3V50A

Complex of shv s130g mutant beta-lactamase complexed to sa2-13
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The importance of the trans-enamine intermediate as a beta-lactamase inhibition strategy probed in inhibitor-resistant SHV beta-lactamase variants.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v50A00
2FFFB 1ES2A 3TSGA 2OLUA 4KZ4A 4OLDA 5EOOA 5EECA 3UNWA 1XPBA 3B3XA 2HP5A 4KZBA 1K57C 1PI5A 2JE5A 5A90A 4JXVA 1SDNA 3ZVWA 2XD1A 2RL3A 3O87A 4EUZA 1M6KA 3NY4A 2ZJ9A 1CEGA 2WAEA 3O88A 4OQGA 2OSUA 1GHMA 4B4ZA 1IYSA 3PBSA 4FH4A 4OKPA 2HDRA 3HREA 1W8YA 1K6SA 2J9PA 1C3BA 5L2FA 4KG5A 4M3KA 5GLCA 1NRFA 2X02A 1L0GA 4E3OA 4RYEA 1NYYA 4JXWA 4EBPA 2Y2OA 3WWXA 1GA0A 3HLGA 4UAAA 1HVBA 1YLPA 1MY8A 4LV2A 3SS5A 3UE1A 3NDGA 1U60A 2JC7A 3BFGA 5E2EA 3V3SA 1PW1A 5FAOA 3DTMA 3G4PA 5BOHA 3FYZA 1K57A 2WGIA 4FSFA 5AQ7A 3SOIA 4MBKA 3ZG0A 2Z2LB 3OPRA 1YT4A 3OZHA 2GDNA 3Q81A 3MBZA 4E3IA 1FQGA 3A3DA 1ZG6A 4BL3A 3D4FA 4E6WA 1ALQA 4DE0A 1KGFA 1YM1A 3VSLA 3VSKA 1AXBA 3CZDA 2J9OA 2XFTA 1YLJA 5E43A 3SH8A 3VP2A 1TDLA 3HLEA 4PMAA 4CJNA 1YLTA 1K4FA 4DDSA 3LY4A 5E2HA 5CGSA 2FFYA 2WZXA 3Q07A 3IHAA 4FD8A 4KZ6A 4OPQA 4WEKA 2EFUA 1VQQA 1ZG4A 5FI2A 5FQKA 2Y2MA 3VMAA 1E3UD 2H0YA 5CTNA 1CI9A 4JLFA 2Y59A 3Q7VB 5AQ9A 5CHJA 4R4SA 4KZ7A 3GQZA 4A5RA 1BLPA 2RCXA 3IF6A 5DF8A 3HL9A 1XGIA 2WUQA 4BL2A 1GHIA 1JVJA 4DDYA 3G30A 4RX2A 4E3NA 2VGKA 3PTEA 1J9MA 1IELA 2Y2LA 3IHBA 1XX2A 3RXXA 5CEDA 5EPHA 1Y54A 2IWCA 4EWFA 4ZAMA 4P0MA 4HBUA 4MEZA 1FSWA 1ES4A 3PAEA 4R4RA 1S6RA 5CERA 3ZHHA 3GVBA 1DY6A 1JTDA 3JYIA 3O86A 3GRJA 4Y0OA 4MBFA 1MBLA 3G32A 4WEJA 3WS5A 1OMEA 5TFQA 3LY3A 3G2YA 4OPZA 3IWIA 2PU2A 2WYXA 5DF9A 2WZZA 5GLDA 3W4QA 3W8KA 3ZG7B 3BECA 2XK1A 3S22A 2XLNA 4KQQA 3PBQA 4R3BA 3IXHA 2G2WA 2ZC5B 5FQQA 4MNRA 3IWQA 1L0DA 1PZOA 3VP0A 1FCNA 1I2WA 1BSGA 1DJBA 4N9LA 2ZQ8A 4R1GA 1O7EA 3ITBA 3A3EA 2I72A 2ZM2A 3BYDA 3FV7A 2QZ6A 4MLLA 4RA7A 4C3QA 3Q1FA 3EQUA 3ZDJA 4DE1A 3E2KA 3FKVA 4S2OA 3HLCA 4ZBEA 5F83A 3P09A 5KMWA 5F1GA 2WKEA 3LCEA 4RX3A 2EXBA 5CHUA 5EVIB 2JBFA 3HLDA 1JTGA 1L2SA 2DCFA 3A3FA 3G31A 3DWKA 3IH8A 4P85A 4U3TA 4UA9A 5EUAA 5FQIA 2V2FF 4GD8A 4WBGA 5CGWA 4GN2A 3IXDA 3ZG8B 1ERQA 4OPRA 1IYPA 1MWTA 2Z2MB 4CPKA 4E3MA 3IF5A 5E2FA 3GSGA 2H5SA 5FSRA 1MWSA 4OOMA 2ZQAA 3ZGAB 4YFMA 1FSYA 2EX6A 3HLBA 3M2KA 4WMCA 4PM6A 1SCWA 3OC2A 4U0XA 4QB8A 4BLMA 1PYYA 2Y2KA 3HUMA 3UN7A 5M18A 4S2NA 3N7WA 2QPNA 2HPBA 3N8RA 4KZ5A 4UHUA 1K6RA 4WMCD 5DVAA 4E3KA 2WADA 1MXOA 5JYPA 1KDWA 1RP5A 1YMXA 2ZQCA 4L0LA 4U0TA 3IT9A 2Y2IA 3AGFA 2XR0A 4N1HA 1WE4A 4HESA 2P9VB 3N6IA 2QMIA 3NBLA 5U47A 2ZQ7A 3UPNA 4QJGA 5A92A 1YLZA 3ZG9B 4F94A 5CRFA 2EFXA 4OOYA 1WYCA 3MXSA 4WYYA 1NY0A 4JPMA 2XD5A 4IBRA 1BLCA 1KVLA 4EBNA 1NZOA 4KQRA 1K25A 2Y55A 2UWXA 3UO9A 4E3JA 1L0FA 3PBRA 1KE0A 3SS3A 3WS1A 4FH2A 5JYOA 1QMFA 2JCHA 1K4EA 5GHZA 2C5WB 1S0WA 1BLHA 4GZBA 3A3IA 4P87A 1FOFA 4QU3A 3I7JA 1E4DA 5I94A 5HX9A 2Y2PA 4KZ9A 4B4XA 4XUZA 2CC1A 4H8RA 4KZAA 1KGEA 2XH9A 3GMWA 1ZKJA 2VGJA 1PW8A 3RXWA 3MZEA 3BM6A 3UY6A 5IHVA 5CHMA 3AGEA 5FQMA 1K55A 3WS4A 2XGNA 3IXGA 5FATA 4IVKA 5FI6A 2Q9MA 3QNBA 1XXMA 5FI7A 2X01A 4BENA 1LLBA 2Y2GA 3G34A 4S2KA 5KSCA 3ZCZA 3AGDA 1GHPA 3VP3A 1G68A 2A49A 2EXAA 4HEFA 1LI0A 3IQAA 4BD1A 3DW0A 4JKTA 1EI5A 3OPPA 2IWDA 1W79A 1ERMA 2G2UA 4FCFA 4QY5A 4S2JA 3A3JA 4S2MA 5EE8A 3W4PA 4DF6A 4Z9QA 4WZ5A 2Q9NA 1KE4A 4KQOA 4NETA 3ZVTA 1N4OA 2DNSA 1IEMA 3HUOA 2Y2QA 3BEBA 3UPOA 4OONA 1GA9A 4KG2A 3S1YA 4S2LA 1PIOA 2B5RA 3LO7A 1TVFA 1VM1A 3CJMA 4EQIA 4GKUA 1NZUA 1SDEA 5M19A 2Y2JA 3NIAA 4WELA 5DTSA 1DJCA 3BRMA 2WAFA 3C7UA 3M6BA 4IVIA 4OP5A 2HDQA 1LL9A 4DE2A 3O3VA 4B88A 1DJAA 4BQMA 2J7VA 5GL9A 3VP1A 5CGXA 2ZC4B 3PBOA 4O7DA 2V1ZA 4X68A 3WS0A 3ZG5A 1JWPA 4DKIA 4UA7A 5FA7A 2ZQDA 1ONGA 4KG6A 5FQ9A 3VP4A 3LEZA 4X53A 4ZDXA 1XP4A 3IF6B 3FWLA 4OQ0A 4GD6A 2ZC6B 1KVMA 4Y0UA 1LL5A 4YINA 4LCMA 2BLSA 5FAQA 4DRTA 5CTMA 4OP8A 1KDSA 2ZLYA 5F82A 3GV9A 3FZCA 4X56A 3MZFA 3ITAA 2WK0A 1M40A 4WZ4A 5GLBA 4X69A 3BFEA 1EWZA 5DTTA 2P9VA 3UPPA 2HDUA 3FKWA 1FR1A 1NYMA 4E3LA 2V20A 4X6TA 1XKZA 1PWGA 4QD4A 3PBTA 4GDBA 4JF6A 3OCLA 4D2OA 2XQZA 2PU4A 3V50A 1K56A 2ZC3B 3VFFA 2R9XA 1EROA 3DWZA 1E3UA 4KZ8A 4LENA 3OPLA 3M6HA 2HDSA 1CI8A 4MBHA 5HAIA 4GNUA 3UDFA 3UDXA 5DTKA 1GCEA 4P6BA 3BLSA 1SKFA 2HP9A 4ZTKA 1LHYA 3NI9A 5CXWA 5GHXA 5E2GA 3IF6C 3VOZA 1XA7A 4LV1A 1K54A 1HD8A 3S4XA 4GB7A 1KGGA 3PBNA 4R3JA 4S2IA 5HL1A 1ES5A 4GOGA 3Q7VA 1BT5A 3V3RA 4Q8IA 1E25A 1ZC2A 1CEFA 1XA1A 4JBFA 5EOEA 4DE3A 3C7VA 1BLSA 3C4PA 1BULA 3C5AA 3MZDA 4XUXA 5FDHA 4BD0A 4BJPA 1K56D 1L0EA 3IXBA 1H8ZA 4RVAA 4PM9A 2WGWA 2J8YA 2ZD8A 2IWBA 1BUEA 1QMEA 4C6YA 5HFOA 4OOLA 3VOYA 4PM5A 3M2JA 2OV5A 3TOIA 1BTLA 4NK3A 3HVFA 1YLYA 3UE3A 1MPLA 2ZC7A 4DXBA 2EX8A 5EVIC 2A3UA 3QHYA 2XF3A 3HBRA 1FCOA 3P98A 3EQVA 4K0WA 2EX9A 1PWCA 1K54C 1RCJA 2H0TA 3PAGA 4OVDA 3HLWA 4S2NC 1W7FA 4GDNA 3WRZA 4X55A 4DXCA 1W8QA 1IYQA 2WGVA 4WZ5C 5AQAA 3SH9A 3ZNTA 3ZNYA 4N9KA 4WM9A 4EBLA 1I5QA 1MWUA 2WKIA 3N8LA 2Y2HA 3V39A 2Y4AA 1FCMA 2BG1A 4JXGA 1SHVA 4N92A 5D3OA 3SH7A 3E2LA 5HAPA 5J8XA 5GLAA 4LV3A 1ESIA 3ZFZA 3HLFA 1LI9A 1NXYA 2ZMAA 4KZ3A 2PBYA 1N9BA 3MKFA 4PPRA 4ZJ2A 1Z6FA 5CEBA 4EV4A 4IBXA 1ONHA 1JWVA 2XEPA 3N8SA 1I2SA 3NC8A 5DF7A 4IEDA 2P74A 5HARA 3V5MA 2OLVA 4ZJ3A 2ZQ9A 4N1XA 3QNCA 5KZHA 1BZAA 3G35A 5G18A 4R23A 3TG9A 2ZM0A 1YMSA 1HZOA 4LV0A 1PWDA 4OQIA 3IH9A 5A91A 4JF5A 1H8YA 1K55C 1WYBA 4QY6A 4R0QA 1Q2QA 1HTZA 4Y0TA 1G6AA 3CMZA 3GR2A 1IKGA 2H10A 4K0XA 5CECA 3WRTA 3HUNA 2DRWA 3VFHA 3MKEA 3MFDA 5AQBA 4ZJ1A 2Y2NA 3CG5A 5FAPA 4OQHA 4PM7A 3BFDA 3NCKA 1XGJA 3BFCA 4S2PA 5EVID 3UE0A 2EX2A 2WGWB 5HW3A 1NJ4A 1MWRA 2R9WA 3W4OA 2XFSA 3C4OA 3NDEA 4ID4A 5M1AA 4C75A 3WS2A 1MKIA 1RGZA 3RJUA 4JXSA 5EVIA 1CK3A 4UA6A 3GTCA 1TEMA 1RGYA 2WKHA 3Q7ZA 4PM8A 3UDIA 1FR6A 1KE3A 2XDMA 4OPYA 2ZM8A 3IWOA 4E6XA 2Y91A 3SS4A 4OLGA 4HBTA 3G2ZA 3OPHA 3N4IA 1PI4A 5TR7A 1YLWA 4K91A 1IYOA 5FQJA 3MXRA 3Q82A 2E8IA 5KSHA 1PZPA 5TGFA 1TDGA 1YQSA 1K38A 3BFFA 4QHCA 5A93A 5F1FA 4XXRA 5EVLA 4JF4A 5HAQA 3BLMA 4OH0A 5FASA 1H5XA 2HP6A 3OCNA 4Y7PA 1ESUA 1Q2PA 2C6WB 4KENB 5GHYA 1O07A 1ES3A 1IKIA 1W5DA 2X71A 3ISGA 1JWZA 4LCLA
chains in the Genus database with same CATH superfamily
5J7EA 3TSGA 2OLUA 5EOOA 5EECA 1K57C 2W3GA 3PHYA 2XD1A 2YKHA 2WAEA 3O88A 1IYSA 2J3WA 3LIEA 2PDRA 3B42A 3CHWP 5EM0A 2X02A 2VV8A 1DRMA 3O5YA 4FTXA 4JXWA 2Y2OA 4BBUA 2B95A 1EW0A 3SS5A 2Z6DA 2W1RA 1IOUA 2WGIA 4FSFA 3ZG0A 4MBKA 2Z2LB 1F9IA 3LI8A 5DJUA 4L9EA 4E3IA 2DMWA 3QP8A 1FQGA 3A3DA 1LSXA 1XJ2A 1YM1A 3CZDA 1TDLA 5E2HA 5CGSA 2WZXA 3Q07A 3IHAA 4KUKA 4WEKA 5I5LA 2EFUA 4ME4A 1ZG4A 3VMAA 2JKFA 1CI9A 5CTNA 3GECA 3Q7VB 3T4LA 3DTKA 4R4SA 2HF6A 3IF6A 4H6JB 1XGIA 2WUQA 4Q0JA 1GHIA 1JVJA 4RX2A 1J9MA 5DKKA 3RXXA 4EEPA 2PYPA 3T1RA 5F5YA 3B47A 1ES4A 4R4RA 5CERA 3V67A 4XT2A 3JYIA 3O86A 3GRJA 4MBFA 3LEQA 1OMEA 4GJ4A 4HP9A 2R78A 5DF9A 3W4QA 3PBQA 1NLYA 3EGDC 3IXHA 4MNRA 1PZOA 1DJBA 2QKPA 3A3EA 3BYDA 3FV7A 2QZ6A 4RA7A 3S7QA 5F83A 5L10A 3RFBA 3NOPC 2XROA 5CHUA 5EVIB 3A3FA 4EQIA 3DWKA 1YSQA 4GN2A 1IYPA 1MWTA 4CPKA 4ETZA 2W3FA 5FSRA 1MWSA 4NXGA 2GJ3A 4WMCA 4PM6A 4U0XA 4QB8A 3S7PA 3MQOA 5M18A 4S2NA 3N7WA 4MN6A 4LGWA 4KZ5A 4UHUA 1K6RA 1HLUP 3IX4A 2ZQCA 3C2WA 1YSPA 2Y2IA 1WE4A 2QMIA 3HJIA 3UPNA 4L9GA 3MXSA 1NY0A 1NZOA 2B02A 1G28A 4HHDA 1P9WA 4P87A 2EA9A 3UB9A 5I94A 3LR3A 2Y2PA 3QP4A 2CC1A 2VK3A 1LSWA 3GMWA 1PW8A 3RXWA 5FQMA 3WS4A 2XGNA 4JGPA 4EUVA 4YOFA 3QNBA 1XXMA 3ZCZA 3VP3A 2EXAA 1LI0A 1D7EA 3OPPA 3LR0A 2IWDA 1ERMA 2G2UA 4FCFA 2YKFA 1TS8A 2Q9NA 2J80A 1KE4A 4NETA 1V9YA 2DNSA 2V0WA 2Y2QA 5DFXA 4KG2A 1IFQA 3S1YA 1VM1A 3JPUA 4GKUA 2O9AA 5M19A 3NIAA 4WELA 1DJCA 4I38A 3M6BA 4IVIA 3O3VA 5EM1A 4NG2A 4UQIS 4ESPA 3LICA 3NULA 4O7DA 1P0ZA 3VP4A 1UGUA 1ONGA 4KG6A 2ZQDA 4ZDXA 1XP4A 3IF6B 4H6JA 4GD6A 4Y0UA 3MMHA 4LCMA 2BLSA 2LB5A 3F1PB 3CPTB 1KDSA 2V8CA 3VE3A 2LB9A 1F98A 4X69A 1EWZA 3UPPA 1BYWA 2HDUA 1FR1A 4X6TA 4GDBA 4HH2A 3SZTA 1K56A 2ZC3B 2ZOIA 4LENA 3UB6A 5HAIA 1T1CA 3UDXA 3BLSA 1T19A 5CXWA 5GHXA 4JGQA 3KO6A 3VOZA 1XA7A 4LRYC 2PRFA 3PBNA 3V3RA 1E25A 2H28A 4BJPA 5F69A 2HJEA 1L0EA 4RVAA 4PM9A 2EWVA 4G3KA 5HFOA 2W3DA 2A3UA 3BW6A 2FH5A 4ARZA 1FCOA 1Z09A 3EQVA 2EX9A 2HGVA 3BJNA 1RCJA 2H0TA 3PAGA 3PXPA 3VV4A 1W7FA 2E8JA 4GDNA 4X55A 1W8QA 5AQAA 3SH9A 3T4QA 5D3OA 4L9FA 5EVEA 2VKSA 3RH8B 3MQQA 5L8MA 4Y3IA 3MKFA 1Z6FA 1JWVA 4ZRRA 3N8SA 1I2SA 1GSWA 2JKTM 3UE6A 3V5MA 2ZQ9A 3QNCA 1BZAA 4R23A 3TG9A 5A91A 1PWDA 5L09A 1WYBA 3ZQ5A 2A24B 2B18A 1DP8A 3CMZA 3GR2A 1IKGA 4K0XA 3VFHA 3MKEA 1J3WA 1W63M 4ZJ1A 4OQHA 3IBJA 4PM7A 2QYBA 3BFCA 1MWRA 3W4OA 3C4OA 4C75A 1MKIA 1RGZA 3KSFA 3E98A 4JXSA 4UA6A 1RGYA 5LBRA 1FR6A 4OPYA 2Y91A 4OLGA 3OPHA 3C30A 1UWPX 1PI4A 1YLWA 1ODVA 2E8IA 1PZPA 2KOIA 1TDGA 3F1NB 3D9YA 5HAQA 4JF4A 2VA0A 4KENB 2C6WB 5GHYA 1O07A 1W5DA 4FUWA 4LCLA 5HDSA 4OLDA 2VLGA 1N9NA 4KZBA 1PI5A 4JXVA 2QJ7A 4DJ2A 3PBSA 4I3AA 4OKPA 5C5KA 3HREA 2J9PA 4UEYA 4KG5A 5GLCA 4E3OA 3HCYA 1H8MA 4RYEA 4EBPA 1FILA 3R7WA 1MY8A 1G5UA 3UE1A 1XJ6A 3NDGA 5BOHA 1XJ4A 3SOIA 3MXQA 4BBTA 3OPRA 1YT4A 4EETB 5TBMA 3DAVA 2W1TA 4BL3A 3D4FA 1AXBA 3VP2A 4CJNA 3E4PA 3HLEA 4PKYG 4FD8A 4KZ6A 2KDKA 1TS0A 3JVUA 5FQKA 2Y2MA 1E3UD 4JLFA 5AQ9A 4KZ7A 4A5RA 2JKRM 2RCXA 3QP6A 4HJ4A 4E3NA 4HI4A 3FPVA 2OAP1 1IELA 1NRJA 2OWJA 4MN5A 1Y54A 4ZAMA 4HBUA 4MEZA 1FSWA 2PBDP 3PR6A 3PAEA 3GVBA 4WEJA 5TFQA 5F6AA 3LY3A 3G2YA 2WYXA 3ZG7B 2WZZA 5J4EA 3EWKA 2XK1A 3S22A 4ARZB 2XLNA 1L0DA 3DTIA 1O7EA 4Q0HA 2ZM2A 5EV0A 4DE1A 3LIFA 3UB8A 3P09A 4HH3A 2EXBA 3HLDA 1L2SA 1D06A 1GSVA 4EXOA 3NHQA 2V2FF 4WBGA 5CGWA 2O9BA 5AJGA 4E3MA 3H7WB 3IF5A 2H5SA 3LI9A 4YFMA 1FSYA 3HLBA 3M2KA 4HJ6A 1SCWA 3OC2A 3BY8A 1GSXA 1PYYA 2Y2KA 4R6LA 2HPBA 3CWFA 4WMCD 4HQAA 1KDWA 1RP5A 1YMXA 4I3JA 3AGFA 4NXFA 4N1HA 4DMZA 1T1AA 2ACGA 3EOIA 5U47A 1YLZA 4F3LA 5CRFA 2EFXA 4JPMA 4KQRA 1K25A 2UWXA 4WLAA 1MZUA 3UO9A 4MN7A 3H82B 1S0WA 2ZBBA 3I7JA 2NUTC 2XH9A 1ZKJA 3LIBA 2PR6A 2VGJA 2K31A 1S66L 3CAXA 4LRXC 1K55A 2BASA 1DP6A 2X01A 2Y2GA 4HEFA 3DW0A 4JKTA 4ETXA 1W79A 3W4PA 3A3JA 4DF6A 4WZ5A 2PD7A 1N4OA 3HUOA 5EFWA 4OONA 3IBRA 4LPZA 4CLCC 4M4XA 2J3TC 2B5RA 1LSVA 1Y4OA 3LO7A 1S1ZA 2Q0OA 4CLCB 1SDEA 2V0UA 3BRMA 4BQMA 4DN0A 3VP1A 5CGXA 2ZC4B 3PBOA 2V1ZA 1LL8A 4HY8A 3ZG5A 1JWPA 4UA7A 1KVMA 1LL5A 5FAQA 4OP8A 2ZOHA 2XA7M 3ICYA 1M40A 4IUHA 4I3IA 3TE8A 3BFEA 5DTTA 2P9VA 3BQAA 2V20A 3PYPA 1PWGA 2XQZA 4QWOA 3DWZA 1E3UA 4KZ8A 3M6HA 3L7HA 4MBHA 3UDFA 1GCEA 4LV1A 1HD8A 2GX5A 4UQIM 3S4XA 1KGGA 2EWWA 4BMWA 5FDSA 1Y28A 4HJ3A 3Q7VA 1CEFA 3C4PA 5KIZA 3C5AA 4XUXA 2VGLM 2P08A 1H8ZA 2WGWA 2J8YA 2ZD8A 4C6YA 4OOLA 3VOYA 3M2JA 3JVVA 2PR5A 2QHKA 3HVFA 1YLYA 3UE3A 2M7UA 3T4KA 5EVIC 2P7JA 5HD5A 1PWCA 3TW8A 4S2NC 4DXCA 4GHIB 1IYQA 4WZ5C 4LFUA 3ZNYA 1MWUA 2M1CA 3N8LA 3LFVA 1FCMA 1SHVA 1JNUA 2PYRA 1SKOB 3SH7A 3E2LA 1T18A 1NXYA 4MCWA 1N9BA 4ZJ2A 3ULFA 1D1JA 5CEBA 1ONHA 3NOTC 3T1SA 2OLVA 5HDCA 3D72A 2ZMFA 5G18A 1HZOA 4OQIA 1H8YA 4R0QA 4HOIA 1Q2QA 2JN7A 2GZAA 4YNRA 1WA9A 5CECA 4CLCD 3MFDA 3T4OA 3UE0A 2EX2A 2WGWB 5HW3A 2XFSA 5M1AA 3RJUA 5EVIA 4PKYA 3Q7ZA 4PM8A 1OTEA 1KE3A 2XDMA 2ZM8A 3G2ZA 2P04A 3MXRA 5TJJA 1YQSA 4IUKA 2PD8A 5A93A 4XXRA 5EVLA 2A24A 2HP6A 1T1BA 1CJFA 1MC0A 1IKIA 2VJWA 2X71A 5DF8A 2FFFB 1ES2A 1L3LA 5A90A 1SDNA 5HL6A 3ZVWA 2RL3A 1M6KA 3NY4A 3UB5P 1CEGA 1GHMA 5A8BA 2HDRA 1W8YA 3T4SA 1C3BA 4R3AA 5HZHA 1L0GA 4YWZA 3WWXA 1GA0A 3HLGA 3MR0A 4UAAA 3F1NA 1HVBA 1YLPA 3BFGA 2JC7A 3V3SA 5FAOA 3G4PA 3FYZA 3K3DA 2GDNA 3Q81A 5L07A 3VE4A 3C38A 1ZG6A 2L1MA 3A0VA 1ALQA 1KGFA 4Y17A 2XFTA 1YLJA 5E43A 4PMAA 1YLTA 4GCZA 2FFYA 4OPQA 3B33A 1XFNA 5DFYA 1VQQA 5FI2A 2H0YA 4EERA 3KSIA 5CHJA 4Q0IA 3GQZA 1BLPA 4CQHA 5AVFA 5G4YA 4BL2A 3A0SA 3BQ8A 3G30A 4LLOB 3IX8A 2VGKA 3IHBA 1XX2A 5FEFA 4LRZE 2IWCA 4KQDA 5HD3A 3ZHHA 1S6RA 3S7OA 1DY6A 1JTDA 4Y0OA 2W3HA 3G32A 4EU0A 3H7WA 3IWIA 3W8KA 3BECA 2NUPC 1DP9A 2ZC5B 3IWQA 1FCNA 1I2WA 1BSGA 4N9LA 3U4LP 2ZQ8A 3F1OA 1OT6A 2I72A 4EW7A 2L0WA 4C3QA 2XRNA 3EQUA 3Q1FA 4B9OA 5KMWA 2HZ5A 1H3QA 2WKEA 5F1GA 4RX3A 2JBFA 4P85A 3FG8A 4UA9A 2DCFA 4U3TA 5EUAA 3UMEA 4GD8A 3OBFA 5HWWA 3IXDA 3ZG8B 5E2FA 2ZQAA 3ZGAB 3T1QB 1N9LA 1S67L 4GHIA 4BLMA 1N9OA 2M7VA 3DBAA 4WL9A 3U2AA 1OTDA 5F68A 4L0LA 3IT9A 4X1MA 3KSHA 4HESA 4CLCE 2P9VB 5A92A 1VB6A 3ZG9B 4F94A 4OOYA 1WYCA 2XD5A 1BLCA 1KVLA 3EEAA 4E3JA 3PBRA 3WS1A 4FH2A 2JCHA 5GHZA 2C5WB 1BLHA 4GZBA 1FOFA 3KYQA 3GDIA 5HX9A 4KZ9A 4B4XA 1KGEA 4CLCA 1S1YA 3MZEA 3UY6A 2IA2A 1K0KA 5FI6A 4BENA 2KX6A 5KSCA 3AGDA 1GHPA 1S4SA 2Y79A 3R4KA 3IQAA 1EI5A 3IS2A 4RQ9A 4GS9A 1ZTUA 4Z9QA 2V9AA 3T1XA 2PAVP 4Z1WA 1GA9A 4Y13A 4S2LA 4EEUA 2VGLS 1VEUA 1NZUA 2Y2JA 3C7UA 2XSSA 4OP5A 1LL9A 3W2ZA 4DE2A 4B88A 1DJAA 5IS1A 2J7VA 5GL9A 3E4OA 1SKOA 3WS0A 4DKIA 5FA7A 2W0NA 3SW1A 3IX3A 5FQ9A 2O0YA 3FWLA 3KYZA 4OQ0A 4DRTA 4NKPA 5CTMA 5F82A 3GV9A 2O99A 3MZFA 2WK0A 5HDDA 5GLBA 5HWTA 3VOLA 4KUOA 1NYMA 4E3LA 1XKZA 1W63Q 3PBTA 4IHQA 3OCLA 2OAQ1 3E0YA 3MJQA 2HDSA 1CI8A 4GNUA 5DTKA 1SKFA 4ZTKA 5AVEA 5E2GA 3IF6C 2V1AA 1K54A 4GB7A 4S2IA 5FEGA 5HL1A 3UMDA 4GOGA 4MDZA 3FC7A 4Q8IA 5K5BA 1ZC2A 1XA1A 5EOEA 3OLOA 4DE3A 3C7VA 1BLSA 1BULA 5FDHA 5HSQA 4BD0A 3IXBA 2IWBA 1UWNX 2OV5A 3TOIA 4NK3A 2ZC7A 4NXEA 3QHYA 3HBRA 4K0WA 4MMNA 2INWA 3HLWA 3WRZA 3ZNTA 4N9KA 4WM9A 4EBLA 3V39A 2WKIA 2Y2HA 2Y4AA 3EEHA 4JXGA 4N92A 1VHMA 1A0KA 5HAPA 1ESIA 1LI9A 1PFLA 2A2LA 1XFQA 4PPRA 4EV4A 4IBXA 4R70A 2W1TB 2XEPA 3NC8A 2P74A 4IJGA 1NLZA 5KZHA 3BY9A 2OWHA 4LV0A 3CI6A 1K55C 2O9CA 2QWSA 1VETB 1HTZA 1G6AA 3LIAA 4E04A 2H10A 2QJ5A 5AQBA 3CG5A 3TRCA 1STZA 3LR4A 1XGJA 1LT0A 4WUJA 1NJ4A 3MS6A 2R9WA 3P7NA 1VEUB 3NDEA 1TS6A 3R7WB 3WS2A 2FZ0A 3UDIA 4HP4A 3IWOA 3EGXC 4E6XA 3SS4A 5IT5A 2D02A 3N4IA 5TR7A 1FIKA 4K91A 1IYOA 5FQJA 3Q82A 2OOLA 5KSHA 1K38A 4QHCA 3BLMA 4OH0A 3NOUC 3OCNA 4Y7PA 1ESUA 3F1PA 3ZFZA 3ISGA 2WKRA 4KZ4A 3UNWA 1X0OA 1XPBA 3B3XA 2HP5A 4Y15A 2JE5A 4GS9B 3O87A 4HIAA 3LR5A 4EUZA 2ZJ9A 4OQGA 2W3EA 2OSUA 4B4ZA 5HPIA 4FH4A 3CPTA 1K6SA 3RTYA 5L2FA 4GW9A 4M3KA 4P6ZM 1NRFA 1H0MA 3K2NA 4QPRA 2UV0E 3D3OA 1NYYA 1OTAA 3LGOA 4LV2A 1U60A 5E2EA 1PW1A 4EESA 3DTMA 1MKMA 3C8CA 3UB7A 1K57A 5AQ7A 4WF0A 3OZHA 3T4TA 2CMNA 3MBZA 2VX8A 4E6WA 3ZYTA 4DE0A 1CF0A 3VSLA 3VSKA 2J9OA 3SH8A 4DDSA 1K4FA 3LY4A 3E4QA 3MF0A 4K08A 4Y5FA 3NECA 4FOFA 2Y59A 2VV7A 1PNEA 2AVXA 3HL9A 4O0PA 4DDYA 3PTEA 1XJ3A 2Y2LA 5CEDA 5EPHA 4DJ3A 4EWFA 4P0MA 1OJ5A 5CX7A 2V1BA 1F2KA 5TBMB 1MBLA 3WS5A 3KSGA 4OPZA 2PU2A 4P6ZS 5GLDA 3MQ0A 4KQQA 4R3BA 2G2WA 2ZMVA 3H82A 5FQQA 2I9VA 3VP0A 4R1GA 3ITBA 4O8GA 4MLLA 4I39A 4Y2FA 3ZDJA 3E2KA 3FKVA 4S2OA 3HLCA 4ZBEA 3LCEA 3OOVA 3BWLA 1JTGA 4JGRA 3G31A 3IH8A 5HPFA 3CITA 5FQIA 5MC7A 1ERQA 4OPRA 2Z2MB 3GSGA 4OOMA 5DJTA 4F3LB 3T4JA 2EX6A 2Y8HA 4B93A 3CUEC 3HUMA 3UN7A 2QPNA 3N8RA 5DVAA 3F1OB 4E3KA 1MXOA 2WADA 5JYPA 4U0TA 2XR0A 2K7SA 2XA7S 3N6IA 3NBLA 1SZVA 2ZQ7A 4QJGA 4I5SA 4WYYA 2MJ6A 4IBRA 4EBNA 1F5MA 2Y55A 4II7A 1L0FA 1KE0A 3SS3A 4BWIA 2ZL1A 5JYOA 1QMFA 2WKPA 4O01A 1K4EA 5G4ZA 3A3IA 2PT7A 4QU3A 1E4DA 4XUZA 4H8RA 2D01A 4KZAA 2W27A 3NJAA 2K2NA 3BM6A 5IHVA 5CHMA 3AGEA 2ZL1B 3FPWA 3IXGA 1G6OA 5FATA 4IVKA 2Q9MA 5FI7A 1ACFA 1LLBA 3G34A 4S2KA 4X25A 3LIDA 1G68A 2A49A 4X1LA 4BD1A 1OTIA 4S2MA 1YPRA 4S2JA 5EE8A 2HV1A 4QY5A 5HWVA 4BBVA 4KQOA 3ZVTA 3LUQA 1IEMA 3BEBA 3P01A 3UPOA 2G7UA 2HJ9C 3QP5A 1TF1A 1PIOA 1TD5A 2GNXA 1TVFA 3CJMA 3DTEA 5DTSA 1TS7A 2WAFA 2HDQA 2J3TD 1PRQA 4X68A 1VETA 3MSHA 3QP2A 3LEZA 4X53A 2ZC6B 3S7NA 4YINA 1AWIA 4R38A 2ZLYA 3QP1A 2WKQA 3HJKA 3FZCA 4JGOA 4X56A 3ITAA 3T12B 4WZ4A 3FKWA 4QD4A 4JF6A 4D2OA 4NXBA 3TJZC 2PU4A 3V50A 3VFFA 2R9XA 1EROA 2BTFP 3OPLA 3L9KA 4HNBA 2VZWA 4P6BA 2HP9A 1LHYA 3NI9A 5FL3A 4EQ1A 3MFXA 4R3JA 4AFIA 4G3VA 1ES5A 1BT5A 4JBFA 3IS2B 1OPXA 3A0RA 3MZDA 3LYXA 1K56D 1YKDA 3KYEA 3CUEA 1BUEA 1QMEA 1CQAA 1OTBA 4PM5A 1BTLA 2VV6A 1MPLA 4DXBA 2VEAA 5IU1A 2EX8A 2XF3A 2JKGA 3P98A 1K54C 4OVDA 1KOUA 2L4RA 4GLQA 1S4RA 2WGVA 4D60A 1I5QA 2BG1A 4XT2B 5J8XA 5GLAA 4LV3A 3HLFA 2ZMAA 4KZ3A 2PBYA 3H9WA 4WN5A 2Z6CA 2KLIA 5DF7A 1OJGA 3G6OA 4IEDA 5HARA 5DKLA 4ZJ3A 4N1XA 3G35A 2V8FA 2ZM0A 1YMSA 3IH9A 4JF5A 4QY6A 1P97A 1NWZA 3K3CA 4Y0TA 3WRTA 3HUNA 2DRWA 4NEED 2Y2NA 5FAPA 2JHEA 1ZHHB 1P9RA 3BFDA 3NCKA 4S2PA 5EVID 1OT9A 4ID4A 1YAXA 1CK3A 2JKTI 3GTCA 1TEMA 1V9ZA 2WKHA 2JKRI 3T50A 2PHYA 4HBTA 4PAUA 4G3WA 3KX0X 4PHTA 5TGFA 5J3WA 3BFFA 5F1FA 3CLOA 5FASA 1H5XA 1Q2PA 1ES3A 1JWZA
chains in the Genus database with same CATH topology
2FFFB 1ES2A 3TSGA 2OLUA 4KZ4A 4OLDA 5EOOA 5EECA 3UNWA 1XPBA 3B3XA 2HP5A 4KZBA 1K57C 1PI5A 2JE5A 5A90A 4JXVA 1SDNA 3ZVWA 2XD1A 2RL3A 3O87A 4EUZA 1M6KA 3NY4A 2ZJ9A 1CEGA 2WAEA 3O88A 4OQGA 2OSUA 1GHMA 4B4ZA 1IYSA 3PBSA 4FH4A 4OKPA 2HDRA 3HREA 1W8YA 1K6SA 2J9PA 1C3BA 5L2FA 4KG5A 4M3KA 5GLCA 1NRFA 2X02A 1L0GA 4E3OA 4RYEA 1NYYA 4JXWA 4EBPA 2Y2OA 3WWXA 1GA0A 3HLGA 4UAAA 1HVBA 1YLPA 1MY8A 4LV2A 3SS5A 3UE1A 3NDGA 1U60A 2JC7A 3BFGA 5E2EA 3V3SA 1PW1A 5FAOA 3DTMA 3G4PA 5BOHA 3FYZA 1K57A 2WGIA 4FSFA 5AQ7A 3SOIA 4MBKA 3ZG0A 2Z2LB 3OPRA 1YT4A 3OZHA 2GDNA 3Q81A 3MBZA 4E3IA 1FQGA 3A3DA 1ZG6A 4BL3A 3D4FA 4E6WA 1ALQA 4DE0A 1KGFA 1YM1A 3VSLA 3VSKA 1AXBA 3CZDA 2J9OA 2XFTA 1YLJA 5E43A 3SH8A 3VP2A 1TDLA 3HLEA 4PMAA 4CJNA 1YLTA 1K4FA 4DDSA 3LY4A 5E2HA 5CGSA 2FFYA 2WZXA 3Q07A 3IHAA 4FD8A 4KZ6A 4OPQA 4WEKA 2EFUA 1VQQA 1ZG4A 5FI2A 5FQKA 2Y2MA 3VMAA 1E3UD 2H0YA 5CTNA 1CI9A 4JLFA 2Y59A 3Q7VB 5AQ9A 5CHJA 4R4SA 4KZ7A 3GQZA 4A5RA 1BLPA 2RCXA 3IF6A 5DF8A 3HL9A 1XGIA 2WUQA 4BL2A 1GHIA 1JVJA 4DDYA 3G30A 4RX2A 4E3NA 2VGKA 3PTEA 1J9MA 1IELA 2Y2LA 3IHBA 1XX2A 3RXXA 5CEDA 5EPHA 1Y54A 2IWCA 4EWFA 4ZAMA 4P0MA 4HBUA 4MEZA 1FSWA 1ES4A 3PAEA 4R4RA 1S6RA 5CERA 3ZHHA 3GVBA 1DY6A 1JTDA 3JYIA 3O86A 3GRJA 4Y0OA 4MBFA 1MBLA 3G32A 4WEJA 3WS5A 1OMEA 5TFQA 3LY3A 3G2YA 4OPZA 3IWIA 2PU2A 2WYXA 5DF9A 2WZZA 5GLDA 3W4QA 3W8KA 3ZG7B 3BECA 2XK1A 3S22A 2XLNA 4KQQA 3PBQA 4R3BA 3IXHA 2G2WA 2ZC5B 5FQQA 4MNRA 3IWQA 1L0DA 1PZOA 3VP0A 1FCNA 1I2WA 1BSGA 1DJBA 4N9LA 2ZQ8A 4R1GA 1O7EA 3ITBA 3A3EA 2I72A 2ZM2A 3BYDA 3FV7A 2QZ6A 4MLLA 4RA7A 4C3QA 3Q1FA 3EQUA 3ZDJA 4DE1A 3E2KA 3FKVA 4S2OA 3HLCA 4ZBEA 5F83A 3P09A 5KMWA 5F1GA 2WKEA 3LCEA 4RX3A 2EXBA 5CHUA 5EVIB 2JBFA 3HLDA 1JTGA 1L2SA 2DCFA 3A3FA 3G31A 3DWKA 3IH8A 4P85A 4U3TA 4UA9A 5EUAA 5FQIA 2V2FF 4GD8A 4WBGA 5CGWA 4GN2A 3IXDA 3ZG8B 1ERQA 4OPRA 1IYPA 1MWTA 2Z2MB 4CPKA 4E3MA 3IF5A 5E2FA 3GSGA 2H5SA 5FSRA 1MWSA 4OOMA 2ZQAA 3ZGAB 4YFMA 1FSYA 2EX6A 3HLBA 3M2KA 4WMCA 4PM6A 1SCWA 3OC2A 4U0XA 4QB8A 4BLMA 1PYYA 2Y2KA 3HUMA 3UN7A 5M18A 4S2NA 3N7WA 2QPNA 2HPBA 3N8RA 4KZ5A 4UHUA 1K6RA 4WMCD 5DVAA 4E3KA 2WADA 1MXOA 5JYPA 1KDWA 1RP5A 1YMXA 2ZQCA 4L0LA 4U0TA 3IT9A 2Y2IA 3AGFA 2XR0A 4N1HA 1WE4A 4HESA 2P9VB 3N6IA 2QMIA 3NBLA 5U47A 2ZQ7A 3UPNA 4QJGA 5A92A 1YLZA 3ZG9B 4F94A 5CRFA 2EFXA 4OOYA 1WYCA 3MXSA 4WYYA 1NY0A 4JPMA 2XD5A 4IBRA 1BLCA 1KVLA 4EBNA 1NZOA 4KQRA 1K25A 2Y55A 2UWXA 3UO9A 4E3JA 1L0FA 3PBRA 1KE0A 3SS3A 3WS1A 4FH2A 5JYOA 1QMFA 2JCHA 1K4EA 5GHZA 2C5WB 1S0WA 1BLHA 4GZBA 3A3IA 4P87A 1FOFA 4QU3A 3I7JA 1E4DA 5I94A 5HX9A 2Y2PA 4KZ9A 4B4XA 4XUZA 2CC1A 4H8RA 4KZAA 1KGEA 2XH9A 3GMWA 1ZKJA 2VGJA 1PW8A 3RXWA 3MZEA 3BM6A 3UY6A 5IHVA 5CHMA 3AGEA 5FQMA 1K55A 3WS4A 2XGNA 3IXGA 5FATA 4IVKA 5FI6A 2Q9MA 3QNBA 1XXMA 5FI7A 2X01A 4BENA 1LLBA 2Y2GA 3G34A 4S2KA 5KSCA 3ZCZA 3AGDA 1GHPA 3VP3A 1G68A 2A49A 2EXAA 4HEFA 1LI0A 3IQAA 4BD1A 3DW0A 4JKTA 1EI5A 3OPPA 2IWDA 1W79A 1ERMA 2G2UA 4FCFA 4QY5A 4S2JA 3A3JA 4S2MA 5EE8A 3W4PA 4DF6A 4Z9QA 4WZ5A 2Q9NA 1KE4A 4KQOA 4NETA 3ZVTA 1N4OA 2DNSA 1IEMA 3HUOA 2Y2QA 3BEBA 3UPOA 4OONA 1GA9A 4KG2A 3S1YA 4S2LA 1PIOA 2B5RA 3LO7A 1TVFA 1VM1A 3CJMA 4EQIA 4GKUA 1NZUA 1SDEA 5M19A 2Y2JA 3NIAA 4WELA 5DTSA 1DJCA 3BRMA 2WAFA 3C7UA 3M6BA 4IVIA 4OP5A 2HDQA 1LL9A 4DE2A 3O3VA 4B88A 1DJAA 4BQMA 2J7VA 5GL9A 3VP1A 5CGXA 2ZC4B 3PBOA 4O7DA 2V1ZA 4X68A 3WS0A 3ZG5A 1JWPA 4DKIA 4UA7A 5FA7A 2ZQDA 1ONGA 4KG6A 5FQ9A 3VP4A 3LEZA 4X53A 4ZDXA 1XP4A 3IF6B 3FWLA 4OQ0A 4GD6A 2ZC6B 1KVMA 4Y0UA 1LL5A 4YINA 4LCMA 2BLSA 5FAQA 4DRTA 5CTMA 4OP8A 1KDSA 2ZLYA 5F82A 3GV9A 3FZCA 4X56A 3MZFA 3ITAA 2WK0A 1M40A 4WZ4A 5GLBA 4X69A 3BFEA 1EWZA 5DTTA 2P9VA 3UPPA 2HDUA 3FKWA 1FR1A 1NYMA 4E3LA 2V20A 4X6TA 1XKZA 1PWGA 4QD4A 3PBTA 4GDBA 4JF6A 3OCLA 4D2OA 2XQZA 2PU4A 3V50A 1K56A 2ZC3B 3VFFA 2R9XA 1EROA 3DWZA 1E3UA 4KZ8A 4LENA 3OPLA 3M6HA 2HDSA 1CI8A 4MBHA 5HAIA 4GNUA 3UDFA 3UDXA 5DTKA 1GCEA 4P6BA 3BLSA 1SKFA 2HP9A 4ZTKA 1LHYA 3NI9A 5CXWA 5GHXA 5E2GA 3IF6C 3VOZA 1XA7A 4LV1A 1K54A 1HD8A 3S4XA 4GB7A 1KGGA 3PBNA 4R3JA 4S2IA 5HL1A 1ES5A 4GOGA 3Q7VA 1BT5A 3V3RA 4Q8IA 1E25A 1ZC2A 1CEFA 1XA1A 4JBFA 5EOEA 4DE3A 3C7VA 1BLSA 3C4PA 1BULA 3C5AA 3MZDA 4XUXA 5FDHA 4BD0A 4BJPA 1K56D 1L0EA 3IXBA 1H8ZA 4RVAA 4PM9A 2WGWA 2J8YA 2ZD8A 2IWBA 1BUEA 1QMEA 4C6YA 5HFOA 4OOLA 3VOYA 4PM5A 3M2JA 2OV5A 3TOIA 1BTLA 4NK3A 3HVFA 1YLYA 3UE3A 1MPLA 2ZC7A 4DXBA 2EX8A 5EVIC 2A3UA 3QHYA 2XF3A 3HBRA 1FCOA 3P98A 3EQVA 4K0WA 2EX9A 1PWCA 1K54C 1RCJA 2H0TA 3PAGA 4OVDA 3HLWA 4S2NC 1W7FA 4GDNA 3WRZA 4X55A 4DXCA 1W8QA 1IYQA 2WGVA 4WZ5C 5AQAA 3SH9A 3ZNTA 3ZNYA 4N9KA 4WM9A 4EBLA 1I5QA 1MWUA 2WKIA 3N8LA 2Y2HA 3V39A 2Y4AA 1FCMA 2BG1A 4JXGA 1SHVA 4N92A 5D3OA 3SH7A 3E2LA 5HAPA 5J8XA 5GLAA 4LV3A 1ESIA 3ZFZA 3HLFA 1LI9A 1NXYA 2ZMAA 4KZ3A 2PBYA 1N9BA 3MKFA 4PPRA 4ZJ2A 1Z6FA 5CEBA 4EV4A 4IBXA 1ONHA 1JWVA 2XEPA 3N8SA 1I2SA 3NC8A 5DF7A 4IEDA 2P74A 5HARA 3V5MA 2OLVA 4ZJ3A 2ZQ9A 4N1XA 3QNCA 5KZHA 1BZAA 3G35A 5G18A 4R23A 3TG9A 2ZM0A 1YMSA 1HZOA 4LV0A 1PWDA 4OQIA 3IH9A 5A91A 4JF5A 1H8YA 1K55C 1WYBA 4QY6A 4R0QA 1Q2QA 1HTZA 4Y0TA 1G6AA 3CMZA 3GR2A 1IKGA 2H10A 4K0XA 5CECA 3WRTA 3HUNA 2DRWA 3VFHA 3MKEA 3MFDA 5AQBA 4ZJ1A 2Y2NA 3CG5A 5FAPA 4OQHA 4PM7A 3BFDA 3NCKA 1XGJA 3BFCA 4S2PA 5EVID 3UE0A 2EX2A 2WGWB 5HW3A 1NJ4A 1MWRA 2R9WA 3W4OA 2XFSA 3C4OA 3NDEA 4ID4A 5M1AA 4C75A 3WS2A 1MKIA 1RGZA 3RJUA 4JXSA 5EVIA 1CK3A 4UA6A 3GTCA 1TEMA 1RGYA 2WKHA 3Q7ZA 4PM8A 3UDIA 1FR6A 1KE3A 2XDMA 4OPYA 2ZM8A 3IWOA 4E6XA 2Y91A 3SS4A 4OLGA 4HBTA 3G2ZA 3OPHA 3N4IA 1PI4A 5TR7A 1YLWA 4K91A 1IYOA 5FQJA 3MXRA 3Q82A 2E8IA 5KSHA 1PZPA 5TGFA 1TDGA 1YQSA 1K38A 3BFFA 4QHCA 5A93A 5F1FA 4XXRA 5EVLA 4JF4A 5HAQA 3BLMA 4OH0A 5FASA 1H5XA 2HP6A 3OCNA 4Y7PA 1ESUA 1Q2PA 2C6WB 4KENB 5GHYA 1O07A 1ES3A 1IKIA 1W5DA 2X71A 3ISGA 1JWZA 4LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFF B;  1ES2 A;  3TSG A;  2OLU A;  4KZ4 A;  4OLD A;  5EOO A;  5EEC A;  3UNW A;  1XPB A;  3B3X A;  2HP5 A;  4KZB A;  1K57 C;  1PI5 A;  2JE5 A;  5A90 A;  4JXV A;  1SDN A;  3ZVW A;  2XD1 A;  2RL3 A;  3O87 A;  4EUZ A;  1M6K A;  3NY4 A;  2ZJ9 A;  1CEG A;  2WAE A;  3O88 A;  4OQG A;  2OSU A;  1GHM A;  4B4Z A;  1IYS A;  3PBS A;  4FH4 A;  4OKP A;  2HDR A;  3HRE A;  1W8Y A;  1K6S A;  2J9P A;  1C3B A;  5L2F A;  4KG5 A;  4M3K A;  5GLC A;  1NRF A;  2X02 A;  1L0G A;  4E3O A;  4RYE A;  1NYY A;  4JXW A;  4EBP A;  2Y2O A;  3WWX A;  1GA0 A;  3HLG A;  4UAA A;  1HVB A;  1YLP A;  1MY8 A;  4LV2 A;  3SS5 A;  3UE1 A;  3NDG A;  1U60 A;  2JC7 A;  3BFG A;  5E2E A;  3V3S A;  1PW1 A;  5FAO A;  3DTM A;  3G4P A;  5BOH A;  3FYZ A;  1K57 A;  2WGI A;  4FSF A;  5AQ7 A;  3SOI A;  4MBK A;  3ZG0 A;  2Z2L B;  3OPR A;  1YT4 A;  3OZH A;  2GDN A;  3Q81 A;  3MBZ A;  4E3I A;  1FQG A;  3A3D A;  1ZG6 A;  4BL3 A;  3D4F A;  4E6W A;  1ALQ A;  4DE0 A;  1KGF A;  1YM1 A;  3VSL A;  3VSK A;  1AXB A;  3CZD A;  2J9O A;  2XFT A;  1YLJ A;  5E43 A;  3SH8 A;  3VP2 A;  1TDL A;  3HLE A;  4PMA A;  4CJN A;  1YLT A;  1K4F A;  4DDS A;  3LY4 A;  5E2H A;  5CGS A;  2FFY A;  2WZX A;  3Q07 A;  3IHA A;  4FD8 A;  4KZ6 A;  4OPQ A;  4WEK A;  2EFU A;  1VQQ A;  1ZG4 A;  5FI2 A;  5FQK A;  2Y2M A;  3VMA A;  1E3U D;  2H0Y A;  5CTN A;  1CI9 A;  4JLF A;  2Y59 A;  3Q7V B;  5AQ9 A;  5CHJ A;  4R4S A;  4KZ7 A;  3GQZ A;  4A5R A;  1BLP A;  2RCX A;  3IF6 A;  5DF8 A;  3HL9 A;  1XGI A;  2WUQ A;  4BL2 A;  1GHI A;  1JVJ A;  4DDY A;  3G30 A;  4RX2 A;  4E3N A;  2VGK A;  3PTE A;  1J9M A;  1IEL A;  2Y2L A;  3IHB A;  1XX2 A;  3RXX A;  5CED A;  5EPH A;  1Y54 A;  2IWC A;  4EWF A;  4ZAM A;  4P0M A;  4HBU A;  4MEZ A;  1FSW A;  1ES4 A;  3PAE A;  4R4R A;  1S6R A;  5CER A;  3ZHH A;  3GVB A;  1DY6 A;  1JTD A;  3JYI A;  3O86 A;  3GRJ A;  4Y0O A;  4MBF A;  1MBL A;  3G32 A;  4WEJ A;  3WS5 A;  1OME A;  5TFQ A;  3LY3 A;  3G2Y A;  4OPZ A;  3IWI A;  2PU2 A;  2WYX A;  5DF9 A;  2WZZ A;  5GLD A;  3W4Q A;  3W8K A;  3ZG7 B;  3BEC A;  2XK1 A;  3S22 A;  2XLN A;  4KQQ A;  3PBQ A;  4R3B A;  3IXH A;  2G2W A;  2ZC5 B;  5FQQ A;  4MNR A;  3IWQ A;  1L0D A;  1PZO A;  3VP0 A;  1FCN A;  1I2W A;  1BSG A;  1DJB A;  4N9L A;  2ZQ8 A;  4R1G A;  1O7E A;  3ITB A;  3A3E A;  2I72 A;  2ZM2 A;  3BYD A;  3FV7 A;  2QZ6 A;  4MLL A;  4RA7 A;  4C3Q A;  3Q1F A;  3EQU A;  3ZDJ A;  4DE1 A;  3E2K A;  3FKV A;  4S2O A;  3HLC A;  4ZBE A;  5F83 A;  3P09 A;  5KMW A;  5F1G A;  2WKE A;  3LCE A;  4RX3 A;  2EXB A;  5CHU A;  5EVI B;  2JBF A;  3HLD A;  1JTG A;  1L2S A;  2DCF A;  3A3F A;  3G31 A;  3DWK A;  3IH8 A;  4P85 A;  4U3T A;  4UA9 A;  5EUA A;  5FQI A;  2V2F F;  4GD8 A;  4WBG A;  5CGW A;  4GN2 A;  3IXD A;  3ZG8 B;  1ERQ A;  4OPR A;  1IYP A;  1MWT A;  2Z2M B;  4CPK A;  4E3M A;  3IF5 A;  5E2F A;  3GSG A;  2H5S A;  5FSR A;  1MWS A;  4OOM A;  2ZQA A;  3ZGA B;  4YFM A;  1FSY A;  2EX6 A;  3HLB A;  3M2K A;  4WMC A;  4PM6 A;  1SCW A;  3OC2 A;  4U0X A;  4QB8 A;  4BLM A;  1PYY A;  2Y2K A;  3HUM A;  3UN7 A;  5M18 A;  4S2N A;  3N7W A;  2QPN A;  2HPB A;  3N8R A;  4KZ5 A;  4UHU A;  1K6R A;  4WMC D;  5DVA A;  4E3K A;  2WAD A;  1MXO A;  5JYP A;  1KDW A;  1RP5 A;  1YMX A;  2ZQC A;  4L0L A;  4U0T A;  3IT9 A;  2Y2I A;  3AGF A;  2XR0 A;  4N1H A;  1WE4 A;  4HES A;  2P9V B;  3N6I A;  2QMI A;  3NBL A;  5U47 A;  2ZQ7 A;  3UPN A;  4QJG A;  5A92 A;  1YLZ A;  3ZG9 B;  4F94 A;  5CRF A;  2EFX A;  4OOY A;  1WYC A;  3MXS A;  4WYY A;  1NY0 A;  4JPM A;  2XD5 A;  4IBR A;  1BLC A;  1KVL A;  4EBN A;  1NZO A;  4KQR A;  1K25 A;  2Y55 A;  2UWX A;  3UO9 A;  4E3J A;  1L0F A;  3PBR A;  1KE0 A;  3SS3 A;  3WS1 A;  4FH2 A;  5JYO A;  1QMF A;  2JCH A;  1K4E A;  5GHZ A;  2C5W B;  1S0W A;  1BLH A;  4GZB A;  3A3I A;  4P87 A;  1FOF A;  4QU3 A;  3I7J A;  1E4D A;  5I94 A;  5HX9 A;  2Y2P A;  4KZ9 A;  4B4X A;  4XUZ A;  2CC1 A;  4H8R A;  4KZA A;  1KGE A;  2XH9 A;  3GMW A;  1ZKJ A;  2VGJ A;  1PW8 A;  3RXW A;  3MZE A;  3BM6 A;  3UY6 A;  5IHV A;  5CHM A;  3AGE A;  5FQM A;  1K55 A;  3WS4 A;  2XGN A;  3IXG A;  5FAT A;  4IVK A;  5FI6 A;  2Q9M A;  3QNB A;  1XXM A;  5FI7 A;  2X01 A;  4BEN A;  1LLB A;  2Y2G A;  3G34 A;  4S2K A;  5KSC A;  3ZCZ A;  3AGD A;  1GHP A;  3VP3 A;  1G68 A;  2A49 A;  2EXA A;  4HEF A;  1LI0 A;  3IQA A;  4BD1 A;  3DW0 A;  4JKT A;  1EI5 A;  3OPP A;  2IWD A;  1W79 A;  1ERM A;  2G2U A;  4FCF A;  4QY5 A;  4S2J A;  3A3J A;  4S2M A;  5EE8 A;  3W4P A;  4DF6 A;  4Z9Q A;  4WZ5 A;  2Q9N A;  1KE4 A;  4KQO A;  4NET A;  3ZVT A;  1N4O A;  2DNS A;  1IEM A;  3HUO A;  2Y2Q A;  3BEB A;  3UPO A;  4OON A;  1GA9 A;  4KG2 A;  3S1Y A;  4S2L A;  1PIO A;  2B5R A;  3LO7 A;  1TVF A;  1VM1 A;  3CJM A;  4EQI A;  4GKU A;  1NZU A;  1SDE A;  5M19 A;  2Y2J A;  3NIA A;  4WEL A;  5DTS A;  1DJC A;  3BRM A;  2WAF A;  3C7U A;  3M6B A;  4IVI A;  4OP5 A;  2HDQ A;  1LL9 A;  4DE2 A;  3O3V A;  4B88 A;  1DJA A;  4BQM A;  2J7V A;  5GL9 A;  3VP1 A;  5CGX A;  2ZC4 B;  3PBO A;  4O7D A;  2V1Z A;  4X68 A;  3WS0 A;  3ZG5 A;  1JWP A;  4DKI A;  4UA7 A;  5FA7 A;  2ZQD A;  1ONG A;  4KG6 A;  5FQ9 A;  3VP4 A;  3LEZ A;  4X53 A;  4ZDX A;  1XP4 A;  3IF6 B;  3FWL A;  4OQ0 A;  4GD6 A;  2ZC6 B;  1KVM A;  4Y0U A;  1LL5 A;  4YIN A;  4LCM A;  2BLS A;  5FAQ A;  4DRT A;  5CTM A;  4OP8 A;  1KDS A;  2ZLY A;  5F82 A;  3GV9 A;  3FZC A;  4X56 A;  3MZF A;  3ITA A;  2WK0 A;  1M40 A;  4WZ4 A;  5GLB A;  4X69 A;  3BFE A;  1EWZ A;  5DTT A;  2P9V A;  3UPP A;  2HDU A;  3FKW A;  1FR1 A;  1NYM A;  4E3L A;  2V20 A;  4X6T A;  1XKZ A;  1PWG A;  4QD4 A;  3PBT A;  4GDB A;  4JF6 A;  3OCL A;  4D2O A;  2XQZ A;  2PU4 A;  3V50 A;  1K56 A;  2ZC3 B;  3VFF A;  2R9X A;  1ERO A;  3DWZ A;  1E3U A;  4KZ8 A;  4LEN A;  3OPL A;  3M6H A;  2HDS A;  1CI8 A;  4MBH A;  5HAI A;  4GNU A;  3UDF A;  3UDX A;  5DTK A;  1GCE A;  4P6B A;  3BLS A;  1SKF A;  2HP9 A;  4ZTK A;  1LHY A;  3NI9 A;  5CXW A;  5GHX A;  5E2G A;  3IF6 C;  3VOZ A;  1XA7 A;  4LV1 A;  1K54 A;  1HD8 A;  3S4X A;  4GB7 A;  1KGG A;  3PBN A;  4R3J A;  4S2I A;  5HL1 A;  1ES5 A;  4GOG A;  3Q7V A;  1BT5 A;  3V3R A;  4Q8I A;  1E25 A;  1ZC2 A;  1CEF A;  1XA1 A;  4JBF A;  5EOE A;  4DE3 A;  3C7V A;  1BLS A;  3C4P A;  1BUL A;  3C5A A;  3MZD A;  4XUX A;  5FDH A;  4BD0 A;  4BJP A;  1K56 D;  1L0E A;  3IXB A;  1H8Z A;  4RVA A;  4PM9 A;  2WGW A;  2J8Y A;  2ZD8 A;  2IWB A;  1BUE A;  1QME A;  4C6Y A;  5HFO A;  4OOL A;  3VOY A;  4PM5 A;  3M2J A;  2OV5 A;  3TOI A;  1BTL A;  4NK3 A;  3HVF A;  1YLY A;  3UE3 A;  1MPL A;  2ZC7 A;  4DXB A;  2EX8 A;  5EVI C;  2A3U A;  3QHY A;  2XF3 A;  3HBR A;  1FCO A;  3P98 A;  3EQV A;  4K0W A;  2EX9 A;  1PWC A;  1K54 C;  1RCJ A;  2H0T A;  3PAG A;  4OVD A;  3HLW A;  4S2N C;  1W7F A;  4GDN A;  3WRZ A;  4X55 A;  4DXC A;  1W8Q A;  1IYQ A;  2WGV A;  4WZ5 C;  5AQA A;  3SH9 A;  3ZNT A;  3ZNY A;  4N9K A;  4WM9 A;  4EBL A;  1I5Q A;  1MWU A;  2WKI A;  3N8L A;  2Y2H A;  3V39 A;  2Y4A A;  1FCM A;  2BG1 A;  4JXG A;  1SHV A;  4N92 A;  5D3O A;  3SH7 A;  3E2L A;  5HAP A;  5J8X A;  5GLA A;  4LV3 A;  1ESI A;  3ZFZ A;  3HLF A;  1LI9 A;  1NXY A;  2ZMA A;  4KZ3 A;  2PBY A;  1N9B A;  3MKF A;  4PPR A;  4ZJ2 A;  1Z6F A;  5CEB A;  4EV4 A;  4IBX A;  1ONH A;  1JWV A;  2XEP A;  3N8S A;  1I2S A;  3NC8 A;  5DF7 A;  4IED A;  2P74 A;  5HAR A;  3V5M A;  2OLV A;  4ZJ3 A;  2ZQ9 A;  4N1X A;  3QNC A;  5KZH A;  1BZA A;  3G35 A;  5G18 A;  4R23 A;  3TG9 A;  2ZM0 A;  1YMS A;  1HZO A;  4LV0 A;  1PWD A;  4OQI A;  3IH9 A;  5A91 A;  4JF5 A;  1H8Y A;  1K55 C;  1WYB A;  4QY6 A;  4R0Q A;  1Q2Q A;  1HTZ A;  4Y0T A;  1G6A A;  3CMZ A;  3GR2 A;  1IKG A;  2H10 A;  4K0X A;  5CEC A;  3WRT A;  3HUN A;  2DRW A;  3VFH A;  3MKE A;  3MFD A;  5AQB A;  4ZJ1 A;  2Y2N A;  3CG5 A;  5FAP A;  4OQH A;  4PM7 A;  3BFD A;  3NCK A;  1XGJ A;  3BFC A;  4S2P A;  5EVI D;  3UE0 A;  2EX2 A;  2WGW B;  5HW3 A;  1NJ4 A;  1MWR A;  2R9W A;  3W4O A;  2XFS A;  3C4O A;  3NDE A;  4ID4 A;  5M1A A;  4C75 A;  3WS2 A;  1MKI A;  1RGZ A;  3RJU A;  4JXS A;  5EVI A;  1CK3 A;  4UA6 A;  3GTC A;  1TEM A;  1RGY A;  2WKH A;  3Q7Z A;  4PM8 A;  3UDI A;  1FR6 A;  1KE3 A;  2XDM A;  4OPY A;  2ZM8 A;  3IWO A;  4E6X A;  2Y91 A;  3SS4 A;  4OLG A;  4HBT A;  3G2Z A;  3OPH A;  3N4I A;  1PI4 A;  5TR7 A;  1YLW A;  4K91 A;  1IYO A;  5FQJ A;  3MXR A;  3Q82 A;  2E8I A;  5KSH A;  1PZP A;  5TGF A;  1TDG A;  1YQS A;  1K38 A;  3BFF A;  4QHC A;  5A93 A;  5F1F A;  4XXR A;  5EVL A;  4JF4 A;  5HAQ A;  3BLM A;  4OH0 A;  5FAS A;  1H5X A;  2HP6 A;  3OCN A;  4Y7P A;  1ESU A;  1Q2P A;  2C6W B;  4KEN B;  5GHY A;  1O07 A;  1ES3 A;  1IKI A;  1W5D A;  2X71 A;  3ISG A;  1JWZ A;  4LCL A; 
#chains in the Genus database with same CATH topology
 5J7E A;  3TSG A;  2OLU A;  5EOO A;  5EEC A;  1K57 C;  2W3G A;  3PHY A;  2XD1 A;  2YKH A;  2WAE A;  3O88 A;  1IYS A;  2J3W A;  3LIE A;  2PDR A;  3B42 A;  3CHW P;  5EM0 A;  2X02 A;  2VV8 A;  1DRM A;  3O5Y A;  4FTX A;  4JXW A;  2Y2O A;  4BBU A;  2B95 A;  1EW0 A;  3SS5 A;  2Z6D A;  2W1R A;  1IOU A;  2WGI A;  4FSF A;  3ZG0 A;  4MBK A;  2Z2L B;  1F9I A;  3LI8 A;  5DJU A;  4L9E A;  4E3I A;  2DMW A;  3QP8 A;  1FQG A;  3A3D A;  1LSX A;  1XJ2 A;  1YM1 A;  3CZD A;  1TDL A;  5E2H A;  5CGS A;  2WZX A;  3Q07 A;  3IHA A;  4KUK A;  4WEK A;  5I5L A;  2EFU A;  4ME4 A;  1ZG4 A;  3VMA A;  2JKF A;  1CI9 A;  5CTN A;  3GEC A;  3Q7V B;  3T4L A;  3DTK A;  4R4S A;  2HF6 A;  3IF6 A;  4H6J B;  1XGI A;  2WUQ A;  4Q0J A;  1GHI A;  1JVJ A;  4RX2 A;  1J9M A;  5DKK A;  3RXX A;  4EEP A;  2PYP A;  3T1R A;  5F5Y A;  3B47 A;  1ES4 A;  4R4R A;  5CER A;  3V67 A;  4XT2 A;  3JYI A;  3O86 A;  3GRJ A;  4MBF A;  3LEQ A;  1OME A;  4GJ4 A;  4HP9 A;  2R78 A;  5DF9 A;  3W4Q A;  3PBQ A;  1NLY A;  3EGD C;  3IXH A;  4MNR A;  1PZO A;  1DJB A;  2QKP A;  3A3E A;  3BYD A;  3FV7 A;  2QZ6 A;  4RA7 A;  3S7Q A;  5F83 A;  5L10 A;  3RFB A;  3NOP C;  2XRO A;  5CHU A;  5EVI B;  3A3F A;  4EQI A;  3DWK A;  1YSQ A;  4GN2 A;  1IYP A;  1MWT A;  4CPK A;  4ETZ A;  2W3F A;  5FSR A;  1MWS A;  4NXG A;  2GJ3 A;  4WMC A;  4PM6 A;  4U0X A;  4QB8 A;  3S7P A;  3MQO A;  5M18 A;  4S2N A;  3N7W A;  4MN6 A;  4LGW A;  4KZ5 A;  4UHU A;  1K6R A;  1HLU P;  3IX4 A;  2ZQC A;  3C2W A;  1YSP A;  2Y2I A;  1WE4 A;  2QMI A;  3HJI A;  3UPN A;  4L9G A;  3MXS A;  1NY0 A;  1NZO A;  2B02 A;  1G28 A;  4HHD A;  1P9W A;  4P87 A;  2EA9 A;  3UB9 A;  5I94 A;  3LR3 A;  2Y2P A;  3QP4 A;  2CC1 A;  2VK3 A;  1LSW A;  3GMW A;  1PW8 A;  3RXW A;  5FQM A;  3WS4 A;  2XGN A;  4JGP A;  4EUV A;  4YOF A;  3QNB A;  1XXM A;  3ZCZ A;  3VP3 A;  2EXA A;  1LI0 A;  1D7E A;  3OPP A;  3LR0 A;  2IWD A;  1ERM A;  2G2U A;  4FCF A;  2YKF A;  1TS8 A;  2Q9N A;  2J80 A;  1KE4 A;  4NET A;  1V9Y A;  2DNS A;  2V0W A;  2Y2Q A;  5DFX A;  4KG2 A;  1IFQ A;  3S1Y A;  1VM1 A;  3JPU A;  4GKU A;  2O9A A;  5M19 A;  3NIA A;  4WEL A;  1DJC A;  4I38 A;  3M6B A;  4IVI A;  3O3V A;  5EM1 A;  4NG2 A;  4UQI S;  4ESP A;  3LIC A;  3NUL A;  4O7D A;  1P0Z A;  3VP4 A;  1UGU A;  1ONG A;  4KG6 A;  2ZQD A;  4ZDX A;  1XP4 A;  3IF6 B;  4H6J A;  4GD6 A;  4Y0U A;  3MMH A;  4LCM A;  2BLS A;  2LB5 A;  3F1P B;  3CPT B;  1KDS A;  2V8C A;  3VE3 A;  2LB9 A;  1F98 A;  4X69 A;  1EWZ A;  3UPP A;  1BYW A;  2HDU A;  1FR1 A;  4X6T A;  4GDB A;  4HH2 A;  3SZT A;  1K56 A;  2ZC3 B;  2ZOI A;  4LEN A;  3UB6 A;  5HAI A;  1T1C A;  3UDX A;  3BLS A;  1T19 A;  5CXW A;  5GHX A;  4JGQ A;  3KO6 A;  3VOZ A;  1XA7 A;  4LRY C;  2PRF A;  3PBN A;  3V3R A;  1E25 A;  2H28 A;  4BJP A;  5F69 A;  2HJE A;  1L0E A;  4RVA A;  4PM9 A;  2EWV A;  4G3K A;  5HFO A;  2W3D A;  2A3U A;  3BW6 A;  2FH5 A;  4ARZ A;  1FCO A;  1Z09 A;  3EQV A;  2EX9 A;  2HGV A;  3BJN A;  1RCJ A;  2H0T A;  3PAG A;  3PXP A;  3VV4 A;  1W7F A;  2E8J A;  4GDN A;  4X55 A;  1W8Q A;  5AQA A;  3SH9 A;  3T4Q A;  5D3O A;  4L9F A;  5EVE A;  2VKS A;  3RH8 B;  3MQQ A;  5L8M A;  4Y3I A;  3MKF A;  1Z6F A;  1JWV A;  4ZRR A;  3N8S A;  1I2S A;  1GSW A;  2JKT M;  3UE6 A;  3V5M A;  2ZQ9 A;  3QNC A;  1BZA A;  4R23 A;  3TG9 A;  5A91 A;  1PWD A;  5L09 A;  1WYB A;  3ZQ5 A;  2A24 B;  2B18 A;  1DP8 A;  3CMZ A;  3GR2 A;  1IKG A;  4K0X A;  3VFH A;  3MKE A;  1J3W A;  1W63 M;  4ZJ1 A;  4OQH A;  3IBJ A;  4PM7 A;  2QYB A;  3BFC A;  1MWR A;  3W4O A;  3C4O A;  4C75 A;  1MKI A;  1RGZ A;  3KSF A;  3E98 A;  4JXS A;  4UA6 A;  1RGY A;  5LBR A;  1FR6 A;  4OPY A;  2Y91 A;  4OLG A;  3OPH A;  3C30 A;  1UWP X;  1PI4 A;  1YLW A;  1ODV A;  2E8I A;  1PZP A;  2KOI A;  1TDG A;  3F1N B;  3D9Y A;  5HAQ A;  4JF4 A;  2VA0 A;  4KEN B;  2C6W B;  5GHY A;  1O07 A;  1W5D A;  4FUW A;  4LCL A;  5HDS A;  4OLD A;  2VLG A;  1N9N A;  4KZB A;  1PI5 A;  4JXV A;  2QJ7 A;  4DJ2 A;  3PBS A;  4I3A A;  4OKP A;  5C5K A;  3HRE A;  2J9P A;  4UEY A;  4KG5 A;  5GLC A;  4E3O A;  3HCY A;  1H8M A;  4RYE A;  4EBP A;  1FIL A;  3R7W A;  1MY8 A;  1G5U A;  3UE1 A;  1XJ6 A;  3NDG A;  5BOH A;  1XJ4 A;  3SOI A;  3MXQ A;  4BBT A;  3OPR A;  1YT4 A;  4EET B;  5TBM A;  3DAV A;  2W1T A;  4BL3 A;  3D4F A;  1AXB A;  3VP2 A;  4CJN A;  3E4P A;  3HLE A;  4PKY G;  4FD8 A;  4KZ6 A;  2KDK A;  1TS0 A;  3JVU A;  5FQK A;  2Y2M A;  1E3U D;  4JLF A;  5AQ9 A;  4KZ7 A;  4A5R A;  2JKR M;  2RCX A;  3QP6 A;  4HJ4 A;  4E3N A;  4HI4 A;  3FPV A;  2OAP 1;  1IEL A;  1NRJ A;  2OWJ A;  4MN5 A;  1Y54 A;  4ZAM A;  4HBU A;  4MEZ A;  1FSW A;  2PBD P;  3PR6 A;  3PAE A;  3GVB A;  4WEJ A;  5TFQ A;  5F6A A;  3LY3 A;  3G2Y A;  2WYX A;  3ZG7 B;  2WZZ A;  5J4E A;  3EWK A;  2XK1 A;  3S22 A;  4ARZ B;  2XLN A;  1L0D A;  3DTI A;  1O7E A;  4Q0H A;  2ZM2 A;  5EV0 A;  4DE1 A;  3LIF A;  3UB8 A;  3P09 A;  4HH3 A;  2EXB A;  3HLD A;  1L2S A;  1D06 A;  1GSV A;  4EXO A;  3NHQ A;  2V2F F;  4WBG A;  5CGW A;  2O9B A;  5AJG A;  4E3M A;  3H7W B;  3IF5 A;  2H5S A;  3LI9 A;  4YFM A;  1FSY A;  3HLB A;  3M2K A;  4HJ6 A;  1SCW A;  3OC2 A;  3BY8 A;  1GSX A;  1PYY A;  2Y2K A;  4R6L A;  2HPB A;  3CWF A;  4WMC D;  4HQA A;  1KDW A;  1RP5 A;  1YMX A;  4I3J A;  3AGF A;  4NXF A;  4N1H A;  4DMZ A;  1T1A A;  2ACG A;  3EOI A;  5U47 A;  1YLZ A;  4F3L A;  5CRF A;  2EFX A;  4JPM A;  4KQR A;  1K25 A;  2UWX A;  4WLA A;  1MZU A;  3UO9 A;  4MN7 A;  3H82 B;  1S0W A;  2ZBB A;  3I7J A;  2NUT C;  2XH9 A;  1ZKJ A;  3LIB A;  2PR6 A;  2VGJ A;  2K31 A;  1S66 L;  3CAX A;  4LRX C;  1K55 A;  2BAS A;  1DP6 A;  2X01 A;  2Y2G A;  4HEF A;  3DW0 A;  4JKT A;  4ETX A;  1W79 A;  3W4P A;  3A3J A;  4DF6 A;  4WZ5 A;  2PD7 A;  1N4O A;  3HUO A;  5EFW A;  4OON A;  3IBR A;  4LPZ A;  4CLC C;  4M4X A;  2J3T C;  2B5R A;  1LSV A;  1Y4O A;  3LO7 A;  1S1Z A;  2Q0O A;  4CLC B;  1SDE A;  2V0U A;  3BRM A;  4BQM A;  4DN0 A;  3VP1 A;  5CGX A;  2ZC4 B;  3PBO A;  2V1Z A;  1LL8 A;  4HY8 A;  3ZG5 A;  1JWP A;  4UA7 A;  1KVM A;  1LL5 A;  5FAQ A;  4OP8 A;  2ZOH A;  2XA7 M;  3ICY A;  1M40 A;  4IUH A;  4I3I A;  3TE8 A;  3BFE A;  5DTT A;  2P9V A;  3BQA A;  2V20 A;  3PYP A;  1PWG A;  2XQZ A;  4QWO A;  3DWZ A;  1E3U A;  4KZ8 A;  3M6H A;  3L7H A;  4MBH A;  3UDF A;  1GCE A;  4LV1 A;  1HD8 A;  2GX5 A;  4UQI M;  3S4X A;  1KGG A;  2EWW A;  4BMW A;  5FDS A;  1Y28 A;  4HJ3 A;  3Q7V A;  1CEF A;  3C4P A;  5KIZ A;  3C5A A;  4XUX A;  2VGL M;  2P08 A;  1H8Z A;  2WGW A;  2J8Y A;  2ZD8 A;  4C6Y A;  4OOL A;  3VOY A;  3M2J A;  3JVV A;  2PR5 A;  2QHK A;  3HVF A;  1YLY A;  3UE3 A;  2M7U A;  3T4K A;  5EVI C;  2P7J A;  5HD5 A;  1PWC A;  3TW8 A;  4S2N C;  4DXC A;  4GHI B;  1IYQ A;  4WZ5 C;  4LFU A;  3ZNY A;  1MWU A;  2M1C A;  3N8L A;  3LFV A;  1FCM A;  1SHV A;  1JNU A;  2PYR A;  1SKO B;  3SH7 A;  3E2L A;  1T18 A;  1NXY A;  4MCW A;  1N9B A;  4ZJ2 A;  3ULF A;  1D1J A;  5CEB A;  1ONH A;  3NOT C;  3T1S A;  2OLV A;  5HDC A;  3D72 A;  2ZMF A;  5G18 A;  1HZO A;  4OQI A;  1H8Y A;  4R0Q A;  4HOI A;  1Q2Q A;  2JN7 A;  2GZA A;  4YNR A;  1WA9 A;  5CEC A;  4CLC D;  3MFD A;  3T4O A;  3UE0 A;  2EX2 A;  2WGW B;  5HW3 A;  2XFS A;  5M1A A;  3RJU A;  5EVI A;  4PKY A;  3Q7Z A;  4PM8 A;  1OTE A;  1KE3 A;  2XDM A;  2ZM8 A;  3G2Z A;  2P04 A;  3MXR A;  5TJJ A;  1YQS A;  4IUK A;  2PD8 A;  5A93 A;  4XXR A;  5EVL A;  2A24 A;  2HP6 A;  1T1B A;  1CJF A;  1MC0 A;  1IKI A;  2VJW A;  2X71 A;  5DF8 A;  2FFF B;  1ES2 A;  1L3L A;  5A90 A;  1SDN A;  5HL6 A;  3ZVW A;  2RL3 A;  1M6K A;  3NY4 A;  3UB5 P;  1CEG A;  1GHM A;  5A8B A;  2HDR A;  1W8Y A;  3T4S A;  1C3B A;  4R3A A;  5HZH A;  1L0G A;  4YWZ A;  3WWX A;  1GA0 A;  3HLG A;  3MR0 A;  4UAA A;  3F1N A;  1HVB A;  1YLP A;  3BFG A;  2JC7 A;  3V3S A;  5FAO A;  3G4P A;  3FYZ A;  3K3D A;  2GDN A;  3Q81 A;  5L07 A;  3VE4 A;  3C38 A;  1ZG6 A;  2L1M A;  3A0V A;  1ALQ A;  1KGF A;  4Y17 A;  2XFT A;  1YLJ A;  5E43 A;  4PMA A;  1YLT A;  4GCZ A;  2FFY A;  4OPQ A;  3B33 A;  1XFN A;  5DFY A;  1VQQ A;  5FI2 A;  2H0Y A;  4EER A;  3KSI A;  5CHJ A;  4Q0I A;  3GQZ A;  1BLP A;  4CQH A;  5AVF A;  5G4Y A;  4BL2 A;  3A0S A;  3BQ8 A;  3G30 A;  4LLO B;  3IX8 A;  2VGK A;  3IHB A;  1XX2 A;  5FEF A;  4LRZ E;  2IWC A;  4KQD A;  5HD3 A;  3ZHH A;  1S6R A;  3S7O A;  1DY6 A;  1JTD A;  4Y0O A;  2W3H A;  3G32 A;  4EU0 A;  3H7W A;  3IWI A;  3W8K A;  3BEC A;  2NUP C;  1DP9 A;  2ZC5 B;  3IWQ A;  1FCN A;  1I2W A;  1BSG A;  4N9L A;  3U4L P;  2ZQ8 A;  3F1O A;  1OT6 A;  2I72 A;  4EW7 A;  2L0W A;  4C3Q A;  2XRN A;  3EQU A;  3Q1F A;  4B9O A;  5KMW A;  2HZ5 A;  1H3Q A;  2WKE A;  5F1G A;  4RX3 A;  2JBF A;  4P85 A;  3FG8 A;  4UA9 A;  2DCF A;  4U3T A;  5EUA A;  3UME A;  4GD8 A;  3OBF A;  5HWW A;  3IXD A;  3ZG8 B;  5E2F A;  2ZQA A;  3ZGA B;  3T1Q B;  1N9L A;  1S67 L;  4GHI A;  4BLM A;  1N9O A;  2M7V A;  3DBA A;  4WL9 A;  3U2A A;  1OTD A;  5F68 A;  4L0L A;  3IT9 A;  4X1M A;  3KSH A;  4HES A;  4CLC E;  2P9V B;  5A92 A;  1VB6 A;  3ZG9 B;  4F94 A;  4OOY A;  1WYC A;  2XD5 A;  1BLC A;  1KVL A;  3EEA A;  4E3J A;  3PBR A;  3WS1 A;  4FH2 A;  2JCH A;  5GHZ A;  2C5W B;  1BLH A;  4GZB A;  1FOF A;  3KYQ A;  3GDI A;  5HX9 A;  4KZ9 A;  4B4X A;  1KGE A;  4CLC A;  1S1Y A;  3MZE A;  3UY6 A;  2IA2 A;  1K0K A;  5FI6 A;  4BEN A;  2KX6 A;  5KSC A;  3AGD A;  1GHP A;  1S4S A;  2Y79 A;  3R4K A;  3IQA A;  1EI5 A;  3IS2 A;  4RQ9 A;  4GS9 A;  1ZTU A;  4Z9Q A;  2V9A A;  3T1X A;  2PAV P;  4Z1W A;  1GA9 A;  4Y13 A;  4S2L A;  4EEU A;  2VGL S;  1VEU A;  1NZU A;  2Y2J A;  3C7U A;  2XSS A;  4OP5 A;  1LL9 A;  3W2Z A;  4DE2 A;  4B88 A;  1DJA A;  5IS1 A;  2J7V A;  5GL9 A;  3E4O A;  1SKO A;  3WS0 A;  4DKI A;  5FA7 A;  2W0N A;  3SW1 A;  3IX3 A;  5FQ9 A;  2O0Y A;  3FWL A;  3KYZ A;  4OQ0 A;  4DRT A;  4NKP A;  5CTM A;  5F82 A;  3GV9 A;  2O99 A;  3MZF A;  2WK0 A;  5HDD A;  5GLB A;  5HWT A;  3VOL A;  4KUO A;  1NYM A;  4E3L A;  1XKZ A;  1W63 Q;  3PBT A;  4IHQ A;  3OCL A;  2OAQ 1;  3E0Y A;  3MJQ A;  2HDS A;  1CI8 A;  4GNU A;  5DTK A;  1SKF A;  4ZTK A;  5AVE A;  5E2G A;  3IF6 C;  2V1A A;  1K54 A;  4GB7 A;  4S2I A;  5FEG A;  5HL1 A;  3UMD A;  4GOG A;  4MDZ A;  3FC7 A;  4Q8I A;  5K5B A;  1ZC2 A;  1XA1 A;  5EOE A;  3OLO A;  4DE3 A;  3C7V A;  1BLS A;  1BUL A;  5FDH A;  5HSQ A;  4BD0 A;  3IXB A;  2IWB A;  1UWN X;  2OV5 A;  3TOI A;  4NK3 A;  2ZC7 A;  4NXE A;  3QHY A;  3HBR A;  4K0W A;  4MMN A;  2INW A;  3HLW A;  3WRZ A;  3ZNT A;  4N9K A;  4WM9 A;  4EBL A;  3V39 A;  2WKI A;  2Y2H A;  2Y4A A;  3EEH A;  4JXG A;  4N92 A;  1VHM A;  1A0K A;  5HAP A;  1ESI A;  1LI9 A;  1PFL A;  2A2L A;  1XFQ A;  4PPR A;  4EV4 A;  4IBX A;  4R70 A;  2W1T B;  2XEP A;  3NC8 A;  2P74 A;  4IJG A;  1NLZ A;  5KZH A;  3BY9 A;  2OWH A;  4LV0 A;  3CI6 A;  1K55 C;  2O9C A;  2QWS A;  1VET B;  1HTZ A;  1G6A A;  3LIA A;  4E04 A;  2H10 A;  2QJ5 A;  5AQB A;  3CG5 A;  3TRC A;  1STZ A;  3LR4 A;  1XGJ A;  1LT0 A;  4WUJ A;  1NJ4 A;  3MS6 A;  2R9W A;  3P7N A;  1VEU B;  3NDE A;  1TS6 A;  3R7W B;  3WS2 A;  2FZ0 A;  3UDI A;  4HP4 A;  3IWO A;  3EGX C;  4E6X A;  3SS4 A;  5IT5 A;  2D02 A;  3N4I A;  5TR7 A;  1FIK A;  4K91 A;  1IYO A;  5FQJ A;  3Q82 A;  2OOL A;  5KSH A;  1K38 A;  4QHC A;  3BLM A;  4OH0 A;  3NOU C;  3OCN A;  4Y7P A;  1ESU A;  3F1P A;  3ZFZ A;  3ISG A;  2WKR A;  4KZ4 A;  3UNW A;  1X0O A;  1XPB A;  3B3X A;  2HP5 A;  4Y15 A;  2JE5 A;  4GS9 B;  3O87 A;  4HIA A;  3LR5 A;  4EUZ A;  2ZJ9 A;  4OQG A;  2W3E A;  2OSU A;  4B4Z A;  5HPI A;  4FH4 A;  3CPT A;  1K6S A;  3RTY A;  5L2F A;  4GW9 A;  4M3K A;  4P6Z M;  1NRF A;  1H0M A;  3K2N A;  4QPR A;  2UV0 E;  3D3O A;  1NYY A;  1OTA A;  3LGO A;  4LV2 A;  1U60 A;  5E2E A;  1PW1 A;  4EES A;  3DTM A;  1MKM A;  3C8C A;  3UB7 A;  1K57 A;  5AQ7 A;  4WF0 A;  3OZH A;  3T4T A;  2CMN A;  3MBZ A;  2VX8 A;  4E6W A;  3ZYT A;  4DE0 A;  1CF0 A;  3VSL A;  3VSK A;  2J9O A;  3SH8 A;  4DDS A;  1K4F A;  3LY4 A;  3E4Q A;  3MF0 A;  4K08 A;  4Y5F A;  3NEC A;  4FOF A;  2Y59 A;  2VV7 A;  1PNE A;  2AVX A;  3HL9 A;  4O0P A;  4DDY A;  3PTE A;  1XJ3 A;  2Y2L A;  5CED A;  5EPH A;  4DJ3 A;  4EWF A;  4P0M A;  1OJ5 A;  5CX7 A;  2V1B A;  1F2K A;  5TBM B;  1MBL A;  3WS5 A;  3KSG A;  4OPZ A;  2PU2 A;  4P6Z S;  5GLD A;  3MQ0 A;  4KQQ A;  4R3B A;  2G2W A;  2ZMV A;  3H82 A;  5FQQ A;  2I9V A;  3VP0 A;  4R1G A;  3ITB A;  4O8G A;  4MLL A;  4I39 A;  4Y2F A;  3ZDJ A;  3E2K A;  3FKV A;  4S2O A;  3HLC A;  4ZBE A;  3LCE A;  3OOV A;  3BWL A;  1JTG A;  4JGR A;  3G31 A;  3IH8 A;  5HPF A;  3CIT A;  5FQI A;  5MC7 A;  1ERQ A;  4OPR A;  2Z2M B;  3GSG A;  4OOM A;  5DJT A;  4F3L B;  3T4J A;  2EX6 A;  2Y8H A;  4B93 A;  3CUE C;  3HUM A;  3UN7 A;  2QPN A;  3N8R A;  5DVA A;  3F1O B;  4E3K A;  1MXO A;  2WAD A;  5JYP A;  4U0T A;  2XR0 A;  2K7S A;  2XA7 S;  3N6I A;  3NBL A;  1SZV A;  2ZQ7 A;  4QJG A;  4I5S A;  4WYY A;  2MJ6 A;  4IBR A;  4EBN A;  1F5M A;  2Y55 A;  4II7 A;  1L0F A;  1KE0 A;  3SS3 A;  4BWI A;  2ZL1 A;  5JYO A;  1QMF A;  2WKP A;  4O01 A;  1K4E A;  5G4Z A;  3A3I A;  2PT7 A;  4QU3 A;  1E4D A;  4XUZ A;  4H8R A;  2D01 A;  4KZA A;  2W27 A;  3NJA A;  2K2N A;  3BM6 A;  5IHV A;  5CHM A;  3AGE A;  2ZL1 B;  3FPW A;  3IXG A;  1G6O A;  5FAT A;  4IVK A;  2Q9M A;  5FI7 A;  1ACF A;  1LLB A;  3G34 A;  4S2K A;  4X25 A;  3LID A;  1G68 A;  2A49 A;  4X1L A;  4BD1 A;  1OTI A;  4S2M A;  1YPR A;  4S2J A;  5EE8 A;  2HV1 A;  4QY5 A;  5HWV A;  4BBV A;  4KQO A;  3ZVT A;  3LUQ A;  1IEM A;  3BEB A;  3P01 A;  3UPO A;  2G7U A;  2HJ9 C;  3QP5 A;  1TF1 A;  1PIO A;  1TD5 A;  2GNX A;  1TVF A;  3CJM A;  3DTE A;  5DTS A;  1TS7 A;  2WAF A;  2HDQ A;  2J3T D;  1PRQ A;  4X68 A;  1VET A;  3MSH A;  3QP2 A;  3LEZ A;  4X53 A;  2ZC6 B;  3S7N A;  4YIN A;  1AWI A;  4R38 A;  2ZLY A;  3QP1 A;  2WKQ A;  3HJK A;  3FZC A;  4JGO A;  4X56 A;  3ITA A;  3T12 B;  4WZ4 A;  3FKW A;  4QD4 A;  4JF6 A;  4D2O A;  4NXB A;  3TJZ C;  2PU4 A;  3V50 A;  3VFF A;  2R9X A;  1ERO A;  2BTF P;  3OPL A;  3L9K A;  4HNB A;  2VZW A;  4P6B A;  2HP9 A;  1LHY A;  3NI9 A;  5FL3 A;  4EQ1 A;  3MFX A;  4R3J A;  4AFI A;  4G3V A;  1ES5 A;  1BT5 A;  4JBF A;  3IS2 B;  1OPX A;  3A0R A;  3MZD A;  3LYX A;  1K56 D;  1YKD A;  3KYE A;  3CUE A;  1BUE A;  1QME A;  1CQA A;  1OTB A;  4PM5 A;  1BTL A;  2VV6 A;  1MPL A;  4DXB A;  2VEA A;  5IU1 A;  2EX8 A;  2XF3 A;  2JKG A;  3P98 A;  1K54 C;  4OVD A;  1KOU A;  2L4R A;  4GLQ A;  1S4R A;  2WGV A;  4D60 A;  1I5Q A;  2BG1 A;  4XT2 B;  5J8X A;  5GLA A;  4LV3 A;  3HLF A;  2ZMA A;  4KZ3 A;  2PBY A;  3H9W A;  4WN5 A;  2Z6C A;  2KLI A;  5DF7 A;  1OJG A;  3G6O A;  4IED A;  5HAR A;  5DKL A;  4ZJ3 A;  4N1X A;  3G35 A;  2V8F A;  2ZM0 A;  1YMS A;  3IH9 A;  4JF5 A;  4QY6 A;  1P97 A;  1NWZ A;  3K3C A;  4Y0T A;  3WRT A;  3HUN A;  2DRW A;  4NEE D;  2Y2N A;  5FAP A;  2JHE A;  1ZHH B;  1P9R A;  3BFD A;  3NCK A;  4S2P A;  5EVI D;  1OT9 A;  4ID4 A;  1YAX A;  1CK3 A;  2JKT I;  3GTC A;  1TEM A;  1V9Z A;  2WKH A;  2JKR I;  3T50 A;  2PHY A;  4HBT A;  4PAU A;  4G3W A;  3KX0 X;  4PHT A;  5TGF A;  5J3W A;  3BFF A;  5F1F A;  3CLO A;  5FAS A;  1H5X A;  1Q2P A;  1ES3 A;  1JWZ A; 
#chains in the Genus database with same CATH homology
 2FFF B;  1ES2 A;  3TSG A;  2OLU A;  4KZ4 A;  4OLD A;  5EOO A;  5EEC A;  3UNW A;  1XPB A;  3B3X A;  2HP5 A;  4KZB A;  1K57 C;  1PI5 A;  2JE5 A;  5A90 A;  4JXV A;  1SDN A;  3ZVW A;  2XD1 A;  2RL3 A;  3O87 A;  4EUZ A;  1M6K A;  3NY4 A;  2ZJ9 A;  1CEG A;  2WAE A;  3O88 A;  4OQG A;  2OSU A;  1GHM A;  4B4Z A;  1IYS A;  3PBS A;  4FH4 A;  4OKP A;  2HDR A;  3HRE A;  1W8Y A;  1K6S A;  2J9P A;  1C3B A;  5L2F A;  4KG5 A;  4M3K A;  5GLC A;  1NRF A;  2X02 A;  1L0G A;  4E3O A;  4RYE A;  1NYY A;  4JXW A;  4EBP A;  2Y2O A;  3WWX A;  1GA0 A;  3HLG A;  4UAA A;  1HVB A;  1YLP A;  1MY8 A;  4LV2 A;  3SS5 A;  3UE1 A;  3NDG A;  1U60 A;  2JC7 A;  3BFG A;  5E2E A;  3V3S A;  1PW1 A;  5FAO A;  3DTM A;  3G4P A;  5BOH A;  3FYZ A;  1K57 A;  2WGI A;  4FSF A;  5AQ7 A;  3SOI A;  4MBK A;  3ZG0 A;  2Z2L B;  3OPR A;  1YT4 A;  3OZH A;  2GDN A;  3Q81 A;  3MBZ A;  4E3I A;  1FQG A;  3A3D A;  1ZG6 A;  4BL3 A;  3D4F A;  4E6W A;  1ALQ A;  4DE0 A;  1KGF A;  1YM1 A;  3VSL A;  3VSK A;  1AXB A;  3CZD A;  2J9O A;  2XFT A;  1YLJ A;  5E43 A;  3SH8 A;  3VP2 A;  1TDL A;  3HLE A;  4PMA A;  4CJN A;  1YLT A;  1K4F A;  4DDS A;  3LY4 A;  5E2H A;  5CGS A;  2FFY A;  2WZX A;  3Q07 A;  3IHA A;  4FD8 A;  4KZ6 A;  4OPQ A;  4WEK A;  2EFU A;  1VQQ A;  1ZG4 A;  5FI2 A;  5FQK A;  2Y2M A;  3VMA A;  1E3U D;  2H0Y A;  5CTN A;  1CI9 A;  4JLF A;  2Y59 A;  3Q7V B;  5AQ9 A;  5CHJ A;  4R4S A;  4KZ7 A;  3GQZ A;  4A5R A;  1BLP A;  2RCX A;  3IF6 A;  5DF8 A;  3HL9 A;  1XGI A;  2WUQ A;  4BL2 A;  1GHI A;  1JVJ A;  4DDY A;  3G30 A;  4RX2 A;  4E3N A;  2VGK A;  3PTE A;  1J9M A;  1IEL A;  2Y2L A;  3IHB A;  1XX2 A;  3RXX A;  5CED A;  5EPH A;  1Y54 A;  2IWC A;  4EWF A;  4ZAM A;  4P0M A;  4HBU A;  4MEZ A;  1FSW A;  1ES4 A;  3PAE A;  4R4R A;  1S6R A;  5CER A;  3ZHH A;  3GVB A;  1DY6 A;  1JTD A;  3JYI A;  3O86 A;  3GRJ A;  4Y0O A;  4MBF A;  1MBL A;  3G32 A;  4WEJ A;  3WS5 A;  1OME A;  5TFQ A;  3LY3 A;  3G2Y A;  4OPZ A;  3IWI A;  2PU2 A;  2WYX A;  5DF9 A;  2WZZ A;  5GLD A;  3W4Q A;  3W8K A;  3ZG7 B;  3BEC A;  2XK1 A;  3S22 A;  2XLN A;  4KQQ A;  3PBQ A;  4R3B A;  3IXH A;  2G2W A;  2ZC5 B;  5FQQ A;  4MNR A;  3IWQ A;  1L0D A;  1PZO A;  3VP0 A;  1FCN A;  1I2W A;  1BSG A;  1DJB A;  4N9L A;  2ZQ8 A;  4R1G A;  1O7E A;  3ITB A;  3A3E A;  2I72 A;  2ZM2 A;  3BYD A;  3FV7 A;  2QZ6 A;  4MLL A;  4RA7 A;  4C3Q A;  3Q1F A;  3EQU A;  3ZDJ A;  4DE1 A;  3E2K A;  3FKV A;  4S2O A;  3HLC A;  4ZBE A;  5F83 A;  3P09 A;  5KMW A;  5F1G A;  2WKE A;  3LCE A;  4RX3 A;  2EXB A;  5CHU A;  5EVI B;  2JBF A;  3HLD A;  1JTG A;  1L2S A;  2DCF A;  3A3F A;  3G31 A;  3DWK A;  3IH8 A;  4P85 A;  4U3T A;  4UA9 A;  5EUA A;  5FQI A;  2V2F F;  4GD8 A;  4WBG A;  5CGW A;  4GN2 A;  3IXD A;  3ZG8 B;  1ERQ A;  4OPR A;  1IYP A;  1MWT A;  2Z2M B;  4CPK A;  4E3M A;  3IF5 A;  5E2F A;  3GSG A;  2H5S A;  5FSR A;  1MWS A;  4OOM A;  2ZQA A;  3ZGA B;  4YFM A;  1FSY A;  2EX6 A;  3HLB A;  3M2K A;  4WMC A;  4PM6 A;  1SCW A;  3OC2 A;  4U0X A;  4QB8 A;  4BLM A;  1PYY A;  2Y2K A;  3HUM A;  3UN7 A;  5M18 A;  4S2N A;  3N7W A;  2QPN A;  2HPB A;  3N8R A;  4KZ5 A;  4UHU A;  1K6R A;  4WMC D;  5DVA A;  4E3K A;  2WAD A;  1MXO A;  5JYP A;  1KDW A;  1RP5 A;  1YMX A;  2ZQC A;  4L0L A;  4U0T A;  3IT9 A;  2Y2I A;  3AGF A;  2XR0 A;  4N1H A;  1WE4 A;  4HES A;  2P9V B;  3N6I A;  2QMI A;  3NBL A;  5U47 A;  2ZQ7 A;  3UPN A;  4QJG A;  5A92 A;  1YLZ A;  3ZG9 B;  4F94 A;  5CRF A;  2EFX A;  4OOY A;  1WYC A;  3MXS A;  4WYY A;  1NY0 A;  4JPM A;  2XD5 A;  4IBR A;  1BLC A;  1KVL A;  4EBN A;  1NZO A;  4KQR A;  1K25 A;  2Y55 A;  2UWX A;  3UO9 A;  4E3J A;  1L0F A;  3PBR A;  1KE0 A;  3SS3 A;  3WS1 A;  4FH2 A;  5JYO A;  1QMF A;  2JCH A;  1K4E A;  5GHZ A;  2C5W B;  1S0W A;  1BLH A;  4GZB A;  3A3I A;  4P87 A;  1FOF A;  4QU3 A;  3I7J A;  1E4D A;  5I94 A;  5HX9 A;  2Y2P A;  4KZ9 A;  4B4X A;  4XUZ A;  2CC1 A;  4H8R A;  4KZA A;  1KGE A;  2XH9 A;  3GMW A;  1ZKJ A;  2VGJ A;  1PW8 A;  3RXW A;  3MZE A;  3BM6 A;  3UY6 A;  5IHV A;  5CHM A;  3AGE A;  5FQM A;  1K55 A;  3WS4 A;  2XGN A;  3IXG A;  5FAT A;  4IVK A;  5FI6 A;  2Q9M A;  3QNB A;  1XXM A;  5FI7 A;  2X01 A;  4BEN A;  1LLB A;  2Y2G A;  3G34 A;  4S2K A;  5KSC A;  3ZCZ A;  3AGD A;  1GHP A;  3VP3 A;  1G68 A;  2A49 A;  2EXA A;  4HEF A;  1LI0 A;  3IQA A;  4BD1 A;  3DW0 A;  4JKT A;  1EI5 A;  3OPP A;  2IWD A;  1W79 A;  1ERM A;  2G2U A;  4FCF A;  4QY5 A;  4S2J A;  3A3J A;  4S2M A;  5EE8 A;  3W4P A;  4DF6 A;  4Z9Q A;  4WZ5 A;  2Q9N A;  1KE4 A;  4KQO A;  4NET A;  3ZVT A;  1N4O A;  2DNS A;  1IEM A;  3HUO A;  2Y2Q A;  3BEB A;  3UPO A;  4OON A;  1GA9 A;  4KG2 A;  3S1Y A;  4S2L A;  1PIO A;  2B5R A;  3LO7 A;  1TVF A;  1VM1 A;  3CJM A;  4EQI A;  4GKU A;  1NZU A;  1SDE A;  5M19 A;  2Y2J A;  3NIA A;  4WEL A;  5DTS A;  1DJC A;  3BRM A;  2WAF A;  3C7U A;  3M6B A;  4IVI A;  4OP5 A;  2HDQ A;  1LL9 A;  4DE2 A;  3O3V A;  4B88 A;  1DJA A;  4BQM A;  2J7V A;  5GL9 A;  3VP1 A;  5CGX A;  2ZC4 B;  3PBO A;  4O7D A;  2V1Z A;  4X68 A;  3WS0 A;  3ZG5 A;  1JWP A;  4DKI A;  4UA7 A;  5FA7 A;  2ZQD A;  1ONG A;  4KG6 A;  5FQ9 A;  3VP4 A;  3LEZ A;  4X53 A;  4ZDX A;  1XP4 A;  3IF6 B;  3FWL A;  4OQ0 A;  4GD6 A;  2ZC6 B;  1KVM A;  4Y0U A;  1LL5 A;  4YIN A;  4LCM A;  2BLS A;  5FAQ A;  4DRT A;  5CTM A;  4OP8 A;  1KDS A;  2ZLY A;  5F82 A;  3GV9 A;  3FZC A;  4X56 A;  3MZF A;  3ITA A;  2WK0 A;  1M40 A;  4WZ4 A;  5GLB A;  4X69 A;  3BFE A;  1EWZ A;  5DTT A;  2P9V A;  3UPP A;  2HDU A;  3FKW A;  1FR1 A;  1NYM A;  4E3L A;  2V20 A;  4X6T A;  1XKZ A;  1PWG A;  4QD4 A;  3PBT A;  4GDB A;  4JF6 A;  3OCL A;  4D2O A;  2XQZ A;  2PU4 A;  3V50 A;  1K56 A;  2ZC3 B;  3VFF A;  2R9X A;  1ERO A;  3DWZ A;  1E3U A;  4KZ8 A;  4LEN A;  3OPL A;  3M6H A;  2HDS A;  1CI8 A;  4MBH A;  5HAI A;  4GNU A;  3UDF A;  3UDX A;  5DTK A;  1GCE A;  4P6B A;  3BLS A;  1SKF A;  2HP9 A;  4ZTK A;  1LHY A;  3NI9 A;  5CXW A;  5GHX A;  5E2G A;  3IF6 C;  3VOZ A;  1XA7 A;  4LV1 A;  1K54 A;  1HD8 A;  3S4X A;  4GB7 A;  1KGG A;  3PBN A;  4R3J A;  4S2I A;  5HL1 A;  1ES5 A;  4GOG A;  3Q7V A;  1BT5 A;  3V3R A;  4Q8I A;  1E25 A;  1ZC2 A;  1CEF A;  1XA1 A;  4JBF A;  5EOE A;  4DE3 A;  3C7V A;  1BLS A;  3C4P A;  1BUL A;  3C5A A;  3MZD A;  4XUX A;  5FDH A;  4BD0 A;  4BJP A;  1K56 D;  1L0E A;  3IXB A;  1H8Z A;  4RVA A;  4PM9 A;  2WGW A;  2J8Y A;  2ZD8 A;  2IWB A;  1BUE A;  1QME A;  4C6Y A;  5HFO A;  4OOL A;  3VOY A;  4PM5 A;  3M2J A;  2OV5 A;  3TOI A;  1BTL A;  4NK3 A;  3HVF A;  1YLY A;  3UE3 A;  1MPL A;  2ZC7 A;  4DXB A;  2EX8 A;  5EVI C;  2A3U A;  3QHY A;  2XF3 A;  3HBR A;  1FCO A;  3P98 A;  3EQV A;  4K0W A;  2EX9 A;  1PWC A;  1K54 C;  1RCJ A;  2H0T A;  3PAG A;  4OVD A;  3HLW A;  4S2N C;  1W7F A;  4GDN A;  3WRZ A;  4X55 A;  4DXC A;  1W8Q A;  1IYQ A;  2WGV A;  4WZ5 C;  5AQA A;  3SH9 A;  3ZNT A;  3ZNY A;  4N9K A;  4WM9 A;  4EBL A;  1I5Q A;  1MWU A;  2WKI A;  3N8L A;  2Y2H A;  3V39 A;  2Y4A A;  1FCM A;  2BG1 A;  4JXG A;  1SHV A;  4N92 A;  5D3O A;  3SH7 A;  3E2L A;  5HAP A;  5J8X A;  5GLA A;  4LV3 A;  1ESI A;  3ZFZ A;  3HLF A;  1LI9 A;  1NXY A;  2ZMA A;  4KZ3 A;  2PBY A;  1N9B A;  3MKF A;  4PPR A;  4ZJ2 A;  1Z6F A;  5CEB A;  4EV4 A;  4IBX A;  1ONH A;  1JWV A;  2XEP A;  3N8S A;  1I2S A;  3NC8 A;  5DF7 A;  4IED A;  2P74 A;  5HAR A;  3V5M A;  2OLV A;  4ZJ3 A;  2ZQ9 A;  4N1X A;  3QNC A;  5KZH A;  1BZA A;  3G35 A;  5G18 A;  4R23 A;  3TG9 A;  2ZM0 A;  1YMS A;  1HZO A;  4LV0 A;  1PWD A;  4OQI A;  3IH9 A;  5A91 A;  4JF5 A;  1H8Y A;  1K55 C;  1WYB A;  4QY6 A;  4R0Q A;  1Q2Q A;  1HTZ A;  4Y0T A;  1G6A A;  3CMZ A;  3GR2 A;  1IKG A;  2H10 A;  4K0X A;  5CEC A;  3WRT A;  3HUN A;  2DRW A;  3VFH A;  3MKE A;  3MFD A;  5AQB A;  4ZJ1 A;  2Y2N A;  3CG5 A;  5FAP A;  4OQH A;  4PM7 A;  3BFD A;  3NCK A;  1XGJ A;  3BFC A;  4S2P A;  5EVI D;  3UE0 A;  2EX2 A;  2WGW B;  5HW3 A;  1NJ4 A;  1MWR A;  2R9W A;  3W4O A;  2XFS A;  3C4O A;  3NDE A;  4ID4 A;  5M1A A;  4C75 A;  3WS2 A;  1MKI A;  1RGZ A;  3RJU A;  4JXS A;  5EVI A;  1CK3 A;  4UA6 A;  3GTC A;  1TEM A;  1RGY A;  2WKH A;  3Q7Z A;  4PM8 A;  3UDI A;  1FR6 A;  1KE3 A;  2XDM A;  4OPY A;  2ZM8 A;  3IWO A;  4E6X A;  2Y91 A;  3SS4 A;  4OLG A;  4HBT A;  3G2Z A;  3OPH A;  3N4I A;  1PI4 A;  5TR7 A;  1YLW A;  4K91 A;  1IYO A;  5FQJ A;  3MXR A;  3Q82 A;  2E8I A;  5KSH A;  1PZP A;  5TGF A;  1TDG A;  1YQS A;  1K38 A;  3BFF A;  4QHC A;  5A93 A;  5F1F A;  4XXR A;  5EVL A;  4JF4 A;  5HAQ A;  3BLM A;  4OH0 A;  5FAS A;  1H5X A;  2HP6 A;  3OCN A;  4Y7P A;  1ESU A;  1Q2P A;  2C6W B;  4KEN B;  5GHY A;  1O07 A;  1ES3 A;  1IKI A;  1W5D A;  2X71 A;  3ISG A;  1JWZ A;  4LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...