3V50A

Complex of shv s130g mutant beta-lactamase complexed to sa2-13
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title The importance of the trans-enamine intermediate as a beta-lactamase inhibition strategy probed in inhibitor-resistant SHV beta-lactamase variants.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v50A00
3BFDA 2WYXA 1SDEA 1EROA 4FD8A 3OPHA 4OPZA 5TFQA 1FSWA 3RXXA 3VMAA 4MNRA 2V1ZA 2Y4AA 2Y91A 1GA0A 4R3BA 4S2JA 4BJPA 3O87A 1H8ZA 5DVAA 3VP0A 1FR1A 1WE4A 4KQOA 1NYMA 1G68A 1U60A 2HDQA 5EVIB 4Y0OA 3M6HA 4WEKA 2ZQ7A 4OVDA 3UE0A 5TGFA 4M3KA 2OV5A 4MLLA 5F82A 4GDBA 5FAQA 1ZG6A 2DCFA 5D3OA 2X01A 5FQQA 1RGYA 3LO7A 2H10A 5EUAA 1ES4A 2Q9MA 2JE5A 1BSGA 1TVFA 3SH7A 3ZG0A 4E3LA 4KZ4A 3IH8A 4P87A 3PBOA 3ZFZA 3GVBA 3IXHA 1E4DA 4GD8A 3VP1A 5DTTA 4JXGA 3WS0A 3P09A 4QY6A 1YQSA 2EX8A 4EV4A 1DJBA 5F83A 3IQAA 3IXGA 3HLEA 3MZFA 2XK1A 3SH8A 1GA9A 1MWRA 1BT5A 1W7FA 2HPBA 3BLSA 4CJNA 4GD6A 2XDMA 3BECA 4QB8A 5HARA 1FSYA 4BD1A 1DJAA 2XH9A 1ES5A 1SCWA 1ZG4A 2HDSA 2Y2JA 3AGDA 3BFFA 1MWSA 3PBQA 5TR7A 3V39A 5CEBA 3FKWA 4EBNA 1Q2PA 4Q8IA 3C4PA 4KZAA 5CHMA 1ES3A 3S4XA 4K91A 4DXCA 2HP6A 2ZC7A 5DF9A 4LV3A 1XX2A 2EXAA 3OPPA 5GLDA 4S2MA 1IYPA 3M2JA 1K55A 5EVID 4S2PA 4U0TA 2CC1A 2RL3A 5J8XA 2JBFA 3Q7VB 4WBGA 3UPOA 2Y2IA 3ZG9B 3HLDA 2IWBA 1YMXA 1N4OA 5FATA 1KE3A 4X53A 1ES2A 1TDGA 3AGFA 4X56A 5M19A 4RX3A 4E6XA 3S1YA 2FFFB 4IBXA 2ZM0A 4HEFA 4IVIA 4E3IA 4GKUA 1EWZA 1IYSA 3A3EA 1N9BA 4Y0TA 5GLBA 3C7VA 4UAAA 2ZQDA 3PAGA 3ZG8B 4EQIA 2Y2QA 1LI9A 1I2WA 1MWUA 4WZ5C 5GLCA 5DF7A 3IWIA 3HLBA 2Y2NA 4OPRA 3VP4A 2A3UA 3AGEA 3IWQA 3W8KA 4ZDXA 3TSGA 4KZ6A 4WEJA 2I72A 2WAFA 2XEPA 4JXWA 3MKFA 2Y2OA 3PBNA 4KZ9A 4R0QA 4RVAA 4U3TA 5AQ9A 3HVFA 1KDSA 3IF6A 1J9MA 4JF6A 2Y55A 2WAEA 4GB7A 4UA9A 1BLHA 5CGWA 1XPBA 1RGZA 2Y2MA 5CERA 4R4RA 3GTCA 2XFTA 3HLGA 4PM8A 3WS4A 4ZBEA 5L2FA 1KGFA 4H8RA 1PW1A 2IWDA 2ZD8A 4RX2A 1IYOA 4EBLA 5FI2A 3BYDA 3SS4A 1FOFA 1JWZA 2HP5A 3ITAA 3ZNYA 1YM1A 1PW8A 5CTNA 1CEGA 2PBYA 2VGJA 3UE3A 1BZAA 1K4EA 1YLWA 3EQUA 1L0FA 2BG1A 2Y2LA 3G34A 3IF5A 1H8YA 2P74A 4KG5A 4XUXA 5GHZA 3ZDJA 3HL9A 5EECA 4LV0A 3ZVWA 5JYPA 5DF8A 4GNUA 3Q1FA 4OLDA 4FH2A 3UDFA 2WKHA 1KGEA 1FCOA 2ZM2A 3HLWA 3M2KA 4MBFA 1L0GA 4S2LA 1NZUA 1SHVA 3HREA 2PU2A 3G31A 2Y2GA 2R9XA 4OLGA 2EFXA 3IHBA 3DWZA 4LENA 5E43A 3ZG5A 4KZ8A 1BLCA 3WS2A 1L0EA 2H0TA 2ZQAA 4Y7PA 1E3UD 4K0WA 2XD1A 4DE2A 3EQVA 4MEZA 2C6WB 4P6BA 4IVKA 1W8QA 2WKIA 2P9VA 2R9WA 4QD4A 3NY4A 2FFYA 4PM9A 4S2OA 5M18A 4WMCA 2Z2LB 2XF3A 1K54A 4S2IA 3SS3A 5F1FA 1EI5A 5FAPA 4UA7A 2DNSA 4JPMA 3VSLA 1KVMA 5KSHA 2J9PA 1RCJA 2JC7A 1LHYA 4C75A 3HLCA 2ZC5B 3V50A 1JWPA 3BM6A 4ZJ1A 1S0WA 4IBRA 4RA7A 2Z2MB 3O88A 3NDEA 4S2NA 1HZOA 2ZLYA 2OLUA 5EPHA 1Z6FA 5FAOA 1I2SA 3GSGA 4R1GA 4WM9A 1W8YA 3MZDA 4NETA 1NRFA 4O7DA 1O7EA 3LEZA 1Y54A 2IWCA 4OQ0A 2XFSA 3OPRA 1K56D 5CGXA 1M6KA 1KDWA 4RYEA 1K55C 2WUQA 1K38A 3IH9A 1PIOA 2G2WA 2WZXA 3BFCA 4PM7A 2Y2KA 1L0DA 4N1XA 3FWLA 3VFHA 3FZCA 3G4PA 4FH4A 4R3JA 4DE1A 3HUOA 1XGIA 2X02A 4PM6A 5M1AA 4EWFA 3GRJA 4JF5A 4DF6A 4GDNA 1S6RA 5E2EA 3A3JA 3O86A 5FASA 5EE8A 3O3VA 4P85A 1PYYA 1ESIA 3SOIA 1YLJA 4EBPA 2XR0A 1BLSA 3M6BA 1JWVA 4PPRA 1Q2QA 4BLMA 4YFMA 4OOYA 3WRTA 3ZGAB 4C6YA 4OP8A 1JTDA 3I7JA 4HBUA 4KG6A 3QHYA 4ZTKA 3ZG7B 1KVLA 1XA1A 3VOYA 3ITBA 4DRTA 3MZEA 3P98A 2XD5A 3OPLA 5DTSA 1PI4A 3N6IA 5CTMA 3G30A 4OOMA 2ZC6B 2C5WB 1QMFA 3ZNTA 3PBSA 1DJCA 1BUEA 3ZHHA 1KE4A 4QHCA 5KZHA 3FKVA 1FCNA 3IF6C 1QMEA 2QZ6A 3PBTA 3UN7A 2J9OA 3UDIA 4K0XA 1KGGA 2HDUA 2WGIA 4U0XA 3G32A 2X71A 1GCEA 2QPNA 5HFOA 5E2GA 5HAPA 2Q9NA 4N9KA 3W4PA 3ZCZA 4OQIA 1BTLA 4MBHA 4PMAA 1ALQA 3WWXA 3VFFA 2HDRA 3HUMA 5A90A 2A49A 3BFGA 4R4SA 5FDHA 5FSRA 3VP2A 4ID4A 4DDSA 1GHMA 2H0YA 1VM1A 2J7VA 4ZAMA 4F94A 1IYQA 4E3OA 3B3XA 3QNBA 1MBLA 3V5MA 2JCHA 2ZC4B 2QMIA 3HBRA 3NCKA 3C4OA 5GHYA 3VP3A 4CPKA 1LL5A 4E3MA 1C3BA 1L2SA 3PAEA 2H5SA 2J8YA 3A3IA 4WZ4A 3IF6B 2Y2HA 1XKZA 1DY6A 4L0LA 4OOLA 1HTZA 1ONGA 2WK0A 1E25A 3E2LA 4MBKA 4OPYA 4BD0A 5KSCA 1XXMA 3MBZA 1NXYA 1ERMA 3NC8A 3A3FA 4X6TA 3UNWA 5FI6A 1CEFA 4LV1A 1NJ4A 1IKGA 5CHJA 4C3QA 2EX2A 5FQJA 3IT9A 3SH9A 5EVLA 2WKEA 3TG9A 5HW3A 4XXRA 4B88A 3OCNA 1PZOA 3NIAA 1XP4A 4KZ7A 4XUZA 3VSKA 3GQZA 4BL3A 4HBTA 5CGSA 1K54C 5EVIA 2XGNA 3FYZA 3N4IA 4BENA 1K57C 5U47A 2G2UA 2ZJ9A 3UDXA 2EX9A 5IHVA 3V3SA 4B4XA 4DXBA 3LY4A 4KZBA 1K57A 5JYOA 2HP9A 4N92A 5A93A 1HD8A 4UA6A 5FQKA 5EOEA 1MPLA 2BLSA 3N8SA 4S2NC 1KE0A 4LCLA 5HL1A 5F1GA 4QJGA 3CG5A 3GR2A 4KENB 1ESUA 5G18A 1W79A 5E2FA 4KQQA 3OCLA 5BOHA 2P9VB 1CI8A 2EX6A 3CJMA 4DE3A 4R23A 2ZQCA 5HX9A 1FR6A 3QNCA 3MFDA 2VGKA 2OSUA 1YLZA 2UWXA 5CRFA 3C5AA 3MXRA 1G6AA 1FQGA 1LI0A 1PWDA 2ZMAA 2ZM8A 4HESA 3BLMA 3HLFA 1WYBA 4X55A 2V2FF 3IXDA 5I94A 4FCFA 4WELA 5KMWA 2GDNA 3W4QA 4DE0A 1ONHA 3CZDA 4EUZA 4N1HA 3Q7ZA 1FCMA 2WGWA 3LCEA 3BFEA 2PU4A 1IEMA 2XLNA 3IWOA 4S2KA 2Y2PA 4KZ3A 4QY5A 2ZC3B 5AQAA 5FA7A 3S22A 1CK3A 3IHAA 1MY8A 2WGVA 3D4FA 3Q7VA 3GMWA 5FQIA 2E8IA 5HAQA 3E2KA 3MKEA 1MWTA 3C7UA 1JTGA 3HUNA 2ZQ9A 4LCMA 3FV7A 4JXVA 2DRWA 3G2YA 2WGWB 3W4OA 3N8LA 3NI9A 4JLFA 3JYIA 1ERQA 4NK3A 4JKTA 4X68A 4YINA 1NZOA 3CMZA 1XA7A 1YT4A 4DKIA 3BRMA 3LY3A 5FQ9A 3PBRA 4ZJ2A 3DTMA 2Y59A 4B4ZA 4OKPA 5A92A 3GV9A 1WYCA 2XQZA 3N8RA 4GOGA 4JXSA 4ZJ3A 1SDNA 1O07A 3Q82A 4WMCD 3UE1A 4IEDA 1IKIA 1VQQA 4E6WA 4OONA 1XGJA 2RCXA 4Z9QA 1GHPA 5CHUA 2OLVA 5GHXA 3ZVTA 3WS5A 2B5RA 3OZHA 4OPQA 3N7WA 3IXBA 1HVBA 1M40A 4GN2A 1PZPA 3DWKA 4E3NA 4E3KA 5A91A 4OP5A 4N9LA 4A5RA 1K4FA 3RXWA 1H5XA 3ISGA 1RP5A 3G35A 3OC2A 5CEDA 5FI7A 4E3JA 2EFUA 1I5QA 1E3UA 1K25A 3UPPA 5DTKA 4OQHA 3V3RA 3RJUA 5GLAA 3TOIA 5AQBA 1YLPA 2WZZA 4KZ5A 4JF4A 1W5DA 4GZBA 4LV2A 3WRZA 5CECA 1YMSA 1LL9A 1CI9A 4PM5A 1K6SA 1SKFA 3NBLA 1TDLA 1JVJA 4WZ5A 1NY0A 4UHUA 5CXWA 1ZKJA 1PWGA 2V20A 4FSFA 3Q81A 3VOZA 5EOOA 4OQGA 4KQRA 3SS5A 5E2HA 3BEBA 1ZC2A 3MXSA 3UY6A 4OH0A 1YLTA 3A3DA 4D2OA 3PTEA 3NDGA 5HAIA 1IELA 5FQMA 1MXOA 3DW0A 4BQMA 1BLPA 4P0MA 3UO9A 4JBFA 1K56A 1MKIA 4KG2A 2ZQ8A 1NYYA 5AQ7A 1PWCA 5GL9A 4DDYA 4BL2A 5EVIC 1LLBA 4QU3A 1YLYA 2EXBA 4Y0UA 1GHIA 2WADA 3G2ZA 3Q07A 1TEMA 1K6RA 1OMEA 1PI5A 1AXBA 4X69A 3WS1A 1BULA 3UPNA 4WYYA
chains in the Genus database with same CATH superfamily
3BFDA 2WYXA 3K3DA 3KSIA 3LFVA 1FSWA 3RXXA 2V1ZA 2QYBA 5EM1A 1H8ZA 3R7WB 2W1TA 4KQOA 2V8CA 3F1OA 1NYMA 1G68A 2HDQA 2ZQ7A 4M3KA 2DCFA 2X01A 1RGYA 3LR5A 2XRNA 2JE5A 3CHWP 1OTBA 4P87A 3ZFZA 1P97A 1TD5A 4EERA 1K0KA 4HIAA 1E4DA 1YQSA 1DJBA 2J3TC 3HLEA 3MZFA 4JGOA 3SH8A 1GA9A 4R3AA 4CJNA 2HPBA 2A24B 3OOVA 2XH9A 3BFFA 4HJ3A 4Q8IA 4AFIA 1ES3A 4K91A 4UQIS 4IJGA 1S67L 2CC1A 2PT7A 3UPOA 1N4OA 1TF1A 1ES2A 3AGFA 4E6XA 4IBXA 2ZM0A 4GLQA 4IVIA 5LBRA 1EWZA 4MDZA 1IYSA 2BASA 2ZQDA 3IBRA 4WZ5C 5GLCA 2Y2NA 3VP4A 1T18A 3IWQA 4ZDXA 4KZ6A 4Q0JA 2I72A 3C8CA 2Y2OA 3PBNA 3QP8A 1KDSA 1J9MA 4GB7A 2HV1A 1BYWA 3HLGA 5FI2A 3BYDA 4WL9A 1JWZA 3ITAA 1T19A 1CEGA 2PHYA 2LB9A 1N9NA 3UE3A 2OOLA 4CLCE 3G34A 3IF5A 1H8YA 4XUXA 3ZDJA 3UB6A 3ZVWA 4LV0A 4GNUA 3Q1FA 4FH2A 5HZHA 1FCOA 3M2KA 2W27A 3F1NA 4S2LA 1SHVA 2Q0OA 2QWSA 3G31A 2Y2GA 3IHBA 1KOUA 2ZQAA 3KSHA 4S2OA 4IVKA 1W8QA 4MN6A 4QD4A 5FL3A 5M18A 3SS3A 4JPMA 4DN0A 2XA7M 3BM6A 1S0WA 3EGDC 3NDEA 4S2NA 2ZLYA 5EPHA 1Z6FA 5G4ZA 1XJ4A 5FAOA 2M7UA 4R1GA 1GSXA 1F98A 4NETA 2KOIA 3LEZA 2VKSA 1Y54A 3OPRA 1K55C 2VK3A 3E0YA 2G2WA 3ULFA 2Y2KA 1L0DA 3VFHA 4MN5A 3MFXA 1XGIA 1XJ2A 5M1AA 4GDNA 3A3JA 4L9FA 3C30A 5EE8A 1ESIA 3SOIA 4EBPA 2B95A 2XR0A 3M6BA 4PPRA 3VE4A 4YFMA 4OOYA 2W3EA 3VOYA 3MZEA 5DTSA 2XROA 1PI4A 5CTMA 3G30A 4LRZE 4NXBA 2ZC6B 2O9CA 1QMFA 4F3LA 3ZHHA 4QHCA 3PBTA 2QZ6A 1KGGA 3TRCA 3G32A 3T4SA 2QPNA 4N9KA 4KUOA 4OQIA 4GCZA 2A49A 3VP2A 4DDSA 1Z09A 2J7VA 4EUVA 2NUPC 3QNBA 3FPWA 3VP3A 1LL5A 2Y2HA 1DY6A 2WKPA 3MBZA 5F68A 2ZL1B 3NC8A 4X6TA 3UNWA 5FI6A 1IKGA 5CHJA 3IT9A 5HW3A 1MKMA 4WUJA 2CMNA 3NIAA 4KZ7A 4WN5A 4XUZA 4GW9A 4HBTA 3IX8A 1K54C 3N4IA 4RQ9A 4B4XA 2H28A 3LY4A 1K57A 4UA6A 2BLSA 4G3VA 1KE0A 4LCLA 2QHKA 5G18A 4KENB 3NJAA 1DP6A 3U4LP 2PYRA 5BOHA 2P08A 3MFDA 5AVFA 2OSUA 2A24A 3MXRA 2ZM8A 5HWVA 4FCFA 2GDNA 1IFQA 4N1HA 3Q7ZA 1FCMA 2XA7S 3LCEA 1IEMA 2ZC3B 2W0NA 2WKQA 1FILA 2ACGA 2PR5A 1MY8A 2B18A 3GMWA 2Z6CA 2E8IA 3MKEA 1MWTA 4UEYA 3HUNA 2FH5A 4JXVA 3G2YA 3NI9A 3JYIA 2VEAA 1NZOA 3CMZA 4JGPA 3DTMA 2Y59A 5FDSA 3N8RA 1O07A 4E6WA 3MSHA 4OONA 5CHUA 2B5RA 2JN7A 4OPQA 3IXBA 1HVBA 1M40A 5FEGA 1PZPA 4E3NA 3S7PA 4E3KA 3PXPA 5A91A 4OP5A 4BWIA 3JVUA 1VHMA 4E3JA 3P7NA 1K25A 4OQHA 1TS7A 5GLAA 2VV7A 3DTEA 4IUKA 4JF4A 2V1AA 1W5DA 3WRZA 4MN7A 3A0VA 3ZYTA 4PM5A 1K6SA 4WZ5A 4ME4A 1ZKJA 1PWGA 1AWIA 4CQHA 5K5BA 2PBDP 5E2HA 3MQQA 3NDGA 5FQMA 3DW0A 5HDSA 4KG2A 1NYYA 5AQ7A 3K2NA 5EFWA 3Q07A 3WS1A 1AXBA 4FTXA 1BULA 2ZOHA 3OPHA 5J4EA 5J3WA 2Y91A 4BJPA 1PRQA 3O87A 3NOPC 1UGUA 5DVAA 3VP0A 4EETB 2WKRA 4Y0OA 3EEHA 1N9OA 4OVDA 3UE0A 1DRMA 4MLLA 1OPXA 1YKDA 4GDBA 5FQQA 3H7WB 2Q9MA 1ACFA 5I5LA 2OWHA 3H82B 1TVFA 3LI9A 3SH7A 3ZG0A 5AVEA 3IH8A 3PBOA 5DTTA 4JGRA 1BT5A 4BD1A 1ES5A 1SCWA 2Y2JA 5CEBA 3B33A 5TR7A 3V39A 4EBNA 4R70A 3C4PA 4Q0IA 3S4XA 2ZC7A 4YOFA 4CLCC 1XX2A 2EXAA 1K55A 4ETZA 4S2PA 4U0TA 2JBFA 3Q7VB 4WBGA 3CAXA 2Y2IA 2IWBA 1F9IA 5FATA 5HL6A 3NHQA 2M1CA 4X56A 3E4PA 4E3IA 5HWWA 4R6LA 3CI6A 3BJNA 3PR6A 4CLCB 3C7VA 3MJQA 3ZG8B 4EQIA 2Y2QA 3GDIA 3TSGA 4EEUA 4WEJA 2WAFA 3BY9A 2PDRA 3CLOA 5AQ9A 1CQAA 5DFYA 2Y55A 1VB6A 1BLHA 5CGWA 2ZD8A 4EESA 1IYOA 3RTYA 3SS4A 4JGQA 3ZNYA 5CTNA 1YLWA 3EQUA 5DKLA 2VGLS 5HD3A 5GHZA 5EECA 3MQOA 5DF8A 2WKHA 1NZUA 5FEFA 3DWZA 4LENA 2O0YA 1L0EA 2H0TA 3EQVA 4MEZA 4P6BA 3NY4A 2FFYA 1V9ZA 2XF3A 1K54A 3S7QA 5FAPA 2PAVP 4FOFA 5F69A 2J9PA 1RCJA 3CPTA 4C75A 3KO6A 1JWPA 4EXOA 4WM9A 3IS2B 3LIBA 4E04A 3EGXC 2IWCA 2XFSA 1LSWA 4RYEA 2WUQA 3VOLA 2LB5A 1WA9A 2WZXA 4N1XA 4R3JA 1D7EA 2B02A 2X02A 3VV4A 4EWFA 3GRJA 1S6RA 5E2EA 4X1MA 4IHQA 3O86A 4PKYG 1YLJA 1JWVA 2HJEA 1Q2QA 1IOUA 1XFNA 4OP8A 1KVLA 1XA1A 5HD5A 4NKPA 5IT5A 1EW0A 1BUEA 1KE4A 4K0XA 4U0XA 2X71A 1UWNX 2Q9NA 4MBHA 3WWXA 3VFFA 1SKOB 3HUMA 2J3TD 1W63M 1GHMA 4LRYC 2HZ5A 4F94A 1IYQA 4G3WA 4I38A 3NCKA 4E3MA 1OTAA 5AJGA 1C3BA 1OJ5A 2J8YA 1XKZA 4L0LA 4OOLA 1HTZA 2WK0A 2V0WA 5C5KA 1ERMA 3E98A 3A3FA 4LV1A 2W3FA 3QP5A 3SH9A 5EVLA 1GSWA 3LYXA 4B88A 3CWFA 3GQZA 4Y17A 4Q0HA 4NG2A 2XGNA 3NULA 2GZAA 2G2UA 3UDXA 5IHVA 2HGVA 3H7WA 3H82A 4Y5FA 5F1GA 4QJGA 3CG5A 1W79A 5E2FA 4KQQA 5HDDA 2ZQCA 5HX9A 2JHEA 1H8MA 3RFBA 3LUQA 1YLZA 2UWXA 3GECA 5CRFA 1G6AA 1PWDA 4X55A 5I94A 5KMWA 3W4QA 4EUZA 2WGWA 3T4JA 5DJUA 3IWOA 2Y2PA 4KZ3A 1CK3A 5G4YA 3IHAA 3L7HA 3W2ZA 3Q7VA 4DJ2A 2K31A 2D01A 3JPUA 4HJ4A 1G28A 3PYPA 4NEED 3C7UA 4LCMA 2DRWA 1G5UA 4X68A 4DKIA 3BRMA 2OAQ1 2ZMFA 4ZJ2A 4OKPA 5A92A 4MCWA 1PFLA 1HLUP 3B42A 1SDNA 3Q82A 4WMCD 1IKIA 1VQQA 2ZMVA 2RCXA 4Z9QA 5GHXA 2GNXA 3D72A 2G7UA 4GN2A 1VETB 4O8GA 4A5RA 3ISGA 3O5YA 3PHYA 4DJ3A 5DTKA 3V3RA 3TOIA 3IX4A 2WZZA 3BQ8A 3S7OA 4KZ5A 2W3DA 1NLZA 4GZBA 5CECA 2GJ3A 2GX5A 1TDLA 1JVJA 2V20A 4FSFA 3Q81A 2W3HA 4OQGA 4KQRA 1ZC2A 1ZHHB 3MXSA 4OH0A 1Y28A 3UY6A 4EW7A 4BQMA 3T1XA 3KYEA 2ZQ8A 3SZTA 5EVIC 1LLBA 4QU3A 3R7WA 2EXBA 2YKHA 1GHIA 1TEMA 4G3KA 1PI5A 1XFQA 4I3IA 1EROA 4FD8A 1LSVA 4OPZA 1GA0A 2HJ9C 2KX6A 2W3GA 3KYZA 3UE6A 4I3JA 1T1CA 1U60A 2Y8HA 5EVIB 1YSPA 5TGFA 3DAVA 2OV5A 3ZQ5A 2V0UA 4I5SA 1ZG6A 4HHDA 3LO7A 2H10A 5EUAA 3IS2A 5IS1A 3C2WA 4E3LA 1CJFA 3GVBA 3KSFA 2V1BA 3VP1A 2KDKA 3TJZC 3WS0A 4EV4A 3IQAA 3BQAA 1MWRA 2XDMA 3BECA 4HH2A 1FSYA 4HY8A 1ZG4A 2HDSA 3AGDA 1LL8A 1MWSA 2R78A 4KZAA 5CHMA 4DXCA 5DF9A 3OPPA 1P9RA 2EA9A 4S2MA 1IYPA 3M2JA 4LRXC 5EVID 4HNBA 3LIEA 3UB5P 3ZG9B 3HLDA 2M7VA 4X25A 1TDGA 3L9KA 2FFFB 4HEFA 3A3EA 2NUTC 4UAAA 1YAXA 3MS6A 1I2WA 2O9BA 3IWIA 3QP4A 3AGEA 5A8BA 2XEPA 4JXWA 3MKFA 4R0QA 1GSVA 2UV0E 3H9WA 2VGLM 1D06A 1XPBA 1RGZA 3GTCA 4PM8A 1J3WA 4H8RA 1PW1A 4FUWA 1NLYA 3LR4A 3UB9A 1FOFA 1YM1A 1PW8A 2VGJA 1BZAA 2AVXA 4BBTA 3CUEC 2Y2LA 4O01A 5HPFA 4KG5A 3HL9A 5MC7A 2XSSA 1S4RA 2O99A 3LR0A 1KGEA 3HLWA 4MBFA 3HREA 4HJ6A 5E43A 3QP6A 1Y4OA 4L9GA 4KZ8A 3ZG5A 3WS2A 4Y7PA 1E3UD 4K0WA 2XD1A 4DE2A 2R9WA 4WMCA 4PAUA 4S2IA 1EI5A 3F1NB 2DNSA 4UA7A 3VSLA 1SZVA 5KSHA 3QP2A 3V50A 4ZJ1A 4IBRA 4RA7A 3O88A 2JKFA 3GSGA 1A0KA 1H0MA 4GHIB 2JKRI 2FZ0A 1NRFA 4O7DA 1O7EA 4OQ0A 3MQ0A 4KQDA 3HJIA 5CGXA 1M6KA 2OAP1 2P04A 4WLAA 3DTKA 1K38A 1TS0A 1PIOA 3IH9A 3BFCA 4PM7A 4DE1A 3FZCA 3G4PA 3TW8A 3HUOA 5HPIA 1P9WA 4NXFA 4YNRA 1JNUA 4DF6A 3P01A 4XT2B 3O3VA 4M4XA 3LICA 4P6ZS 1BLSA 5L8MA 3WRTA 3ICYA 1JTDA 1DP9A 3I7JA 4HBUA 1VETA 4KG6A 4ZTKA 3ZG7B 4DRTA 3P98A 2XD5A 2JKTI 3N6IA 5L10A 2ZOIA 2D02A 3PBSA 1DJCA 3FKVA 1FCNA 3IF6C 1QMEA 5HAPA 5E2GA 3W4PA 3ZCZA 1ALQA 2HDRA 4ID4A 2ZL1A 3U2AA 2H0YA 4NXEA 1G6OA 1MBLA 1OTDA 2JCHA 4PHTA 2QMIA 5GHYA 1L2SA 3PAEA 2I9VA 4WZ4A 3IF6B 2Y79A 3OBFA 3E2LA 4HI4A 4MBKA 5KSCA 4CLCD 1CEFA 3NOUC 4Y3IA 4C3QA 5FQJA 3TG9A 4GJ4A 4XXRA 1PZOA 1XJ6A 3VSKA 3T4TA 5EVIA 3FYZA 4BENA 1K57C 4LLOB 5U47A 2ZJ9A 2EX9A 1H3QA 3V3SA 3EWKA 3MMHA 4DXBA 5JYOA 4N92A 5FQKA 1X0OA 4ARZB 5EOEA 1MPLA 2BTFP 3N8SA 3GR2A 1ESUA 4L9EA 3TE8A 2P9VB 4DE3A 3FC7A 1FR6A 3VE3A 4MMNA 1LI0A 3HLFA 1WYBA 2V2FF 4WELA 1ONHA 3CZDA 5TBMB 3BFEA 2PU4A 5F6AA 1V9YA 2XLNA 4S2KA 2VLGA 5EM0A 3T1QB 5AQAA 1UWPX 2WGVA 5FQIA 2V9AA 1OJGA 5HAQA 1JTGA 2ZQ9A 4JLFA 1ERQA 3R4KA 4I3AA 4YINA 1XA7A 3UMEA 1YT4A 3UB8A 3T1RA 3LY3A 3T4KA 5FQ9A 1ODVA 4B4ZA 2XQZA 4GOGA 4ZJ3A 2QJ5A 1XGJA 2OLVA 3WS5A 3DWKA 3HCYA 2INWA 1K4FA 3OC2A 3G35A 1E3UA 3UPPA 5AQBA 1T1BA 1YLPA 3EEAA 3DTIA 2ZBBA 3V67A 2E8JA 1YMSA 1LL9A 1CI9A 3T12B 1SKFA 2JKRM 1NY0A 5CXWA 2OWJA 3LIFA 5EOOA 3UB7A 3BWLA 3SS5A 3BEBA 1YLTA 4D2OA 1IELA 1L3LA 4K08A 1BLPA 4P0MA 4JBFA 1MKIA 1PWCA 4BL2A 3SW1A 2KLIA 5TJJA 1YLYA 1F5MA 4Y0UA 4R38A 4WYYA 3IX3A 1SDEA 3KX0X 1DP8A 5TFQA 3VMAA 4MNRA 4EQ1A 2Y4AA 1STZA 4R3BA 3CUEA 4S2JA 2JKTM 3A0SA 1FR1A 1WE4A 4Y15A 3D3OA 3M6HA 4WEKA 1D1JA 5F82A 5FAQA 5F5YA 5D3OA 1ES4A 4GHIA 1BSGA 4KZ4A 2QJ7A 4GS9B 1VEUB 3IXHA 2VV6A 4GD8A 4JXGA 3P09A 4QY6A 2EX8A 5F83A 3IXGA 2XK1A 3BLSA 1W7FA 4GD6A 1LT0A 4QB8A 3E4QA 5HARA 4Z1WA 1DJAA 5DFXA 4X1LA 3PBQA 3FKWA 1Q2PA 4XT2A 1S66L 2HP6A 2W1RA 4LV3A 2P7JA 4O0PA 5GLDA 1T1AA 2K7SA 2RL3A 5J8XA 4CLCA 4QWOA 1YMXA 1F2KA 1KE3A 4X53A 3LIDA 5M19A 4RX3A 5CX7A 3BY8A 3LEQA 3S1YA 1P0ZA 1OT9A 4GKUA 1N9BA 4H6JB 3IBJA 4Y0TA 5GLBA 1MZUA 2VA0A 3PAGA 3LGOA 4HOIA 1LI9A 2PYPA 1MWUA 5DF7A 3HLBA 5KIZA 4OPRA 3W8KA 2A3UA 1S1ZA 3QP1A 3MF0A 4D60A 4KZ9A 5HSQA 5DKKA 4RVAA 4LPZA 4U3TA 3HVFA 3F1PB 3IF6A 4JF6A 2WAEA 1N9LA 3C38A 4UA9A 2Y2MA 5CERA 4R4RA 2XFTA 3WS4A 4ZBEA 4BBUA 5L2FA 1KGFA 3DBAA 2IWDA 2VJWA 2J80A 4RX2A 4EBLA 2HP5A 2PBYA 1W63Q 1TS8A 1K4EA 1L0FA 2BG1A 2VZWA 2P74A 5JYPA 1YPRA 4OLDA 3UDFA 2V8FA 4PKYA 1S1YA 2ZM2A 3FG8A 1L0GA 4ESPA 3CITA 3LIAA 2PU2A 4ARZA 4OLGA 2R9XA 2EFXA 2L4RA 3T4OA 1BLCA 4II7A 2C6WB 5J7EA 2WKIA 2P9VA 3NOTC 4PM9A 3MR0A 2Z2LB 5F1FA 3T4QA 5EVEA 1KVMA 2W1TB 2JC7A 1LHYA 3F1OB 2Z6DA 3T4LA 3HLCA 2ZC5B 1ZTUA 3HJKA 2Z2MB 5TBMA 1HZOA 2OLUA 1I2SA 5DJTA 1W8YA 3MZDA 3CPTB 4LGWA 1K56D 4HP9A 4P6ZM 1KDWA 2A2LA 5HWTA 1OTIA 2L0WA 2PR6A 3FWLA 4FH4A 1LSXA 2L1MA 4PM6A 5IU1A 4JF5A 5FASA 4P85A 1PYYA 2HF6A 4LFUA 4BLMA 3ZGAB 4C6YA 2K2NA 3QHYA 3E4OA 2O9AA 3BW6A 3ITBA 3OPLA 4OOMA 1SKOA 1CF0A 2C5WB 3ZNTA 3NECA 5KZHA 4HH3A 3UN7A 2J9OA 3LR3A 5EV0A 3UDIA 2HDUA 2WGIA 5HFOA 1GCEA 2IA2A 1BTLA 4PMAA 5A90A 3BFGA 4R4SA 3OLOA 3LI8A 5FDHA 5FSRA 1VM1A 4ZAMA 1YSQA 3D9YA 4E3OA 3B3XA 3V5MA 2ZC4B 3HBRA 3C4OA 4CPKA 4BBVA 1XJ3A 2J3WA 2H5SA 3A3IA 4HP4A 3JVVA 1ONGA 1E25A 4OPYA 4BD0A 1XXMA 1NXYA 4YWZA 4B9OA 1NJ4A 4ETXA 2EX2A 2WKEA 3OCNA 3T50A 3K3CA 1XP4A 1NWZA 4BL3A 3EOIA 4EU0A 5CGSA 4WF0A 4B93A 4KZBA 2HP9A 5A93A 1HD8A 4S2NC 4GS9A 1VEUA 5HL1A 2JKGA 3KYQA 3OCLA 4NXGA 3CJMA 1CI8A 2EX6A 4Y13A 4R23A 4EEPA 3QNCA 2VGKA 2YKFA 3C5AA 1FQGA 2ZMAA 4HESA 1MC0A 3BLMA 1TS6A 3IXDA 2EWWA 4DE0A 4UQIM 1OTEA 4QY5A 2PD8A 1S4SA 5FA7A 3S22A 5L07A 3D4FA 3A0RA 2EWVA 3E2KA 4ZRRA 3FV7A 2VV8A 3W4OA 2WGWB 3N8LA 3T1SA 4DMZA 4NK3A 2DMWA 4JKTA 3G6OA 3S7NA 3PBRA 3FPVA 5HDCA 3GV9A 4IUHA 4H6JA 1WYCA 4JXSA 3UE1A 4IEDA 4QPRA 1FIKA 2PRFA 3ZVTA 1GHPA 3KSGA 3OZHA 3N7WA 3UMDA 3MXQA 3RH8B 4N9LA 5CEDA 3RXWA 1H5XA 1RP5A 5FI7A 2EFUA 4HQAA 1I5QA 3RJUA 3F1PA 1OT6A 2PD7A 4F3LB 4LV2A 2VX8A 3NBLA 4BMWA 4UHUA 4KUKA 3VOZA 2MJ6A 1NRJA 3A3DA 4Y2FA 3PTEA 5HAIA 1MXOA 2QKPA 3UO9A 5L09A 1K56A 5GL9A 4DDYA 3B47A 4I39A 3G2ZA 2WADA 4X69A 1K6RA 1OMEA 1PNEA 3UPNA
chains in the Genus database with same CATH topology
3BFDA 2WYXA 1SDEA 1EROA 4FD8A 3OPHA 4OPZA 5TFQA 1FSWA 3RXXA 3VMAA 4MNRA 2V1ZA 2Y4AA 2Y91A 1GA0A 4R3BA 4S2JA 4BJPA 3O87A 1H8ZA 5DVAA 3VP0A 1FR1A 1WE4A 4KQOA 1NYMA 1G68A 1U60A 2HDQA 5EVIB 4Y0OA 3M6HA 4WEKA 2ZQ7A 4OVDA 3UE0A 5TGFA 4M3KA 2OV5A 4MLLA 5F82A 4GDBA 5FAQA 1ZG6A 2DCFA 5D3OA 2X01A 5FQQA 1RGYA 3LO7A 2H10A 5EUAA 1ES4A 2Q9MA 2JE5A 1BSGA 1TVFA 3SH7A 3ZG0A 4E3LA 4KZ4A 3IH8A 4P87A 3PBOA 3ZFZA 3GVBA 3IXHA 1E4DA 4GD8A 3VP1A 5DTTA 4JXGA 3WS0A 3P09A 4QY6A 1YQSA 2EX8A 4EV4A 1DJBA 5F83A 3IQAA 3IXGA 3HLEA 3MZFA 2XK1A 3SH8A 1GA9A 1MWRA 1BT5A 1W7FA 2HPBA 3BLSA 4CJNA 4GD6A 2XDMA 3BECA 4QB8A 5HARA 1FSYA 4BD1A 1DJAA 2XH9A 1ES5A 1SCWA 1ZG4A 2HDSA 2Y2JA 3AGDA 3BFFA 1MWSA 3PBQA 5TR7A 3V39A 5CEBA 3FKWA 4EBNA 1Q2PA 4Q8IA 3C4PA 4KZAA 5CHMA 1ES3A 3S4XA 4K91A 4DXCA 2HP6A 2ZC7A 5DF9A 4LV3A 1XX2A 2EXAA 3OPPA 5GLDA 4S2MA 1IYPA 3M2JA 1K55A 5EVID 4S2PA 4U0TA 2CC1A 2RL3A 5J8XA 2JBFA 3Q7VB 4WBGA 3UPOA 2Y2IA 3ZG9B 3HLDA 2IWBA 1YMXA 1N4OA 5FATA 1KE3A 4X53A 1ES2A 1TDGA 3AGFA 4X56A 5M19A 4RX3A 4E6XA 3S1YA 2FFFB 4IBXA 2ZM0A 4HEFA 4IVIA 4E3IA 4GKUA 1EWZA 1IYSA 3A3EA 1N9BA 4Y0TA 5GLBA 3C7VA 4UAAA 2ZQDA 3PAGA 3ZG8B 4EQIA 2Y2QA 1LI9A 1I2WA 1MWUA 4WZ5C 5GLCA 5DF7A 3IWIA 3HLBA 2Y2NA 4OPRA 3VP4A 2A3UA 3AGEA 3IWQA 3W8KA 4ZDXA 3TSGA 4KZ6A 4WEJA 2I72A 2WAFA 2XEPA 4JXWA 3MKFA 2Y2OA 3PBNA 4KZ9A 4R0QA 4RVAA 4U3TA 5AQ9A 3HVFA 1KDSA 3IF6A 1J9MA 4JF6A 2Y55A 2WAEA 4GB7A 4UA9A 1BLHA 5CGWA 1XPBA 1RGZA 2Y2MA 5CERA 4R4RA 3GTCA 2XFTA 3HLGA 4PM8A 3WS4A 4ZBEA 5L2FA 1KGFA 4H8RA 1PW1A 2IWDA 2ZD8A 4RX2A 1IYOA 4EBLA 5FI2A 3BYDA 3SS4A 1FOFA 1JWZA 2HP5A 3ITAA 3ZNYA 1YM1A 1PW8A 5CTNA 1CEGA 2PBYA 2VGJA 3UE3A 1BZAA 1K4EA 1YLWA 3EQUA 1L0FA 2BG1A 2Y2LA 3G34A 3IF5A 1H8YA 2P74A 4KG5A 4XUXA 5GHZA 3ZDJA 3HL9A 5EECA 4LV0A 3ZVWA 5JYPA 5DF8A 4GNUA 3Q1FA 4OLDA 4FH2A 3UDFA 2WKHA 1KGEA 1FCOA 2ZM2A 3HLWA 3M2KA 4MBFA 1L0GA 4S2LA 1NZUA 1SHVA 3HREA 2PU2A 3G31A 2Y2GA 2R9XA 4OLGA 2EFXA 3IHBA 3DWZA 4LENA 5E43A 3ZG5A 4KZ8A 1BLCA 3WS2A 1L0EA 2H0TA 2ZQAA 4Y7PA 1E3UD 4K0WA 2XD1A 4DE2A 3EQVA 4MEZA 2C6WB 4P6BA 4IVKA 1W8QA 2WKIA 2P9VA 2R9WA 4QD4A 3NY4A 2FFYA 4PM9A 4S2OA 5M18A 4WMCA 2Z2LB 2XF3A 1K54A 4S2IA 3SS3A 5F1FA 1EI5A 5FAPA 4UA7A 2DNSA 4JPMA 3VSLA 1KVMA 5KSHA 2J9PA 1RCJA 2JC7A 1LHYA 4C75A 3HLCA 2ZC5B 3V50A 1JWPA 3BM6A 4ZJ1A 1S0WA 4IBRA 4RA7A 2Z2MB 3O88A 3NDEA 4S2NA 1HZOA 2ZLYA 2OLUA 5EPHA 1Z6FA 5FAOA 1I2SA 3GSGA 4R1GA 4WM9A 1W8YA 3MZDA 4NETA 1NRFA 4O7DA 1O7EA 3LEZA 1Y54A 2IWCA 4OQ0A 2XFSA 3OPRA 1K56D 5CGXA 1M6KA 1KDWA 4RYEA 1K55C 2WUQA 1K38A 3IH9A 1PIOA 2G2WA 2WZXA 3BFCA 4PM7A 2Y2KA 1L0DA 4N1XA 3FWLA 3VFHA 3FZCA 3G4PA 4FH4A 4R3JA 4DE1A 3HUOA 1XGIA 2X02A 4PM6A 5M1AA 4EWFA 3GRJA 4JF5A 4DF6A 4GDNA 1S6RA 5E2EA 3A3JA 3O86A 5FASA 5EE8A 3O3VA 4P85A 1PYYA 1ESIA 3SOIA 1YLJA 4EBPA 2XR0A 1BLSA 3M6BA 1JWVA 4PPRA 1Q2QA 4BLMA 4YFMA 4OOYA 3WRTA 3ZGAB 4C6YA 4OP8A 1JTDA 3I7JA 4HBUA 4KG6A 3QHYA 4ZTKA 3ZG7B 1KVLA 1XA1A 3VOYA 3ITBA 4DRTA 3MZEA 3P98A 2XD5A 3OPLA 5DTSA 1PI4A 3N6IA 5CTMA 3G30A 4OOMA 2ZC6B 2C5WB 1QMFA 3ZNTA 3PBSA 1DJCA 1BUEA 3ZHHA 1KE4A 4QHCA 5KZHA 3FKVA 1FCNA 3IF6C 1QMEA 2QZ6A 3PBTA 3UN7A 2J9OA 3UDIA 4K0XA 1KGGA 2HDUA 2WGIA 4U0XA 3G32A 2X71A 1GCEA 2QPNA 5HFOA 5E2GA 5HAPA 2Q9NA 4N9KA 3W4PA 3ZCZA 4OQIA 1BTLA 4MBHA 4PMAA 1ALQA 3WWXA 3VFFA 2HDRA 3HUMA 5A90A 2A49A 3BFGA 4R4SA 5FDHA 5FSRA 3VP2A 4ID4A 4DDSA 1GHMA 2H0YA 1VM1A 2J7VA 4ZAMA 4F94A 1IYQA 4E3OA 3B3XA 3QNBA 1MBLA 3V5MA 2JCHA 2ZC4B 2QMIA 3HBRA 3NCKA 3C4OA 5GHYA 3VP3A 4CPKA 1LL5A 4E3MA 1C3BA 1L2SA 3PAEA 2H5SA 2J8YA 3A3IA 4WZ4A 3IF6B 2Y2HA 1XKZA 1DY6A 4L0LA 4OOLA 1HTZA 1ONGA 2WK0A 1E25A 3E2LA 4MBKA 4OPYA 4BD0A 5KSCA 1XXMA 3MBZA 1NXYA 1ERMA 3NC8A 3A3FA 4X6TA 3UNWA 5FI6A 1CEFA 4LV1A 1NJ4A 1IKGA 5CHJA 4C3QA 2EX2A 5FQJA 3IT9A 3SH9A 5EVLA 2WKEA 3TG9A 5HW3A 4XXRA 4B88A 3OCNA 1PZOA 3NIAA 1XP4A 4KZ7A 4XUZA 3VSKA 3GQZA 4BL3A 4HBTA 5CGSA 1K54C 5EVIA 2XGNA 3FYZA 3N4IA 4BENA 1K57C 5U47A 2G2UA 2ZJ9A 3UDXA 2EX9A 5IHVA 3V3SA 4B4XA 4DXBA 3LY4A 4KZBA 1K57A 5JYOA 2HP9A 4N92A 5A93A 1HD8A 4UA6A 5FQKA 5EOEA 1MPLA 2BLSA 3N8SA 4S2NC 1KE0A 4LCLA 5HL1A 5F1GA 4QJGA 3CG5A 3GR2A 4KENB 1ESUA 5G18A 1W79A 5E2FA 4KQQA 3OCLA 5BOHA 2P9VB 1CI8A 2EX6A 3CJMA 4DE3A 4R23A 2ZQCA 5HX9A 1FR6A 3QNCA 3MFDA 2VGKA 2OSUA 1YLZA 2UWXA 5CRFA 3C5AA 3MXRA 1G6AA 1FQGA 1LI0A 1PWDA 2ZMAA 2ZM8A 4HESA 3BLMA 3HLFA 1WYBA 4X55A 2V2FF 3IXDA 5I94A 4FCFA 4WELA 5KMWA 2GDNA 3W4QA 4DE0A 1ONHA 3CZDA 4EUZA 4N1HA 3Q7ZA 1FCMA 2WGWA 3LCEA 3BFEA 2PU4A 1IEMA 2XLNA 3IWOA 4S2KA 2Y2PA 4KZ3A 4QY5A 2ZC3B 5AQAA 5FA7A 3S22A 1CK3A 3IHAA 1MY8A 2WGVA 3D4FA 3Q7VA 3GMWA 5FQIA 2E8IA 5HAQA 3E2KA 3MKEA 1MWTA 3C7UA 1JTGA 3HUNA 2ZQ9A 4LCMA 3FV7A 4JXVA 2DRWA 3G2YA 2WGWB 3W4OA 3N8LA 3NI9A 4JLFA 3JYIA 1ERQA 4NK3A 4JKTA 4X68A 4YINA 1NZOA 3CMZA 1XA7A 1YT4A 4DKIA 3BRMA 3LY3A 5FQ9A 3PBRA 4ZJ2A 3DTMA 2Y59A 4B4ZA 4OKPA 5A92A 3GV9A 1WYCA 2XQZA 3N8RA 4GOGA 4JXSA 4ZJ3A 1SDNA 1O07A 3Q82A 4WMCD 3UE1A 4IEDA 1IKIA 1VQQA 4E6WA 4OONA 1XGJA 2RCXA 4Z9QA 1GHPA 5CHUA 2OLVA 5GHXA 3ZVTA 3WS5A 2B5RA 3OZHA 4OPQA 3N7WA 3IXBA 1HVBA 1M40A 4GN2A 1PZPA 3DWKA 4E3NA 4E3KA 5A91A 4OP5A 4N9LA 4A5RA 1K4FA 3RXWA 1H5XA 3ISGA 1RP5A 3G35A 3OC2A 5CEDA 5FI7A 4E3JA 2EFUA 1I5QA 1E3UA 1K25A 3UPPA 5DTKA 4OQHA 3V3RA 3RJUA 5GLAA 3TOIA 5AQBA 1YLPA 2WZZA 4KZ5A 4JF4A 1W5DA 4GZBA 4LV2A 3WRZA 5CECA 1YMSA 1LL9A 1CI9A 4PM5A 1K6SA 1SKFA 3NBLA 1TDLA 1JVJA 4WZ5A 1NY0A 4UHUA 5CXWA 1ZKJA 1PWGA 2V20A 4FSFA 3Q81A 3VOZA 5EOOA 4OQGA 4KQRA 3SS5A 5E2HA 3BEBA 1ZC2A 3MXSA 3UY6A 4OH0A 1YLTA 3A3DA 4D2OA 3PTEA 3NDGA 5HAIA 1IELA 5FQMA 1MXOA 3DW0A 4BQMA 1BLPA 4P0MA 3UO9A 4JBFA 1K56A 1MKIA 4KG2A 2ZQ8A 1NYYA 5AQ7A 1PWCA 5GL9A 4DDYA 4BL2A 5EVIC 1LLBA 4QU3A 1YLYA 2EXBA 4Y0UA 1GHIA 2WADA 3G2ZA 3Q07A 1TEMA 1K6RA 1OMEA 1PI5A 1AXBA 4X69A 3WS1A 1BULA 3UPNA 4WYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFD A;  2WYX A;  1SDE A;  1ERO A;  4FD8 A;  3OPH A;  4OPZ A;  5TFQ A;  1FSW A;  3RXX A;  3VMA A;  4MNR A;  2V1Z A;  2Y4A A;  2Y91 A;  1GA0 A;  4R3B A;  4S2J A;  4BJP A;  3O87 A;  1H8Z A;  5DVA A;  3VP0 A;  1FR1 A;  1WE4 A;  4KQO A;  1NYM A;  1G68 A;  1U60 A;  2HDQ A;  5EVI B;  4Y0O A;  3M6H A;  4WEK A;  2ZQ7 A;  4OVD A;  3UE0 A;  5TGF A;  4M3K A;  2OV5 A;  4MLL A;  5F82 A;  4GDB A;  5FAQ A;  1ZG6 A;  2DCF A;  5D3O A;  2X01 A;  5FQQ A;  1RGY A;  3LO7 A;  2H10 A;  5EUA A;  1ES4 A;  2Q9M A;  2JE5 A;  1BSG A;  1TVF A;  3SH7 A;  3ZG0 A;  4E3L A;  4KZ4 A;  3IH8 A;  4P87 A;  3PBO A;  3ZFZ A;  3GVB A;  3IXH A;  1E4D A;  4GD8 A;  3VP1 A;  5DTT A;  4JXG A;  3WS0 A;  3P09 A;  4QY6 A;  1YQS A;  2EX8 A;  4EV4 A;  1DJB A;  5F83 A;  3IQA A;  3IXG A;  3HLE A;  3MZF A;  2XK1 A;  3SH8 A;  1GA9 A;  1MWR A;  1BT5 A;  1W7F A;  2HPB A;  3BLS A;  4CJN A;  4GD6 A;  2XDM A;  3BEC A;  4QB8 A;  5HAR A;  1FSY A;  4BD1 A;  1DJA A;  2XH9 A;  1ES5 A;  1SCW A;  1ZG4 A;  2HDS A;  2Y2J A;  3AGD A;  3BFF A;  1MWS A;  3PBQ A;  5TR7 A;  3V39 A;  5CEB A;  3FKW A;  4EBN A;  1Q2P A;  4Q8I A;  3C4P A;  4KZA A;  5CHM A;  1ES3 A;  3S4X A;  4K91 A;  4DXC A;  2HP6 A;  2ZC7 A;  5DF9 A;  4LV3 A;  1XX2 A;  2EXA A;  3OPP A;  5GLD A;  4S2M A;  1IYP A;  3M2J A;  1K55 A;  5EVI D;  4S2P A;  4U0T A;  2CC1 A;  2RL3 A;  5J8X A;  2JBF A;  3Q7V B;  4WBG A;  3UPO A;  2Y2I A;  3ZG9 B;  3HLD A;  2IWB A;  1YMX A;  1N4O A;  5FAT A;  1KE3 A;  4X53 A;  1ES2 A;  1TDG A;  3AGF A;  4X56 A;  5M19 A;  4RX3 A;  4E6X A;  3S1Y A;  2FFF B;  4IBX A;  2ZM0 A;  4HEF A;  4IVI A;  4E3I A;  4GKU A;  1EWZ A;  1IYS A;  3A3E A;  1N9B A;  4Y0T A;  5GLB A;  3C7V A;  4UAA A;  2ZQD A;  3PAG A;  3ZG8 B;  4EQI A;  2Y2Q A;  1LI9 A;  1I2W A;  1MWU A;  4WZ5 C;  5GLC A;  5DF7 A;  3IWI A;  3HLB A;  2Y2N A;  4OPR A;  3VP4 A;  2A3U A;  3AGE A;  3IWQ A;  3W8K A;  4ZDX A;  3TSG A;  4KZ6 A;  4WEJ A;  2I72 A;  2WAF A;  2XEP A;  4JXW A;  3MKF A;  2Y2O A;  3PBN A;  4KZ9 A;  4R0Q A;  4RVA A;  4U3T A;  5AQ9 A;  3HVF A;  1KDS A;  3IF6 A;  1J9M A;  4JF6 A;  2Y55 A;  2WAE A;  4GB7 A;  4UA9 A;  1BLH A;  5CGW A;  1XPB A;  1RGZ A;  2Y2M A;  5CER A;  4R4R A;  3GTC A;  2XFT A;  3HLG A;  4PM8 A;  3WS4 A;  4ZBE A;  5L2F A;  1KGF A;  4H8R A;  1PW1 A;  2IWD A;  2ZD8 A;  4RX2 A;  1IYO A;  4EBL A;  5FI2 A;  3BYD A;  3SS4 A;  1FOF A;  1JWZ A;  2HP5 A;  3ITA A;  3ZNY A;  1YM1 A;  1PW8 A;  5CTN A;  1CEG A;  2PBY A;  2VGJ A;  3UE3 A;  1BZA A;  1K4E A;  1YLW A;  3EQU A;  1L0F A;  2BG1 A;  2Y2L A;  3G34 A;  3IF5 A;  1H8Y A;  2P74 A;  4KG5 A;  4XUX A;  5GHZ A;  3ZDJ A;  3HL9 A;  5EEC A;  4LV0 A;  3ZVW A;  5JYP A;  5DF8 A;  4GNU A;  3Q1F A;  4OLD A;  4FH2 A;  3UDF A;  2WKH A;  1KGE A;  1FCO A;  2ZM2 A;  3HLW A;  3M2K A;  4MBF A;  1L0G A;  4S2L A;  1NZU A;  1SHV A;  3HRE A;  2PU2 A;  3G31 A;  2Y2G A;  2R9X A;  4OLG A;  2EFX A;  3IHB A;  3DWZ A;  4LEN A;  5E43 A;  3ZG5 A;  4KZ8 A;  1BLC A;  3WS2 A;  1L0E A;  2H0T A;  2ZQA A;  4Y7P A;  1E3U D;  4K0W A;  2XD1 A;  4DE2 A;  3EQV A;  4MEZ A;  2C6W B;  4P6B A;  4IVK A;  1W8Q A;  2WKI A;  2P9V A;  2R9W A;  4QD4 A;  3NY4 A;  2FFY A;  4PM9 A;  4S2O A;  5M18 A;  4WMC A;  2Z2L B;  2XF3 A;  1K54 A;  4S2I A;  3SS3 A;  5F1F A;  1EI5 A;  5FAP A;  4UA7 A;  2DNS A;  4JPM A;  3VSL A;  1KVM A;  5KSH A;  2J9P A;  1RCJ A;  2JC7 A;  1LHY A;  4C75 A;  3HLC A;  2ZC5 B;  3V50 A;  1JWP A;  3BM6 A;  4ZJ1 A;  1S0W A;  4IBR A;  4RA7 A;  2Z2M B;  3O88 A;  3NDE A;  4S2N A;  1HZO A;  2ZLY A;  2OLU A;  5EPH A;  1Z6F A;  5FAO A;  1I2S A;  3GSG A;  4R1G A;  4WM9 A;  1W8Y A;  3MZD A;  4NET A;  1NRF A;  4O7D A;  1O7E A;  3LEZ A;  1Y54 A;  2IWC A;  4OQ0 A;  2XFS A;  3OPR A;  1K56 D;  5CGX A;  1M6K A;  1KDW A;  4RYE A;  1K55 C;  2WUQ A;  1K38 A;  3IH9 A;  1PIO A;  2G2W A;  2WZX A;  3BFC A;  4PM7 A;  2Y2K A;  1L0D A;  4N1X A;  3FWL A;  3VFH A;  3FZC A;  3G4P A;  4FH4 A;  4R3J A;  4DE1 A;  3HUO A;  1XGI A;  2X02 A;  4PM6 A;  5M1A A;  4EWF A;  3GRJ A;  4JF5 A;  4DF6 A;  4GDN A;  1S6R A;  5E2E A;  3A3J A;  3O86 A;  5FAS A;  5EE8 A;  3O3V A;  4P85 A;  1PYY A;  1ESI A;  3SOI A;  1YLJ A;  4EBP A;  2XR0 A;  1BLS A;  3M6B A;  1JWV A;  4PPR A;  1Q2Q A;  4BLM A;  4YFM A;  4OOY A;  3WRT A;  3ZGA B;  4C6Y A;  4OP8 A;  1JTD A;  3I7J A;  4HBU A;  4KG6 A;  3QHY A;  4ZTK A;  3ZG7 B;  1KVL A;  1XA1 A;  3VOY A;  3ITB A;  4DRT A;  3MZE A;  3P98 A;  2XD5 A;  3OPL A;  5DTS A;  1PI4 A;  3N6I A;  5CTM A;  3G30 A;  4OOM A;  2ZC6 B;  2C5W B;  1QMF A;  3ZNT A;  3PBS A;  1DJC A;  1BUE A;  3ZHH A;  1KE4 A;  4QHC A;  5KZH A;  3FKV A;  1FCN A;  3IF6 C;  1QME A;  2QZ6 A;  3PBT A;  3UN7 A;  2J9O A;  3UDI A;  4K0X A;  1KGG A;  2HDU A;  2WGI A;  4U0X A;  3G32 A;  2X71 A;  1GCE A;  2QPN A;  5HFO A;  5E2G A;  5HAP A;  2Q9N A;  4N9K A;  3W4P A;  3ZCZ A;  4OQI A;  1BTL A;  4MBH A;  4PMA A;  1ALQ A;  3WWX A;  3VFF A;  2HDR A;  3HUM A;  5A90 A;  2A49 A;  3BFG A;  4R4S A;  5FDH A;  5FSR A;  3VP2 A;  4ID4 A;  4DDS A;  1GHM A;  2H0Y A;  1VM1 A;  2J7V A;  4ZAM A;  4F94 A;  1IYQ A;  4E3O A;  3B3X A;  3QNB A;  1MBL A;  3V5M A;  2JCH A;  2ZC4 B;  2QMI A;  3HBR A;  3NCK A;  3C4O A;  5GHY A;  3VP3 A;  4CPK A;  1LL5 A;  4E3M A;  1C3B A;  1L2S A;  3PAE A;  2H5S A;  2J8Y A;  3A3I A;  4WZ4 A;  3IF6 B;  2Y2H A;  1XKZ A;  1DY6 A;  4L0L A;  4OOL A;  1HTZ A;  1ONG A;  2WK0 A;  1E25 A;  3E2L A;  4MBK A;  4OPY A;  4BD0 A;  5KSC A;  1XXM A;  3MBZ A;  1NXY A;  1ERM A;  3NC8 A;  3A3F A;  4X6T A;  3UNW A;  5FI6 A;  1CEF A;  4LV1 A;  1NJ4 A;  1IKG A;  5CHJ A;  4C3Q A;  2EX2 A;  5FQJ A;  3IT9 A;  3SH9 A;  5EVL A;  2WKE A;  3TG9 A;  5HW3 A;  4XXR A;  4B88 A;  3OCN A;  1PZO A;  3NIA A;  1XP4 A;  4KZ7 A;  4XUZ A;  3VSK A;  3GQZ A;  4BL3 A;  4HBT A;  5CGS A;  1K54 C;  5EVI A;  2XGN A;  3FYZ A;  3N4I A;  4BEN A;  1K57 C;  5U47 A;  2G2U A;  2ZJ9 A;  3UDX A;  2EX9 A;  5IHV A;  3V3S A;  4B4X A;  4DXB A;  3LY4 A;  4KZB A;  1K57 A;  5JYO A;  2HP9 A;  4N92 A;  5A93 A;  1HD8 A;  4UA6 A;  5FQK A;  5EOE A;  1MPL A;  2BLS A;  3N8S A;  4S2N C;  1KE0 A;  4LCL A;  5HL1 A;  5F1G A;  4QJG A;  3CG5 A;  3GR2 A;  4KEN B;  1ESU A;  5G18 A;  1W79 A;  5E2F A;  4KQQ A;  3OCL A;  5BOH A;  2P9V B;  1CI8 A;  2EX6 A;  3CJM A;  4DE3 A;  4R23 A;  2ZQC A;  5HX9 A;  1FR6 A;  3QNC A;  3MFD A;  2VGK A;  2OSU A;  1YLZ A;  2UWX A;  5CRF A;  3C5A A;  3MXR A;  1G6A A;  1FQG A;  1LI0 A;  1PWD A;  2ZMA A;  2ZM8 A;  4HES A;  3BLM A;  3HLF A;  1WYB A;  4X55 A;  2V2F F;  3IXD A;  5I94 A;  4FCF A;  4WEL A;  5KMW A;  2GDN A;  3W4Q A;  4DE0 A;  1ONH A;  3CZD A;  4EUZ A;  4N1H A;  3Q7Z A;  1FCM A;  2WGW A;  3LCE A;  3BFE A;  2PU4 A;  1IEM A;  2XLN A;  3IWO A;  4S2K A;  2Y2P A;  4KZ3 A;  4QY5 A;  2ZC3 B;  5AQA A;  5FA7 A;  3S22 A;  1CK3 A;  3IHA A;  1MY8 A;  2WGV A;  3D4F A;  3Q7V A;  3GMW A;  5FQI A;  2E8I A;  5HAQ A;  3E2K A;  3MKE A;  1MWT A;  3C7U A;  1JTG A;  3HUN A;  2ZQ9 A;  4LCM A;  3FV7 A;  4JXV A;  2DRW A;  3G2Y A;  2WGW B;  3W4O A;  3N8L A;  3NI9 A;  4JLF A;  3JYI A;  1ERQ A;  4NK3 A;  4JKT A;  4X68 A;  4YIN A;  1NZO A;  3CMZ A;  1XA7 A;  1YT4 A;  4DKI A;  3BRM A;  3LY3 A;  5FQ9 A;  3PBR A;  4ZJ2 A;  3DTM A;  2Y59 A;  4B4Z A;  4OKP A;  5A92 A;  3GV9 A;  1WYC A;  2XQZ A;  3N8R A;  4GOG A;  4JXS A;  4ZJ3 A;  1SDN A;  1O07 A;  3Q82 A;  4WMC D;  3UE1 A;  4IED A;  1IKI A;  1VQQ A;  4E6W A;  4OON A;  1XGJ A;  2RCX A;  4Z9Q A;  1GHP A;  5CHU A;  2OLV A;  5GHX A;  3ZVT A;  3WS5 A;  2B5R A;  3OZH A;  4OPQ A;  3N7W A;  3IXB A;  1HVB A;  1M40 A;  4GN2 A;  1PZP A;  3DWK A;  4E3N A;  4E3K A;  5A91 A;  4OP5 A;  4N9L A;  4A5R A;  1K4F A;  3RXW A;  1H5X A;  3ISG A;  1RP5 A;  3G35 A;  3OC2 A;  5CED A;  5FI7 A;  4E3J A;  2EFU A;  1I5Q A;  1E3U A;  1K25 A;  3UPP A;  5DTK A;  4OQH A;  3V3R A;  3RJU A;  5GLA A;  3TOI A;  5AQB A;  1YLP A;  2WZZ A;  4KZ5 A;  4JF4 A;  1W5D A;  4GZB A;  4LV2 A;  3WRZ A;  5CEC A;  1YMS A;  1LL9 A;  1CI9 A;  4PM5 A;  1K6S A;  1SKF A;  3NBL A;  1TDL A;  1JVJ A;  4WZ5 A;  1NY0 A;  4UHU A;  5CXW A;  1ZKJ A;  1PWG A;  2V20 A;  4FSF A;  3Q81 A;  3VOZ A;  5EOO A;  4OQG A;  4KQR A;  3SS5 A;  5E2H A;  3BEB A;  1ZC2 A;  3MXS A;  3UY6 A;  4OH0 A;  1YLT A;  3A3D A;  4D2O A;  3PTE A;  3NDG A;  5HAI A;  1IEL A;  5FQM A;  1MXO A;  3DW0 A;  4BQM A;  1BLP A;  4P0M A;  3UO9 A;  4JBF A;  1K56 A;  1MKI A;  4KG2 A;  2ZQ8 A;  1NYY A;  5AQ7 A;  1PWC A;  5GL9 A;  4DDY A;  4BL2 A;  5EVI C;  1LLB A;  4QU3 A;  1YLY A;  2EXB A;  4Y0U A;  1GHI A;  2WAD A;  3G2Z A;  3Q07 A;  1TEM A;  1K6R A;  1OME A;  1PI5 A;  1AXB A;  4X69 A;  3WS1 A;  1BUL A;  3UPN A;  4WYY A; 
#chains in the Genus database with same CATH topology
 3BFD A;  2WYX A;  3K3D A;  3KSI A;  3LFV A;  1FSW A;  3RXX A;  2V1Z A;  2QYB A;  5EM1 A;  1H8Z A;  3R7W B;  2W1T A;  4KQO A;  2V8C A;  3F1O A;  1NYM A;  1G68 A;  2HDQ A;  2ZQ7 A;  4M3K A;  2DCF A;  2X01 A;  1RGY A;  3LR5 A;  2XRN A;  2JE5 A;  3CHW P;  1OTB A;  4P87 A;  3ZFZ A;  1P97 A;  1TD5 A;  4EER A;  1K0K A;  4HIA A;  1E4D A;  1YQS A;  1DJB A;  2J3T C;  3HLE A;  3MZF A;  4JGO A;  3SH8 A;  1GA9 A;  4R3A A;  4CJN A;  2HPB A;  2A24 B;  3OOV A;  2XH9 A;  3BFF A;  4HJ3 A;  4Q8I A;  4AFI A;  1ES3 A;  4K91 A;  4UQI S;  4IJG A;  1S67 L;  2CC1 A;  2PT7 A;  3UPO A;  1N4O A;  1TF1 A;  1ES2 A;  3AGF A;  4E6X A;  4IBX A;  2ZM0 A;  4GLQ A;  4IVI A;  5LBR A;  1EWZ A;  4MDZ A;  1IYS A;  2BAS A;  2ZQD A;  3IBR A;  4WZ5 C;  5GLC A;  2Y2N A;  3VP4 A;  1T18 A;  3IWQ A;  4ZDX A;  4KZ6 A;  4Q0J A;  2I72 A;  3C8C A;  2Y2O A;  3PBN A;  3QP8 A;  1KDS A;  1J9M A;  4GB7 A;  2HV1 A;  1BYW A;  3HLG A;  5FI2 A;  3BYD A;  4WL9 A;  1JWZ A;  3ITA A;  1T19 A;  1CEG A;  2PHY A;  2LB9 A;  1N9N A;  3UE3 A;  2OOL A;  4CLC E;  3G34 A;  3IF5 A;  1H8Y A;  4XUX A;  3ZDJ A;  3UB6 A;  3ZVW A;  4LV0 A;  4GNU A;  3Q1F A;  4FH2 A;  5HZH A;  1FCO A;  3M2K A;  2W27 A;  3F1N A;  4S2L A;  1SHV A;  2Q0O A;  2QWS A;  3G31 A;  2Y2G A;  3IHB A;  1KOU A;  2ZQA A;  3KSH A;  4S2O A;  4IVK A;  1W8Q A;  4MN6 A;  4QD4 A;  5FL3 A;  5M18 A;  3SS3 A;  4JPM A;  4DN0 A;  2XA7 M;  3BM6 A;  1S0W A;  3EGD C;  3NDE A;  4S2N A;  2ZLY A;  5EPH A;  1Z6F A;  5G4Z A;  1XJ4 A;  5FAO A;  2M7U A;  4R1G A;  1GSX A;  1F98 A;  4NET A;  2KOI A;  3LEZ A;  2VKS A;  1Y54 A;  3OPR A;  1K55 C;  2VK3 A;  3E0Y A;  2G2W A;  3ULF A;  2Y2K A;  1L0D A;  3VFH A;  4MN5 A;  3MFX A;  1XGI A;  1XJ2 A;  5M1A A;  4GDN A;  3A3J A;  4L9F A;  3C30 A;  5EE8 A;  1ESI A;  3SOI A;  4EBP A;  2B95 A;  2XR0 A;  3M6B A;  4PPR A;  3VE4 A;  4YFM A;  4OOY A;  2W3E A;  3VOY A;  3MZE A;  5DTS A;  2XRO A;  1PI4 A;  5CTM A;  3G30 A;  4LRZ E;  4NXB A;  2ZC6 B;  2O9C A;  1QMF A;  4F3L A;  3ZHH A;  4QHC A;  3PBT A;  2QZ6 A;  1KGG A;  3TRC A;  3G32 A;  3T4S A;  2QPN A;  4N9K A;  4KUO A;  4OQI A;  4GCZ A;  2A49 A;  3VP2 A;  4DDS A;  1Z09 A;  2J7V A;  4EUV A;  2NUP C;  3QNB A;  3FPW A;  3VP3 A;  1LL5 A;  2Y2H A;  1DY6 A;  2WKP A;  3MBZ A;  5F68 A;  2ZL1 B;  3NC8 A;  4X6T A;  3UNW A;  5FI6 A;  1IKG A;  5CHJ A;  3IT9 A;  5HW3 A;  1MKM A;  4WUJ A;  2CMN A;  3NIA A;  4KZ7 A;  4WN5 A;  4XUZ A;  4GW9 A;  4HBT A;  3IX8 A;  1K54 C;  3N4I A;  4RQ9 A;  4B4X A;  2H28 A;  3LY4 A;  1K57 A;  4UA6 A;  2BLS A;  4G3V A;  1KE0 A;  4LCL A;  2QHK A;  5G18 A;  4KEN B;  3NJA A;  1DP6 A;  3U4L P;  2PYR A;  5BOH A;  2P08 A;  3MFD A;  5AVF A;  2OSU A;  2A24 A;  3MXR A;  2ZM8 A;  5HWV A;  4FCF A;  2GDN A;  1IFQ A;  4N1H A;  3Q7Z A;  1FCM A;  2XA7 S;  3LCE A;  1IEM A;  2ZC3 B;  2W0N A;  2WKQ A;  1FIL A;  2ACG A;  2PR5 A;  1MY8 A;  2B18 A;  3GMW A;  2Z6C A;  2E8I A;  3MKE A;  1MWT A;  4UEY A;  3HUN A;  2FH5 A;  4JXV A;  3G2Y A;  3NI9 A;  3JYI A;  2VEA A;  1NZO A;  3CMZ A;  4JGP A;  3DTM A;  2Y59 A;  5FDS A;  3N8R A;  1O07 A;  4E6W A;  3MSH A;  4OON A;  5CHU A;  2B5R A;  2JN7 A;  4OPQ A;  3IXB A;  1HVB A;  1M40 A;  5FEG A;  1PZP A;  4E3N A;  3S7P A;  4E3K A;  3PXP A;  5A91 A;  4OP5 A;  4BWI A;  3JVU A;  1VHM A;  4E3J A;  3P7N A;  1K25 A;  4OQH A;  1TS7 A;  5GLA A;  2VV7 A;  3DTE A;  4IUK A;  4JF4 A;  2V1A A;  1W5D A;  3WRZ A;  4MN7 A;  3A0V A;  3ZYT A;  4PM5 A;  1K6S A;  4WZ5 A;  4ME4 A;  1ZKJ A;  1PWG A;  1AWI A;  4CQH A;  5K5B A;  2PBD P;  5E2H A;  3MQQ A;  3NDG A;  5FQM A;  3DW0 A;  5HDS A;  4KG2 A;  1NYY A;  5AQ7 A;  3K2N A;  5EFW A;  3Q07 A;  3WS1 A;  1AXB A;  4FTX A;  1BUL A;  2ZOH A;  3OPH A;  5J4E A;  5J3W A;  2Y91 A;  4BJP A;  1PRQ A;  3O87 A;  3NOP C;  1UGU A;  5DVA A;  3VP0 A;  4EET B;  2WKR A;  4Y0O A;  3EEH A;  1N9O A;  4OVD A;  3UE0 A;  1DRM A;  4MLL A;  1OPX A;  1YKD A;  4GDB A;  5FQQ A;  3H7W B;  2Q9M A;  1ACF A;  5I5L A;  2OWH A;  3H82 B;  1TVF A;  3LI9 A;  3SH7 A;  3ZG0 A;  5AVE A;  3IH8 A;  3PBO A;  5DTT A;  4JGR A;  1BT5 A;  4BD1 A;  1ES5 A;  1SCW A;  2Y2J A;  5CEB A;  3B33 A;  5TR7 A;  3V39 A;  4EBN A;  4R70 A;  3C4P A;  4Q0I A;  3S4X A;  2ZC7 A;  4YOF A;  4CLC C;  1XX2 A;  2EXA A;  1K55 A;  4ETZ A;  4S2P A;  4U0T A;  2JBF A;  3Q7V B;  4WBG A;  3CAX A;  2Y2I A;  2IWB A;  1F9I A;  5FAT A;  5HL6 A;  3NHQ A;  2M1C A;  4X56 A;  3E4P A;  4E3I A;  5HWW A;  4R6L A;  3CI6 A;  3BJN A;  3PR6 A;  4CLC B;  3C7V A;  3MJQ A;  3ZG8 B;  4EQI A;  2Y2Q A;  3GDI A;  3TSG A;  4EEU A;  4WEJ A;  2WAF A;  3BY9 A;  2PDR A;  3CLO A;  5AQ9 A;  1CQA A;  5DFY A;  2Y55 A;  1VB6 A;  1BLH A;  5CGW A;  2ZD8 A;  4EES A;  1IYO A;  3RTY A;  3SS4 A;  4JGQ A;  3ZNY A;  5CTN A;  1YLW A;  3EQU A;  5DKL A;  2VGL S;  5HD3 A;  5GHZ A;  5EEC A;  3MQO A;  5DF8 A;  2WKH A;  1NZU A;  5FEF A;  3DWZ A;  4LEN A;  2O0Y A;  1L0E A;  2H0T A;  3EQV A;  4MEZ A;  4P6B A;  3NY4 A;  2FFY A;  1V9Z A;  2XF3 A;  1K54 A;  3S7Q A;  5FAP A;  2PAV P;  4FOF A;  5F69 A;  2J9P A;  1RCJ A;  3CPT A;  4C75 A;  3KO6 A;  1JWP A;  4EXO A;  4WM9 A;  3IS2 B;  3LIB A;  4E04 A;  3EGX C;  2IWC A;  2XFS A;  1LSW A;  4RYE A;  2WUQ A;  3VOL A;  2LB5 A;  1WA9 A;  2WZX A;  4N1X A;  4R3J A;  1D7E A;  2B02 A;  2X02 A;  3VV4 A;  4EWF A;  3GRJ A;  1S6R A;  5E2E A;  4X1M A;  4IHQ A;  3O86 A;  4PKY G;  1YLJ A;  1JWV A;  2HJE A;  1Q2Q A;  1IOU A;  1XFN A;  4OP8 A;  1KVL A;  1XA1 A;  5HD5 A;  4NKP A;  5IT5 A;  1EW0 A;  1BUE A;  1KE4 A;  4K0X A;  4U0X A;  2X71 A;  1UWN X;  2Q9N A;  4MBH A;  3WWX A;  3VFF A;  1SKO B;  3HUM A;  2J3T D;  1W63 M;  1GHM A;  4LRY C;  2HZ5 A;  4F94 A;  1IYQ A;  4G3W A;  4I38 A;  3NCK A;  4E3M A;  1OTA A;  5AJG A;  1C3B A;  1OJ5 A;  2J8Y A;  1XKZ A;  4L0L A;  4OOL A;  1HTZ A;  2WK0 A;  2V0W A;  5C5K A;  1ERM A;  3E98 A;  3A3F A;  4LV1 A;  2W3F A;  3QP5 A;  3SH9 A;  5EVL A;  1GSW A;  3LYX A;  4B88 A;  3CWF A;  3GQZ A;  4Y17 A;  4Q0H A;  4NG2 A;  2XGN A;  3NUL A;  2GZA A;  2G2U A;  3UDX A;  5IHV A;  2HGV A;  3H7W A;  3H82 A;  4Y5F A;  5F1G A;  4QJG A;  3CG5 A;  1W79 A;  5E2F A;  4KQQ A;  5HDD A;  2ZQC A;  5HX9 A;  2JHE A;  1H8M A;  3RFB A;  3LUQ A;  1YLZ A;  2UWX A;  3GEC A;  5CRF A;  1G6A A;  1PWD A;  4X55 A;  5I94 A;  5KMW A;  3W4Q A;  4EUZ A;  2WGW A;  3T4J A;  5DJU A;  3IWO A;  2Y2P A;  4KZ3 A;  1CK3 A;  5G4Y A;  3IHA A;  3L7H A;  3W2Z A;  3Q7V A;  4DJ2 A;  2K31 A;  2D01 A;  3JPU A;  4HJ4 A;  1G28 A;  3PYP A;  4NEE D;  3C7U A;  4LCM A;  2DRW A;  1G5U A;  4X68 A;  4DKI A;  3BRM A;  2OAQ 1;  2ZMF A;  4ZJ2 A;  4OKP A;  5A92 A;  4MCW A;  1PFL A;  1HLU P;  3B42 A;  1SDN A;  3Q82 A;  4WMC D;  1IKI A;  1VQQ A;  2ZMV A;  2RCX A;  4Z9Q A;  5GHX A;  2GNX A;  3D72 A;  2G7U A;  4GN2 A;  1VET B;  4O8G A;  4A5R A;  3ISG A;  3O5Y A;  3PHY A;  4DJ3 A;  5DTK A;  3V3R A;  3TOI A;  3IX4 A;  2WZZ A;  3BQ8 A;  3S7O A;  4KZ5 A;  2W3D A;  1NLZ A;  4GZB A;  5CEC A;  2GJ3 A;  2GX5 A;  1TDL A;  1JVJ A;  2V20 A;  4FSF A;  3Q81 A;  2W3H A;  4OQG A;  4KQR A;  1ZC2 A;  1ZHH B;  3MXS A;  4OH0 A;  1Y28 A;  3UY6 A;  4EW7 A;  4BQM A;  3T1X A;  3KYE A;  2ZQ8 A;  3SZT A;  5EVI C;  1LLB A;  4QU3 A;  3R7W A;  2EXB A;  2YKH A;  1GHI A;  1TEM A;  4G3K A;  1PI5 A;  1XFQ A;  4I3I A;  1ERO A;  4FD8 A;  1LSV A;  4OPZ A;  1GA0 A;  2HJ9 C;  2KX6 A;  2W3G A;  3KYZ A;  3UE6 A;  4I3J A;  1T1C A;  1U60 A;  2Y8H A;  5EVI B;  1YSP A;  5TGF A;  3DAV A;  2OV5 A;  3ZQ5 A;  2V0U A;  4I5S A;  1ZG6 A;  4HHD A;  3LO7 A;  2H10 A;  5EUA A;  3IS2 A;  5IS1 A;  3C2W A;  4E3L A;  1CJF A;  3GVB A;  3KSF A;  2V1B A;  3VP1 A;  2KDK A;  3TJZ C;  3WS0 A;  4EV4 A;  3IQA A;  3BQA A;  1MWR A;  2XDM A;  3BEC A;  4HH2 A;  1FSY A;  4HY8 A;  1ZG4 A;  2HDS A;  3AGD A;  1LL8 A;  1MWS A;  2R78 A;  4KZA A;  5CHM A;  4DXC A;  5DF9 A;  3OPP A;  1P9R A;  2EA9 A;  4S2M A;  1IYP A;  3M2J A;  4LRX C;  5EVI D;  4HNB A;  3LIE A;  3UB5 P;  3ZG9 B;  3HLD A;  2M7V A;  4X25 A;  1TDG A;  3L9K A;  2FFF B;  4HEF A;  3A3E A;  2NUT C;  4UAA A;  1YAX A;  3MS6 A;  1I2W A;  2O9B A;  3IWI A;  3QP4 A;  3AGE A;  5A8B A;  2XEP A;  4JXW A;  3MKF A;  4R0Q A;  1GSV A;  2UV0 E;  3H9W A;  2VGL M;  1D06 A;  1XPB A;  1RGZ A;  3GTC A;  4PM8 A;  1J3W A;  4H8R A;  1PW1 A;  4FUW A;  1NLY A;  3LR4 A;  3UB9 A;  1FOF A;  1YM1 A;  1PW8 A;  2VGJ A;  1BZA A;  2AVX A;  4BBT A;  3CUE C;  2Y2L A;  4O01 A;  5HPF A;  4KG5 A;  3HL9 A;  5MC7 A;  2XSS A;  1S4R A;  2O99 A;  3LR0 A;  1KGE A;  3HLW A;  4MBF A;  3HRE A;  4HJ6 A;  5E43 A;  3QP6 A;  1Y4O A;  4L9G A;  4KZ8 A;  3ZG5 A;  3WS2 A;  4Y7P A;  1E3U D;  4K0W A;  2XD1 A;  4DE2 A;  2R9W A;  4WMC A;  4PAU A;  4S2I A;  1EI5 A;  3F1N B;  2DNS A;  4UA7 A;  3VSL A;  1SZV A;  5KSH A;  3QP2 A;  3V50 A;  4ZJ1 A;  4IBR A;  4RA7 A;  3O88 A;  2JKF A;  3GSG A;  1A0K A;  1H0M A;  4GHI B;  2JKR I;  2FZ0 A;  1NRF A;  4O7D A;  1O7E A;  4OQ0 A;  3MQ0 A;  4KQD A;  3HJI A;  5CGX A;  1M6K A;  2OAP 1;  2P04 A;  4WLA A;  3DTK A;  1K38 A;  1TS0 A;  1PIO A;  3IH9 A;  3BFC A;  4PM7 A;  4DE1 A;  3FZC A;  3G4P A;  3TW8 A;  3HUO A;  5HPI A;  1P9W A;  4NXF A;  4YNR A;  1JNU A;  4DF6 A;  3P01 A;  4XT2 B;  3O3V A;  4M4X A;  3LIC A;  4P6Z S;  1BLS A;  5L8M A;  3WRT A;  3ICY A;  1JTD A;  1DP9 A;  3I7J A;  4HBU A;  1VET A;  4KG6 A;  4ZTK A;  3ZG7 B;  4DRT A;  3P98 A;  2XD5 A;  2JKT I;  3N6I A;  5L10 A;  2ZOI A;  2D02 A;  3PBS A;  1DJC A;  3FKV A;  1FCN A;  3IF6 C;  1QME A;  5HAP A;  5E2G A;  3W4P A;  3ZCZ A;  1ALQ A;  2HDR A;  4ID4 A;  2ZL1 A;  3U2A A;  2H0Y A;  4NXE A;  1G6O A;  1MBL A;  1OTD A;  2JCH A;  4PHT A;  2QMI A;  5GHY A;  1L2S A;  3PAE A;  2I9V A;  4WZ4 A;  3IF6 B;  2Y79 A;  3OBF A;  3E2L A;  4HI4 A;  4MBK A;  5KSC A;  4CLC D;  1CEF A;  3NOU C;  4Y3I A;  4C3Q A;  5FQJ A;  3TG9 A;  4GJ4 A;  4XXR A;  1PZO A;  1XJ6 A;  3VSK A;  3T4T A;  5EVI A;  3FYZ A;  4BEN A;  1K57 C;  4LLO B;  5U47 A;  2ZJ9 A;  2EX9 A;  1H3Q A;  3V3S A;  3EWK A;  3MMH A;  4DXB A;  5JYO A;  4N92 A;  5FQK A;  1X0O A;  4ARZ B;  5EOE A;  1MPL A;  2BTF P;  3N8S A;  3GR2 A;  1ESU A;  4L9E A;  3TE8 A;  2P9V B;  4DE3 A;  3FC7 A;  1FR6 A;  3VE3 A;  4MMN A;  1LI0 A;  3HLF A;  1WYB A;  2V2F F;  4WEL A;  1ONH A;  3CZD A;  5TBM B;  3BFE A;  2PU4 A;  5F6A A;  1V9Y A;  2XLN A;  4S2K A;  2VLG A;  5EM0 A;  3T1Q B;  5AQA A;  1UWP X;  2WGV A;  5FQI A;  2V9A A;  1OJG A;  5HAQ A;  1JTG A;  2ZQ9 A;  4JLF A;  1ERQ A;  3R4K A;  4I3A A;  4YIN A;  1XA7 A;  3UME A;  1YT4 A;  3UB8 A;  3T1R A;  3LY3 A;  3T4K A;  5FQ9 A;  1ODV A;  4B4Z A;  2XQZ A;  4GOG A;  4ZJ3 A;  2QJ5 A;  1XGJ A;  2OLV A;  3WS5 A;  3DWK A;  3HCY A;  2INW A;  1K4F A;  3OC2 A;  3G35 A;  1E3U A;  3UPP A;  5AQB A;  1T1B A;  1YLP A;  3EEA A;  3DTI A;  2ZBB A;  3V67 A;  2E8J A;  1YMS A;  1LL9 A;  1CI9 A;  3T12 B;  1SKF A;  2JKR M;  1NY0 A;  5CXW A;  2OWJ A;  3LIF A;  5EOO A;  3UB7 A;  3BWL A;  3SS5 A;  3BEB A;  1YLT A;  4D2O A;  1IEL A;  1L3L A;  4K08 A;  1BLP A;  4P0M A;  4JBF A;  1MKI A;  1PWC A;  4BL2 A;  3SW1 A;  2KLI A;  5TJJ A;  1YLY A;  1F5M A;  4Y0U A;  4R38 A;  4WYY A;  3IX3 A;  1SDE A;  3KX0 X;  1DP8 A;  5TFQ A;  3VMA A;  4MNR A;  4EQ1 A;  2Y4A A;  1STZ A;  4R3B A;  3CUE A;  4S2J A;  2JKT M;  3A0S A;  1FR1 A;  1WE4 A;  4Y15 A;  3D3O A;  3M6H A;  4WEK A;  1D1J A;  5F82 A;  5FAQ A;  5F5Y A;  5D3O A;  1ES4 A;  4GHI A;  1BSG A;  4KZ4 A;  2QJ7 A;  4GS9 B;  1VEU B;  3IXH A;  2VV6 A;  4GD8 A;  4JXG A;  3P09 A;  4QY6 A;  2EX8 A;  5F83 A;  3IXG A;  2XK1 A;  3BLS A;  1W7F A;  4GD6 A;  1LT0 A;  4QB8 A;  3E4Q A;  5HAR A;  4Z1W A;  1DJA A;  5DFX A;  4X1L A;  3PBQ A;  3FKW A;  1Q2P A;  4XT2 A;  1S66 L;  2HP6 A;  2W1R A;  4LV3 A;  2P7J A;  4O0P A;  5GLD A;  1T1A A;  2K7S A;  2RL3 A;  5J8X A;  4CLC A;  4QWO A;  1YMX A;  1F2K A;  1KE3 A;  4X53 A;  3LID A;  5M19 A;  4RX3 A;  5CX7 A;  3BY8 A;  3LEQ A;  3S1Y A;  1P0Z A;  1OT9 A;  4GKU A;  1N9B A;  4H6J B;  3IBJ A;  4Y0T A;  5GLB A;  1MZU A;  2VA0 A;  3PAG A;  3LGO A;  4HOI A;  1LI9 A;  2PYP A;  1MWU A;  5DF7 A;  3HLB A;  5KIZ A;  4OPR A;  3W8K A;  2A3U A;  1S1Z A;  3QP1 A;  3MF0 A;  4D60 A;  4KZ9 A;  5HSQ A;  5DKK A;  4RVA A;  4LPZ A;  4U3T A;  3HVF A;  3F1P B;  3IF6 A;  4JF6 A;  2WAE A;  1N9L A;  3C38 A;  4UA9 A;  2Y2M A;  5CER A;  4R4R A;  2XFT A;  3WS4 A;  4ZBE A;  4BBU A;  5L2F A;  1KGF A;  3DBA A;  2IWD A;  2VJW A;  2J80 A;  4RX2 A;  4EBL A;  2HP5 A;  2PBY A;  1W63 Q;  1TS8 A;  1K4E A;  1L0F A;  2BG1 A;  2VZW A;  2P74 A;  5JYP A;  1YPR A;  4OLD A;  3UDF A;  2V8F A;  4PKY A;  1S1Y A;  2ZM2 A;  3FG8 A;  1L0G A;  4ESP A;  3CIT A;  3LIA A;  2PU2 A;  4ARZ A;  4OLG A;  2R9X A;  2EFX A;  2L4R A;  3T4O A;  1BLC A;  4II7 A;  2C6W B;  5J7E A;  2WKI A;  2P9V A;  3NOT C;  4PM9 A;  3MR0 A;  2Z2L B;  5F1F A;  3T4Q A;  5EVE A;  1KVM A;  2W1T B;  2JC7 A;  1LHY A;  3F1O B;  2Z6D A;  3T4L A;  3HLC A;  2ZC5 B;  1ZTU A;  3HJK A;  2Z2M B;  5TBM A;  1HZO A;  2OLU A;  1I2S A;  5DJT A;  1W8Y A;  3MZD A;  3CPT B;  4LGW A;  1K56 D;  4HP9 A;  4P6Z M;  1KDW A;  2A2L A;  5HWT A;  1OTI A;  2L0W A;  2PR6 A;  3FWL A;  4FH4 A;  1LSX A;  2L1M A;  4PM6 A;  5IU1 A;  4JF5 A;  5FAS A;  4P85 A;  1PYY A;  2HF6 A;  4LFU A;  4BLM A;  3ZGA B;  4C6Y A;  2K2N A;  3QHY A;  3E4O A;  2O9A A;  3BW6 A;  3ITB A;  3OPL A;  4OOM A;  1SKO A;  1CF0 A;  2C5W B;  3ZNT A;  3NEC A;  5KZH A;  4HH3 A;  3UN7 A;  2J9O A;  3LR3 A;  5EV0 A;  3UDI A;  2HDU A;  2WGI A;  5HFO A;  1GCE A;  2IA2 A;  1BTL A;  4PMA A;  5A90 A;  3BFG A;  4R4S A;  3OLO A;  3LI8 A;  5FDH A;  5FSR A;  1VM1 A;  4ZAM A;  1YSQ A;  3D9Y A;  4E3O A;  3B3X A;  3V5M A;  2ZC4 B;  3HBR A;  3C4O A;  4CPK A;  4BBV A;  1XJ3 A;  2J3W A;  2H5S A;  3A3I A;  4HP4 A;  3JVV A;  1ONG A;  1E25 A;  4OPY A;  4BD0 A;  1XXM A;  1NXY A;  4YWZ A;  4B9O A;  1NJ4 A;  4ETX A;  2EX2 A;  2WKE A;  3OCN A;  3T50 A;  3K3C A;  1XP4 A;  1NWZ A;  4BL3 A;  3EOI A;  4EU0 A;  5CGS A;  4WF0 A;  4B93 A;  4KZB A;  2HP9 A;  5A93 A;  1HD8 A;  4S2N C;  4GS9 A;  1VEU A;  5HL1 A;  2JKG A;  3KYQ A;  3OCL A;  4NXG A;  3CJM A;  1CI8 A;  2EX6 A;  4Y13 A;  4R23 A;  4EEP A;  3QNC A;  2VGK A;  2YKF A;  3C5A A;  1FQG A;  2ZMA A;  4HES A;  1MC0 A;  3BLM A;  1TS6 A;  3IXD A;  2EWW A;  4DE0 A;  4UQI M;  1OTE A;  4QY5 A;  2PD8 A;  1S4S A;  5FA7 A;  3S22 A;  5L07 A;  3D4F A;  3A0R A;  2EWV A;  3E2K A;  4ZRR A;  3FV7 A;  2VV8 A;  3W4O A;  2WGW B;  3N8L A;  3T1S A;  4DMZ A;  4NK3 A;  2DMW A;  4JKT A;  3G6O A;  3S7N A;  3PBR A;  3FPV A;  5HDC A;  3GV9 A;  4IUH A;  4H6J A;  1WYC A;  4JXS A;  3UE1 A;  4IED A;  4QPR A;  1FIK A;  2PRF A;  3ZVT A;  1GHP A;  3KSG A;  3OZH A;  3N7W A;  3UMD A;  3MXQ A;  3RH8 B;  4N9L A;  5CED A;  3RXW A;  1H5X A;  1RP5 A;  5FI7 A;  2EFU A;  4HQA A;  1I5Q A;  3RJU A;  3F1P A;  1OT6 A;  2PD7 A;  4F3L B;  4LV2 A;  2VX8 A;  3NBL A;  4BMW A;  4UHU A;  4KUK A;  3VOZ A;  2MJ6 A;  1NRJ A;  3A3D A;  4Y2F A;  3PTE A;  5HAI A;  1MXO A;  2QKP A;  3UO9 A;  5L09 A;  1K56 A;  5GL9 A;  4DDY A;  3B47 A;  4I39 A;  3G2Z A;  2WAD A;  4X69 A;  1K6R A;  1OME A;  1PNE A;  3UPN A; 
#chains in the Genus database with same CATH homology
 3BFD A;  2WYX A;  1SDE A;  1ERO A;  4FD8 A;  3OPH A;  4OPZ A;  5TFQ A;  1FSW A;  3RXX A;  3VMA A;  4MNR A;  2V1Z A;  2Y4A A;  2Y91 A;  1GA0 A;  4R3B A;  4S2J A;  4BJP A;  3O87 A;  1H8Z A;  5DVA A;  3VP0 A;  1FR1 A;  1WE4 A;  4KQO A;  1NYM A;  1G68 A;  1U60 A;  2HDQ A;  5EVI B;  4Y0O A;  3M6H A;  4WEK A;  2ZQ7 A;  4OVD A;  3UE0 A;  5TGF A;  4M3K A;  2OV5 A;  4MLL A;  5F82 A;  4GDB A;  5FAQ A;  1ZG6 A;  2DCF A;  5D3O A;  2X01 A;  5FQQ A;  1RGY A;  3LO7 A;  2H10 A;  5EUA A;  1ES4 A;  2Q9M A;  2JE5 A;  1BSG A;  1TVF A;  3SH7 A;  3ZG0 A;  4E3L A;  4KZ4 A;  3IH8 A;  4P87 A;  3PBO A;  3ZFZ A;  3GVB A;  3IXH A;  1E4D A;  4GD8 A;  3VP1 A;  5DTT A;  4JXG A;  3WS0 A;  3P09 A;  4QY6 A;  1YQS A;  2EX8 A;  4EV4 A;  1DJB A;  5F83 A;  3IQA A;  3IXG A;  3HLE A;  3MZF A;  2XK1 A;  3SH8 A;  1GA9 A;  1MWR A;  1BT5 A;  1W7F A;  2HPB A;  3BLS A;  4CJN A;  4GD6 A;  2XDM A;  3BEC A;  4QB8 A;  5HAR A;  1FSY A;  4BD1 A;  1DJA A;  2XH9 A;  1ES5 A;  1SCW A;  1ZG4 A;  2HDS A;  2Y2J A;  3AGD A;  3BFF A;  1MWS A;  3PBQ A;  5TR7 A;  3V39 A;  5CEB A;  3FKW A;  4EBN A;  1Q2P A;  4Q8I A;  3C4P A;  4KZA A;  5CHM A;  1ES3 A;  3S4X A;  4K91 A;  4DXC A;  2HP6 A;  2ZC7 A;  5DF9 A;  4LV3 A;  1XX2 A;  2EXA A;  3OPP A;  5GLD A;  4S2M A;  1IYP A;  3M2J A;  1K55 A;  5EVI D;  4S2P A;  4U0T A;  2CC1 A;  2RL3 A;  5J8X A;  2JBF A;  3Q7V B;  4WBG A;  3UPO A;  2Y2I A;  3ZG9 B;  3HLD A;  2IWB A;  1YMX A;  1N4O A;  5FAT A;  1KE3 A;  4X53 A;  1ES2 A;  1TDG A;  3AGF A;  4X56 A;  5M19 A;  4RX3 A;  4E6X A;  3S1Y A;  2FFF B;  4IBX A;  2ZM0 A;  4HEF A;  4IVI A;  4E3I A;  4GKU A;  1EWZ A;  1IYS A;  3A3E A;  1N9B A;  4Y0T A;  5GLB A;  3C7V A;  4UAA A;  2ZQD A;  3PAG A;  3ZG8 B;  4EQI A;  2Y2Q A;  1LI9 A;  1I2W A;  1MWU A;  4WZ5 C;  5GLC A;  5DF7 A;  3IWI A;  3HLB A;  2Y2N A;  4OPR A;  3VP4 A;  2A3U A;  3AGE A;  3IWQ A;  3W8K A;  4ZDX A;  3TSG A;  4KZ6 A;  4WEJ A;  2I72 A;  2WAF A;  2XEP A;  4JXW A;  3MKF A;  2Y2O A;  3PBN A;  4KZ9 A;  4R0Q A;  4RVA A;  4U3T A;  5AQ9 A;  3HVF A;  1KDS A;  3IF6 A;  1J9M A;  4JF6 A;  2Y55 A;  2WAE A;  4GB7 A;  4UA9 A;  1BLH A;  5CGW A;  1XPB A;  1RGZ A;  2Y2M A;  5CER A;  4R4R A;  3GTC A;  2XFT A;  3HLG A;  4PM8 A;  3WS4 A;  4ZBE A;  5L2F A;  1KGF A;  4H8R A;  1PW1 A;  2IWD A;  2ZD8 A;  4RX2 A;  1IYO A;  4EBL A;  5FI2 A;  3BYD A;  3SS4 A;  1FOF A;  1JWZ A;  2HP5 A;  3ITA A;  3ZNY A;  1YM1 A;  1PW8 A;  5CTN A;  1CEG A;  2PBY A;  2VGJ A;  3UE3 A;  1BZA A;  1K4E A;  1YLW A;  3EQU A;  1L0F A;  2BG1 A;  2Y2L A;  3G34 A;  3IF5 A;  1H8Y A;  2P74 A;  4KG5 A;  4XUX A;  5GHZ A;  3ZDJ A;  3HL9 A;  5EEC A;  4LV0 A;  3ZVW A;  5JYP A;  5DF8 A;  4GNU A;  3Q1F A;  4OLD A;  4FH2 A;  3UDF A;  2WKH A;  1KGE A;  1FCO A;  2ZM2 A;  3HLW A;  3M2K A;  4MBF A;  1L0G A;  4S2L A;  1NZU A;  1SHV A;  3HRE A;  2PU2 A;  3G31 A;  2Y2G A;  2R9X A;  4OLG A;  2EFX A;  3IHB A;  3DWZ A;  4LEN A;  5E43 A;  3ZG5 A;  4KZ8 A;  1BLC A;  3WS2 A;  1L0E A;  2H0T A;  2ZQA A;  4Y7P A;  1E3U D;  4K0W A;  2XD1 A;  4DE2 A;  3EQV A;  4MEZ A;  2C6W B;  4P6B A;  4IVK A;  1W8Q A;  2WKI A;  2P9V A;  2R9W A;  4QD4 A;  3NY4 A;  2FFY A;  4PM9 A;  4S2O A;  5M18 A;  4WMC A;  2Z2L B;  2XF3 A;  1K54 A;  4S2I A;  3SS3 A;  5F1F A;  1EI5 A;  5FAP A;  4UA7 A;  2DNS A;  4JPM A;  3VSL A;  1KVM A;  5KSH A;  2J9P A;  1RCJ A;  2JC7 A;  1LHY A;  4C75 A;  3HLC A;  2ZC5 B;  3V50 A;  1JWP A;  3BM6 A;  4ZJ1 A;  1S0W A;  4IBR A;  4RA7 A;  2Z2M B;  3O88 A;  3NDE A;  4S2N A;  1HZO A;  2ZLY A;  2OLU A;  5EPH A;  1Z6F A;  5FAO A;  1I2S A;  3GSG A;  4R1G A;  4WM9 A;  1W8Y A;  3MZD A;  4NET A;  1NRF A;  4O7D A;  1O7E A;  3LEZ A;  1Y54 A;  2IWC A;  4OQ0 A;  2XFS A;  3OPR A;  1K56 D;  5CGX A;  1M6K A;  1KDW A;  4RYE A;  1K55 C;  2WUQ A;  1K38 A;  3IH9 A;  1PIO A;  2G2W A;  2WZX A;  3BFC A;  4PM7 A;  2Y2K A;  1L0D A;  4N1X A;  3FWL A;  3VFH A;  3FZC A;  3G4P A;  4FH4 A;  4R3J A;  4DE1 A;  3HUO A;  1XGI A;  2X02 A;  4PM6 A;  5M1A A;  4EWF A;  3GRJ A;  4JF5 A;  4DF6 A;  4GDN A;  1S6R A;  5E2E A;  3A3J A;  3O86 A;  5FAS A;  5EE8 A;  3O3V A;  4P85 A;  1PYY A;  1ESI A;  3SOI A;  1YLJ A;  4EBP A;  2XR0 A;  1BLS A;  3M6B A;  1JWV A;  4PPR A;  1Q2Q A;  4BLM A;  4YFM A;  4OOY A;  3WRT A;  3ZGA B;  4C6Y A;  4OP8 A;  1JTD A;  3I7J A;  4HBU A;  4KG6 A;  3QHY A;  4ZTK A;  3ZG7 B;  1KVL A;  1XA1 A;  3VOY A;  3ITB A;  4DRT A;  3MZE A;  3P98 A;  2XD5 A;  3OPL A;  5DTS A;  1PI4 A;  3N6I A;  5CTM A;  3G30 A;  4OOM A;  2ZC6 B;  2C5W B;  1QMF A;  3ZNT A;  3PBS A;  1DJC A;  1BUE A;  3ZHH A;  1KE4 A;  4QHC A;  5KZH A;  3FKV A;  1FCN A;  3IF6 C;  1QME A;  2QZ6 A;  3PBT A;  3UN7 A;  2J9O A;  3UDI A;  4K0X A;  1KGG A;  2HDU A;  2WGI A;  4U0X A;  3G32 A;  2X71 A;  1GCE A;  2QPN A;  5HFO A;  5E2G A;  5HAP A;  2Q9N A;  4N9K A;  3W4P A;  3ZCZ A;  4OQI A;  1BTL A;  4MBH A;  4PMA A;  1ALQ A;  3WWX A;  3VFF A;  2HDR A;  3HUM A;  5A90 A;  2A49 A;  3BFG A;  4R4S A;  5FDH A;  5FSR A;  3VP2 A;  4ID4 A;  4DDS A;  1GHM A;  2H0Y A;  1VM1 A;  2J7V A;  4ZAM A;  4F94 A;  1IYQ A;  4E3O A;  3B3X A;  3QNB A;  1MBL A;  3V5M A;  2JCH A;  2ZC4 B;  2QMI A;  3HBR A;  3NCK A;  3C4O A;  5GHY A;  3VP3 A;  4CPK A;  1LL5 A;  4E3M A;  1C3B A;  1L2S A;  3PAE A;  2H5S A;  2J8Y A;  3A3I A;  4WZ4 A;  3IF6 B;  2Y2H A;  1XKZ A;  1DY6 A;  4L0L A;  4OOL A;  1HTZ A;  1ONG A;  2WK0 A;  1E25 A;  3E2L A;  4MBK A;  4OPY A;  4BD0 A;  5KSC A;  1XXM A;  3MBZ A;  1NXY A;  1ERM A;  3NC8 A;  3A3F A;  4X6T A;  3UNW A;  5FI6 A;  1CEF A;  4LV1 A;  1NJ4 A;  1IKG A;  5CHJ A;  4C3Q A;  2EX2 A;  5FQJ A;  3IT9 A;  3SH9 A;  5EVL A;  2WKE A;  3TG9 A;  5HW3 A;  4XXR A;  4B88 A;  3OCN A;  1PZO A;  3NIA A;  1XP4 A;  4KZ7 A;  4XUZ A;  3VSK A;  3GQZ A;  4BL3 A;  4HBT A;  5CGS A;  1K54 C;  5EVI A;  2XGN A;  3FYZ A;  3N4I A;  4BEN A;  1K57 C;  5U47 A;  2G2U A;  2ZJ9 A;  3UDX A;  2EX9 A;  5IHV A;  3V3S A;  4B4X A;  4DXB A;  3LY4 A;  4KZB A;  1K57 A;  5JYO A;  2HP9 A;  4N92 A;  5A93 A;  1HD8 A;  4UA6 A;  5FQK A;  5EOE A;  1MPL A;  2BLS A;  3N8S A;  4S2N C;  1KE0 A;  4LCL A;  5HL1 A;  5F1G A;  4QJG A;  3CG5 A;  3GR2 A;  4KEN B;  1ESU A;  5G18 A;  1W79 A;  5E2F A;  4KQQ A;  3OCL A;  5BOH A;  2P9V B;  1CI8 A;  2EX6 A;  3CJM A;  4DE3 A;  4R23 A;  2ZQC A;  5HX9 A;  1FR6 A;  3QNC A;  3MFD A;  2VGK A;  2OSU A;  1YLZ A;  2UWX A;  5CRF A;  3C5A A;  3MXR A;  1G6A A;  1FQG A;  1LI0 A;  1PWD A;  2ZMA A;  2ZM8 A;  4HES A;  3BLM A;  3HLF A;  1WYB A;  4X55 A;  2V2F F;  3IXD A;  5I94 A;  4FCF A;  4WEL A;  5KMW A;  2GDN A;  3W4Q A;  4DE0 A;  1ONH A;  3CZD A;  4EUZ A;  4N1H A;  3Q7Z A;  1FCM A;  2WGW A;  3LCE A;  3BFE A;  2PU4 A;  1IEM A;  2XLN A;  3IWO A;  4S2K A;  2Y2P A;  4KZ3 A;  4QY5 A;  2ZC3 B;  5AQA A;  5FA7 A;  3S22 A;  1CK3 A;  3IHA A;  1MY8 A;  2WGV A;  3D4F A;  3Q7V A;  3GMW A;  5FQI A;  2E8I A;  5HAQ A;  3E2K A;  3MKE A;  1MWT A;  3C7U A;  1JTG A;  3HUN A;  2ZQ9 A;  4LCM A;  3FV7 A;  4JXV A;  2DRW A;  3G2Y A;  2WGW B;  3W4O A;  3N8L A;  3NI9 A;  4JLF A;  3JYI A;  1ERQ A;  4NK3 A;  4JKT A;  4X68 A;  4YIN A;  1NZO A;  3CMZ A;  1XA7 A;  1YT4 A;  4DKI A;  3BRM A;  3LY3 A;  5FQ9 A;  3PBR A;  4ZJ2 A;  3DTM A;  2Y59 A;  4B4Z A;  4OKP A;  5A92 A;  3GV9 A;  1WYC A;  2XQZ A;  3N8R A;  4GOG A;  4JXS A;  4ZJ3 A;  1SDN A;  1O07 A;  3Q82 A;  4WMC D;  3UE1 A;  4IED A;  1IKI A;  1VQQ A;  4E6W A;  4OON A;  1XGJ A;  2RCX A;  4Z9Q A;  1GHP A;  5CHU A;  2OLV A;  5GHX A;  3ZVT A;  3WS5 A;  2B5R A;  3OZH A;  4OPQ A;  3N7W A;  3IXB A;  1HVB A;  1M40 A;  4GN2 A;  1PZP A;  3DWK A;  4E3N A;  4E3K A;  5A91 A;  4OP5 A;  4N9L A;  4A5R A;  1K4F A;  3RXW A;  1H5X A;  3ISG A;  1RP5 A;  3G35 A;  3OC2 A;  5CED A;  5FI7 A;  4E3J A;  2EFU A;  1I5Q A;  1E3U A;  1K25 A;  3UPP A;  5DTK A;  4OQH A;  3V3R A;  3RJU A;  5GLA A;  3TOI A;  5AQB A;  1YLP A;  2WZZ A;  4KZ5 A;  4JF4 A;  1W5D A;  4GZB A;  4LV2 A;  3WRZ A;  5CEC A;  1YMS A;  1LL9 A;  1CI9 A;  4PM5 A;  1K6S A;  1SKF A;  3NBL A;  1TDL A;  1JVJ A;  4WZ5 A;  1NY0 A;  4UHU A;  5CXW A;  1ZKJ A;  1PWG A;  2V20 A;  4FSF A;  3Q81 A;  3VOZ A;  5EOO A;  4OQG A;  4KQR A;  3SS5 A;  5E2H A;  3BEB A;  1ZC2 A;  3MXS A;  3UY6 A;  4OH0 A;  1YLT A;  3A3D A;  4D2O A;  3PTE A;  3NDG A;  5HAI A;  1IEL A;  5FQM A;  1MXO A;  3DW0 A;  4BQM A;  1BLP A;  4P0M A;  3UO9 A;  4JBF A;  1K56 A;  1MKI A;  4KG2 A;  2ZQ8 A;  1NYY A;  5AQ7 A;  1PWC A;  5GL9 A;  4DDY A;  4BL2 A;  5EVI C;  1LLB A;  4QU3 A;  1YLY A;  2EXB A;  4Y0U A;  1GHI A;  2WAD A;  3G2Z A;  3Q07 A;  1TEM A;  1K6R A;  1OME A;  1PI5 A;  1AXB A;  4X69 A;  3WS1 A;  1BUL A;  3UPN A;  4WYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...