3V50A

Complex of shv s130g mutant beta-lactamase complexed to sa2-13
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The importance of the trans-enamine intermediate as a beta-lactamase inhibition strategy probed in inhibitor-resistant SHV beta-lactamase variants.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v50A00
5FQ9A 3ZCZA 1I5QA 4S2NA 1K56D 1XXMA 4FD8A 4N9KA 4MNRA 4P0MA 1C3BA 1CEFA 2XF3A 3HLGA 3Q7ZA 3BRMA 5CGSA 1W8QA 3IXGA 1NJ4A 1XA7A 3NDEA 4R4RA 3G2YA 4PM7A 4OP8A 1MPLA 2BG1A 4JXSA 1GA9A 5M1AA 5FAQA 3A3FA 3LY4A 1HVBA 1JTDA 1MBLA 5E2GA 2JC7A 3A3EA 5A92A 4RVAA 1FCMA 4X55A 3Q7VA 5AQBA 3UE0A 1YLWA 4ZAMA 2WAEA 2Y4AA 1K56A 2Y2GA 3ISGA 2FFFB 4U0TA 5FI6A 4EV4A 3VOYA 2Y2QA 5FQQA 2WZZA 1E3UD 1RGZA 3SOIA 1PW8A 3M2JA 3ZVWA 3HUMA 5CGWA 1BLCA 1IKIA 3PTEA 3M6BA 2IWDA 4GDNA 2J7VA 4QY6A 3GR2A 2BLSA 2XGNA 3FV7A 3GV9A 5CXWA 1KDSA 3ITBA 2XD1A 5FI7A 4WZ5A 1E4DA 1ES4A 2ZQ7A 3BLSA 1FOFA 1EI5A 1SKFA 1OMEA 1XP4A 3ZG9B 3UE1A 3GRJA 2EXAA 3UNWA 3PBQA 4LV0A 1BSGA 5E2EA 1K55C 3IF6A 3FZCA 3BFDA 5DTKA 2H0TA 3GVBA 1RP5A 3HVFA 5KSHA 2HPBA 3VSKA 4O7DA 3VFFA 1MWRA 2PU4A 5J8XA 2QPNA 3BFFA 2ZC7A 3MKEA 4MEZA 4YINA 5DTSA 1J9MA 5FAOA 4DE0A 4DXCA 4E3OA 4MBKA 4S2JA 2HDUA 5KSCA 3NC8A 1K57C 2ZMAA 2OV5A 1SDNA 3VP1A 2HDRA 1WYCA 4OPQA 4GN2A 1YLYA 3VP0A 2C5WB 3C7UA 3IHBA 1TVFA 5DF8A 4GKUA 2IWBA 1G6AA 3IWIA 2OLVA 1RGYA 3FKWA 1WE4A 4OOLA 2Z2LB 4E6XA 3HBRA 5GHZA 3GQZA 4R1GA 2P9VA 4L0LA 3G2ZA 1XA1A 4KG5A 4DE1A 5EOEA 3RXXA 3DTMA 2VGKA 4KQRA 4X6TA 4QD4A 5FATA 3WS0A 4DDYA 1PWDA 4GB7A 1FQGA 1AXBA 4B88A 4CJNA 4BQMA 3VP3A 3IH8A 1XPBA 3MBZA 4KZ5A 5DVAA 5E2FA 2XDMA 3ZVTA 4WZ5C 4BL2A 4OONA 3S4XA 1LL5A 3IHAA 3BFGA 2DNSA 3N4IA 3AGEA 4KZ4A 3IXBA 5HAIA 3N8SA 3GTCA 3SH7A 3ZG5A 1BTLA 1XGJA 5JYOA 2Y2KA 3MZEA 1H8YA 1U60A 4U0XA 3HLWA 3JYIA 4OVDA 4FH2A 2Y2JA 1CEGA 3VOZA 1BT5A 3PBSA 4BLMA 1E3UA 3AGFA 1L0FA 3M6HA 5EVIC 3G4PA 4OQIA 3PAGA 1W79A 4KZ6A 3PBTA 5FAPA 3TOIA 4ZJ2A 4FCFA 5GLCA 1BLSA 2ZM0A 4LCLA 2EX8A 2IWCA 2Z2MB 1Q2PA 5KZHA 3ZG8B 4E6WA 5HW3A 4Y0OA 5G18A 4WYYA 3BLMA 1ONGA 3P98A 5GLAA 5JYPA 4FSFA 5F1GA 5HARA 1ONHA 3M2KA 1RCJA 3UO9A 1PI4A 4JXVA 1NYYA 4GDBA 4UAAA 4E3KA 5EVLA 3V3RA 2XEPA 4DE2A 1KGEA 3G31A 5M19A 4HBTA 5EVID 2EX6A 1ZKJA 3N8RA 4OH0A 1MXOA 1QMFA 4B4XA 1E25A 1S0WA 5EPHA 3MZFA 4HBUA 2DRWA 1L2SA 1VQQA 1H5XA 3BYDA 4OPZA 2PU2A 4R23A 1S6RA 4EUZA 3NBLA 5FQKA 1DY6A 4KZ9A 1K54C 1O7EA 3E2KA 1K25A 1WYBA 2X71A 5U47A 1DJCA 1CI9A 3PAEA 1PW1A 5GLBA 5M18A 3I7JA 5FQMA 5EVIA 4LV3A 1XGIA 4RX3A 1BLPA 2Y91A 2EX2A 3TG9A 3ZNTA 4ZDXA 3UN7A 4GZBA 3LO7A 2EFUA 4D2OA 3IT9A 1JTGA 2OSUA 4PMAA 3D4FA 1BLHA 5F82A 4LV1A 3OZHA 3UPNA 2ZQDA 4JF4A 2Y2OA 4N9LA 2XH9A 4R3JA 4E3JA 3LY3A 2A49A 1Z6FA 4JLFA 4U3TA 1NZOA 3UDFA 4A5RA 2WK0A 2RCXA 2B5RA 3O88A 3OPHA 2WGIA 1CI8A 2P9VB 1DJBA 3WRZA 4IEDA 4NK3A 1YM1A 1ES5A 4LENA 4OP5A 4C3QA 1EWZA 3P09A 1ERQA 1I2WA 2G2WA 3GMWA 4PM9A 4N1XA 3LCEA 4KZAA 5CHUA 2ZC4B 3Q81A 4XUZA 2ZD8A 3V50A 4N92A 1HD8A 2J9PA 1EROA 5GL9A 3WWXA 1NZUA 2ZQ9A 3SS3A 2ZC6B 4WEKA 1W7FA 1YLTA 5CEDA 1ESUA 4DXBA 2WKEA 4WMCA 1GHIA 2H5SA 4ZBEA 2HP6A 2Q9MA 3VP2A 1K54A 3UDXA 1K6RA 2V2FF 2CC1A 4M3KA 4KQOA 5DF7A 1PYYA 3VP4A 2OLUA 4EQIA 1IYSA 1IYQA 1IYOA 1KE3A 3A3JA 1NY0A 1NYMA 2Y2IA 3FKVA 3IXHA 4CPKA 3G32A 2H10A 4FH4A 5GHYA 1LL9A 5AQ7A 5BOHA 4UA9A 3IWQA 2X02A 4WEJA 3W8KA 4C6YA 4OPYA 2WKHA 3DWKA 4WELA 1XX2A 2WKIA 5EOOA 2JBFA 3HLDA 3OCLA 4JBFA 2Q9NA 5HFOA 3RJUA 3BFEA 4E3IA 3MZDA 2RL3A 2A3UA 2Y59A 4JF6A 1JVJA 1JWVA 1MWSA 4EBNA 4MBFA 4F94A 1YLPA 5FASA 4BENA 1N9BA 4UHUA 4X53A 3WS5A 1IYPA 4R4SA 3W4PA 3G30A 3S22A 4ZJ3A 2WGWB 1I2SA 4OKPA 3A3IA 1TEMA 4JXWA 3CG5A 1SDEA 2XFTA 3NIAA 3SH9A 4X68A 3WS1A 1IELA 1LLBA 1GHPA 4LCMA 2UWXA 5CECA 2V1ZA 1M40A 4GD6A 4HESA 1K6SA 1DJAA 3EQVA 4UA6A 4K0XA 1K38A 1QMEA 2QZ6A 1YLJA 5FQJA 3CZDA 4N1HA 5TGFA 3LEZA 3AGDA 4KZ3A 1ALQA 3IWOA 3HLEA 5TFQA 1FCOA 3NY4A 4EBLA 4ZJ1A 1MWUA 2HDQA 3NCKA 3WRTA 2V20A 4QU3A 1K4EA 1TDLA 3N7WA 5FI2A 3UPOA 3HUNA 3ITAA 3QHYA 4GNUA 4UA7A 4IBRA 3C7VA 5AQ9A 4Y0TA 3BM6A 2EXBA 2EFXA 2ZC5B 1M6KA 3PBOA 2GDNA 4RYEA 3OPRA 1MKIA 3MKFA 1YMSA 4JXGA 3IXDA 4S2IA 2Y2MA 5D3OA 1G68A 5IHVA 3ZHHA 3OPLA 1ESIA 3E2LA 4K0WA 3QNBA 4KZ8A 4MLLA 1BZAA 3ZDJA 2ZJ9A 2ZM8A 3ZNYA 5TR7A 5A91A 1VM1A 3OCNA 4XUXA 4YFMA 3HL9A 2H0YA 1ERMA 1GHMA 3O87A 1FSWA 5CERA 1FSYA 2HDSA 5EVIB 4S2LA 1KDWA 4RA7A 1N4OA 1CK3A 4S2NC 1YMXA 3HLBA 3V3SA 3IF6B 3O86A 2WAFA 2G2UA 4RX2A 2HP9A 4Q8IA 2DCFA 4IVIA 3OPPA 3VFHA 2WADA 3CMZA 1PZPA 2EX9A 4ID4A 3GSGA 2E8IA 4C75A 4BD1A 5E2HA 4OPRA 1IEMA 1MY8A 3IF5A 1LHYA 5AQAA 3HLCA 4S2MA 3RXWA 5L2FA 4R3BA 4K91A 4DF6A 4S2PA 1MWTA 3MXRA 4MBHA 1FR6A 4E3MA 1KGFA 1XKZA 2I72A 2WYXA 1Y54A 5EUAA 1L0GA 2P74A 3VSLA 4KG2A 3W4QA 3N8LA 2ZC3B 1W8YA 3BFCA 3HUOA 4Z9QA 4X69A 5HAQA 1GA0A 5A90A 4HEFA 4KG6A 3V39A 4LV2A 2XD5A 4WBGA 3WS4A 5CTMA 4OQHA 2XLNA 1K4FA 5F83A 4JKTA 2WGWA 4IBXA 4WMCD 4E3LA 3IH9A 1BULA 2WGVA 3DWZA 1H8ZA 4B4ZA 4PM5A 5FA7A 4OQGA 1K55A 3IF6C 4KENB 5FSRA 5F1FA 3Q7VB 4H8RA 2ZQCA 1PIOA 3CJMA 2ZQ8A 4BJPA 5CEBA 4QHCA 3UDIA 1SCWA 4S2OA 2Y55A 3BECA 4Y0UA 5CTNA 3NDGA 4OOYA 4OLDA 3FYZA 3TSGA 3SH8A 1JWZA 2X01A 4EBPA 1ES3A 2QMIA 3UPPA 4QB8A 5FQIA 4GD8A 4S2KA 1NXYA 4WM9A 1YQSA 5HL1A 1ZC2A 3OC2A 2WZXA 3HREA 1PWCA 5CHJA 4EWFA 1SHVA 1GCEA 3Q07A 1K57A 1Q2QA 1LI0A 4DE3A 1NRFA 2XFSA 4PM8A 4QY5A 3UY6A 3C4PA 5CHMA 4KZBA 3ZG0A 2WUQA 5FDHA 4XXRA 3A3DA 1JWPA 5EECA 2XQZA 3SS4A 1ES2A 4P85A 3FWLA 2Y2NA 3HLFA 4QJGA 5I94A 1KVMA 5EE8A 1KE4A 5A93A 4P6BA 5CGXA 1ZG6A 3W4OA 3C5AA 1ZG4A 4KQQA 3ZFZA 1PI5A 1L0EA 3Q82A 3DW0A 1FR1A 3BEBA 3MXSA 1HZOA 3G34A 3MFDA 4NETA 3O3VA 1TDGA 2Y2PA 5KMWA 1HTZA 1BUEA 5HX9A 2C6WB 4P87A 3ZG7B 3ZGAB 4OQ0A 2Y2HA 4BD0A 1FCNA 1KGGA 3C4OA 1PWGA 4PPRA 5CRFA 4PM6A 3PBRA 5GHXA 2HP5A 1KE0A 1W5DA 2VGJA 5GLDA 3WS2A 4DDSA 2JE5A 2XR0A 5DF9A 1LI9A 1O07A 4OOMA 5E43A 4ZTKA 4DKIA 2XK1A 3V5MA 2R9XA 3QNCA 4E3NA 3UE3A 3B3XA 4X56A 2J8YA 4JPMA 2J9OA 2PBYA 3VMAA 3Q1FA 4BL3A 4DRTA 2ZQAA 1L0DA 2FFYA 4JF5A 5DTTA 3NI9A 3PBNA 4KZ7A 3SS5A 2Y2LA 3S1YA 5HAPA 4WZ4A 2R9WA 3N6IA 4GOGA 1IKGA 2ZLYA 4Y7PA 1YLZA 3G35A 3EQUA 2ZM2A 4R0QA 3IQAA 4IVKA 1KVLA 1PZOA 4OLGA 2JCHA 1YT4A
chains in the Genus database with same CATH superfamily
3C2WA 5FQ9A 1JNUA 1K56D 2MJ6A 3Q7ZA 4NG2A 5CGSA 3BRMA 3G2YA 1GA9A 3NOTC 3A3FA 1HVBA 4X1LA 5MC7A 3A3EA 3LIDA 3Q7VA 5AQBA 3KSHA 2W3FA 2Y4AA 1K56A 2Y2GA 3LIBA 3IS2A 2L0WA 3M2JA 3ZVWA 3PTEA 3M6BA 2IWDA 4GDNA 1CQAA 3G6OA 2XSSA 1XFQA 4WZ5A 1E4DA 2ZQ7A 3B33A 3NOUC 2NUPC 2EXAA 1ODVA 3CPTB 3FZCA 5HL6A 4GS9B 3VFFA 5J8XA 2QPNA 3MKEA 4MEZA 4E3OA 5FAOA 2HDUA 5KSCA 3B47A 4LFUA 2OV5A 4AFIA 2B02A 3MSHA 3IWIA 3KYEA 1WE4A 4X1MA 4NEED 3DTMA 3UMEA 4X6TA 3WS0A 5FATA 1G5UA 1PWDA 1FQGA 4CJNA 3VP3A 2V0UA 3IH8A 3ZVTA 4I3IA 1XJ4A 3S4XA 1ZTUA 3IHAA 4WL9A 2W1RA 5HAIA 3SH7A 3ZG5A 4IJGA 1BTLA 1XGJA 5JYOA 4UQIM 3MZEA 4U0XA 3UB5P 3JYIA 5L10A 4BLMA 3BY8A 3ZQ5A 4OQIA 1W79A 4KZ6A 1ZHHB 3TOIA 4ZJ2A 3BQ8A 4WUJA 5GLCA 3IX3A 3KX0X 4WYYA 1ONGA 5F1GA 3SZTA 1ONHA 2PDRA 4JXVA 4UAAA 2XEPA 2EX6A 4OH0A 4MN5A 4B4XA 1N9NA 3UMDA 1TS0A 1VQQA 4OPZA 5HDSA 2PU2A 1V9YA 4EUZA 4KZ9A 1X0OA 3E2KA 1WYBA 5U47A 1DJCA 5M18A 4LV3A 1BLPA 2EX2A 3UN7A 4GZBA 2ZBBA 2EFUA 4KUOA 4D2OA 3UPNA 2ZQDA 4N9LA 4E3JA 3E98A 2A49A 1Z6FA 3LY3A 4JLFA 3WRZA 2HZ5A 1ES5A 3HJKA 2HJEA 4PM9A 2OWHA 3Q81A 2KLIA 1HD8A 1NZUA 3SS3A 2W3DA 1LT0A 2VJWA 5DF7A 4DN0A 2A24A 1EW0A 3A3JA 1OTBA 4HP4A 3G32A 4IUKA 1LL9A 5BOHA 4C6YA 2WKHA 4WELA 2FZ0A 3LI9A 4EXOA 3OCLA 4JBFA 2Q9NA 3BFEA 2Y59A 3MQ0A 2B95A 1JVJA 1MWSA 4EBNA 3LUQA 4F94A 1YLPA 3JPUA 5FL3A 3W4PA 2YKFA 4X25A 3LEQA 3ICYA 1TS6A 2XFTA 4CLCE 3SH9A 1GHPA 4P6ZS 4MN7A 1DJAA 3RFBA 4MN6A 2QJ5A 2D01A 5TGFA 3LEZA 4KZ3A 3HLEA 3TW8A 4ZJ1A 2W3EA 5FI2A 1TDLA 2IA2A 3ITAA 3DTKA 3C7VA 5AQ9A 3BM6A 2ZC5B 1M6KA 2GDNA 4BBUA 3OPRA 4JXGA 4S2IA 1G68A 5IHVA 4K0WA 1BZAA 1MKMA 3OBFA 1GHMA 3O87A 1FSWA 1FSYA 2HDSA 5EVIB 1KDWA 1N4OA 3HLBA 3V3SA 2PD7A 4Y17A 4RX2A 4Q8IA 3MFXA 3VFHA 2QWSA 4ID4A 4JGQA 2E8IA 2A2LA 4C75A 2GNXA 2PT7A 3IF5A 1LHYA 1MWTA 3LGOA 1KGFA 1XKZA 2I72A 2P74A 4Y3IA 3HUOA 4KG6A 3V39A 4ARZA 4DMZA 4OQHA 2VEAA 4HHDA 2VK3A 3LFVA 3KYQA 5EFWA 4LRYC 3E0YA 4KQDA 5DFYA 2K31A 4OLDA 3FYZA 3TSGA 3SH8A 1F9IA 1JWZA 3UB8A 3UPPA 4EEPA 4R38A 4S2KA 1ZC2A 5CHJA 3Q07A 4PM8A 2L1MA 3A3DA 3SS4A 1DP9A 1KVMA 5EE8A 1L0EA 3CUEA 3Q82A 1FR1A 4NETA 1TDGA 2V8FA 3ZG7B 5EM1A 5FEFA 3ZGAB 3MS6A 2Y2HA 4WLAA 3DBAA 5GHXA 2HP5A 1KE0A 2JE5A 4OOMA 5E43A 1J3WA 2XK1A 2A24B 2R9XA 3D72A 3UE3A 3B3XA 4X56A 4PKYG 3Q1FA 1L0DA 4JF5A 4KZ7A 3QP2A 3N6IA 1IKGA 3RTYA 2ZLYA 4Y7PA 4R0QA 3EQUA 2ZM2A 4IVKA 4BBTA 1YT4A 4G3VA 2FH5A 4WN5A 1C3BA 2BTFP 3CUEC 4R4RA 3C38A 4OP8A 1VETB 5M1AA 5DKLA 1T1CA 1NLYA 3MMHA 3A0VA 5FAQA 2PR5A 3D9YA 5A92A 1P9RA 1FCMA 1YLWA 5FI6A 4U0TA 2FFFB 1VHMA 1E3UD 3H82B 2M7UA 1IKIA 3T1SA 2VV7A 1TS8A 4D60A 3GR2A 2BLSA 3FV7A 3GV9A 4I3JA 3UB7A 1KDSA 2XD1A 5F6AA 3K3CA 1FOFA 1EI5A 4NKPA 3UE1A 3KYZA 3MR0A 3PBQA 4LV0A 2R78A 3BFDA 3OLOA 2PAVP 5KSHA 2HPBA 1Y28A 1MWRA 1D06A 2PU4A 3F1NB 4IUHA 2ZC7A 5DTSA 4YINA 1J9MA 3NC8A 1OPXA 2ZMAA 1SDNA 1WYCA 1YLYA 3BJNA 3L9KA 1G6AA 4OOLA 3HBRA 3GQZA 4R1GA 4L0LA 4DE1A 5F68A 4KQRA 4QD4A 3R4KA 4GB7A 4ESPA 4B88A 2LB5A 4BQMA 1DRMA 1XPBA 4QPRA 4WZ5C 4BL2A 4OONA 5C5KA 3BFGA 3N4IA 1HLUP 4KUKA 3GTCA 2WKPA 3IBRA 2OAP1 1H8YA 1U60A 4OVDA 4FH2A 3PBSA 3AGFA 1L0FA 3G4PA 3PAGA 4LCLA 2EX8A 5K5BA 3BLMA 5JYPA 5HARA 2OWJA 3M2KA 2UV0E 3UO9A 1K0KA 4GDBA 5EVLA 4DE2A 1KGEA 4HBTA 1ZKJA 3N8RA 1S0WA 5EPHA 2JHEA 4L9GA 1L2SA 1H5XA 3BYDA 4R23A 3NBLA 4ETXA 1PNEA 5AVFA 1XFNA 1T19A 2V9AA 4RX3A 2Y91A 3TG9A 4ZDXA 3LO7A 5IU1A 1JTGA 1W63Q 2OSUA 4YOFA 1GSWA 4JF4A 2Y2OA 3DTIA 3S7NA 3S7QA 2AVXA 1NZOA 2I9VA 4A5RA 2WGIA 1CI8A 3TRCA 4IEDA 4NK3A 1YM1A 4BBVA 1LSVA 2J3WA 4OP5A 1EWZA 1I2WA 2GX5A 2VA0A 4G3WA 3LR3A 2J3TC 3IX4A 4N92A 5GL9A 3WWXA 4Y5FA 2VKSA 4WEKA 1W7FA 2WKEA 4HNBA 2HP6A 3UDXA 1OTAA 4M3KA 4KQOA 1TF1A 5G4ZA 1KE3A 1IYOA 4BMWA 1YSPA 3IXHA 2H10A 4FH4A 5AQ7A 5DJTA 4UA9A 4GLQA 3W8KA 3DWKA 5EOOA 4CLCA 1PRQA 3HLDA 4ETZA 5TBMB 4QWOA 4MDZA 4GCZA 4MBFA 5FASA 3DTEA 4UHUA 4L9EA 1IYPA 4R4SA 3G30A 4ZJ3A 2VLGA 4OKPA 3A3IA 1TEMA 4O01A 1SDEA 1IELA 4LCMA 2UWXA 1K6SA 1K38A 5EV0A 2QZ6A 1YLJA 4JGPA 3CZDA 3FC7A 2Y79A 5HSQA 4FTXA 3IWOA 3VE4A 2V20A 1K4EA 3UPOA 3QHYA 4UA7A 1N9LA 5J4EA 1STZA 1LSXA 2PD8A 1S67L 3QP6A 2XA7M 1PFLA 4RYEA 1MKIA 4GS9A 3F1NA 5D3OA 3E2LA 4KZ8A 4MLLA 3ZDJA 2ZJ9A 3ZNYA 2PR6A 5TR7A 1VM1A 1ERMA 4S2LA 1OTDA 3LIEA 3IF6B 1S4SA 2WAFA 3LYXA 4HJ4A 2WADA 1VEUB 3GSGA 5E2HA 4OPRA 3RXWA 4K91A 4S2PA 1ACFA 3MXRA 4MBHA 4Q0HA 2WYXA 3T50A 3VSLA 2NUTC 5HAQA 3T1XA 4HEFA 4LV2A 2XD5A 4WBGA 3WS4A 3NULA 4M4XA 2ZL1A 5F83A 2WGWA 4WMCD 1OT9A 4Y13A 3IH9A 4GJ4A 4B4ZA 4PM5A 1H8ZA 5F1FA 5DJUA 4XT2A 3EGDC 5L09A 5A8BA 1PIOA 3PHYA 4PKYA 4BJPA 4NXFA 4EESA 3BECA 1L3LA 4OOYA 2X01A 3LIAA 2QMIA 3K3DA 2J3TD 5FQIA 4GD8A 3OC2A 4PAUA 1GCEA 1NRFA 5CHMA 4KZBA 2WUQA 4R3AA 4XXRA 3CPTA 2XQZA 4FOFA 4B93A 4F3LB 2HGVA 5AJGA 3HLFA 4I38A 5CGXA 1PI5A 3DW0A 4ZRRA 3MFDA 4R70A 5KMWA 1HTZA 2C6WB 4P87A 1T1BA 4OQ0A 4BD0A 1FCNA 5DKKA 4PM6A 3PBRA 3EOIA 2Y8HA 4DDSA 3WS2A 4DKIA 3QNCA 1DP8A 1GSXA 3VMAA 4BL3A 4YWZA 2FFYA 2JKTI 3SS5A 1KOUA 4JGRA 4WZ4A 3S7PA 4OLGA 3LR5A 3ZCZA 2OAQ1 1XXMA 4CQHA 4N9KA 5HDCA 1CEFA 3HLGA 3IXGA 1NJ4A 1XA7A 3NDEA 1S1YA 4HIAA 2BG1A 1LL8A 3LY4A 5E2GA 1JTDA 1MBLA 2JC7A 4RVAA 3UE0A 4ZAMA 3ISGA 4EV4A 2Y2QA 2YKHA 5FQQA 3NECA 1RGZA 3SOIA 4II7A 3U2AA 3HUMA 3A0SA 4LRZE 3DAVA 2J7VA 4QY6A 1OTEA 5CXWA 1GSVA 3ITBA 5FI7A 1ES4A 2VV6A 3VE3A 1OMEA 3ZG9B 1BSGA 5E2EA 3IF6A 3VSKA 4O7DA 2KDKA 2PHYA 2VZWA 4DXCA 2W1TB 3H9WA 4MBKA 4S2JA 3H7WB 1K57C 3TJZC 3VP0A 1A0KA 3C7UA 3IHBA 1TVFA 5DF8A 4GKUA 2IWBA 2OLVA 1RGYA 2W3GA 3FKWA 4E6XA 2Z2LB 2W0NA 1DP6A 2P9VA 1XA1A 1P9WA 4BWIA 4DDYA 1AXBA 2Z6DA 3PYPA 3MBZA 3T4LA 3BWLA 3F1OB 2INWA 4KZ4A 5LBRA 3IXBA 3N8SA 4CLCC 3O5YA 5HWWA 1CEGA 3VOZA 2M7VA 1BT5A 1E3UA 2K7SA 5EVIC 5FAPA 4FCFA 1BLSA 2IWCA 1XJ2A 4G3KA 5KZHA 5HWVA 4E6WA 5G18A 1LSWA 3P98A 5GLAA 1S1ZA 1UWNX 3D3OA 2O9CA 1H8MA 4HJ3A 3G31A 5EVID 1MXOA 1QMFA 3KSFA 2PBDP 1NLZA 3MZFA 4HBUA 2DRWA 1OJ5A 1S6RA 5FQKA 2E8JA 1S4RA 1S66L 1K54C 1O7EA 4P6ZM 2X71A 1CI9A 2JKRI 1PW1A 2L4RA 3PAEA 3I7JA 5FQMA 1XGIA 2HF6A 3P01A 4HH2A 3ZNTA 4NXEA 1SKOB 3IT9A 4JGOA 4PMAA 5F82A 1BLHA 3CAXA 3MQQA 3OZHA 4LLOB 3T4KA 3UE6A 4R3JA 1IOUA 4LGWA 4U3TA 3UDFA 2WK0A 2RCXA 2B5RA 3O88A 4DJ2A 1DJBA 3P09A 1ERQA 4GW9A 4N1XA 3LCEA 4KZAA 5CHUA 4XUZA 2ZD8A 2ZQ9A 2ZC6B 3HJIA 1YLTA 5CEDA 1IFQA 1ESUA 1GHIA 3W2ZA 1WA9A 3VP2A 3EEHA 4UQIS 1K6RA 1PYYA 3VP4A 3H7WA 3EGXC 2OLUA 3E4OA 2PYPA 4EQIA 3LICA 2JN7A 4CPKA 3IWQA 4MCWA 1XX2A 4LRXC 4ME4A 5HFOA 4E3IA 4JF6A 2H28A 3OOVA 2EWWA 4BENA 4ARZB 4HH3A 1N9BA 4X53A 3WS5A 4HY8A 5L8MA 1I2SA 5HWTA 4EETB 3NIAA 2P7JA 4HJ6A 1VB6A 5CECA 3C30A 5G4YA 1M40A 4DJ3A 3EQVA 4UA6A 4K0XA 1FIKA 3AGDA 4HI4A 1W63M 1ALQA 3QP1A 1FCOA 3NY4A 5TJJA 1MWUA 3WRTA 4QU3A 3N7WA 3HUNA 2EXBA 4I39A 1YSQA 5J7EA 3MKFA 1YMSA 5IT5A 3IXDA 3ZHHA 4HP9A 3CWFA 1OJGA 2EWVA 4XUXA 3OCNA 4YNRA 5HDDA 4Z1WA 4EUVA 1CK3A 3O86A 5FDSA 3NJAA 2DCFA 1F98A 3QP5A 5J3WA 1PZPA 2EX9A 1YAXA 4BD1A 4MMNA 3LR0A 5AQAA 3HLCA 3NOPC 4S2MA 4DF6A 1D1JA 4Q0JA 5IS1A 4E3MA 2HJ9C 3T4SA 4B9OA 3QP4A 5EUAA 3W4QA 2ZC3B 1W8YA 4Z9QA 1GA0A 1Z09A 5CTMA 2XLNA 1K4FA 4IBXA 3DWZA 3E4PA 3IF6C 4KENB 3T1RA 3Q7VB 4H6JB 3C8CA 2ZOIA 2QKPA 2ZQCA 4Y15A 2ZQ8A 3T4TA 3UDIA 1SCWA 4S2OA 2Y55A 4PHTA 4HQAA 4Y0UA 5CTNA 5HD5A 3PR6A 3CHWP 3FPWA 1NXYA 3HREA 4EWFA 2XROA 3T4QA 1Q2QA 2XFSA 4QY5A 3ZG0A 2M1CA 1FILA 1G28A 3LI8A 1JWPA 5EVEA 1ES2A 2LB9A 4QJGA 2Y2NA 5I94A 1CJFA 1KE4A 5A93A 1ZG6A 4KQQA 3BEBA 1HZOA 3O3VA 2Y2PA 1BUEA 5HX9A 2BASA 3E4QA 3B42A 3V67A 1KGGA 1PWGA 4UEYA 3IX8A 4O0PA 2XR0A 1YPRA 4K08A 4ZTKA 2Z6CA 3CITA 4E3NA 2J8YA 2J9OA 4DRTA 3K2NA 2VV8A 2ZQAA 1F2KA 5DTTA 3NI9A 1YKDA 2D02A 4GOGA 3G35A 1PZOA 1H3QA 1XJ6A 4GHIB 1I5QA 4S2NA 1XJ3A 4FD8A 3PXPA 4MNRA 4P0MA 2XF3A 1W8QA 4PM7A 1MPLA 4JXSA 1NWZA 2V1BA 2VGLS 1SKOA 4X55A 2WAEA 3VOYA 2WZZA 1PW8A 4EEUA 5CGWA 1BLCA 1OT6A 2XGNA 2KOIA 3BLSA 3BY9A 1SKFA 4L9FA 1XP4A 3GRJA 3UNWA 2KX6A 1K55C 5DTKA 3FG8A 2H0TA 4I5SA 3GVBA 1RP5A 3HVFA 3BFFA 1VEUA 2JKFA 4DE0A 3RH8B 3GECA 3VP1A 2HDRA 4OPQA 4GN2A 2C5WB 3UB9A 2GJ3A 2HV1A 5GHZA 3G2ZA 4CLCD 4KG5A 3JVVA 5EOEA 3RXXA 2VGKA 4CLCB 5CX7A 3R7WA 3T4JA 4KZ5A 5DVAA 5E2FA 2XDMA 3S7OA 1LL5A 2DNSA 3AGEA 2GZAA 4EERA 1D7EA 2Y2KA 4H6JA 2VX8A 3HLWA 4NXBA 2Y2JA 3M6HA 3F1PA 3PBTA 2ZM0A 1OTIA 2Z2MB 1Q2PA 3ZG8B 5HW3A 2XRNA 1P97A 4Y0OA 4FSFA 2K2NA 1RCJA 2O0YA 1PI4A 3IS2B 1NYYA 4E3KA 3V3RA 4XT2B 3CI6A 2G7UA 1UGUA 2ZL1B 3JVUA 5M19A 2WKQA 3T12B 2V1AA 1E25A 5F5YA 5HZHA 1DY6A 4I3AA 1K25A 5GLBA 4HOIA 5EVIA 5KIZA 3NHQA 3EEAA 4F3LA 3D4FA 3VV4A 3ZYTA 3VOLA 4LV1A 2XH9A 1T1AA 3OPHA 2ZOHA 2P9VB 4LENA 4C3QA 3R7WB 2G2WA 3GMWA 2ZC4B 5HPFA 3V50A 2J9PA 2JKRM 1EROA 3LR4A 4DXBA 2DMWA 2ZMFA 4WMCA 3MXQA 2H5SA 4ZBEA 3T1QB 4LPZA 2Q9MA 1K54A 2O9BA 2V2FF 2CC1A 1IYSA 1IYQA 2XA7S 1Y4OA 1NY0A 1NYMA 2Y2IA 3FKVA 5GHYA 2PYRA 2X02A 4WEJA 4OPYA 2WKIA 2JBFA 3RJUA 2EA9A 2Q0OA 3MZDA 2RL3A 2A3UA 1JWVA 3KO6A 4IHQA 2QJ7A 4E04A 1F5MA 4EU0A 3S22A 2WGWB 4JXWA 1UWPX 2W1TA 3CG5A 2ACGA 1TS7A 2CMNA 3L7HA 4X68A 3WS1A 3A0RA 5DFXA 1LLBA 1T18A 2VGLM 2V1ZA 2JKGA 3F1PB 5FEGA 4GHIA 4GD6A 4HESA 3H82A 1QMEA 5FQJA 4N1HA 5AVEA 3MJQA 5TFQA 4EBLA 2HDQA 3NCKA 4O8GA 2J80A 2B18A 4GNUA 4R6LA 4IBRA 4Y0TA 3F1OA 2EFXA 3PBOA 4Y2FA 1G6OA 2Y2MA 3OPLA 1ESIA 3QNBA 3CLOA 1V9ZA 2V0WA 2ZM8A 3KSIA 5A91A 4YFMA 3U4LP 2W27A 3HL9A 2H0YA 5CERA 4RA7A 2O9AA 4S2NC 1YMXA 4WF0A 1SZVA 1VETA 4Q0IA 2G2UA 2HP9A 4EQ1A 4IVIA 3OPPA 3CMZA 2O99A 5I5LA 4EW7A 1IEMA 1MY8A 5L2FA 4R3BA 2V8CA 1H0MA 3QP8A 1FR6A 3KSGA 1Y54A 5L07A 1L0GA 3BQAA 4KG2A 1NRJA 3N8LA 3BFCA 4X69A 5A90A 2OOLA 3T4OA 4NXGA 4JKTA 4E3LA 1MZUA 1BULA 2WGVA 5HD3A 2W3HA 5FA7A 4OQGA 1K55A 2PRFA 5FSRA 5F69A 4H8RA 2P08A 3CJMA 5CEBA 4QHCA 3NDGA 3P7NA 4EBPA 1ES3A 3GDIA 4QB8A 2ZMVA 3FPVA 3MF0A 4WM9A 1YQSA 5HL1A 2WZXA 1PWCA 1SHVA 4DE3A 1K57A 1TD5A 1LI0A 1BYWA 3HCYA 3UY6A 3C4PA 5FDHA 1AWIA 3SW1A 5EECA 3BW6A 1N9OA 3FWLA 4P85A 4P6BA 3W4OA 1MC0A 1ZG4A 3C5AA 3IBJA 3MQOA 3ZFZA 3TE8A 3MXSA 3G34A 4RQ9A 1CF0A 1P0ZA 2QYBA 5EM0A 4PPRA 3C4OA 5CRFA 3EWKA 5TBMA 1W5DA 2VGJA 5GLDA 5DF9A 1LI9A 1O07A 3V5MA 2QHKA 4JPMA 2PBYA 2P04A 3ULFA 2JKTM 2WKRA 4FUWA 3PBNA 3LIFA 2Y2LA 3S1YA 5HPIA 5HAPA 2R9WA 3UB6A 1YLZA 3IQAA 1KVLA 2JCHA
chains in the Genus database with same CATH topology
5FQ9A 3ZCZA 1I5QA 4S2NA 1K56D 1XXMA 4FD8A 4N9KA 4MNRA 4P0MA 1C3BA 1CEFA 2XF3A 3HLGA 3Q7ZA 3BRMA 5CGSA 1W8QA 3IXGA 1NJ4A 1XA7A 3NDEA 4R4RA 3G2YA 4PM7A 4OP8A 1MPLA 2BG1A 4JXSA 1GA9A 5M1AA 5FAQA 3A3FA 3LY4A 1HVBA 1JTDA 1MBLA 5E2GA 2JC7A 3A3EA 5A92A 4RVAA 1FCMA 4X55A 3Q7VA 5AQBA 3UE0A 1YLWA 4ZAMA 2WAEA 2Y4AA 1K56A 2Y2GA 3ISGA 2FFFB 4U0TA 5FI6A 4EV4A 3VOYA 2Y2QA 5FQQA 2WZZA 1E3UD 1RGZA 3SOIA 1PW8A 3M2JA 3ZVWA 3HUMA 5CGWA 1BLCA 1IKIA 3PTEA 3M6BA 2IWDA 4GDNA 2J7VA 4QY6A 3GR2A 2BLSA 2XGNA 3FV7A 3GV9A 5CXWA 1KDSA 3ITBA 2XD1A 5FI7A 4WZ5A 1E4DA 1ES4A 2ZQ7A 3BLSA 1FOFA 1EI5A 1SKFA 1OMEA 1XP4A 3ZG9B 3UE1A 3GRJA 2EXAA 3UNWA 3PBQA 4LV0A 1BSGA 5E2EA 1K55C 3IF6A 3FZCA 3BFDA 5DTKA 2H0TA 3GVBA 1RP5A 3HVFA 5KSHA 2HPBA 3VSKA 4O7DA 3VFFA 1MWRA 2PU4A 5J8XA 2QPNA 3BFFA 2ZC7A 3MKEA 4MEZA 4YINA 5DTSA 1J9MA 5FAOA 4DE0A 4DXCA 4E3OA 4MBKA 4S2JA 2HDUA 5KSCA 3NC8A 1K57C 2ZMAA 2OV5A 1SDNA 3VP1A 2HDRA 1WYCA 4OPQA 4GN2A 1YLYA 3VP0A 2C5WB 3C7UA 3IHBA 1TVFA 5DF8A 4GKUA 2IWBA 1G6AA 3IWIA 2OLVA 1RGYA 3FKWA 1WE4A 4OOLA 2Z2LB 4E6XA 3HBRA 5GHZA 3GQZA 4R1GA 2P9VA 4L0LA 3G2ZA 1XA1A 4KG5A 4DE1A 5EOEA 3RXXA 3DTMA 2VGKA 4KQRA 4X6TA 4QD4A 5FATA 3WS0A 4DDYA 1PWDA 4GB7A 1FQGA 1AXBA 4B88A 4CJNA 4BQMA 3VP3A 3IH8A 1XPBA 3MBZA 4KZ5A 5DVAA 5E2FA 2XDMA 3ZVTA 4WZ5C 4BL2A 4OONA 3S4XA 1LL5A 3IHAA 3BFGA 2DNSA 3N4IA 3AGEA 4KZ4A 3IXBA 5HAIA 3N8SA 3GTCA 3SH7A 3ZG5A 1BTLA 1XGJA 5JYOA 2Y2KA 3MZEA 1H8YA 1U60A 4U0XA 3HLWA 3JYIA 4OVDA 4FH2A 2Y2JA 1CEGA 3VOZA 1BT5A 3PBSA 4BLMA 1E3UA 3AGFA 1L0FA 3M6HA 5EVIC 3G4PA 4OQIA 3PAGA 1W79A 4KZ6A 3PBTA 5FAPA 3TOIA 4ZJ2A 4FCFA 5GLCA 1BLSA 2ZM0A 4LCLA 2EX8A 2IWCA 2Z2MB 1Q2PA 5KZHA 3ZG8B 4E6WA 5HW3A 4Y0OA 5G18A 4WYYA 3BLMA 1ONGA 3P98A 5GLAA 5JYPA 4FSFA 5F1GA 5HARA 1ONHA 3M2KA 1RCJA 3UO9A 1PI4A 4JXVA 1NYYA 4GDBA 4UAAA 4E3KA 5EVLA 3V3RA 2XEPA 4DE2A 1KGEA 3G31A 5M19A 4HBTA 5EVID 2EX6A 1ZKJA 3N8RA 4OH0A 1MXOA 1QMFA 4B4XA 1E25A 1S0WA 5EPHA 3MZFA 4HBUA 2DRWA 1L2SA 1VQQA 1H5XA 3BYDA 4OPZA 2PU2A 4R23A 1S6RA 4EUZA 3NBLA 5FQKA 1DY6A 4KZ9A 1K54C 1O7EA 3E2KA 1K25A 1WYBA 2X71A 5U47A 1DJCA 1CI9A 3PAEA 1PW1A 5GLBA 5M18A 3I7JA 5FQMA 5EVIA 4LV3A 1XGIA 4RX3A 1BLPA 2Y91A 2EX2A 3TG9A 3ZNTA 4ZDXA 3UN7A 4GZBA 3LO7A 2EFUA 4D2OA 3IT9A 1JTGA 2OSUA 4PMAA 3D4FA 1BLHA 5F82A 4LV1A 3OZHA 3UPNA 2ZQDA 4JF4A 2Y2OA 4N9LA 2XH9A 4R3JA 4E3JA 3LY3A 2A49A 1Z6FA 4JLFA 4U3TA 1NZOA 3UDFA 4A5RA 2WK0A 2RCXA 2B5RA 3O88A 3OPHA 2WGIA 1CI8A 2P9VB 1DJBA 3WRZA 4IEDA 4NK3A 1YM1A 1ES5A 4LENA 4OP5A 4C3QA 1EWZA 3P09A 1ERQA 1I2WA 2G2WA 3GMWA 4PM9A 4N1XA 3LCEA 4KZAA 5CHUA 2ZC4B 3Q81A 4XUZA 2ZD8A 3V50A 4N92A 1HD8A 2J9PA 1EROA 5GL9A 3WWXA 1NZUA 2ZQ9A 3SS3A 2ZC6B 4WEKA 1W7FA 1YLTA 5CEDA 1ESUA 4DXBA 2WKEA 4WMCA 1GHIA 2H5SA 4ZBEA 2HP6A 2Q9MA 3VP2A 1K54A 3UDXA 1K6RA 2V2FF 2CC1A 4M3KA 4KQOA 5DF7A 1PYYA 3VP4A 2OLUA 4EQIA 1IYSA 1IYQA 1IYOA 1KE3A 3A3JA 1NY0A 1NYMA 2Y2IA 3FKVA 3IXHA 4CPKA 3G32A 2H10A 4FH4A 5GHYA 1LL9A 5AQ7A 5BOHA 4UA9A 3IWQA 2X02A 4WEJA 3W8KA 4C6YA 4OPYA 2WKHA 3DWKA 4WELA 1XX2A 2WKIA 5EOOA 2JBFA 3HLDA 3OCLA 4JBFA 2Q9NA 5HFOA 3RJUA 3BFEA 4E3IA 3MZDA 2RL3A 2A3UA 2Y59A 4JF6A 1JVJA 1JWVA 1MWSA 4EBNA 4MBFA 4F94A 1YLPA 5FASA 4BENA 1N9BA 4UHUA 4X53A 3WS5A 1IYPA 4R4SA 3W4PA 3G30A 3S22A 4ZJ3A 2WGWB 1I2SA 4OKPA 3A3IA 1TEMA 4JXWA 3CG5A 1SDEA 2XFTA 3NIAA 3SH9A 4X68A 3WS1A 1IELA 1LLBA 1GHPA 4LCMA 2UWXA 5CECA 2V1ZA 1M40A 4GD6A 4HESA 1K6SA 1DJAA 3EQVA 4UA6A 4K0XA 1K38A 1QMEA 2QZ6A 1YLJA 5FQJA 3CZDA 4N1HA 5TGFA 3LEZA 3AGDA 4KZ3A 1ALQA 3IWOA 3HLEA 5TFQA 1FCOA 3NY4A 4EBLA 4ZJ1A 1MWUA 2HDQA 3NCKA 3WRTA 2V20A 4QU3A 1K4EA 1TDLA 3N7WA 5FI2A 3UPOA 3HUNA 3ITAA 3QHYA 4GNUA 4UA7A 4IBRA 3C7VA 5AQ9A 4Y0TA 3BM6A 2EXBA 2EFXA 2ZC5B 1M6KA 3PBOA 2GDNA 4RYEA 3OPRA 1MKIA 3MKFA 1YMSA 4JXGA 3IXDA 4S2IA 2Y2MA 5D3OA 1G68A 5IHVA 3ZHHA 3OPLA 1ESIA 3E2LA 4K0WA 3QNBA 4KZ8A 4MLLA 1BZAA 3ZDJA 2ZJ9A 2ZM8A 3ZNYA 5TR7A 5A91A 1VM1A 3OCNA 4XUXA 4YFMA 3HL9A 2H0YA 1ERMA 1GHMA 3O87A 1FSWA 5CERA 1FSYA 2HDSA 5EVIB 4S2LA 1KDWA 4RA7A 1N4OA 1CK3A 4S2NC 1YMXA 3HLBA 3V3SA 3IF6B 3O86A 2WAFA 2G2UA 4RX2A 2HP9A 4Q8IA 2DCFA 4IVIA 3OPPA 3VFHA 2WADA 3CMZA 1PZPA 2EX9A 4ID4A 3GSGA 2E8IA 4C75A 4BD1A 5E2HA 4OPRA 1IEMA 1MY8A 3IF5A 1LHYA 5AQAA 3HLCA 4S2MA 3RXWA 5L2FA 4R3BA 4K91A 4DF6A 4S2PA 1MWTA 3MXRA 4MBHA 1FR6A 4E3MA 1KGFA 1XKZA 2I72A 2WYXA 1Y54A 5EUAA 1L0GA 2P74A 3VSLA 4KG2A 3W4QA 3N8LA 2ZC3B 1W8YA 3BFCA 3HUOA 4Z9QA 4X69A 5HAQA 1GA0A 5A90A 4HEFA 4KG6A 3V39A 4LV2A 2XD5A 4WBGA 3WS4A 5CTMA 4OQHA 2XLNA 1K4FA 5F83A 4JKTA 2WGWA 4IBXA 4WMCD 4E3LA 3IH9A 1BULA 2WGVA 3DWZA 1H8ZA 4B4ZA 4PM5A 5FA7A 4OQGA 1K55A 3IF6C 4KENB 5FSRA 5F1FA 3Q7VB 4H8RA 2ZQCA 1PIOA 3CJMA 2ZQ8A 4BJPA 5CEBA 4QHCA 3UDIA 1SCWA 4S2OA 2Y55A 3BECA 4Y0UA 5CTNA 3NDGA 4OOYA 4OLDA 3FYZA 3TSGA 3SH8A 1JWZA 2X01A 4EBPA 1ES3A 2QMIA 3UPPA 4QB8A 5FQIA 4GD8A 4S2KA 1NXYA 4WM9A 1YQSA 5HL1A 1ZC2A 3OC2A 2WZXA 3HREA 1PWCA 5CHJA 4EWFA 1SHVA 1GCEA 3Q07A 1K57A 1Q2QA 1LI0A 4DE3A 1NRFA 2XFSA 4PM8A 4QY5A 3UY6A 3C4PA 5CHMA 4KZBA 3ZG0A 2WUQA 5FDHA 4XXRA 3A3DA 1JWPA 5EECA 2XQZA 3SS4A 1ES2A 4P85A 3FWLA 2Y2NA 3HLFA 4QJGA 5I94A 1KVMA 5EE8A 1KE4A 5A93A 4P6BA 5CGXA 1ZG6A 3W4OA 3C5AA 1ZG4A 4KQQA 3ZFZA 1PI5A 1L0EA 3Q82A 3DW0A 1FR1A 3BEBA 3MXSA 1HZOA 3G34A 3MFDA 4NETA 3O3VA 1TDGA 2Y2PA 5KMWA 1HTZA 1BUEA 5HX9A 2C6WB 4P87A 3ZG7B 3ZGAB 4OQ0A 2Y2HA 4BD0A 1FCNA 1KGGA 3C4OA 1PWGA 4PPRA 5CRFA 4PM6A 3PBRA 5GHXA 2HP5A 1KE0A 1W5DA 2VGJA 5GLDA 3WS2A 4DDSA 2JE5A 2XR0A 5DF9A 1LI9A 1O07A 4OOMA 5E43A 4ZTKA 4DKIA 2XK1A 3V5MA 2R9XA 3QNCA 4E3NA 3UE3A 3B3XA 4X56A 2J8YA 4JPMA 2J9OA 2PBYA 3VMAA 3Q1FA 4BL3A 4DRTA 2ZQAA 1L0DA 2FFYA 4JF5A 5DTTA 3NI9A 3PBNA 4KZ7A 3SS5A 2Y2LA 3S1YA 5HAPA 4WZ4A 2R9WA 3N6IA 4GOGA 1IKGA 2ZLYA 4Y7PA 1YLZA 3G35A 3EQUA 2ZM2A 4R0QA 3IQAA 4IVKA 1KVLA 1PZOA 4OLGA 2JCHA 1YT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQ9 A;  3ZCZ A;  1I5Q A;  4S2N A;  1K56 D;  1XXM A;  4FD8 A;  4N9K A;  4MNR A;  4P0M A;  1C3B A;  1CEF A;  2XF3 A;  3HLG A;  3Q7Z A;  3BRM A;  5CGS A;  1W8Q A;  3IXG A;  1NJ4 A;  1XA7 A;  3NDE A;  4R4R A;  3G2Y A;  4PM7 A;  4OP8 A;  1MPL A;  2BG1 A;  4JXS A;  1GA9 A;  5M1A A;  5FAQ A;  3A3F A;  3LY4 A;  1HVB A;  1JTD A;  1MBL A;  5E2G A;  2JC7 A;  3A3E A;  5A92 A;  4RVA A;  1FCM A;  4X55 A;  3Q7V A;  5AQB A;  3UE0 A;  1YLW A;  4ZAM A;  2WAE A;  2Y4A A;  1K56 A;  2Y2G A;  3ISG A;  2FFF B;  4U0T A;  5FI6 A;  4EV4 A;  3VOY A;  2Y2Q A;  5FQQ A;  2WZZ A;  1E3U D;  1RGZ A;  3SOI A;  1PW8 A;  3M2J A;  3ZVW A;  3HUM A;  5CGW A;  1BLC A;  1IKI A;  3PTE A;  3M6B A;  2IWD A;  4GDN A;  2J7V A;  4QY6 A;  3GR2 A;  2BLS A;  2XGN A;  3FV7 A;  3GV9 A;  5CXW A;  1KDS A;  3ITB A;  2XD1 A;  5FI7 A;  4WZ5 A;  1E4D A;  1ES4 A;  2ZQ7 A;  3BLS A;  1FOF A;  1EI5 A;  1SKF A;  1OME A;  1XP4 A;  3ZG9 B;  3UE1 A;  3GRJ A;  2EXA A;  3UNW A;  3PBQ A;  4LV0 A;  1BSG A;  5E2E A;  1K55 C;  3IF6 A;  3FZC A;  3BFD A;  5DTK A;  2H0T A;  3GVB A;  1RP5 A;  3HVF A;  5KSH A;  2HPB A;  3VSK A;  4O7D A;  3VFF A;  1MWR A;  2PU4 A;  5J8X A;  2QPN A;  3BFF A;  2ZC7 A;  3MKE A;  4MEZ A;  4YIN A;  5DTS A;  1J9M A;  5FAO A;  4DE0 A;  4DXC A;  4E3O A;  4MBK A;  4S2J A;  2HDU A;  5KSC A;  3NC8 A;  1K57 C;  2ZMA A;  2OV5 A;  1SDN A;  3VP1 A;  2HDR A;  1WYC A;  4OPQ A;  4GN2 A;  1YLY A;  3VP0 A;  2C5W B;  3C7U A;  3IHB A;  1TVF A;  5DF8 A;  4GKU A;  2IWB A;  1G6A A;  3IWI A;  2OLV A;  1RGY A;  3FKW A;  1WE4 A;  4OOL A;  2Z2L B;  4E6X A;  3HBR A;  5GHZ A;  3GQZ A;  4R1G A;  2P9V A;  4L0L A;  3G2Z A;  1XA1 A;  4KG5 A;  4DE1 A;  5EOE A;  3RXX A;  3DTM A;  2VGK A;  4KQR A;  4X6T A;  4QD4 A;  5FAT A;  3WS0 A;  4DDY A;  1PWD A;  4GB7 A;  1FQG A;  1AXB A;  4B88 A;  4CJN A;  4BQM A;  3VP3 A;  3IH8 A;  1XPB A;  3MBZ A;  4KZ5 A;  5DVA A;  5E2F A;  2XDM A;  3ZVT A;  4WZ5 C;  4BL2 A;  4OON A;  3S4X A;  1LL5 A;  3IHA A;  3BFG A;  2DNS A;  3N4I A;  3AGE A;  4KZ4 A;  3IXB A;  5HAI A;  3N8S A;  3GTC A;  3SH7 A;  3ZG5 A;  1BTL A;  1XGJ A;  5JYO A;  2Y2K A;  3MZE A;  1H8Y A;  1U60 A;  4U0X A;  3HLW A;  3JYI A;  4OVD A;  4FH2 A;  2Y2J A;  1CEG A;  3VOZ A;  1BT5 A;  3PBS A;  4BLM A;  1E3U A;  3AGF A;  1L0F A;  3M6H A;  5EVI C;  3G4P A;  4OQI A;  3PAG A;  1W79 A;  4KZ6 A;  3PBT A;  5FAP A;  3TOI A;  4ZJ2 A;  4FCF A;  5GLC A;  1BLS A;  2ZM0 A;  4LCL A;  2EX8 A;  2IWC A;  2Z2M B;  1Q2P A;  5KZH A;  3ZG8 B;  4E6W A;  5HW3 A;  4Y0O A;  5G18 A;  4WYY A;  3BLM A;  1ONG A;  3P98 A;  5GLA A;  5JYP A;  4FSF A;  5F1G A;  5HAR A;  1ONH A;  3M2K A;  1RCJ A;  3UO9 A;  1PI4 A;  4JXV A;  1NYY A;  4GDB A;  4UAA A;  4E3K A;  5EVL A;  3V3R A;  2XEP A;  4DE2 A;  1KGE A;  3G31 A;  5M19 A;  4HBT A;  5EVI D;  2EX6 A;  1ZKJ A;  3N8R A;  4OH0 A;  1MXO A;  1QMF A;  4B4X A;  1E25 A;  1S0W A;  5EPH A;  3MZF A;  4HBU A;  2DRW A;  1L2S A;  1VQQ A;  1H5X A;  3BYD A;  4OPZ A;  2PU2 A;  4R23 A;  1S6R A;  4EUZ A;  3NBL A;  5FQK A;  1DY6 A;  4KZ9 A;  1K54 C;  1O7E A;  3E2K A;  1K25 A;  1WYB A;  2X71 A;  5U47 A;  1DJC A;  1CI9 A;  3PAE A;  1PW1 A;  5GLB A;  5M18 A;  3I7J A;  5FQM A;  5EVI A;  4LV3 A;  1XGI A;  4RX3 A;  1BLP A;  2Y91 A;  2EX2 A;  3TG9 A;  3ZNT A;  4ZDX A;  3UN7 A;  4GZB A;  3LO7 A;  2EFU A;  4D2O A;  3IT9 A;  1JTG A;  2OSU A;  4PMA A;  3D4F A;  1BLH A;  5F82 A;  4LV1 A;  3OZH A;  3UPN A;  2ZQD A;  4JF4 A;  2Y2O A;  4N9L A;  2XH9 A;  4R3J A;  4E3J A;  3LY3 A;  2A49 A;  1Z6F A;  4JLF A;  4U3T A;  1NZO A;  3UDF A;  4A5R A;  2WK0 A;  2RCX A;  2B5R A;  3O88 A;  3OPH A;  2WGI A;  1CI8 A;  2P9V B;  1DJB A;  3WRZ A;  4IED A;  4NK3 A;  1YM1 A;  1ES5 A;  4LEN A;  4OP5 A;  4C3Q A;  1EWZ A;  3P09 A;  1ERQ A;  1I2W A;  2G2W A;  3GMW A;  4PM9 A;  4N1X A;  3LCE A;  4KZA A;  5CHU A;  2ZC4 B;  3Q81 A;  4XUZ A;  2ZD8 A;  3V50 A;  4N92 A;  1HD8 A;  2J9P A;  1ERO A;  5GL9 A;  3WWX A;  1NZU A;  2ZQ9 A;  3SS3 A;  2ZC6 B;  4WEK A;  1W7F A;  1YLT A;  5CED A;  1ESU A;  4DXB A;  2WKE A;  4WMC A;  1GHI A;  2H5S A;  4ZBE A;  2HP6 A;  2Q9M A;  3VP2 A;  1K54 A;  3UDX A;  1K6R A;  2V2F F;  2CC1 A;  4M3K A;  4KQO A;  5DF7 A;  1PYY A;  3VP4 A;  2OLU A;  4EQI A;  1IYS A;  1IYQ A;  1IYO A;  1KE3 A;  3A3J A;  1NY0 A;  1NYM A;  2Y2I A;  3FKV A;  3IXH A;  4CPK A;  3G32 A;  2H10 A;  4FH4 A;  5GHY A;  1LL9 A;  5AQ7 A;  5BOH A;  4UA9 A;  3IWQ A;  2X02 A;  4WEJ A;  3W8K A;  4C6Y A;  4OPY A;  2WKH A;  3DWK A;  4WEL A;  1XX2 A;  2WKI A;  5EOO A;  2JBF A;  3HLD A;  3OCL A;  4JBF A;  2Q9N A;  5HFO A;  3RJU A;  3BFE A;  4E3I A;  3MZD A;  2RL3 A;  2A3U A;  2Y59 A;  4JF6 A;  1JVJ A;  1JWV A;  1MWS A;  4EBN A;  4MBF A;  4F94 A;  1YLP A;  5FAS A;  4BEN A;  1N9B A;  4UHU A;  4X53 A;  3WS5 A;  1IYP A;  4R4S A;  3W4P A;  3G30 A;  3S22 A;  4ZJ3 A;  2WGW B;  1I2S A;  4OKP A;  3A3I A;  1TEM A;  4JXW A;  3CG5 A;  1SDE A;  2XFT A;  3NIA A;  3SH9 A;  4X68 A;  3WS1 A;  1IEL A;  1LLB A;  1GHP A;  4LCM A;  2UWX A;  5CEC A;  2V1Z A;  1M40 A;  4GD6 A;  4HES A;  1K6S A;  1DJA A;  3EQV A;  4UA6 A;  4K0X A;  1K38 A;  1QME A;  2QZ6 A;  1YLJ A;  5FQJ A;  3CZD A;  4N1H A;  5TGF A;  3LEZ A;  3AGD A;  4KZ3 A;  1ALQ A;  3IWO A;  3HLE A;  5TFQ A;  1FCO A;  3NY4 A;  4EBL A;  4ZJ1 A;  1MWU A;  2HDQ A;  3NCK A;  3WRT A;  2V20 A;  4QU3 A;  1K4E A;  1TDL A;  3N7W A;  5FI2 A;  3UPO A;  3HUN A;  3ITA A;  3QHY A;  4GNU A;  4UA7 A;  4IBR A;  3C7V A;  5AQ9 A;  4Y0T A;  3BM6 A;  2EXB A;  2EFX A;  2ZC5 B;  1M6K A;  3PBO A;  2GDN A;  4RYE A;  3OPR A;  1MKI A;  3MKF A;  1YMS A;  4JXG A;  3IXD A;  4S2I A;  2Y2M A;  5D3O A;  1G68 A;  5IHV A;  3ZHH A;  3OPL A;  1ESI A;  3E2L A;  4K0W A;  3QNB A;  4KZ8 A;  4MLL A;  1BZA A;  3ZDJ A;  2ZJ9 A;  2ZM8 A;  3ZNY A;  5TR7 A;  5A91 A;  1VM1 A;  3OCN A;  4XUX A;  4YFM A;  3HL9 A;  2H0Y A;  1ERM A;  1GHM A;  3O87 A;  1FSW A;  5CER A;  1FSY A;  2HDS A;  5EVI B;  4S2L A;  1KDW A;  4RA7 A;  1N4O A;  1CK3 A;  4S2N C;  1YMX A;  3HLB A;  3V3S A;  3IF6 B;  3O86 A;  2WAF A;  2G2U A;  4RX2 A;  2HP9 A;  4Q8I A;  2DCF A;  4IVI A;  3OPP A;  3VFH A;  2WAD A;  3CMZ A;  1PZP A;  2EX9 A;  4ID4 A;  3GSG A;  2E8I A;  4C75 A;  4BD1 A;  5E2H A;  4OPR A;  1IEM A;  1MY8 A;  3IF5 A;  1LHY A;  5AQA A;  3HLC A;  4S2M A;  3RXW A;  5L2F A;  4R3B A;  4K91 A;  4DF6 A;  4S2P A;  1MWT A;  3MXR A;  4MBH A;  1FR6 A;  4E3M A;  1KGF A;  1XKZ A;  2I72 A;  2WYX A;  1Y54 A;  5EUA A;  1L0G A;  2P74 A;  3VSL A;  4KG2 A;  3W4Q A;  3N8L A;  2ZC3 B;  1W8Y A;  3BFC A;  3HUO A;  4Z9Q A;  4X69 A;  5HAQ A;  1GA0 A;  5A90 A;  4HEF A;  4KG6 A;  3V39 A;  4LV2 A;  2XD5 A;  4WBG A;  3WS4 A;  5CTM A;  4OQH A;  2XLN A;  1K4F A;  5F83 A;  4JKT A;  2WGW A;  4IBX A;  4WMC D;  4E3L A;  3IH9 A;  1BUL A;  2WGV A;  3DWZ A;  1H8Z A;  4B4Z A;  4PM5 A;  5FA7 A;  4OQG A;  1K55 A;  3IF6 C;  4KEN B;  5FSR A;  5F1F A;  3Q7V B;  4H8R A;  2ZQC A;  1PIO A;  3CJM A;  2ZQ8 A;  4BJP A;  5CEB A;  4QHC A;  3UDI A;  1SCW A;  4S2O A;  2Y55 A;  3BEC A;  4Y0U A;  5CTN A;  3NDG A;  4OOY A;  4OLD A;  3FYZ A;  3TSG A;  3SH8 A;  1JWZ A;  2X01 A;  4EBP A;  1ES3 A;  2QMI A;  3UPP A;  4QB8 A;  5FQI A;  4GD8 A;  4S2K A;  1NXY A;  4WM9 A;  1YQS A;  5HL1 A;  1ZC2 A;  3OC2 A;  2WZX A;  3HRE A;  1PWC A;  5CHJ A;  4EWF A;  1SHV A;  1GCE A;  3Q07 A;  1K57 A;  1Q2Q A;  1LI0 A;  4DE3 A;  1NRF A;  2XFS A;  4PM8 A;  4QY5 A;  3UY6 A;  3C4P A;  5CHM A;  4KZB A;  3ZG0 A;  2WUQ A;  5FDH A;  4XXR A;  3A3D A;  1JWP A;  5EEC A;  2XQZ A;  3SS4 A;  1ES2 A;  4P85 A;  3FWL A;  2Y2N A;  3HLF A;  4QJG A;  5I94 A;  1KVM A;  5EE8 A;  1KE4 A;  5A93 A;  4P6B A;  5CGX A;  1ZG6 A;  3W4O A;  3C5A A;  1ZG4 A;  4KQQ A;  3ZFZ A;  1PI5 A;  1L0E A;  3Q82 A;  3DW0 A;  1FR1 A;  3BEB A;  3MXS A;  1HZO A;  3G34 A;  3MFD A;  4NET A;  3O3V A;  1TDG A;  2Y2P A;  5KMW A;  1HTZ A;  1BUE A;  5HX9 A;  2C6W B;  4P87 A;  3ZG7 B;  3ZGA B;  4OQ0 A;  2Y2H A;  4BD0 A;  1FCN A;  1KGG A;  3C4O A;  1PWG A;  4PPR A;  5CRF A;  4PM6 A;  3PBR A;  5GHX A;  2HP5 A;  1KE0 A;  1W5D A;  2VGJ A;  5GLD A;  3WS2 A;  4DDS A;  2JE5 A;  2XR0 A;  5DF9 A;  1LI9 A;  1O07 A;  4OOM A;  5E43 A;  4ZTK A;  4DKI A;  2XK1 A;  3V5M A;  2R9X A;  3QNC A;  4E3N A;  3UE3 A;  3B3X A;  4X56 A;  2J8Y A;  4JPM A;  2J9O A;  2PBY A;  3VMA A;  3Q1F A;  4BL3 A;  4DRT A;  2ZQA A;  1L0D A;  2FFY A;  4JF5 A;  5DTT A;  3NI9 A;  3PBN A;  4KZ7 A;  3SS5 A;  2Y2L A;  3S1Y A;  5HAP A;  4WZ4 A;  2R9W A;  3N6I A;  4GOG A;  1IKG A;  2ZLY A;  4Y7P A;  1YLZ A;  3G35 A;  3EQU A;  2ZM2 A;  4R0Q A;  3IQA A;  4IVK A;  1KVL A;  1PZO A;  4OLG A;  2JCH A;  1YT4 A; 
#chains in the Genus database with same CATH topology
 3C2W A;  5FQ9 A;  1JNU A;  1K56 D;  2MJ6 A;  3Q7Z A;  4NG2 A;  5CGS A;  3BRM A;  3G2Y A;  1GA9 A;  3NOT C;  3A3F A;  1HVB A;  4X1L A;  5MC7 A;  3A3E A;  3LID A;  3Q7V A;  5AQB A;  3KSH A;  2W3F A;  2Y4A A;  1K56 A;  2Y2G A;  3LIB A;  3IS2 A;  2L0W A;  3M2J A;  3ZVW A;  3PTE A;  3M6B A;  2IWD A;  4GDN A;  1CQA A;  3G6O A;  2XSS A;  1XFQ A;  4WZ5 A;  1E4D A;  2ZQ7 A;  3B33 A;  3NOU C;  2NUP C;  2EXA A;  1ODV A;  3CPT B;  3FZC A;  5HL6 A;  4GS9 B;  3VFF A;  5J8X A;  2QPN A;  3MKE A;  4MEZ A;  4E3O A;  5FAO A;  2HDU A;  5KSC A;  3B47 A;  4LFU A;  2OV5 A;  4AFI A;  2B02 A;  3MSH A;  3IWI A;  3KYE A;  1WE4 A;  4X1M A;  4NEE D;  3DTM A;  3UME A;  4X6T A;  3WS0 A;  5FAT A;  1G5U A;  1PWD A;  1FQG A;  4CJN A;  3VP3 A;  2V0U A;  3IH8 A;  3ZVT A;  4I3I A;  1XJ4 A;  3S4X A;  1ZTU A;  3IHA A;  4WL9 A;  2W1R A;  5HAI A;  3SH7 A;  3ZG5 A;  4IJG A;  1BTL A;  1XGJ A;  5JYO A;  4UQI M;  3MZE A;  4U0X A;  3UB5 P;  3JYI A;  5L10 A;  4BLM A;  3BY8 A;  3ZQ5 A;  4OQI A;  1W79 A;  4KZ6 A;  1ZHH B;  3TOI A;  4ZJ2 A;  3BQ8 A;  4WUJ A;  5GLC A;  3IX3 A;  3KX0 X;  4WYY A;  1ONG A;  5F1G A;  3SZT A;  1ONH A;  2PDR A;  4JXV A;  4UAA A;  2XEP A;  2EX6 A;  4OH0 A;  4MN5 A;  4B4X A;  1N9N A;  3UMD A;  1TS0 A;  1VQQ A;  4OPZ A;  5HDS A;  2PU2 A;  1V9Y A;  4EUZ A;  4KZ9 A;  1X0O A;  3E2K A;  1WYB A;  5U47 A;  1DJC A;  5M18 A;  4LV3 A;  1BLP A;  2EX2 A;  3UN7 A;  4GZB A;  2ZBB A;  2EFU A;  4KUO A;  4D2O A;  3UPN A;  2ZQD A;  4N9L A;  4E3J A;  3E98 A;  2A49 A;  1Z6F A;  3LY3 A;  4JLF A;  3WRZ A;  2HZ5 A;  1ES5 A;  3HJK A;  2HJE A;  4PM9 A;  2OWH A;  3Q81 A;  2KLI A;  1HD8 A;  1NZU A;  3SS3 A;  2W3D A;  1LT0 A;  2VJW A;  5DF7 A;  4DN0 A;  2A24 A;  1EW0 A;  3A3J A;  1OTB A;  4HP4 A;  3G32 A;  4IUK A;  1LL9 A;  5BOH A;  4C6Y A;  2WKH A;  4WEL A;  2FZ0 A;  3LI9 A;  4EXO A;  3OCL A;  4JBF A;  2Q9N A;  3BFE A;  2Y59 A;  3MQ0 A;  2B95 A;  1JVJ A;  1MWS A;  4EBN A;  3LUQ A;  4F94 A;  1YLP A;  3JPU A;  5FL3 A;  3W4P A;  2YKF A;  4X25 A;  3LEQ A;  3ICY A;  1TS6 A;  2XFT A;  4CLC E;  3SH9 A;  1GHP A;  4P6Z S;  4MN7 A;  1DJA A;  3RFB A;  4MN6 A;  2QJ5 A;  2D01 A;  5TGF A;  3LEZ A;  4KZ3 A;  3HLE A;  3TW8 A;  4ZJ1 A;  2W3E A;  5FI2 A;  1TDL A;  2IA2 A;  3ITA A;  3DTK A;  3C7V A;  5AQ9 A;  3BM6 A;  2ZC5 B;  1M6K A;  2GDN A;  4BBU A;  3OPR A;  4JXG A;  4S2I A;  1G68 A;  5IHV A;  4K0W A;  1BZA A;  1MKM A;  3OBF A;  1GHM A;  3O87 A;  1FSW A;  1FSY A;  2HDS A;  5EVI B;  1KDW A;  1N4O A;  3HLB A;  3V3S A;  2PD7 A;  4Y17 A;  4RX2 A;  4Q8I A;  3MFX A;  3VFH A;  2QWS A;  4ID4 A;  4JGQ A;  2E8I A;  2A2L A;  4C75 A;  2GNX A;  2PT7 A;  3IF5 A;  1LHY A;  1MWT A;  3LGO A;  1KGF A;  1XKZ A;  2I72 A;  2P74 A;  4Y3I A;  3HUO A;  4KG6 A;  3V39 A;  4ARZ A;  4DMZ A;  4OQH A;  2VEA A;  4HHD A;  2VK3 A;  3LFV A;  3KYQ A;  5EFW A;  4LRY C;  3E0Y A;  4KQD A;  5DFY A;  2K31 A;  4OLD A;  3FYZ A;  3TSG A;  3SH8 A;  1F9I A;  1JWZ A;  3UB8 A;  3UPP A;  4EEP A;  4R38 A;  4S2K A;  1ZC2 A;  5CHJ A;  3Q07 A;  4PM8 A;  2L1M A;  3A3D A;  3SS4 A;  1DP9 A;  1KVM A;  5EE8 A;  1L0E A;  3CUE A;  3Q82 A;  1FR1 A;  4NET A;  1TDG A;  2V8F A;  3ZG7 B;  5EM1 A;  5FEF A;  3ZGA B;  3MS6 A;  2Y2H A;  4WLA A;  3DBA A;  5GHX A;  2HP5 A;  1KE0 A;  2JE5 A;  4OOM A;  5E43 A;  1J3W A;  2XK1 A;  2A24 B;  2R9X A;  3D72 A;  3UE3 A;  3B3X A;  4X56 A;  4PKY G;  3Q1F A;  1L0D A;  4JF5 A;  4KZ7 A;  3QP2 A;  3N6I A;  1IKG A;  3RTY A;  2ZLY A;  4Y7P A;  4R0Q A;  3EQU A;  2ZM2 A;  4IVK A;  4BBT A;  1YT4 A;  4G3V A;  2FH5 A;  4WN5 A;  1C3B A;  2BTF P;  3CUE C;  4R4R A;  3C38 A;  4OP8 A;  1VET B;  5M1A A;  5DKL A;  1T1C A;  1NLY A;  3MMH A;  3A0V A;  5FAQ A;  2PR5 A;  3D9Y A;  5A92 A;  1P9R A;  1FCM A;  1YLW A;  5FI6 A;  4U0T A;  2FFF B;  1VHM A;  1E3U D;  3H82 B;  2M7U A;  1IKI A;  3T1S A;  2VV7 A;  1TS8 A;  4D60 A;  3GR2 A;  2BLS A;  3FV7 A;  3GV9 A;  4I3J A;  3UB7 A;  1KDS A;  2XD1 A;  5F6A A;  3K3C A;  1FOF A;  1EI5 A;  4NKP A;  3UE1 A;  3KYZ A;  3MR0 A;  3PBQ A;  4LV0 A;  2R78 A;  3BFD A;  3OLO A;  2PAV P;  5KSH A;  2HPB A;  1Y28 A;  1MWR A;  1D06 A;  2PU4 A;  3F1N B;  4IUH A;  2ZC7 A;  5DTS A;  4YIN A;  1J9M A;  3NC8 A;  1OPX A;  2ZMA A;  1SDN A;  1WYC A;  1YLY A;  3BJN A;  3L9K A;  1G6A A;  4OOL A;  3HBR A;  3GQZ A;  4R1G A;  4L0L A;  4DE1 A;  5F68 A;  4KQR A;  4QD4 A;  3R4K A;  4GB7 A;  4ESP A;  4B88 A;  2LB5 A;  4BQM A;  1DRM A;  1XPB A;  4QPR A;  4WZ5 C;  4BL2 A;  4OON A;  5C5K A;  3BFG A;  3N4I A;  1HLU P;  4KUK A;  3GTC A;  2WKP A;  3IBR A;  2OAP 1;  1H8Y A;  1U60 A;  4OVD A;  4FH2 A;  3PBS A;  3AGF A;  1L0F A;  3G4P A;  3PAG A;  4LCL A;  2EX8 A;  5K5B A;  3BLM A;  5JYP A;  5HAR A;  2OWJ A;  3M2K A;  2UV0 E;  3UO9 A;  1K0K A;  4GDB A;  5EVL A;  4DE2 A;  1KGE A;  4HBT A;  1ZKJ A;  3N8R A;  1S0W A;  5EPH A;  2JHE A;  4L9G A;  1L2S A;  1H5X A;  3BYD A;  4R23 A;  3NBL A;  4ETX A;  1PNE A;  5AVF A;  1XFN A;  1T19 A;  2V9A A;  4RX3 A;  2Y91 A;  3TG9 A;  4ZDX A;  3LO7 A;  5IU1 A;  1JTG A;  1W63 Q;  2OSU A;  4YOF A;  1GSW A;  4JF4 A;  2Y2O A;  3DTI A;  3S7N A;  3S7Q A;  2AVX A;  1NZO A;  2I9V A;  4A5R A;  2WGI A;  1CI8 A;  3TRC A;  4IED A;  4NK3 A;  1YM1 A;  4BBV A;  1LSV A;  2J3W A;  4OP5 A;  1EWZ A;  1I2W A;  2GX5 A;  2VA0 A;  4G3W A;  3LR3 A;  2J3T C;  3IX4 A;  4N92 A;  5GL9 A;  3WWX A;  4Y5F A;  2VKS A;  4WEK A;  1W7F A;  2WKE A;  4HNB A;  2HP6 A;  3UDX A;  1OTA A;  4M3K A;  4KQO A;  1TF1 A;  5G4Z A;  1KE3 A;  1IYO A;  4BMW A;  1YSP A;  3IXH A;  2H10 A;  4FH4 A;  5AQ7 A;  5DJT A;  4UA9 A;  4GLQ A;  3W8K A;  3DWK A;  5EOO A;  4CLC A;  1PRQ A;  3HLD A;  4ETZ A;  5TBM B;  4QWO A;  4MDZ A;  4GCZ A;  4MBF A;  5FAS A;  3DTE A;  4UHU A;  4L9E A;  1IYP A;  4R4S A;  3G30 A;  4ZJ3 A;  2VLG A;  4OKP A;  3A3I A;  1TEM A;  4O01 A;  1SDE A;  1IEL A;  4LCM A;  2UWX A;  1K6S A;  1K38 A;  5EV0 A;  2QZ6 A;  1YLJ A;  4JGP A;  3CZD A;  3FC7 A;  2Y79 A;  5HSQ A;  4FTX A;  3IWO A;  3VE4 A;  2V20 A;  1K4E A;  3UPO A;  3QHY A;  4UA7 A;  1N9L A;  5J4E A;  1STZ A;  1LSX A;  2PD8 A;  1S67 L;  3QP6 A;  2XA7 M;  1PFL A;  4RYE A;  1MKI A;  4GS9 A;  3F1N A;  5D3O A;  3E2L A;  4KZ8 A;  4MLL A;  3ZDJ A;  2ZJ9 A;  3ZNY A;  2PR6 A;  5TR7 A;  1VM1 A;  1ERM A;  4S2L A;  1OTD A;  3LIE A;  3IF6 B;  1S4S A;  2WAF A;  3LYX A;  4HJ4 A;  2WAD A;  1VEU B;  3GSG A;  5E2H A;  4OPR A;  3RXW A;  4K91 A;  4S2P A;  1ACF A;  3MXR A;  4MBH A;  4Q0H A;  2WYX A;  3T50 A;  3VSL A;  2NUT C;  5HAQ A;  3T1X A;  4HEF A;  4LV2 A;  2XD5 A;  4WBG A;  3WS4 A;  3NUL A;  4M4X A;  2ZL1 A;  5F83 A;  2WGW A;  4WMC D;  1OT9 A;  4Y13 A;  3IH9 A;  4GJ4 A;  4B4Z A;  4PM5 A;  1H8Z A;  5F1F A;  5DJU A;  4XT2 A;  3EGD C;  5L09 A;  5A8B A;  1PIO A;  3PHY A;  4PKY A;  4BJP A;  4NXF A;  4EES A;  3BEC A;  1L3L A;  4OOY A;  2X01 A;  3LIA A;  2QMI A;  3K3D A;  2J3T D;  5FQI A;  4GD8 A;  3OC2 A;  4PAU A;  1GCE A;  1NRF A;  5CHM A;  4KZB A;  2WUQ A;  4R3A A;  4XXR A;  3CPT A;  2XQZ A;  4FOF A;  4B93 A;  4F3L B;  2HGV A;  5AJG A;  3HLF A;  4I38 A;  5CGX A;  1PI5 A;  3DW0 A;  4ZRR A;  3MFD A;  4R70 A;  5KMW A;  1HTZ A;  2C6W B;  4P87 A;  1T1B A;  4OQ0 A;  4BD0 A;  1FCN A;  5DKK A;  4PM6 A;  3PBR A;  3EOI A;  2Y8H A;  4DDS A;  3WS2 A;  4DKI A;  3QNC A;  1DP8 A;  1GSX A;  3VMA A;  4BL3 A;  4YWZ A;  2FFY A;  2JKT I;  3SS5 A;  1KOU A;  4JGR A;  4WZ4 A;  3S7P A;  4OLG A;  3LR5 A;  3ZCZ A;  2OAQ 1;  1XXM A;  4CQH A;  4N9K A;  5HDC A;  1CEF A;  3HLG A;  3IXG A;  1NJ4 A;  1XA7 A;  3NDE A;  1S1Y A;  4HIA A;  2BG1 A;  1LL8 A;  3LY4 A;  5E2G A;  1JTD A;  1MBL A;  2JC7 A;  4RVA A;  3UE0 A;  4ZAM A;  3ISG A;  4EV4 A;  2Y2Q A;  2YKH A;  5FQQ A;  3NEC A;  1RGZ A;  3SOI A;  4II7 A;  3U2A A;  3HUM A;  3A0S A;  4LRZ E;  3DAV A;  2J7V A;  4QY6 A;  1OTE A;  5CXW A;  1GSV A;  3ITB A;  5FI7 A;  1ES4 A;  2VV6 A;  3VE3 A;  1OME A;  3ZG9 B;  1BSG A;  5E2E A;  3IF6 A;  3VSK A;  4O7D A;  2KDK A;  2PHY A;  2VZW A;  4DXC A;  2W1T B;  3H9W A;  4MBK A;  4S2J A;  3H7W B;  1K57 C;  3TJZ C;  3VP0 A;  1A0K A;  3C7U A;  3IHB A;  1TVF A;  5DF8 A;  4GKU A;  2IWB A;  2OLV A;  1RGY A;  2W3G A;  3FKW A;  4E6X A;  2Z2L B;  2W0N A;  1DP6 A;  2P9V A;  1XA1 A;  1P9W A;  4BWI A;  4DDY A;  1AXB A;  2Z6D A;  3PYP A;  3MBZ A;  3T4L A;  3BWL A;  3F1O B;  2INW A;  4KZ4 A;  5LBR A;  3IXB A;  3N8S A;  4CLC C;  3O5Y A;  5HWW A;  1CEG A;  3VOZ A;  2M7V A;  1BT5 A;  1E3U A;  2K7S A;  5EVI C;  5FAP A;  4FCF A;  1BLS A;  2IWC A;  1XJ2 A;  4G3K A;  5KZH A;  5HWV A;  4E6W A;  5G18 A;  1LSW A;  3P98 A;  5GLA A;  1S1Z A;  1UWN X;  3D3O A;  2O9C A;  1H8M A;  4HJ3 A;  3G31 A;  5EVI D;  1MXO A;  1QMF A;  3KSF A;  2PBD P;  1NLZ A;  3MZF A;  4HBU A;  2DRW A;  1OJ5 A;  1S6R A;  5FQK A;  2E8J A;  1S4R A;  1S66 L;  1K54 C;  1O7E A;  4P6Z M;  2X71 A;  1CI9 A;  2JKR I;  1PW1 A;  2L4R A;  3PAE A;  3I7J A;  5FQM A;  1XGI A;  2HF6 A;  3P01 A;  4HH2 A;  3ZNT A;  4NXE A;  1SKO B;  3IT9 A;  4JGO A;  4PMA A;  5F82 A;  1BLH A;  3CAX A;  3MQQ A;  3OZH A;  4LLO B;  3T4K A;  3UE6 A;  4R3J A;  1IOU A;  4LGW A;  4U3T A;  3UDF A;  2WK0 A;  2RCX A;  2B5R A;  3O88 A;  4DJ2 A;  1DJB A;  3P09 A;  1ERQ A;  4GW9 A;  4N1X A;  3LCE A;  4KZA A;  5CHU A;  4XUZ A;  2ZD8 A;  2ZQ9 A;  2ZC6 B;  3HJI A;  1YLT A;  5CED A;  1IFQ A;  1ESU A;  1GHI A;  3W2Z A;  1WA9 A;  3VP2 A;  3EEH A;  4UQI S;  1K6R A;  1PYY A;  3VP4 A;  3H7W A;  3EGX C;  2OLU A;  3E4O A;  2PYP A;  4EQI A;  3LIC A;  2JN7 A;  4CPK A;  3IWQ A;  4MCW A;  1XX2 A;  4LRX C;  4ME4 A;  5HFO A;  4E3I A;  4JF6 A;  2H28 A;  3OOV A;  2EWW A;  4BEN A;  4ARZ B;  4HH3 A;  1N9B A;  4X53 A;  3WS5 A;  4HY8 A;  5L8M A;  1I2S A;  5HWT A;  4EET B;  3NIA A;  2P7J A;  4HJ6 A;  1VB6 A;  5CEC A;  3C30 A;  5G4Y A;  1M40 A;  4DJ3 A;  3EQV A;  4UA6 A;  4K0X A;  1FIK A;  3AGD A;  4HI4 A;  1W63 M;  1ALQ A;  3QP1 A;  1FCO A;  3NY4 A;  5TJJ A;  1MWU A;  3WRT A;  4QU3 A;  3N7W A;  3HUN A;  2EXB A;  4I39 A;  1YSQ A;  5J7E A;  3MKF A;  1YMS A;  5IT5 A;  3IXD A;  3ZHH A;  4HP9 A;  3CWF A;  1OJG A;  2EWV A;  4XUX A;  3OCN A;  4YNR A;  5HDD A;  4Z1W A;  4EUV A;  1CK3 A;  3O86 A;  5FDS A;  3NJA A;  2DCF A;  1F98 A;  3QP5 A;  5J3W A;  1PZP A;  2EX9 A;  1YAX A;  4BD1 A;  4MMN A;  3LR0 A;  5AQA A;  3HLC A;  3NOP C;  4S2M A;  4DF6 A;  1D1J A;  4Q0J A;  5IS1 A;  4E3M A;  2HJ9 C;  3T4S A;  4B9O A;  3QP4 A;  5EUA A;  3W4Q A;  2ZC3 B;  1W8Y A;  4Z9Q A;  1GA0 A;  1Z09 A;  5CTM A;  2XLN A;  1K4F A;  4IBX A;  3DWZ A;  3E4P A;  3IF6 C;  4KEN B;  3T1R A;  3Q7V B;  4H6J B;  3C8C A;  2ZOI A;  2QKP A;  2ZQC A;  4Y15 A;  2ZQ8 A;  3T4T A;  3UDI A;  1SCW A;  4S2O A;  2Y55 A;  4PHT A;  4HQA A;  4Y0U A;  5CTN A;  5HD5 A;  3PR6 A;  3CHW P;  3FPW A;  1NXY A;  3HRE A;  4EWF A;  2XRO A;  3T4Q A;  1Q2Q A;  2XFS A;  4QY5 A;  3ZG0 A;  2M1C A;  1FIL A;  1G28 A;  3LI8 A;  1JWP A;  5EVE A;  1ES2 A;  2LB9 A;  4QJG A;  2Y2N A;  5I94 A;  1CJF A;  1KE4 A;  5A93 A;  1ZG6 A;  4KQQ A;  3BEB A;  1HZO A;  3O3V A;  2Y2P A;  1BUE A;  5HX9 A;  2BAS A;  3E4Q A;  3B42 A;  3V67 A;  1KGG A;  1PWG A;  4UEY A;  3IX8 A;  4O0P A;  2XR0 A;  1YPR A;  4K08 A;  4ZTK A;  2Z6C A;  3CIT A;  4E3N A;  2J8Y A;  2J9O A;  4DRT A;  3K2N A;  2VV8 A;  2ZQA A;  1F2K A;  5DTT A;  3NI9 A;  1YKD A;  2D02 A;  4GOG A;  3G35 A;  1PZO A;  1H3Q A;  1XJ6 A;  4GHI B;  1I5Q A;  4S2N A;  1XJ3 A;  4FD8 A;  3PXP A;  4MNR A;  4P0M A;  2XF3 A;  1W8Q A;  4PM7 A;  1MPL A;  4JXS A;  1NWZ A;  2V1B A;  2VGL S;  1SKO A;  4X55 A;  2WAE A;  3VOY A;  2WZZ A;  1PW8 A;  4EEU A;  5CGW A;  1BLC A;  1OT6 A;  2XGN A;  2KOI A;  3BLS A;  3BY9 A;  1SKF A;  4L9F A;  1XP4 A;  3GRJ A;  3UNW A;  2KX6 A;  1K55 C;  5DTK A;  3FG8 A;  2H0T A;  4I5S A;  3GVB A;  1RP5 A;  3HVF A;  3BFF A;  1VEU A;  2JKF A;  4DE0 A;  3RH8 B;  3GEC A;  3VP1 A;  2HDR A;  4OPQ A;  4GN2 A;  2C5W B;  3UB9 A;  2GJ3 A;  2HV1 A;  5GHZ A;  3G2Z A;  4CLC D;  4KG5 A;  3JVV A;  5EOE A;  3RXX A;  2VGK A;  4CLC B;  5CX7 A;  3R7W A;  3T4J A;  4KZ5 A;  5DVA A;  5E2F A;  2XDM A;  3S7O A;  1LL5 A;  2DNS A;  3AGE A;  2GZA A;  4EER A;  1D7E A;  2Y2K A;  4H6J A;  2VX8 A;  3HLW A;  4NXB A;  2Y2J A;  3M6H A;  3F1P A;  3PBT A;  2ZM0 A;  1OTI A;  2Z2M B;  1Q2P A;  3ZG8 B;  5HW3 A;  2XRN A;  1P97 A;  4Y0O A;  4FSF A;  2K2N A;  1RCJ A;  2O0Y A;  1PI4 A;  3IS2 B;  1NYY A;  4E3K A;  3V3R A;  4XT2 B;  3CI6 A;  2G7U A;  1UGU A;  2ZL1 B;  3JVU A;  5M19 A;  2WKQ A;  3T12 B;  2V1A A;  1E25 A;  5F5Y A;  5HZH A;  1DY6 A;  4I3A A;  1K25 A;  5GLB A;  4HOI A;  5EVI A;  5KIZ A;  3NHQ A;  3EEA A;  4F3L A;  3D4F A;  3VV4 A;  3ZYT A;  3VOL A;  4LV1 A;  2XH9 A;  1T1A A;  3OPH A;  2ZOH A;  2P9V B;  4LEN A;  4C3Q A;  3R7W B;  2G2W A;  3GMW A;  2ZC4 B;  5HPF A;  3V50 A;  2J9P A;  2JKR M;  1ERO A;  3LR4 A;  4DXB A;  2DMW A;  2ZMF A;  4WMC A;  3MXQ A;  2H5S A;  4ZBE A;  3T1Q B;  4LPZ A;  2Q9M A;  1K54 A;  2O9B A;  2V2F F;  2CC1 A;  1IYS A;  1IYQ A;  2XA7 S;  1Y4O A;  1NY0 A;  1NYM A;  2Y2I A;  3FKV A;  5GHY A;  2PYR A;  2X02 A;  4WEJ A;  4OPY A;  2WKI A;  2JBF A;  3RJU A;  2EA9 A;  2Q0O A;  3MZD A;  2RL3 A;  2A3U A;  1JWV A;  3KO6 A;  4IHQ A;  2QJ7 A;  4E04 A;  1F5M A;  4EU0 A;  3S22 A;  2WGW B;  4JXW A;  1UWP X;  2W1T A;  3CG5 A;  2ACG A;  1TS7 A;  2CMN A;  3L7H A;  4X68 A;  3WS1 A;  3A0R A;  5DFX A;  1LLB A;  1T18 A;  2VGL M;  2V1Z A;  2JKG A;  3F1P B;  5FEG A;  4GHI A;  4GD6 A;  4HES A;  3H82 A;  1QME A;  5FQJ A;  4N1H A;  5AVE A;  3MJQ A;  5TFQ A;  4EBL A;  2HDQ A;  3NCK A;  4O8G A;  2J80 A;  2B18 A;  4GNU A;  4R6L A;  4IBR A;  4Y0T A;  3F1O A;  2EFX A;  3PBO A;  4Y2F A;  1G6O A;  2Y2M A;  3OPL A;  1ESI A;  3QNB A;  3CLO A;  1V9Z A;  2V0W A;  2ZM8 A;  3KSI A;  5A91 A;  4YFM A;  3U4L P;  2W27 A;  3HL9 A;  2H0Y A;  5CER A;  4RA7 A;  2O9A A;  4S2N C;  1YMX A;  4WF0 A;  1SZV A;  1VET A;  4Q0I A;  2G2U A;  2HP9 A;  4EQ1 A;  4IVI A;  3OPP A;  3CMZ A;  2O99 A;  5I5L A;  4EW7 A;  1IEM A;  1MY8 A;  5L2F A;  4R3B A;  2V8C A;  1H0M A;  3QP8 A;  1FR6 A;  3KSG A;  1Y54 A;  5L07 A;  1L0G A;  3BQA A;  4KG2 A;  1NRJ A;  3N8L A;  3BFC A;  4X69 A;  5A90 A;  2OOL A;  3T4O A;  4NXG A;  4JKT A;  4E3L A;  1MZU A;  1BUL A;  2WGV A;  5HD3 A;  2W3H A;  5FA7 A;  4OQG A;  1K55 A;  2PRF A;  5FSR A;  5F69 A;  4H8R A;  2P08 A;  3CJM A;  5CEB A;  4QHC A;  3NDG A;  3P7N A;  4EBP A;  1ES3 A;  3GDI A;  4QB8 A;  2ZMV A;  3FPV A;  3MF0 A;  4WM9 A;  1YQS A;  5HL1 A;  2WZX A;  1PWC A;  1SHV A;  4DE3 A;  1K57 A;  1TD5 A;  1LI0 A;  1BYW A;  3HCY A;  3UY6 A;  3C4P A;  5FDH A;  1AWI A;  3SW1 A;  5EEC A;  3BW6 A;  1N9O A;  3FWL A;  4P85 A;  4P6B A;  3W4O A;  1MC0 A;  1ZG4 A;  3C5A A;  3IBJ A;  3MQO A;  3ZFZ A;  3TE8 A;  3MXS A;  3G34 A;  4RQ9 A;  1CF0 A;  1P0Z A;  2QYB A;  5EM0 A;  4PPR A;  3C4O A;  5CRF A;  3EWK A;  5TBM A;  1W5D A;  2VGJ A;  5GLD A;  5DF9 A;  1LI9 A;  1O07 A;  3V5M A;  2QHK A;  4JPM A;  2PBY A;  2P04 A;  3ULF A;  2JKT M;  2WKR A;  4FUW A;  3PBN A;  3LIF A;  2Y2L A;  3S1Y A;  5HPI A;  5HAP A;  2R9W A;  3UB6 A;  1YLZ A;  3IQA A;  1KVL A;  2JCH A; 
#chains in the Genus database with same CATH homology
 5FQ9 A;  3ZCZ A;  1I5Q A;  4S2N A;  1K56 D;  1XXM A;  4FD8 A;  4N9K A;  4MNR A;  4P0M A;  1C3B A;  1CEF A;  2XF3 A;  3HLG A;  3Q7Z A;  3BRM A;  5CGS A;  1W8Q A;  3IXG A;  1NJ4 A;  1XA7 A;  3NDE A;  4R4R A;  3G2Y A;  4PM7 A;  4OP8 A;  1MPL A;  2BG1 A;  4JXS A;  1GA9 A;  5M1A A;  5FAQ A;  3A3F A;  3LY4 A;  1HVB A;  1JTD A;  1MBL A;  5E2G A;  2JC7 A;  3A3E A;  5A92 A;  4RVA A;  1FCM A;  4X55 A;  3Q7V A;  5AQB A;  3UE0 A;  1YLW A;  4ZAM A;  2WAE A;  2Y4A A;  1K56 A;  2Y2G A;  3ISG A;  2FFF B;  4U0T A;  5FI6 A;  4EV4 A;  3VOY A;  2Y2Q A;  5FQQ A;  2WZZ A;  1E3U D;  1RGZ A;  3SOI A;  1PW8 A;  3M2J A;  3ZVW A;  3HUM A;  5CGW A;  1BLC A;  1IKI A;  3PTE A;  3M6B A;  2IWD A;  4GDN A;  2J7V A;  4QY6 A;  3GR2 A;  2BLS A;  2XGN A;  3FV7 A;  3GV9 A;  5CXW A;  1KDS A;  3ITB A;  2XD1 A;  5FI7 A;  4WZ5 A;  1E4D A;  1ES4 A;  2ZQ7 A;  3BLS A;  1FOF A;  1EI5 A;  1SKF A;  1OME A;  1XP4 A;  3ZG9 B;  3UE1 A;  3GRJ A;  2EXA A;  3UNW A;  3PBQ A;  4LV0 A;  1BSG A;  5E2E A;  1K55 C;  3IF6 A;  3FZC A;  3BFD A;  5DTK A;  2H0T A;  3GVB A;  1RP5 A;  3HVF A;  5KSH A;  2HPB A;  3VSK A;  4O7D A;  3VFF A;  1MWR A;  2PU4 A;  5J8X A;  2QPN A;  3BFF A;  2ZC7 A;  3MKE A;  4MEZ A;  4YIN A;  5DTS A;  1J9M A;  5FAO A;  4DE0 A;  4DXC A;  4E3O A;  4MBK A;  4S2J A;  2HDU A;  5KSC A;  3NC8 A;  1K57 C;  2ZMA A;  2OV5 A;  1SDN A;  3VP1 A;  2HDR A;  1WYC A;  4OPQ A;  4GN2 A;  1YLY A;  3VP0 A;  2C5W B;  3C7U A;  3IHB A;  1TVF A;  5DF8 A;  4GKU A;  2IWB A;  1G6A A;  3IWI A;  2OLV A;  1RGY A;  3FKW A;  1WE4 A;  4OOL A;  2Z2L B;  4E6X A;  3HBR A;  5GHZ A;  3GQZ A;  4R1G A;  2P9V A;  4L0L A;  3G2Z A;  1XA1 A;  4KG5 A;  4DE1 A;  5EOE A;  3RXX A;  3DTM A;  2VGK A;  4KQR A;  4X6T A;  4QD4 A;  5FAT A;  3WS0 A;  4DDY A;  1PWD A;  4GB7 A;  1FQG A;  1AXB A;  4B88 A;  4CJN A;  4BQM A;  3VP3 A;  3IH8 A;  1XPB A;  3MBZ A;  4KZ5 A;  5DVA A;  5E2F A;  2XDM A;  3ZVT A;  4WZ5 C;  4BL2 A;  4OON A;  3S4X A;  1LL5 A;  3IHA A;  3BFG A;  2DNS A;  3N4I A;  3AGE A;  4KZ4 A;  3IXB A;  5HAI A;  3N8S A;  3GTC A;  3SH7 A;  3ZG5 A;  1BTL A;  1XGJ A;  5JYO A;  2Y2K A;  3MZE A;  1H8Y A;  1U60 A;  4U0X A;  3HLW A;  3JYI A;  4OVD A;  4FH2 A;  2Y2J A;  1CEG A;  3VOZ A;  1BT5 A;  3PBS A;  4BLM A;  1E3U A;  3AGF A;  1L0F A;  3M6H A;  5EVI C;  3G4P A;  4OQI A;  3PAG A;  1W79 A;  4KZ6 A;  3PBT A;  5FAP A;  3TOI A;  4ZJ2 A;  4FCF A;  5GLC A;  1BLS A;  2ZM0 A;  4LCL A;  2EX8 A;  2IWC A;  2Z2M B;  1Q2P A;  5KZH A;  3ZG8 B;  4E6W A;  5HW3 A;  4Y0O A;  5G18 A;  4WYY A;  3BLM A;  1ONG A;  3P98 A;  5GLA A;  5JYP A;  4FSF A;  5F1G A;  5HAR A;  1ONH A;  3M2K A;  1RCJ A;  3UO9 A;  1PI4 A;  4JXV A;  1NYY A;  4GDB A;  4UAA A;  4E3K A;  5EVL A;  3V3R A;  2XEP A;  4DE2 A;  1KGE A;  3G31 A;  5M19 A;  4HBT A;  5EVI D;  2EX6 A;  1ZKJ A;  3N8R A;  4OH0 A;  1MXO A;  1QMF A;  4B4X A;  1E25 A;  1S0W A;  5EPH A;  3MZF A;  4HBU A;  2DRW A;  1L2S A;  1VQQ A;  1H5X A;  3BYD A;  4OPZ A;  2PU2 A;  4R23 A;  1S6R A;  4EUZ A;  3NBL A;  5FQK A;  1DY6 A;  4KZ9 A;  1K54 C;  1O7E A;  3E2K A;  1K25 A;  1WYB A;  2X71 A;  5U47 A;  1DJC A;  1CI9 A;  3PAE A;  1PW1 A;  5GLB A;  5M18 A;  3I7J A;  5FQM A;  5EVI A;  4LV3 A;  1XGI A;  4RX3 A;  1BLP A;  2Y91 A;  2EX2 A;  3TG9 A;  3ZNT A;  4ZDX A;  3UN7 A;  4GZB A;  3LO7 A;  2EFU A;  4D2O A;  3IT9 A;  1JTG A;  2OSU A;  4PMA A;  3D4F A;  1BLH A;  5F82 A;  4LV1 A;  3OZH A;  3UPN A;  2ZQD A;  4JF4 A;  2Y2O A;  4N9L A;  2XH9 A;  4R3J A;  4E3J A;  3LY3 A;  2A49 A;  1Z6F A;  4JLF A;  4U3T A;  1NZO A;  3UDF A;  4A5R A;  2WK0 A;  2RCX A;  2B5R A;  3O88 A;  3OPH A;  2WGI A;  1CI8 A;  2P9V B;  1DJB A;  3WRZ A;  4IED A;  4NK3 A;  1YM1 A;  1ES5 A;  4LEN A;  4OP5 A;  4C3Q A;  1EWZ A;  3P09 A;  1ERQ A;  1I2W A;  2G2W A;  3GMW A;  4PM9 A;  4N1X A;  3LCE A;  4KZA A;  5CHU A;  2ZC4 B;  3Q81 A;  4XUZ A;  2ZD8 A;  3V50 A;  4N92 A;  1HD8 A;  2J9P A;  1ERO A;  5GL9 A;  3WWX A;  1NZU A;  2ZQ9 A;  3SS3 A;  2ZC6 B;  4WEK A;  1W7F A;  1YLT A;  5CED A;  1ESU A;  4DXB A;  2WKE A;  4WMC A;  1GHI A;  2H5S A;  4ZBE A;  2HP6 A;  2Q9M A;  3VP2 A;  1K54 A;  3UDX A;  1K6R A;  2V2F F;  2CC1 A;  4M3K A;  4KQO A;  5DF7 A;  1PYY A;  3VP4 A;  2OLU A;  4EQI A;  1IYS A;  1IYQ A;  1IYO A;  1KE3 A;  3A3J A;  1NY0 A;  1NYM A;  2Y2I A;  3FKV A;  3IXH A;  4CPK A;  3G32 A;  2H10 A;  4FH4 A;  5GHY A;  1LL9 A;  5AQ7 A;  5BOH A;  4UA9 A;  3IWQ A;  2X02 A;  4WEJ A;  3W8K A;  4C6Y A;  4OPY A;  2WKH A;  3DWK A;  4WEL A;  1XX2 A;  2WKI A;  5EOO A;  2JBF A;  3HLD A;  3OCL A;  4JBF A;  2Q9N A;  5HFO A;  3RJU A;  3BFE A;  4E3I A;  3MZD A;  2RL3 A;  2A3U A;  2Y59 A;  4JF6 A;  1JVJ A;  1JWV A;  1MWS A;  4EBN A;  4MBF A;  4F94 A;  1YLP A;  5FAS A;  4BEN A;  1N9B A;  4UHU A;  4X53 A;  3WS5 A;  1IYP A;  4R4S A;  3W4P A;  3G30 A;  3S22 A;  4ZJ3 A;  2WGW B;  1I2S A;  4OKP A;  3A3I A;  1TEM A;  4JXW A;  3CG5 A;  1SDE A;  2XFT A;  3NIA A;  3SH9 A;  4X68 A;  3WS1 A;  1IEL A;  1LLB A;  1GHP A;  4LCM A;  2UWX A;  5CEC A;  2V1Z A;  1M40 A;  4GD6 A;  4HES A;  1K6S A;  1DJA A;  3EQV A;  4UA6 A;  4K0X A;  1K38 A;  1QME A;  2QZ6 A;  1YLJ A;  5FQJ A;  3CZD A;  4N1H A;  5TGF A;  3LEZ A;  3AGD A;  4KZ3 A;  1ALQ A;  3IWO A;  3HLE A;  5TFQ A;  1FCO A;  3NY4 A;  4EBL A;  4ZJ1 A;  1MWU A;  2HDQ A;  3NCK A;  3WRT A;  2V20 A;  4QU3 A;  1K4E A;  1TDL A;  3N7W A;  5FI2 A;  3UPO A;  3HUN A;  3ITA A;  3QHY A;  4GNU A;  4UA7 A;  4IBR A;  3C7V A;  5AQ9 A;  4Y0T A;  3BM6 A;  2EXB A;  2EFX A;  2ZC5 B;  1M6K A;  3PBO A;  2GDN A;  4RYE A;  3OPR A;  1MKI A;  3MKF A;  1YMS A;  4JXG A;  3IXD A;  4S2I A;  2Y2M A;  5D3O A;  1G68 A;  5IHV A;  3ZHH A;  3OPL A;  1ESI A;  3E2L A;  4K0W A;  3QNB A;  4KZ8 A;  4MLL A;  1BZA A;  3ZDJ A;  2ZJ9 A;  2ZM8 A;  3ZNY A;  5TR7 A;  5A91 A;  1VM1 A;  3OCN A;  4XUX A;  4YFM A;  3HL9 A;  2H0Y A;  1ERM A;  1GHM A;  3O87 A;  1FSW A;  5CER A;  1FSY A;  2HDS A;  5EVI B;  4S2L A;  1KDW A;  4RA7 A;  1N4O A;  1CK3 A;  4S2N C;  1YMX A;  3HLB A;  3V3S A;  3IF6 B;  3O86 A;  2WAF A;  2G2U A;  4RX2 A;  2HP9 A;  4Q8I A;  2DCF A;  4IVI A;  3OPP A;  3VFH A;  2WAD A;  3CMZ A;  1PZP A;  2EX9 A;  4ID4 A;  3GSG A;  2E8I A;  4C75 A;  4BD1 A;  5E2H A;  4OPR A;  1IEM A;  1MY8 A;  3IF5 A;  1LHY A;  5AQA A;  3HLC A;  4S2M A;  3RXW A;  5L2F A;  4R3B A;  4K91 A;  4DF6 A;  4S2P A;  1MWT A;  3MXR A;  4MBH A;  1FR6 A;  4E3M A;  1KGF A;  1XKZ A;  2I72 A;  2WYX A;  1Y54 A;  5EUA A;  1L0G A;  2P74 A;  3VSL A;  4KG2 A;  3W4Q A;  3N8L A;  2ZC3 B;  1W8Y A;  3BFC A;  3HUO A;  4Z9Q A;  4X69 A;  5HAQ A;  1GA0 A;  5A90 A;  4HEF A;  4KG6 A;  3V39 A;  4LV2 A;  2XD5 A;  4WBG A;  3WS4 A;  5CTM A;  4OQH A;  2XLN A;  1K4F A;  5F83 A;  4JKT A;  2WGW A;  4IBX A;  4WMC D;  4E3L A;  3IH9 A;  1BUL A;  2WGV A;  3DWZ A;  1H8Z A;  4B4Z A;  4PM5 A;  5FA7 A;  4OQG A;  1K55 A;  3IF6 C;  4KEN B;  5FSR A;  5F1F A;  3Q7V B;  4H8R A;  2ZQC A;  1PIO A;  3CJM A;  2ZQ8 A;  4BJP A;  5CEB A;  4QHC A;  3UDI A;  1SCW A;  4S2O A;  2Y55 A;  3BEC A;  4Y0U A;  5CTN A;  3NDG A;  4OOY A;  4OLD A;  3FYZ A;  3TSG A;  3SH8 A;  1JWZ A;  2X01 A;  4EBP A;  1ES3 A;  2QMI A;  3UPP A;  4QB8 A;  5FQI A;  4GD8 A;  4S2K A;  1NXY A;  4WM9 A;  1YQS A;  5HL1 A;  1ZC2 A;  3OC2 A;  2WZX A;  3HRE A;  1PWC A;  5CHJ A;  4EWF A;  1SHV A;  1GCE A;  3Q07 A;  1K57 A;  1Q2Q A;  1LI0 A;  4DE3 A;  1NRF A;  2XFS A;  4PM8 A;  4QY5 A;  3UY6 A;  3C4P A;  5CHM A;  4KZB A;  3ZG0 A;  2WUQ A;  5FDH A;  4XXR A;  3A3D A;  1JWP A;  5EEC A;  2XQZ A;  3SS4 A;  1ES2 A;  4P85 A;  3FWL A;  2Y2N A;  3HLF A;  4QJG A;  5I94 A;  1KVM A;  5EE8 A;  1KE4 A;  5A93 A;  4P6B A;  5CGX A;  1ZG6 A;  3W4O A;  3C5A A;  1ZG4 A;  4KQQ A;  3ZFZ A;  1PI5 A;  1L0E A;  3Q82 A;  3DW0 A;  1FR1 A;  3BEB A;  3MXS A;  1HZO A;  3G34 A;  3MFD A;  4NET A;  3O3V A;  1TDG A;  2Y2P A;  5KMW A;  1HTZ A;  1BUE A;  5HX9 A;  2C6W B;  4P87 A;  3ZG7 B;  3ZGA B;  4OQ0 A;  2Y2H A;  4BD0 A;  1FCN A;  1KGG A;  3C4O A;  1PWG A;  4PPR A;  5CRF A;  4PM6 A;  3PBR A;  5GHX A;  2HP5 A;  1KE0 A;  1W5D A;  2VGJ A;  5GLD A;  3WS2 A;  4DDS A;  2JE5 A;  2XR0 A;  5DF9 A;  1LI9 A;  1O07 A;  4OOM A;  5E43 A;  4ZTK A;  4DKI A;  2XK1 A;  3V5M A;  2R9X A;  3QNC A;  4E3N A;  3UE3 A;  3B3X A;  4X56 A;  2J8Y A;  4JPM A;  2J9O A;  2PBY A;  3VMA A;  3Q1F A;  4BL3 A;  4DRT A;  2ZQA A;  1L0D A;  2FFY A;  4JF5 A;  5DTT A;  3NI9 A;  3PBN A;  4KZ7 A;  3SS5 A;  2Y2L A;  3S1Y A;  5HAP A;  4WZ4 A;  2R9W A;  3N6I A;  4GOG A;  1IKG A;  2ZLY A;  4Y7P A;  1YLZ A;  3G35 A;  3EQU A;  2ZM2 A;  4R0Q A;  3IQA A;  4IVK A;  1KVL A;  1PZO A;  4OLG A;  2JCH A;  1YT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...