 2PAJA 2IX7C 5AVQB 1A02F 4N78D 4RESB 2NPSD 1SFCC 1FJKA 2XNXA 1J1EC 1QL1A 1HGVA 1W2EA 2HYNA 1FAVA 4IFFA 1IO4A 1YTZT 1LT9C 3EFGA 3NMDA 1LTAC 2Z4EA 1H88A 3L37A 3RL0B 1N7SA 1MUUA 1IFJA 1N7SB 2H43A 5KJ7D 3HE4A 4AQRD 3HE4B 3LIDA 5AVRB 1RF1C 5BVZA 4C46A 1RF0A 3L35A 5AW1B 2Q7CA 4LGDE 3M0AA 2FFDA 5CHXA 3NFQA 4I1LA 1HTLC 3PP5A 2YNYA 2CPSA 2W27A 3KYQA 1L4AC 2J59M 5CCGA 1ZR4A 3V5BA 1RE4C 3A3YB 2R32A 4N6JA 3HD7D 2L5GB 4N78E 1N7LA 3B5NB 3CI9A 2R3CA 3HD7C 1QL2A 2QM7A 2WPQA 2JEEA 2A45I 2GUSA 2MJZA 5AVVB 5CJ0A 3RL0D 2N9BA 1NH4A 1KQLA 1FU1A 5APXA 1JY2N 3WMM0 1N86A 3RL0C 2WTYA 4AYCA 3A2AA 1SQVK 1IFNA 3M0DA 4N3YB 2FYZA 3II6A 5BU8B 1FZFA 1HUCA 4XA4A 2P1JA 3TNUA 3HUSA 5AVWB 1NKNA 3SWYA 3TNUB 3HUSB 1L0LK 2POHA 2NPSA 2M3BA 1H8AA 2NPSB 2XU6A 2N1TD 3V2RA 4C7RA 5CCGD 2FFDC 2P67A 1JY3N 1SP4A 1HGZA 1H89A 5CCGC 1HJBA 1NAFA 1RY3A 1GZLA 1T2KD 1SVFA 1JMMA 1GL2D 3HTKA 5APWA 3GHGA 2OYHA 3MUDA 3HTKB 5KJ7A 1T2KC 3GHGB 2OYHB 1IFIA 3P8MC 1YTZI 2WPRA 2PP6A 2I1JA 3A7OA 2YKPA 1JY2P 3OA7A 5APYA 1NTZK 4JF7A 1CSBA 4HYTB 4IFMA 2KOGA 1ZV8A 4W7YA 1RE3A 2P7JA 3M0DC 3M06A 2WSEH 4EIJA 1IFMA 1EQ7A 2H8PD 3P8CD 1GTWA 1JCCA 2W6AA 3HD7A 3RK3D 1AQ5A 3HUSC 1LTJA 2E43A 3HD7B 2W6BA 2WITA 2KSJA 2YKQA 2NPSC 1KFNA 1NKZB 5AVUB 1SLQA 3VMZA 1LGHB 1JY3P 3V4QA 3OAKA 3V4WA 2JJLA 4O9BA 1GD2E 4EOTA 1FZGA 1XTGB 3P7KA 1ZLLA 1HWTC 1FJPA 3GHGC 4GT1A 2XV5A 2OYHC 5KJ7C 2E42A 2O1KA 1ZR2A 1Z56A 1N73A 4GKGA 1N73B 3N7NA 2A45G 3RK2D 2FFDB 4Y99B 1NWQA 2N1TA 1MZ9A 2O1JA 2FYUK 1FZBA 2N1TB 1RE3C 3RK2C 3SWFA 1OXZA 1LWUA 2KLVA 4WBAA 3EQ2A 3L4FA 1LWUB 3P8CE 3L36A 1GL2A 3TSIA 1LTJC 1M1JA 5AVZB 1GL2B 1J2JB 3P32A 1L0NK 2GUVA 2YO2A 1NO4A 3E1IA 2XZRA 1LTIC 1NOHA 3H6PA 1WRGA 3IR9A 2P2UA 1G2CA 2C0XA 1G2CB 1T3UA 3VMYA 3NTNA 5AW2B 3IFMA 4JYCA 3CL3D 3HRNA 3VMXA 2IFMA 2WZ7A 1M7LA 2M8RA 1HVVA 1OWAA 3RK3B 3HE5A 1N73C 3U1CA 3U1AA 3VN0A 1URQD 1SQQK 3HE5B 4Y99C 2WSCH 1JTHA 1CI6A 1FDMA 1MV8A 1JTHB 1CI6B 2N1TC 5CMZA 4I6MC 1T8ZA 1G1IA 1KFMA 1DX7A 3B8EB 1LWUC 1GK6A 1GW3A 3KPEA 1GL2C 1IFDA 3M9QA 1KILD 1SQPK 1M1JC 1JUNA 1VPCA 2IFNA 5AVXB 2HFED 3M9HA 1FBMA 5AVSB 3U59A 5AVTB 1LTSC 2KB7P 1LTGC 1SQBK 3LW5H 2ZXEB 5APSA 3VP9A 1YYCA 2Q9IA 3A5TA 1NTKK 2YMYA 3RK2B 2FXMA 5CCHA 2WPSA 4GIFA 3BRTB 1S9KD 4W80A 2YKOA 2C0WA 1LTJB 2WWWA 1LTTC 3KDPB 4B86A 3NXSA 3RK3C 1NTMK 4LLHA 3TYYA 1SFCD 1GDTA 2HODA 2QM8A 3MIWA 1PFIA 2HODB 4IFDK 1JCDA 1NHLA 4LC1A 3UIAA 3VP8A 5KTBA 5APTA 4XE5B 5AW5B 3BRVB 1IK9A 1ZN5A 2J58A 1X8YA 2Z5IA 5AW3B 4OH8B 1HH0A 1VDFA 3KQGA 1GU4A 4AUWA 2C9LY 2VRSA 5AW7B 3C9IA 2C9NY 1JY2O 1NU1K 1FZCA 3MGNA 1GU5A 1DEBA 1URQA 1T3JA 1FZCB 5APQA 4W7ZA 2O01H 5CCHD 2Q5UA 1URQB 3MTUE 1X9VA 2ZFCA 4WY4D 2OYIA 3T97A 2GM4A 5CCHC 2XDJA 2OYIB 1S9KE 1L4AD 4WY4C 3VYIA 1M1JB 1GK4A 3BVHA 4M3LA 1G1JA 3BATA 1KILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE5 B;  1H88 A;  1CSB A;  3L37 A;  1CI6 A;  1MFZ A;  4HYT B;  3VTP C;  1MV8 A;  1CI6 B;  5CMZ A;  1MUU A;  4I2L C;  2WT7 A;  2P7J A;  4DZO A;  4I6M C;  3M06 A;  3HE4 A;  2WT7 B;  4AQR D;  2Z5H A;  3B8E B;  3HE4 B;  1GTW A;  2W6A A;  1GK6 A;  5AW4 B;  1FOS E;  3LID A;  5AVR B;  2E43 A;  4JYB A;  2R5D A;  4C46 A;  3L35 A;  5AW1 B;  1JUN A;  2Q7C A;  5AVU B;  1SLQ A;  3M0A A;  5AVY B;  3VMZ A;  5AVX B;  3M9H A;  3O8Z A;  3V4Q A;  3NFQ A;  4C7N A;  5AVS B;  2YNY A;  3OAK A;  3M9B A;  2W27 A;  3V4W A;  5AVT B;  4C7N B;  3LIE A;  1CZQ A;  3V5B A;  5AW0 B;  3A3Y B;  2JJL A;  2R32 A;  1GD2 E;  2BAS A;  5AW9 B;  2ZXE B;  5APS A;  1YYC A;  3A5T A;  5AW6 B;  3M91 A;  4EOT A;  1HBW A;  3P7K A;  1HWT C;  2R3C A;  2QM7 A;  2WPS A;  3I5C A;  2WPQ A;  4KHX A;  4GT1 A;  2XV5 A;  1S9K D;  3VN0 A;  2YO3 A;  1FOS F;  2E42 A;  5AVV B;  2WWW A;  3KDP B;  4B86 A;  2N9B A;  3NXS A;  1JNM A;  4GKG A;  1KQL A;  5APX A;  3TYY A;  1NWQ A;  2QM8 A;  5AW8 B;  2WTY A;  4AYC A;  3A2A A;  2IPP A;  3M0D A;  2KP8 A;  3SWF A;  1OXZ A;  4LC1 A;  5APU A;  1HUC A;  3UIA A;  5APV A;  3TNU A;  5AVW B;  3TNU B;  3L36 A;  5APT A;  2H7H A;  4XE5 B;  5AW5 B;  2R5B A;  5AVZ B;  1H8A A;  1X8Y A;  1J2J B;  3P32 A;  1A02 J;  2XU6 A;  1DH3 A;  2Z5I A;  5AW3 B;  2YO2 A;  3KQG A;  2P67 A;  2XZR A;  1GU4 A;  4AUW A;  2Q3I A;  2C9L Y;  2VRS A;  5AW7 B;  2C9N Y;  1SP4 A;  3IR9 A;  2P2U A;  3TK1 A;  1H89 A;  3MGN A;  3MD0 A;  1GU5 A;  1HJB A;  5AVQ B;  1NAF A;  1A02 F;  1GZL A;  5APQ A;  1G2C B;  1T2K D;  4RES B;  2Q5U A;  3VMY A;  3NTN A;  5AW2 B;  3HTK A;  5APW A;  2ZFC A;  4JYC A;  3T97 A;  1T2K C;  3VMX A;  1S9K E;  3P8M C;  1FAV A;  2WPR A;  1IO4 A;  3VYI A;  1GK4 A;  1OWA A;  3A7O A;  3HE5 A;  4M3L A;  3NMD A;  5APY A; 
#chains in the Genus database with same CATH topology
 2IDB A;  2WT7 A;  3L74 J;  3AE1 C;  2QEX P;  1KZU B;  5KAF E;  2R5D A;  1QVG O;  2HPC A;  1CW5 A;  1J1D B;  5AVY B;  1N7S D;  2E74 B;  4C7N A;  2Q3E A;  2W6J H;  2FKW B;  3M9B A;  5EFW B;  1VQ8 P;  3LIE A;  1JO5 A;  5AW0 B;  1OVR A;  4YXD C;  4ZKP A;  5AW9 B;  1IK7 A;  5AW6 B;  1WT6 A;  1VF5 B;  3I5C A;  4KHX A;  2OYI C;  2YO3 A;  2LR2 A;  2FYN C;  1JEK A;  3B5N C;  1BGY E;  1K8A Q;  2WSE J;  4WY4 A;  1KTM A;  1VQK P;  1SQX E;  3O6Q B;  3MD0 A;  2IX7 C;  4BRY B;  4RES B;  2NPS D;  1SFC C;  3PHL A;  1AJY A;  2XNX A;  3L75 G;  3G71 P;  3S1K A;  4IFF A;  1S72 P;  1S5L X;  1MFT A;  1MUU A;  2H43 A;  5KLI B;  3HE4 A;  1GMJ A;  1BE3 E;  1RF1 C;  2WPV B;  3L74 E;  1RF0 A;  3H1J G;  1AV1 A;  1YHQ P;  1ZOY C;  3AEA C;  4H13 C;  2FYU D;  2QG4 A;  2JDI H;  1L4A C;  2J59 M;  3V5B A;  4N6J A;  3GLM A;  5TIS E;  3B5N B;  3CI9 A;  2QM7 A;  2ZYD A;  3CCL P;  3RL0 D;  2N9B A;  1KQL A;  2P58 A;  4RO0 A;  1SQV D;  2FXO A;  2QJP B;  1OW6 A;  3D6Z A;  3A2A A;  4JQ0 D;  1IFN A;  3M0D A;  4U7J A;  1EZV I;  1HUC A;  5TJH A;  3TNU A;  1KB9 I;  3MZW B;  5AVW B;  4PD4 I;  2N9Y B;  2Q6Q A;  3FX0 A;  1K05 A;  3HUS B;  1Y9B A;  1DEE G;  1LJ2 A;  3FWN A;  3ABV C;  1JY3 N;  4IL6 E;  1BSH A;  1SP4 A;  5CCG C;  1HJB A;  1RY3 A;  1GZL A;  3AEG C;  2KI7 B;  2ZYA A;  2OYH A;  3L71 G;  3GHG B;  4H44 D;  2FYU J;  3LW5 J;  3P8M C;  1NTZ D;  3A7O A;  3Q1M A;  1PV3 A;  3OA7 A;  2D2C D;  3CX5 E;  4IFM A;  2KOG A;  2Y0D A;  1FS0 E;  1L0N J;  2Y9Y A;  3M06 A;  2E5Y A;  1IFM A;  2JO1 A;  1JCC A;  1GTW A;  2A06 G;  3W68 A;  2E43 A;  1Y8A A;  1PP9 E;  2NPS C;  5AVU B;  1SLQ A;  1LGH B;  3E7K A;  5B66 E;  3L70 E;  3V4Q A;  2B88 A;  1PGJ A;  1GD2 E;  1T6A A;  2K37 A;  1NU1 G;  3Q5R A;  3L72 J;  3P7K A;  3H1H J;  4L74 A;  1SQP E;  2XV5 A;  2O01 J;  1Z56 A;  4GKG A;  1OW7 A;  3TDK A;  3FXD A;  2O1J A;  4OGQ C;  3L4F A;  3L36 A;  1M1J A;  3L73 G;  1GL2 B;  1J2J B;  1FDO A;  2WVR A;  3CCM P;  2OGU A;  2YO2 A;  4DT0 A;  1NOH A;  1WRG A;  2P2U A;  1RH5 B;  1QLE D;  1PPJ G;  3IFM A;  3CL3 D;  4TT3 H;  2IFM A;  1M7L A;  1SQQ D;  3JSV C;  3HE5 A;  2AEM A;  1N73 C;  1M90 Q;  4IOI H;  1RHZ B;  2L91 A;  1JTH B;  1CI6 B;  3H1K G;  3R4Y A;  1KFM A;  3IN6 A;  3B8E B;  2K88 A;  1LWU C;  2IYO A;  1GK6 A;  1GW3 A;  2PFX A;  2QJK B;  1P84 D;  1EC5 A;  1YBK A;  5AVX B;  1SQB D;  1NTK D;  4ZMD A;  4IL6 H;  1YJN P;  3VP9 A;  1S3J A;  2AXT E;  4OGQ B;  4U3F G;  4WVZ A;  2Y0C A;  2E74 D;  2FXM A;  5CCH A;  4RJT A;  4W80 A;  1H0T A;  3L72 E;  2BEZ F;  1NTM K;  3H1H E;  2B87 B;  3O6Q A;  1VF5 D;  2QM8 A;  4ASV A;  1UII A;  4BRY A;  1PFI A;  4IFD K;  3CX5 H;  5KTB A;  3BRV B;  1IK9 A;  1KIL E;  1R8E A;  4OH8 B;  1HH0 A;  4CPG A;  1VDF A;  2VRS A;  3C9I A;  1VQ6 P;  5GTI E;  1NU1 K;  1LT1 A;  5B66 H;  1EDJ A;  5CCH D;  2Q5U A;  1URQ B;  1X9V A;  2OYI A;  3T97 A;  2XDJ A;  2K9Y A;  1SQB J;  3Q3D A;  4M3L A;  1MFZ A;  3VTP C;  1KIL B;  4DZO A;  3B5N A;  2ZAE B;  1KV4 A;  2IBZ E;  2J5U A;  1BGY D;  1SQV G;  4D6T G;  1GW4 A;  2Q1K A;  3KHU A;  5AW4 B;  2B9B A;  1SQX D;  1BCC G;  1R5S A;  1L0L G;  1FZE A;  3Q5P A;  3O8Z A;  3GF7 A;  2IZ1 A;  1M1K Q;  1IFP A;  2JWA A;  1SFC A;  1K04 A;  3CWB G;  4MN4 C;  1FC2 C;  2CPB A;  3N4X A;  1YQ3 C;  1LT9 B;  3B5N D;  5AW8 B;  2IPP A;  5BU5 A;  2KP8 A;  4WB4 A;  3G3Z A;  5APU A;  5APV A;  3RBX A;  1BE3 D;  4YPC A;  1RF1 A;  3L74 D;  3GMA A;  1X79 B;  1J1D C;  3TF5 A;  2A45 H;  1DH3 A;  1XTC C;  3AE3 C;  1AVO A;  3H32 A;  1JOC A;  1L4A A;  1IC2 A;  1BGY J;  3CC7 P;  2PAJ A;  1KMI Z;  4UB6 E;  2SPZ A;  3BCC G;  1VF5 C;  1YI2 P;  1QL1 A;  2WSS H;  1IO4 A;  3I56 P;  4PV1 B;  1JB0 J;  3NMD A;  1H88 A;  2JWD A;  2V7Q H;  1N7S A;  1IFJ A;  2KIK A;  1ZRT E;  5KJ7 D;  3WUU A;  4JBZ A;  5AVR B;  3G4S P;  1LNQ A;  2QSI A;  2YXR B;  5CHX A;  2QJY C;  4I1L A;  1HTL C;  2YNY A;  3KYQ A;  2H88 C;  5CCG A;  1BE3 J;  2R32 A;  5GTI H;  4N78 E;  3AE2 C;  2HR3 A;  5M1B A;  3H1L G;  3HD7 C;  2H89 C;  2MJZ A;  3L71 J;  1X22 A;  2Y0E A;  1U7M A;  2CK3 H;  3RL0 g;  3CX5 D;  5APX A;  1JY2 N;  1UIX A;  3L75 E;  4AYC A;  1SQV K;  4N3Y B;  1QX8 A;  1SQQ G;  5KLI C;  5BU8 B;  1FZF A;  3RGU A;  1S2E A;  3KZI E;  1L0L K;  2NPS A;  1OX3 A;  4R4L A;  5CCG D;  2FFD C;  2JR8 A;  2P67 A;  1VQ5 P;  3USS A;  1NAF A;  1GL2 D;  3H1J E;  1SQP D;  3HTK B;  2M5A B;  1T2K C;  5KKZ B;  1P84 I;  1YTZ I;  4XFJ A;  2YKP A;  3H1I G;  2QJP C;  3PTZ A;  5APY A;  1K73 Q;  1NTZ K;  2QJY B;  3FWL A;  2BCC G;  3WUT A;  1RQV A;  3HUS C;  3CXH E;  3HD7 B;  2KSJ A;  2K9J B;  1NKZ B;  3L73 J;  5H2F E;  1JY3 P;  5E79 H;  3IAO A;  3OAK A;  2ZT9 B;  5B5E E;  4HB1 A;  4L75 A;  3CCQ P;  1PP9 J;  1HWT C;  1FJP A;  4UB6 H;  3GHG C;  3L70 J;  3MUD C;  5KJ7 C;  3SFE C;  2NRG A;  1N73 A;  3ZDM A;  4OGQ D;  3WUV A;  1W2B O;  2FFD B;  3L71 E;  1VQ7 P;  1SQP J;  2N1T B;  1RE3 C;  3SWF A;  1LWU A;  3P8C E;  1L0N D;  3RK3 E;  5AVZ B;  1EZV G;  5KLV G;  3MP7 B;  1LP1 B;  2GUV A;  3G6E P;  1NO4 A;  2XZR A;  1ZME C;  2A06 E;  3H6P A;  3IR9 A;  3ITK A;  2C0X A;  1G2C B;  1M56 D;  1T3U A;  3VMA A;  3VMY A;  5AW2 B;  1KN7 A;  2ITA A;  2W83 C;  3E1R A;  3VMX A;  2WZ7 A;  3L72 D;  1WMK A;  2W8Z A;  3H1H D;  3RK3 B;  1NU1 E;  2OQQ A;  1EDK A;  1VQM P;  1URQ D;  1SQQ K;  3TGU G;  1FDM A;  5CMZ A;  1T8Z A;  2OTL P;  1S1C X;  1GL2 C;  1IFD A;  3M9Q A;  1KIL D;  3KZI H;  1VPC A;  2HFE D;  4Y28 J;  5AVT B;  1NTM G;  4I7Z B;  3L73 E;  1SQB K;  5APS A;  2UWJ E;  2Q9I A;  1NGM B;  1NTK K;  2YMY A;  1KYO E;  3FXE A;  3AEE C;  2WPS A;  4GIF A;  2YKO A;  4KJM A;  4OVN F;  3Q2Y A;  1LTT C;  4B86 A;  2ZJS E;  1PPJ E;  3TYY A;  2HOD A;  2OTJ P;  3AEB C;  2IBZ D;  1AA0 A;  4LC1 A;  3UIA A;  1KQS O;  3VP8 A;  3OW2 O;  2V7Q J;  2QJK C;  3F5H A;  4D6T J;  1KB9 H;  4XE5 B;  1ZN5 A;  1R5L A;  3H1K E;  4ZNC A;  3CXH H;  2Z5I A;  5AW3 B;  3KQG A;  4BXL A;  1BCC J;  1GU4 A;  4AUW A;  3JCU E;  2C9N Y;  5H2F H;  4OWF A;  1GU5 A;  1DEB A;  3MHV A;  1FZC B;  5APQ A;  2FY8 A;  1ZXG A;  5B5E H;  5L8R J;  2ZFC A;  2KNC B;  2GM4 A;  1S9K E;  3CCU P;  3CCR P;  1U7J A;  4WY4 C;  3VYI A;  1GK4 A;  4U3F E;  1G1J A;  1JY3 O;  4I2L C;  1PGP A;  2WT7 B;  2OAR A;  2Z5H A;  1E5W A;  4PV1 D;  5KLV K;  1FOS E;  4JYB A;  2Y9Z A;  2PRR A;  5CJ4 A;  1IJD B;  4ZKU A;  2K1A A;  2HPC B;  4H0L B;  1SQX K;  2QRX A;  4K35 A;  4C7N B;  3CX5 I;  4PJ0 E;  2I1K A;  3Q5S A;  3VOP A;  5DJU B;  5CBO A;  2BAS A;  1URQ C;  4EI2 A;  2KYV A;  1BDC A;  3BCC J;  3G9R A;  1FOS F;  1J1E B;  1KQG B;  1RF0 C;  1N8R Q;  4IL6 X;  3B71 A;  1JNM A;  2HLO A;  1KIL C;  1ZRT D;  3OJA B;  1N2D C;  3CCJ P;  1TU3 F;  4WY4 B;  3AE8 C;  4L76 A;  2M0B A;  4D6T E;  1IZN B;  3CPW O;  2Q3I A;  1A02 F;  4N78 D;  1BCC E;  1L0L E;  5C39 A;  1M57 D;  4EDF A;  1HGV A;  1W2E A;  2HYN A;  1KYO H;  1LT9 C;  2LXB A;  1NVO A;  3GW6 A;  3QH9 A;  2Z4E A;  3L75 D;  3CWB E;  3RL0 B;  2E5T A;  2JP3 A;  4AQR D;  2JKV A;  4HJG H;  2FYU G;  3HE4 B;  4YXW H;  1YJW P;  3AEF C;  3L35 A;  3SFD C;  1EXI A;  3AE7 C;  2Q7C A;  3CMA P;  4LGD E;  2FFD A;  2DW3 A;  2ZVN B;  3NFQ A;  3PP5 A;  1L0N G;  2CPS A;  2GA1 A;  2W27 A;  1ZR4 A;  1RE4 C;  3HD7 D;  3AED C;  3H1J D;  3JCU H;  3FGA D;  1N7L A;  1QL2 A;  2JEE A;  2AXC A;  2A45 I;  2ZT9 D;  5CJ0 A;  4PV1 C;  1NH4 A;  2E76 B;  2O3J A;  3BCC E;  3WMM 0;  1EDL A;  3H1I J;  4QMA A;  3C8V A;  2BCC J;  2FYZ A;  1PL5 A;  4XA4 A;  3EFF K;  3HUS A;  1AQT A;  1K9M Q;  1NKN A;  3SWY A;  3CXH D;  3TNU B;  2XND H;  4JPZ B;  1H8A A;  3L75 J;  2N1T D;  3CME P;  1HGZ A;  2QE7 H;  2G8Y A;  3D71 A;  1NTZ G;  1SVF A;  1T2K D;  4PJ0 H;  3RBZ A;  3GHG A;  3MUD A;  5KJ7 A;  2OYH B;  1QVF O;  1USD A;  5E79 E;  2ZXX A;  2WPR A;  2PP6 A;  4WWI A;  2KZJ A;  2I1J A;  1X0T A;  1JY2 P;  3L71 D;  3H1J J;  4JF7 A;  3H1L E;  4W7Y A;  1RE3 A;  2P7J A;  2RN0 A;  3CCS P;  4EIJ A;  1QGK B;  3P8C D;  3RK3 D;  2W6B A;  3AE5 C;  1VQP P;  2WIT A;  1SQQ E;  1KFN A;  1VQL P;  2KSE A;  1YIJ P;  2A06 D;  3V4W A;  3GF3 A;  1S5L E;  3PH0 A;  1L2P A;  1KC8 Q;  1OW8 A;  2KK7 A;  2G3A A;  5DJT B;  4EOT A;  1FZG A;  2IBZ I;  1ZLL A;  5KKZ C;  3PLN A;  2O1K A;  1ZR2 A;  1NU1 D;  2OYO A;  4Y99 B;  1NWQ A;  1MZ9 A;  2FYU K;  2E75 C;  3RK2 C;  1OXZ A;  3CC2 P;  2R44 A;  2KLV A;  4WBA A;  2RMZ A;  3EQ2 A;  3H1I E;  4GOF A;  1GL2 A;  2BCC E;  1LTJ C;  3P32 A;  1L0N K;  3EWK A;  2ZT9 C;  2YMK A;  3L73 D;  1KOR A;  1OMI A;  1NTM J;  1KYO D;  4JYC A;  3HRN A;  3F89 A;  1NYH A;  1PP9 D;  5KAI E;  2M8R A;  1HJ0 A;  3V6I A;  1OWA A;  1PPJ D;  3L70 D;  3U1C A;  2V4H A;  3HE5 B;  1JTH A;  1CI6 A;  2N1T C;  3AE4 C;  3PRJ A;  1DX7 A;  1SQB G;  1NU1 J;  1NTK G;  3H1K D;  2IFN A;  3WU2 E;  3M9H A;  2KS1 B;  5AVS B;  3U59 A;  1LTS C;  2KB7 P;  1LTG C;  2E75 B;  4HKZ H;  2RH0 A;  1EZV E;  5KLV E;  1YYC A;  3A5T A;  1KB9 E;  3RK2 B;  4PD4 E;  1PGQ A;  4EYY Q;  4H0L D;  1S9K D;  3AEC C;  1LTJ B;  2WWW A;  2P10 A;  3KDP B;  2B87 A;  1H0T B;  3RK3 C;  4U3F D;  1NJI Q;  1W5C E;  1Q82 Q;  3AE6 C;  1GDT A;  1RQU A;  2QIW A;  4UB8 E;  3H25 A;  1JCD A;  2YIU C;  2R3S A;  3IF4 A;  1M8O B;  3TGU E;  4GOE A;  3D70 A;  2J58 A;  1X8Y A;  1EDI A;  2C9L Y;  5AW7 B;  1JY2 O;  4I7Z C;  4BWN A;  1URQ A;  1T3J A;  2IZ0 A;  4W7Z A;  1JM0 A;  1HF9 A;  3MTU E;  1S5L H;  3H1K J;  2ZYG A;  4WY4 D;  1D7M A;  2AEF A;  2OYI B;  2QA4 P;  3T97 B;  1ZP0 C;  2O01 N;  1NTM E;  1PIX A;  1P84 H;  3BVH A;  1Q86 Q;  1BGY G;  3BAT A;  1KIL A;  3A0B E;  3C1L A;  2FYN B;  1OVU A;  3PJS K;  3V2N A;  1SQX G;  1VL2 A;  4U3F J;  3V2P A;  3BAS A;  3S9O A;  4D6T D;  2NZ2 A;  1KQF B;  4DJG A;  4DOJ A;  3CLQ A;  2KXP B;  1CZQ A;  1N7S C;  3JC2 2;  1FZC C;  1BCC D;  1L0L D;  2HG5 D;  2WSC J;  3M91 A;  2YIU B;  1SFC B;  1HBW A;  3V2Q A;  3CXH I;  2XKM A;  1LT9 A;  5KAF H;  5KAI H;  1BE3 G;  2MKV A;  3CWB D;  5GTH E;  3L74 G;  1LTB C;  1FZA A;  1AFO A;  4RKU J;  2KUB A;  2FBW C;  2E76 D;  2H7H A;  1RF1 B;  3R2P A;  2R5B A;  1MKM A;  2WSF H;  1A02 J;  4H0L C;  4H13 B;  2LKM A;  4HH2 A;  1RE4 A;  3H32 B;  3WU2 H;  1L4A B;  3TK1 A;  4L73 A;  5AVQ B;  1VQ9 P;  1QEX A;  3AE9 C;  1Q90 D;  1FJK A;  2AEJ A;  1SQV J;  1J1E C;  1S4X A;  4PD4 H;  1U57 A;  1FAV A;  2KZI A;  1YTZ T;  3EFG A;  3BCC D;  2M3E A;  1LTA C;  3L37 A;  1L0L J;  1N7S B;  1E79 H;  2WQY C;  1Q81 Q;  3A0H E;  2FXP A;  3LID A;  4UB8 H;  5BVZ A;  4C46 A;  5AW1 B;  3CWB J;  3M0A A;  2IYP A;  1Q2N A;  1JMB A;  3KXD A;  3A3Y B;  2OTK E;  2L5G B;  1NTZ J;  1NAY A;  2R3C A;  2WPQ A;  2GUS A;  3GG2 A;  5AVV B;  1SS1 A;  1FU1 A;  3H1L D;  1N86 A;  3RL0 C;  2WTY A;  1PP9 G;  2WMM A;  3A0B H;  3II6 A;  3CCV P;  3L70 G;  2P1J A;  1KYO I;  4DCK A;  1OIP A;  5K5G B;  5TIS H;  2POH A;  1AVY A;  2M3B A;  2W90 A;  2NPS B;  2XU6 A;  3V2R A;  4C7R A;  2QVA A;  1SQP G;  2FYU E;  1H89 A;  4NPE A;  1YJ9 P;  1JMM A;  3HTK A;  5APW A;  2M5A A;  5CBN A;  1L0N E;  1IFI A;  3SWK A;  1EXJ A;  4GOD A;  2KS1 A;  2E76 C;  1PZQ A;  4H44 C;  2KLU A;  1PGO A;  1SQV E;  1CSB A;  4HYT B;  1ZV8 A;  3I55 P;  3M0D C;  3S4R A;  5GTH H;  2D2C C;  2WSE H;  1EQ7 A;  2H8P D;  3H1I D;  2W6A A;  3HD7 A;  1AQ5 A;  2BCC D;  1LTJ A;  4YTP C;  2K9J A;  2YKQ A;  3H1L J;  3VMZ A;  1BDD A;  4GDO A;  1DIP A;  1OZH A;  1USE A;  2JJL A;  4O9B A;  4ASW A;  1SQQ J;  1XTG B;  2OYH C;  4GT1 A;  2K3R A;  1DD4 A;  2E42 A;  4TLF A;  3SSU A;  1NTZ E;  2E75 D;  4A7P A;  1N73 B;  1Y47 A;  3N7N A;  2A45 G;  3RK2 D;  2N1T A;  1Q7Y Q;  1FZB A;  1FDI A;  1DD3 A;  1LWU B;  1YIT P;  3TSI A;  3A0H H;  2BEQ D;  1LP1 A;  1NTK J;  3E1I A;  4H44 B;  1LTI C;  3CCE P;  1G2C A;  1EZV D;  5KLV D;  2LXC B;  3L72 G;  1KB9 D;  3H1H G;  4PD4 D;  2ZVO B;  3NTN A;  2D2C B;  4R4M A;  1HVV A;  3U1A A;  3VN0 A;  4Y99 C;  2WSC H;  1VQN P;  1MV8 A;  4K3A A;  4I6M C;  1G1I A;  1FE6 A;  3TGU D;  1YQ4 C;  3KPE A;  3B4S A;  1SQP K;  1M1J C;  1JUN A;  1VQ4 P;  4KT0 J;  1FBM A;  1ZW0 A;  2WSF J;  3D6Y A;  1KD1 Q;  3LW5 H;  2ZXE B;  1VQO P;  4NPD A;  1BSN A;  3BRT B;  1NTM D;  1OVV A;  2C0W A;  2E74 C;  3NXS A;  2IBZ G;  3CD6 P;  4LLH A;  4NPF X;  5KLV J;  1SFC D;  3MIW A;  2RKL A;  3W67 A;  2HOD B;  1NHL A;  1SQX J;  2AXT H;  5APT A;  2YXQ B;  2B89 A;  2PGD A;  1P84 E;  5AW5 B;  1OFC X;  1SQB E;  3QWO C;  1FZC A;  3MGN A;  1NTK E;  4Z1M H;  2O01 H;  3TGU J;  2KNC A;  3CC4 P;  4H13 D;  5CCH C;  2I8D A;  1L4A D;  1M1J B;  3K5B A; 
#chains in the Genus database with same CATH homology
 1MFZ A;  1JY3 O;  3VTP C;  1KIL B;  2WT7 A;  4I2L C;  4DZO A;  3B5N A;  3V2N A;  2WT7 B;  2OAR A;  2Z5H A;  1E5W A;  1GW4 A;  5AW4 B;  1KZU B;  5KLV K;  1FOS E;  4JYB A;  3V2P A;  3BAS A;  5CJ4 A;  2R5D A;  2HPC A;  1IJD B;  4ZKU A;  1CW5 A;  1J1D B;  2HPC B;  5AVY B;  1N7S D;  1FZE A;  3O8Z A;  4C7N A;  1SQX K;  2FKW B;  3CLQ A;  4DOJ A;  3M9B A;  4C7N B;  3LIE A;  1CZQ A;  1N7S C;  1JO5 A;  5AW0 B;  2I1K A;  3VOP A;  1FZC C;  4ZKP A;  2BAS A;  5AW9 B;  1SFC A;  1URQ C;  2HG5 D;  5AW6 B;  2KYV A;  3M91 A;  1WT6 A;  1SFC B;  1HBW A;  3V2Q A;  3I5C A;  4KHX A;  2OYI C;  2YO3 A;  1FOS F;  1J1E B;  2CPB A;  1RF0 C;  2XKM A;  3N4X A;  1LT9 A;  1JNM A;  1LT9 B;  2HLO A;  3B5N D;  1KIL C;  5AW8 B;  1LTB C;  1FZA A;  1AFO A;  2IPP A;  5BU5 A;  2KP8 A;  4WB4 A;  3G3Z A;  3B5N C;  5APU A;  5APV A;  3OJA B;  1RF1 A;  1N2D C;  2H7H A;  1X79 B;  1RF1 B;  3R2P A;  2R5B A;  2WSF H;  4WY4 A;  1J1D C;  1A02 J;  2A45 H;  1DH3 A;  1XTC C;  4WY4 B;  3H32 A;  1JOC A;  1L4A A;  2Q3I A;  2LKM A;  4HH2 A;  1RE4 A;  1IC2 A;  3H32 B;  1L4A B;  3TK1 A;  3MD0 A;  2PAJ A;  2IX7 C;  5AVQ B;  1A02 F;  4N78 D;  4RES B;  2NPS D;  1SFC C;  1FJK A;  2XNX A;  1J1E C;  1QL1 A;  1HGV A;  1W2E A;  2HYN A;  1FAV A;  4IFF A;  1IO4 A;  1YTZ T;  1LT9 C;  3EFG A;  3NMD A;  1LTA C;  2Z4E A;  1H88 A;  3L37 A;  3RL0 B;  1N7S A;  1MUU A;  1IFJ A;  1N7S B;  2H43 A;  5KJ7 D;  3HE4 A;  4AQR D;  3HE4 B;  3LID A;  5AVR B;  1RF1 C;  5BVZ A;  4C46 A;  1RF0 A;  3L35 A;  5AW1 B;  2Q7C A;  4LGD E;  3M0A A;  2FFD A;  5CHX A;  3NFQ A;  4I1L A;  1HTL C;  3PP5 A;  2YNY A;  2CPS A;  2W27 A;  3KYQ A;  1L4A C;  2J59 M;  5CCG A;  1ZR4 A;  3V5B A;  1RE4 C;  3A3Y B;  2R32 A;  4N6J A;  3HD7 D;  2L5G B;  4N78 E;  1N7L A;  3B5N B;  3CI9 A;  2R3C A;  3HD7 C;  1QL2 A;  2QM7 A;  2WPQ A;  2JEE A;  2A45 I;  2GUS A;  2MJZ A;  5AVV B;  5CJ0 A;  3RL0 D;  2N9B A;  1NH4 A;  1KQL A;  1FU1 A;  5APX A;  1JY2 N;  3WMM 0;  1N86 A;  3RL0 C;  2WTY A;  4AYC A;  3A2A A;  1SQV K;  1IFN A;  3M0D A;  4N3Y B;  2FYZ A;  3II6 A;  5BU8 B;  1FZF A;  1HUC A;  4XA4 A;  2P1J A;  3TNU A;  3HUS A;  5AVW B;  1NKN A;  3SWY A;  3TNU B;  3HUS B;  1L0L K;  2POH A;  2NPS A;  2M3B A;  1H8A A;  2NPS B;  2XU6 A;  2N1T D;  3V2R A;  4C7R A;  5CCG D;  2FFD C;  2P67 A;  1JY3 N;  1SP4 A;  1HGZ A;  1H89 A;  5CCG C;  1HJB A;  1NAF A;  1RY3 A;  1GZL A;  1T2K D;  1SVF A;  1JMM A;  1GL2 D;  3HTK A;  5APW A;  3GHG A;  2OYH A;  3MUD A;  3HTK B;  5KJ7 A;  1T2K C;  3GHG B;  2OYH B;  1IFI A;  3P8M C;  1YTZ I;  2WPR A;  2PP6 A;  2I1J A;  3A7O A;  2YKP A;  1JY2 P;  3OA7 A;  5APY A;  1NTZ K;  4JF7 A;  1CSB A;  4HYT B;  4IFM A;  2KOG A;  1ZV8 A;  4W7Y A;  1RE3 A;  2P7J A;  3M0D C;  3M06 A;  2WSE H;  4EIJ A;  1IFM A;  1EQ7 A;  2H8P D;  3P8C D;  1GTW A;  1JCC A;  2W6A A;  3HD7 A;  3RK3 D;  1AQ5 A;  3HUS C;  1LTJ A;  2E43 A;  3HD7 B;  2W6B A;  2WIT A;  2KSJ A;  2YKQ A;  2NPS C;  1KFN A;  1NKZ B;  5AVU B;  1SLQ A;  3VMZ A;  1LGH B;  1JY3 P;  3V4Q A;  3OAK A;  3V4W A;  2JJL A;  4O9B A;  1GD2 E;  4EOT A;  1FZG A;  1XTG B;  3P7K A;  1ZLL A;  1HWT C;  1FJP A;  3GHG C;  4GT1 A;  2XV5 A;  2OYH C;  5KJ7 C;  2E42 A;  2O1K A;  1ZR2 A;  1Z56 A;  1N73 A;  4GKG A;  1N73 B;  3N7N A;  2A45 G;  3RK2 D;  2FFD B;  4Y99 B;  1NWQ A;  2N1T A;  1MZ9 A;  2O1J A;  2FYU K;  1FZB A;  2N1T B;  1RE3 C;  3RK2 C;  3SWF A;  1OXZ A;  1LWU A;  2KLV A;  4WBA A;  3EQ2 A;  3L4F A;  1LWU B;  3P8C E;  3L36 A;  1GL2 A;  3TSI A;  1LTJ C;  1M1J A;  5AVZ B;  1GL2 B;  1J2J B;  3P32 A;  1L0N K;  2GUV A;  2YO2 A;  1NO4 A;  3E1I A;  2XZR A;  1LTI C;  1NOH A;  3H6P A;  1WRG A;  3IR9 A;  2P2U A;  1G2C A;  2C0X A;  1G2C B;  1T3U A;  3VMY A;  3NTN A;  5AW2 B;  3IFM A;  4JYC A;  3CL3 D;  3HRN A;  3VMX A;  2IFM A;  2WZ7 A;  1M7L A;  2M8R A;  1HVV A;  1OWA A;  3RK3 B;  3HE5 A;  1N73 C;  3U1C A;  3U1A A;  3VN0 A;  1URQ D;  1SQQ K;  3HE5 B;  4Y99 C;  2WSC H;  1JTH A;  1CI6 A;  1FDM A;  1MV8 A;  1JTH B;  1CI6 B;  2N1T C;  5CMZ A;  4I6M C;  1T8Z A;  1G1I A;  1KFM A;  1DX7 A;  3B8E B;  1LWU C;  1GK6 A;  1GW3 A;  3KPE A;  1GL2 C;  1IFD A;  3M9Q A;  1KIL D;  1SQP K;  1M1J C;  1JUN A;  1VPC A;  2IFN A;  5AVX B;  2HFE D;  3M9H A;  1FBM A;  5AVS B;  3U59 A;  5AVT B;  1LTS C;  2KB7 P;  1LTG C;  1SQB K;  3LW5 H;  2ZXE B;  5APS A;  3VP9 A;  1YYC A;  2Q9I A;  3A5T A;  1NTK K;  2YMY A;  3RK2 B;  2FXM A;  5CCH A;  2WPS A;  4GIF A;  3BRT B;  1S9K D;  4W80 A;  2YKO A;  2C0W A;  1LTJ B;  2WWW A;  1LTT C;  3KDP B;  4B86 A;  3NXS A;  3RK3 C;  1NTM K;  4LLH A;  3TYY A;  1SFC D;  1GDT A;  2HOD A;  2QM8 A;  3MIW A;  1PFI A;  2HOD B;  4IFD K;  1JCD A;  1NHL A;  4LC1 A;  3UIA A;  3VP8 A;  5KTB A;  5APT A;  4XE5 B;  5AW5 B;  3BRV B;  1IK9 A;  1ZN5 A;  2J58 A;  1X8Y A;  2Z5I A;  5AW3 B;  4OH8 B;  1HH0 A;  1VDF A;  3KQG A;  1GU4 A;  4AUW A;  2C9L Y;  2VRS A;  5AW7 B;  3C9I A;  2C9N Y;  1JY2 O;  1NU1 K;  1FZC A;  3MGN A;  1GU5 A;  1DEB A;  1URQ A;  1T3J A;  1FZC B;  5APQ A;  4W7Z A;  2O01 H;  5CCH D;  2Q5U A;  1URQ B;  3MTU E;  1X9V A;  2ZFC A;  4WY4 D;  2OYI A;  3T97 A;  2GM4 A;  5CCH C;  2XDJ A;  2OYI B;  1S9K E;  1L4A D;  4WY4 C;  3VYI A;  1M1J B;  1GK4 A;  3BVH A;  4M3L A;  1G1J A;  3BAT A;  1KIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...