3V50A

Complex of shv s130g mutant beta-lactamase complexed to sa2-13
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Klebsiella pneumoniae
publication title The importance of the trans-enamine intermediate as a beta-lactamase inhibition strategy probed in inhibitor-resistant SHV beta-lactamase variants.
pubmed doi rcsb
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v50A00
4X55A 1GCEA 3IXGA 3GVBA 1E25A 3C4PA 3C4OA 4S2OA 3FKVA 1BLHA 3Q1FA 1AXBA 1E3UD 3BFFA 5CHJA 3UN7A 1LLBA 5E43A 4LENA 4E3JA 3IWOA 1IYOA 3LY4A 2E8IA 5CEBA 2XR0A 1KDWA 3DTMA 3MFDA 3AGFA 4B88A 2WKEA 2XFSA 2ZC4B 4DDSA 3ZG0A 3CJMA 2JC7A 2WUQA 4N1XA 2ZD8A 3EQVA 1BZAA 3HBRA 3ZCZA 4HESA 5DF8A 1YLWA 2V1ZA 3OPRA 3HUOA 4OONA 2EX2A 1H8YA 3WRTA 3SH8A 4RX2A 4N9KA 2WGVA 2R9XA 4R4SA 3NIAA 4OVDA 4DE0A 3BRMA 4Z9QA 3IXDA 4X68A 1W8QA 2ZQ7A 5KMWA 3HLDA 4HEFA 4S2IA 4E3LA 3QNCA 4Q8IA 4JBFA 3BM6A 3WS1A 5I94A 1TVFA 4BD0A 1K54C 3TSGA 2Z2LB 4JF5A 5GHXA 5EVID 5M1AA 4WMCA 1JTDA 5CHMA 1BLPA 3PBNA 5FQKA 1KE3A 5DF7A 3UY6A 3A3EA 4EWFA 3IWQA 5DTSA 2Y2KA 1K4EA 3Q82A 3EQUA 3V50A 3ZDJA 1JVJA 1BTLA 3TG9A 4M3KA 3IT9A 3M6HA 2XGNA 1QMEA 1K6RA 2EX8A 1PWDA 3M2KA 3NY4A 3Q7ZA 4C3QA 1G6AA 5FDHA 1YLYA 2OSUA 4Y0UA 2ZLYA 5E2EA 1IKGA 3W8KA 4X56A 1KDSA 4E3NA 4UA7A 3BYDA 2XD1A 4L0LA 4LV2A 4E3OA 1Q2QA 4N9LA 5DF9A 5FI6A 1BLSA 2XK1A 5AQ7A 5G18A 4IVKA 4WELA 2ZC7A 1JWZA 4Y0OA 1ALQA 5A92A 3S4XA 3FWLA 3UPOA 4PM6A 3HVFA 3HL9A 1YM1A 3OZHA 4D2OA 4GN2A 5JYOA 2WADA 2HDUA 3P09A 3W4QA 2XH9A 3UO9A 4ZDXA 2WGWB 1IEMA 2ZQCA 5EECA 5FAOA 4WBGA 5A90A 1RCJA 3SH9A 4BJPA 4KQRA 4DRTA 2OLVA 5HAQA 1L0FA 2HDSA 4IBRA 5EVIB 4ZJ3A 3MZFA 4FSFA 3OC2A 5JYPA 1FR6A 2Y2GA 4R0QA 2J7VA 4BLMA 3G31A 4P6BA 1LI9A 5CTMA 4OOMA 5AQBA 5HL1A 1YLPA 4WZ5A 1L0DA 3DWZA 1CI9A 1K56D 4HBUA 5E2HA 3SH7A 2C6WB 5IHVA 1K55A 3HREA 1LL5A 1IYPA 4GKUA 5CGXA 3CMZA 3ZG8B 4B4XA 4KZBA 3O3VA 2QMIA 1W5DA 1BUEA 4N1HA 1QMFA 2QPNA 4A5RA 3VP0A 1IYSA 1WYCA 3VP2A 5EOEA 4C75A 3ZFZA 4E6XA 4P87A 2PBYA 3VFHA 1PYYA 1S6RA 2PU2A 4RA7A 3N4IA 5FATA 4KG2A 3ZG9B 3G2ZA 2VGKA 4PPRA 2Q9NA 5J8XA 5GLAA 3NBLA 3IF6A 4KQQA 3PAEA 5DTKA 1DJAA 3JYIA 2ZM8A 4X6TA 4WZ4A 3ISGA 1EROA 4OLDA 4R23A 3BFGA 4QJGA 3UDXA 2JBFA 2WAFA 4IVIA 1K54A 4KQOA 1XA7A 4MBHA 4U3TA 2G2WA 2Y55A 4Y7PA 4DKIA 4E3KA 3C7UA 4DE1A 1C3BA 2EX6A 1PI4A 5HAPA 5BOHA 5AQAA 5GL9A 5FSRA 1SDNA 2EXBA 2XF3A 3BEBA 3IQAA 1MWSA 1NZOA 2WGWA 5CGWA 3HLEA 4K0XA 2X02A 3V39A 4MEZA 4UAAA 4LV0A 3VSKA 1GA0A 1MBLA 4JXGA 5DVAA 2XD5A 2ZC6B 5CHUA 1GHMA 4OOLA 5EVIA 4OQIA 3MZDA 3NDEA 4GDNA 5GHYA 4GB7A 1SHVA 4MLLA 1YLTA 3G2YA 5TR7A 4ZJ1A 1YMSA 2JE5A 3A3DA 1DJBA 2Y2QA 1BSGA 4IBXA 1MWTA 1IYQA 4KZ3A 3ZGAB 2Y2PA 1BULA 3HLCA 4B4ZA 4DF6A 4MNRA 1OMEA 3WS4A 1RGYA 4DXBA 1HD8A 5EVLA 3WWXA 4GZBA 3RXXA 3MXSA 2WZZA 2PU4A 3IF5A 1ZG6A 1Q2PA 4WM9A 1WE4A 1KE4A 3IH8A 3BFEA 3QHYA 5EOOA 3WS5A 3ZHHA 3Q81A 4EQIA 3PTEA 1SCWA 2H5SA 4Y0TA 1PZOA 4GDBA 2V2FF 5CGSA 2EFUA 1MWUA 1ERQA 1L2SA 3W4PA 1VM1A 3N8LA 1W8YA 2ZC3B 4RX3A 1YQSA 3ZNTA 5CXWA 3PBQA 4OPYA 4RVAA 1NRFA 1KGGA 4WMCD 2XLNA 2Y2MA 3SS3A 1XPBA 3C5AA 4OKPA 1ESUA 3N8SA 2H0TA 3LO7A 3O87A 4OQ0A 4X69A 3VP3A 4DDYA 4E3IA 3PBOA 3VP4A 2ZMAA 2EXAA 2FFFB 3IXHA 3OPLA 4DE2A 1DJCA 3UPNA 4PM9A 2A49A 1PWCA 3E2KA 4LCMA 2P9VB 4DXCA 4OQHA 1LL9A 4O7DA 4S2NA 4S2PA 4RYEA 1K57A 4KENB 3VSLA 3FZCA 2J8YA 3O86A 3Q07A 5HFOA 3Q7VA 3AGEA 5CTNA 1ES4A 4OP5A 1YT4A 3UDFA 1K6SA 5CECA 5FQMA 3N8RA 4KZAA 1J9MA 2XEPA 3TOIA 2DRWA 4GNUA 5KSHA 1I2WA 4UA9A 2XQZA 3E2LA 4QU3A 4FCFA 2XFTA 4WEJA 5TFQA 5F1FA 3UE3A 4QD4A 3D4FA 4OPQA 1SKFA 1ZC2A 3MKFA 4LV1A 3SOIA 2IWCA 1DY6A 5EE8A 1MWRA 1XGJA 5HARA 3GR2A 4JXSA 1G68A 1HVBA 4E3MA 3IF6B 3GTCA 4ZJ2A 4OQGA 4OP8A 2Y59A 1NY0A 3M6BA 5KZHA 1S0WA 1GHPA 1MY8A 3N6IA 3M2JA 3UPPA 3OPHA 4JXWA 3W4OA 3UE1A 4QY5A 4BQMA 4OH0A 2Y2HA 1K55C 2P74A 3NCKA 3A3JA 2BG1A 3G4PA 3BFDA 5CERA 2GDNA 3G30A 1XA1A 1MPLA 1JTGA 1KVLA 5TGFA 1ES5A 3ZG5A 3BLSA 3HUNA 4JLFA 3PBTA 1M40A 4KZ8A 1BLCA 5FQJA 2V20A 4E6WA 1I5QA 4NK3A 3ZVWA 3O88A 4CJNA 2CC1A 1L0GA 1W7FA 3V3SA 2ZJ9A 3HLWA 4CPKA 4EUZA 3ITAA 1O07A 1LI0A 5FQ9A 5E2FA 2HP6A 3FV7A 3PBSA 5FA7A 1YLJA 3CG5A 4WEKA 2Y2OA 4H8RA 4NETA 5GLCA 4QHCA 3ZVTA 1Z6FA 4R3JA 4ZTKA 2HDRA 4OPZA 2Y2LA 1FSYA 4X53A 3IHAA 1EWZA 3OCNA 4JPMA 4N92A 3OCLA 3WRZA 3WS0A 2H0YA 3ITBA 2ZQ9A 1TDGA 2WKHA 1TEMA 2Y2JA 4K0WA 3VOYA 1BT5A 1SDEA 2WGIA 4ZAMA 1FQGA 2WAEA 3HUMA 4GD6A 3HLFA 3G32A 4MBKA 1K38A 1VQQA 4EBPA 4KZ5A 5E2GA 5L2FA 1NYYA 2ZQDA 2IWBA 1FR1A 2A3UA 3A3IA 2VGJA 1H5XA 1FCMA 3ZNYA 3IF6C 1MXOA 3RJUA 1NZUA 2UWXA 3FYZA 4EBLA 2RCXA 4EV4A 1EI5A 3GMWA 3V5MA 1HZOA 3HLBA 1RP5A 4PMAA 2XDMA 4FH4A 4JF4A 1KGFA 4KG5A 3CZDA 5KSCA 1XKZA 4OLGA 5HAIA 3S1YA 2X71A 4BL2A 3DWKA 4U0TA 5FQQA 1FCNA 3MBZA 5HX9A 4HBTA 4XUXA 4GD8A 3S22A 4XXRA 4P0MA 1FSWA 5AQ9A 3GRJA 1PWGA 4FD8A 2IWDA 5D3OA 1PIOA 1NYMA 1H8ZA 2OLUA 3A3FA 5CEDA 1ERMA 5U47A 5EUAA 1K25A 3GSGA 3MXRA 1K56A 1ZG4A 3N7WA 4JXVA 5F1GA 2Z2MB 4S2KA 1E3UA 4ID4A 4KZ9A 1CEFA 1L0EA 1XXMA 3C7VA 1KGEA 5EPHA 2X01A 3ZG7B 3PBRA 1I2SA 5FI7A 2WK0A 4K91A 2Y2IA 3SS4A 2HDQA 1GHIA 1HTZA 4YFMA 2EFXA 2HP5A 2Y2NA 4BD1A 5FASA 4ZBEA 1ES2A 4U0XA 4S2NC 3WS2A 1IELA 5HW3A 4OPRA 4PM8A 3IXBA 3P98A 3VFFA 5F83A 2DNSA 2ZM0A 3NI9A 1CI8A 4KZ7A 4S2LA 5FAQA 4EBNA 2G2UA 2JCHA 1JWPA 1ONGA 2H10A 3G34A 1ESIA 3GQZA 3LEZA 4P85A 4F94A 1WYBA 3B3XA 1PZPA 3IH9A 3GV9A 2R9WA 5GHZA 2Q9MA 1PW1A 4R4RA 3MZEA 2Y4AA 3SS5A 1LHYA 2Y91A 2J9PA 2C5WB 5GLDA 1ES3A 2WYXA 2I72A 2ZQ8A 3QNBA 2ZC5B 3IWIA 3NC8A 4S2JA 1W79A 3DW0A 4YINA 3VP1A 4JKTA 4KG6A 3FKWA 4QY6A 1CEGA 3OPPA 5F82A 5A93A 4FH2A 3UDIA 4MBFA 2QZ6A 4R1GA 4WYYA 5GLBA 3UNWA 1N4OA 2ZQAA 1N9BA 5FQIA 1RGZA 2ZM2A 4XUZA 4OOYA 3V3RA 5M18A 1GA9A 2HPBA 1KVMA 1CK3A 1JWVA 3G35A 1U60A 2WZXA 3VMAA 1NXYA 1FCOA 1ZKJA 1XX2A 4UA6A 5EVIC 1PW8A 3BLMA 3I7JA 4GOGA 3UE0A 4C6YA 1XP4A 3LCEA 1YLZA 1IKIA 2B5RA 4BL3A 1XGIA 1FOFA 1NJ4A 3VOZA 3BECA 3MKEA 3RXWA 1MKIA 4DE3A 4WZ5C 4KZ6A 1YMXA 5M19A 5CRFA 2EX9A 4JF6A 2RL3A 1KE0A 1K57C 5A91A 4BENA 3HLGA 5FAPA 5DTTA 4PM7A 4IEDA 1E4DA 3PAGA 1Y54A 4R3BA 2WKIA 4LCLA 2P9VA 2HP9A 1TDLA 1ONHA 4KZ4A 4UHUA 4LV3A 3IHBA 1PI5A 4S2MA 1O7EA 5FI2A 2J9OA 2FFYA 2DCFA 3Q7VB 2BLSA 2OV5A 1M6KA 1K4FA 3AGDA 3NDGA 4QB8A 3LY3A 3BFCA 4PM5A
chains in the Genus database with same CATH superfamily
3C4PA 1BLHA 3Q1FA 1E3UD 5CHJA 3DTIA 2W1RA 4MN7A 2XR0A 3DAVA 4ESPA 2XFSA 3KO6A 2ZC4B 3ZG0A 4N1XA 1BZAA 2W1TB 2V1ZA 3OPRA 4D60A 2GJ3A 4OONA 3WRTA 2K7SA 2HJEA 3OOVA 2R9XA 3NIAA 4OVDA 3BRMA 4Z9QA 4X68A 1W8QA 4E3LA 4Q8IA 1S4RA 4JBFA 3BQAA 3TSGA 2DMWA 3CAXA 3QP5A 4R38A 1K4EA 3UB7A 3V50A 2KDKA 4NEED 1HLUP 4M3KA 1G5UA 3IT9A 3M6HA 1YKDA 3ZYTA 1PWDA 2V8FA 2ZLYA 5E2EA 2VA0A 3W8KA 3G6OA 4E3NA 4L0LA 4QPRA 1S1YA 4GLQA 2XK1A 3A0VA 4IVKA 1JWZA 2ZC7A 5A92A 2VV6A 3OZHA 3P09A 1VEUB 2XH9A 2Z6DA 3MXQA 2ZQCA 4KQRA 4Z1WA 1L0FA 2HDSA 4IBRA 4ZJ3A 3KSHA 4FSFA 3OC2A 4X1MA 4CLCC 1FR6A 3IBRA 5HL1A 4L9GA 4WZ5A 4Y15A 1CI9A 5IHVA 3HREA 1IYPA 3CMZA 3ZG8B 4ARZA 3O3VA 1W5DA 4N1HA 1QMFA 1WYCA 4C75A 3ZFZA 3KYZA 2R78A 5DFYA 3UMEA 5FATA 2VGKA 1V9ZA 2PAVP 2JKFA 3IF6A 5DTKA 1DJAA 2PR5A 4HNBA 2JBFA 4EBPA 1DP9A 4MBHA 4E3KA 3OLOA 4IUHA 5BOHA 5AQAA 3BEBA 5CGWA 3VSKA 4JXGA 5DVAA 4G3VA 1SHVA 2W3EA 3G2YA 1T1CA 2VKSA 1YMSA 4EEPA 4BBUA 4IBXA 2GNXA 1IYQA 4KZ3A 3KSIA 4GHIB 1OMEA 3NOTC 5EVEA 3WWXA 1F5MA 4O0PA 1ZG6A 4WM9A 1WE4A 3QHYA 4EQIA 4GDBA 3W4PA 1VM1A 1YQSA 4PHTA 2XA7S 4RVAA 1NRFA 4WMCD 2H0TA 1OJ5A 2EXAA 3OPLA 4PM9A 2A49A 4BMWA 4FUWA 1ZTUA 4KENB 3VSLA 1YPRA 5C5KA 3O86A 3NOUC 1K6SA 5CECA 4EQ1A 4KZAA 1P0ZA 4UA9A 4EUVA 4WEJA 5TFQA 5F1FA 3LR5A 4OPQA 4QD4A 1ZC2A 4UQIM 1K0KA 1DY6A 1MWRA 1XGJA 5HARA 2NUPC 4E3MA 2HV1A 2EWVA 2Y59A 1NY0A 5KZHA 1S0WA 3M2JA 3RH8B 1EW0A 3W4OA 3D72A 4BQMA 3T50A 4DN0A 2Y2HA 5FEGA 5EM0A 3NCKA 2BG1A 5F6AA 4KUKA 3EWKA 3ZG5A 4JLFA 1BLCA 3T4KA 5FQJA 4NK3A 4LGWA 1DP6A 1LSWA 2VK3A 4Q0JA 1O07A 3ICYA 1UGUA 5E2FA 2HP6A 4H8RA 2B95A 4HJ3A 4QHCA 2ZL1A 3T4QA 1EWZA 3WS0A 4HI4A 2H0YA 1TDGA 2WKHA 3VOYA 2WGIA 5MC7A 2WAEA 3HUMA 4GD6A 3HLFA 2M7VA 3EEAA 2ZQDA 3S7QA 2O9CA 2HF6A 1ZHHB 3FYZA 4EBLA 4I39A 3GMWA 3V5MA 4FH4A 4G3KA 4JF4A 4KG5A 3UMDA 4OLGA 3EGXC 4HY8A 3CPTA 3DWKA 4U0TA 2H28A 1FCNA 3L9KA 1NYMA 4UQIS 5F1GA 2W3FA 1L0EA 2O99A 1KGEA 3ZG7B 1G6OA 2WK0A 2Y2IA 2HDQA 1HTZA 3UB5P 5HPFA 1KOUA 1ES2A 4U0XA 3T1XA 1IELA 1J3WA 4P6ZS 4OPRA 5F83A 2DNSA 2ZM0A 5FAQA 4RQ9A 2G2UA 3VOLA 1ONGA 2H10A 3G34A 4BBVA 4P85A 1PZPA 2GZAA 3GV9A 5FDSA 5G4ZA 2Y4AA 2Y91A 2J9PA 2C5WB 2WYXA 2Z6CA 5IT5A 4IUKA 2ZC5B 3NC8A 2PT7A 5J3WA 4KG6A 1CEGA 3OPPA 5FEFA 1TS0A 4LRZE 1TS8A 3LIBA 4WYYA 1YSPA 5L10A 2ZQAA 3NJAA 1RGZA 2A24B 3V3RA 3E0YA 1GA9A 1Y4OA 2HPBA 1JWVA 1XX2A 3BLMA 1XP4A 1YLZA 4EU0A 3BECA 3MKEA 3SW1A 1YMXA 1OTBA 5CRFA 4JF6A 2K2NA 1KE0A 5IS1A 3P01A 5HPIA 3PAGA 4CQHA 2WKIA 4KZ4A 4Y17A 1DP8A 1PI5A 4S2MA 1D06A 1O7EA 5FI2A 3BFCA 1GCEA 1E25A 1H8MA 3LICA 3FKVA 3BFFA 3UN7A 5LBRA 5CEBA 3MFDA 2ZL1B 1D1JA 2PBDP 2W3DA 2VJWA 3D9YA 4DDSA 1TD5A 2JC7A 3T4SA 2ZD8A 3EQVA 3ZCZA 4HESA 5DF8A 1H8YA 3SH8A 4N9KA 2WGVA 4R4SA 1GSWA 4F3LA 2Q0OA 3IXDA 3K3CA 2LB9A 2ZQ7A 3HLDA 4HEFA 3BM6A 1TVFA 1K54C 4HH3A 3VV4A 3H82A 5M1AA 1XJ2A 3A3EA 1VHMA 2Y2KA 3Q82A 3EQUA 1JVJA 1BTLA 1NLYA 1OT6A 2XGNA 2JKGA 3M2KA 1G6AA 5FDHA 1YLYA 3UB6A 1IKGA 5K5BA 2XD1A 4N9LA 4I3IA 5G18A 1P97A 3S4XA 3UPOA 2ZOIA 3HVFA 4R3AA 1YM1A 4D2OA 4X1LA 3W4QA 4GCZA 3UO9A 2WGWB 3SH9A 3F1NA 5EVIB 3CLOA 3MZFA 5JYPA 1OTEA 2Y2GA 2J7VA 3G31A 1LI9A 5AQBA 1YLPA 1L0DA 3UB8A 5E2HA 3SH7A 3BQ8A 4NG2A 1K55A 1LL5A 5CX7A 4JGRA 4B4XA 5KIZA 4X25A 4LRXC 3VP0A 1IYSA 2QYBA 4P87A 4JGOA 4RA7A 3G2ZA 5J8XA 4PPRA 4KQQA 3PAEA 4KQDA 2KLIA 3JYIA 4WZ4A 4KUOA 3BFGA 4QJGA 4DKIA 3MF0A 3NHQA 4DE1A 4EXOA 5HAPA 3FPWA 1SDNA 2EXBA 3IQAA 3HLEA 2ZMFA 3T12B 4LV0A 1GA0A 1UWPX 1GHMA 4GB7A 4MLLA 4Q0HA 1Y28A 5TR7A 4EETB 3NULA 5EM1A 1VETA 1MWTA 3RTYA 3HLCA 4B4ZA 5HWTA 2A24A 4GZBA 3RXXA 2WZZA 4MCWA 2PU4A 3IF5A 3IH8A 4EEUA 3BFEA 3KYEA 5EOOA 3WS5A 3KYQA 2H5SA 1MKMA 1MWUA 3PBQA 4OKPA 4YNRA 3VP3A 4OQ0A 3PBOA 2ZMAA 3C30A 1STZA 4CLCB 3LIFA 3IXHA 2L1MA 1YSQA 3E2KA 4LCMA 1LL9A 3E4OA 4S2PA 2J80A 2J8YA 5HFOA 3Q7VA 1ES4A 1YT4A 5AVFA 2PHYA 2XEPA 2DRWA 3BJNA 4GNUA 5KSHA 2XQZA 3E2LA 2Y79A 2XFTA 2V9AA 1D7EA 5AVEA 3UE3A 4LV1A 3SOIA 3GR2A 3CUEA 1HVBA 4M4XA 1GHPA 2PRFA 3N6IA 1XJ4A 3UE1A 1BYWA 1K55C 4G3WA 3BFDA 3O5YA 1XA1A 1JTGA 5TGFA 2OOLA 4EERA 4E6WA 1I5QA 3H82B 4CJNA 5HDDA 3ITAA 3FV7A 3C8CA 5FA7A 4WEKA 5GLCA 4ZTKA 1FSYA 3IHAA 5EV0A 3OCLA 3ZQ5A 1TEMA 1BT5A 4ZRRA 2VLGA 1VQQA 5L2FA 1FR1A 3A3IA 3ZNYA 1NZUA 1XFQA 4XT2B 4PMAA 2O9AA 4FOFA 5FQQA 3VE3A 3MJQA 4CLCD 2INWA 3TW8A 3K3DA 3S22A 3U4LP 4P0MA 3GRJA 1PWGA 3KSGA 5D3OA 3V67A 3MXRA 4S2KA 1LL8A 3BY9A 4KZ9A 1CEFA 3C7VA 4B9OA 3PBRA 1I2SA 4YFMA 4WN5A 2HP5A 4BD1A 3WS2A 4PM8A 4DJ2A 3C38A 3IX4A 1CI8A 3LEZA 1YAXA 3IH9A 5IU1A 2R9WA 4HH2A 3F1NB 5GHZA 1PW1A 4R4RA 3SS5A 4YWZA 1OJGA 2I72A 5TBMA 3IWIA 4YINA 4JKTA 4FH2A 3UDIA 2ACGA 4MBFA 4ETXA 3UNWA 3F1PA 1N9BA 3LYXA 1CJFA 4XUZA 3PYPA 4OOYA 2V0WA 1H0MA 3T1QB 2UV0E 1CK3A 3G35A 1U60A 2WZXA 1NXYA 1NLZA 3IBJA 4C6YA 2B5RA 1W63Q 2FZ0A 4KZ6A 2P04A 4BENA 3F1OB 3CWFA 5DTTA 4IEDA 4YOFA 2B02A 1GSVA 4LCLA 2CMNA 1TDLA 1ONHA 4HOIA 4WUJA 2J9OA 2DCFA 3A0SA 2OV5A 1M6KA 1K4FA 3LI9A 3NDGA 5A8BA 4PM5A 3IXGA 3GVBA 4IHQA 3EGDC 1AXBA 5HD3A 5E43A 4LENA 3TRCA 4E3JA 3IWOA 1IYOA 2E8IA 1KDWA 3DTMA 5I5LA 4B88A 2V1BA 1NWZA 3CJMA 1OTIA 4RX2A 4GJ4A 4DE0A 2NUTC 4NKPA 3MSHA 3FC7A 3IX3A 5I94A 5HL6A 4JF5A 5EVID 4WMCA 5CHMA 3PBNA 5DF7A 3IWQA 5DTSA 3LR0A 2PDRA 3ZDJA 1T1BA 3TG9A 2EX8A 1K6RA 1N9LA 2YKHA 4QWOA 4Y13A 1NRJA 1CF0A 4GHIA 3BYDA 3IS2B 3LR4A 4LV2A 5FI6A 1BLSA 4WELA 3HL9A 4GN2A 1SKOA 2WADA 2ZOHA 3H7WA 4ZDXA 4WBGA 5A90A 1RCJA 3LFVA 4DRTA 5HAQA 4XT2A 5EFWA 2ZBBA 4R0QA 2BTFP 1ACFA 2WKPA 1VETB 4MN5A 3DWZA 2VGLS 1K56D 5HDCA 4HBUA 4PAUA 3T4TA 2C6WB 4LPZA 4GKUA 2QMIA 2JKTI 1BUEA 3H9WA 4A5RA 4WF0A 3VP2A 5HZHA 2V0UA 3VFHA 1S6RA 3B47A 2PD7A 3ZG9B 2Q9NA 2JKRM 2QWSA 3PHYA 1P9RA 4X6TA 2E8JA 3ISGA 1EROA 1T1AA 4R23A 5TBMB 2WAFA 1XA7A 1GSXA 2G2WA 2L4RA 3C7UA 1C3BA 1PI4A 5GL9A 5FSRA 5HWVA 3CITA 2I9VA 1NZOA 2WGWA 3E4QA 4UAAA 1MBLA 1LSXA 2XD5A 2ZC6B 1G28A 4R70A 5EVIA 3MZDA 3NDEA 4GDNA 2JKRI 2W3HA 3KSFA 4ME4A 2JE5A 3PR6A 1W63M 1BSGA 2PYRA 1BULA 4DF6A 1N9OA 3WS4A 1RGYA 3MS6A 4GS9B 4DXBA 5EVLA 3MXSA 1Q2PA 2J3TD 3ZHHA 2QJ7A 1PNEA 3Q81A 4WL9A 1PZOA 3LUQA 2V2FF 4JGPA 5CGSA 4L9FA 2EFUA 1ERQA 3R7WB 3ZNTA 2ZC3B 2ZMVA 4LLOB 5G4YA 2XLNA 2Y2MA 3SS3A 1XPBA 3C5AA 4MMNA 1ESUA 4X69A 3LO7A 3F1OA 4E3IA 4Q0IA 4DE2A 2W27A 5DJUA 3UPNA 1PWCA 4RYEA 3FZCA 4Y3IA 3LI8A 3AGEA 4OP5A 5FQMA 3N8RA 3TOIA 4DJ3A 1I2WA 3MQOA 4FCFA 2OAQ1 3T4JA 2J3TC 3ULFA 2Y8HA 3MKFA 2IWCA 4JXSA 2OAP1 3LIDA 4OQGA 3M6BA 1MY8A 4F3LB 2BASA 1P9WA 5TJJA 4QY5A 4II7A 4OH0A 2P74A 3A3JA 2J3WA 3G4PA 2GDNA 1MPLA 1KVLA 3U2AA 3E98A 1X0OA 3QP2A 2D01A 2V20A 3ZVWA 3O88A 1L0GA 3V3SA 5HDSA 5F69A 3HLWA 1LI0A 2W3GA 2QHKA 4H6JB 5FQ9A 3BW6A 1YLJA 1S1ZA 3CG5A 2Y2OA 4NETA 3ZVTA 1Z6FA 4R3JA 2HDRA 4OPZA 2VGLM 4X53A 4JPMA 4O01A 3ITBA 4K0WA 2QJ5A 2Y2JA 2L0WA 4MDZA 2W1TA 1FQGA 2JHEA 4MBKA 4WLAA 5E2GA 1NYYA 3LIAA 2A3UA 1FCMA 2VGJA 2FH5A 2UWXA 2OWHA 2RCXA 4EV4A 3C2WA 1XFNA 2KX6A 1EI5A 4P6ZM 1HZOA 3HLBA 2XDMA 1KGFA 2W0NA 5HAIA 1WA9A 4BL2A 3MR0A 5HSQA 5HX9A 4HBTA 4XUXA 2XROA 4XXRA 1S4SA 3UE6A 2IWDA 3A3FA 1H8ZA 1ERMA 3EOIA 5U47A 5EUAA 1K25A 3GSGA 3N7WA 1K56A 4JXVA 1E3UA 2X01A 4I3JA 5FI7A 2HJ9C 1GHIA 1OTAA 2EFXA 2Y2NA 5FASA 4ZBEA 5DKKA 5HW3A 3P98A 1T19A 1TF1A 3NI9A 1LT0A 3GQZA 3L7HA 1OTDA 5DJTA 2XA7M 3EEHA 4LFUA 3MZEA 2ZQ8A 3QNBA 3SZTA 4S2JA 4CLCA 5F82A 1SZVA 2EA9A 3LEQA 1DRMA 4R1GA 3HJIA 5GLBA 1N4OA 2O9BA 5FQIA 2VEAA 2ZM2A 3QP1A 5J7EA 5M18A 4ETZA 1F98A 1KVMA 3NECA 1ZKJA 4UA6A 1MZUA 5EVIC 2YKFA 3LCEA 3R7WA 1IKIA 4NXGA 2KOIA 2D02A 1FOFA 1NJ4A 4BBTA 5DKLA 2PD8A 1MKIA 4DE3A 1MC0A 5M19A 2EX9A 2RL3A 1FIKA 1K57C 5A91A 3S7PA 3HLGA 4PM7A 1E4DA 2HZ5A 2P9VA 5DFXA 5AJGA 4LV3A 3IHBA 3T1RA 2JN7A 4HJ6A 3Q7VB 2BLSA 3AGDA 5HWWA 4I5SA 4QB8A 4X55A 3GDIA 3C4OA 4S2OA 1N9NA 4GW9A 4DMZA 1LLBA 1PFLA 3LY4A 4NXFA 2G7UA 3AGFA 2WKEA 4Y2FA 2PYPA 2WUQA 3HBRA 1YLWA 4HQAA 3HUOA 2EX2A 1UWNX 3E4PA 5KMWA 4O8GA 4S2IA 3QNCA 1F2KA 1T18A 3WS1A 2M1CA 1V9YA 4BD0A 3MMHA 4NXEA 2Z2LB 3RFBA 3FG8A 5GHXA 5FQKA 1JTDA 1BLPA 3UY6A 1KE3A 3FPVA 4EWFA 2P7JA 4ARZB 1XJ3A 1QMEA 3NY4A 3Q7ZA 5HD5A 4C3QA 2OSUA 4Y0UA 3BY8A 1OPXA 4X56A 1L3LA 1KDSA 4UA7A 5F5YA 3S7NA 3DBAA 4E3OA 1Q2QA 5DF9A 5AQ7A 2GX5A 4Y0OA 1ALQA 3FWLA 3A0RA 4PM6A 4I38A 5JYOA 3P7NA 3TE8A 2HDUA 3NOPC 3R4KA 2V1AA 1IEMA 3QP6A 5EECA 5FAOA 4BJPA 2K31A 2OLVA 4HP4A 1OT9A 4L9EA 4BLMA 4P6BA 5CTMA 4OOMA 1JNUA 4EW7A 3CHWP 5CGXA 5FL3A 1S67L 4HJ4A 4KZBA 2XRNA 2QPNA 3JVVA 5EOEA 4E6XA 3BWLA 3D3OA 1IOUA 2PBYA 1PYYA 2PU2A 3N4IA 4KG2A 3IS2A 3T1SA 5GLAA 3NBLA 2LB5A 3HJKA 3B33A 1F9IA 4LRYC 1A0KA 2ZM8A 4OLDA 3UDXA 4KQOA 4IVIA 1K54A 4U3TA 2Y55A 4Y7PA 2EX6A 2XF3A 3T4LA 1MWSA 4K0XA 2X02A 3V39A 4MEZA 5CHUA 4OOLA 4OQIA 5GHYA 1YLTA 4ZJ1A 5L07A 3A3DA 1DJBA 2Y2QA 3MQ0A 3ZGAB 2Y2PA 4MNRA 3F1PB 1HD8A 3S7OA 4JGQA 4NXBA 3KX0X 1KE4A 3PTEA 1SCWA 4Y0TA 1SKOB 1VEUA 1L2SA 3N8LA 4RX3A 1W8YA 5CXWA 4K08A 4OPYA 1KGGA 3O87A 3N8SA 4DDYA 3VP4A 4HP9A 2FFFB 1DJCA 1FILA 3W2ZA 3VE4A 2P9VB 3K2NA 4DXCA 2VV8A 4OQHA 1Z09A 4O7DA 4S2NA 1TS6A 1K57A 3Q07A 5CTNA 1H3QA 3UDFA 1J9MA 5J4EA 2VV7A 4QU3A 2B18A 1LSVA 1VB6A 2P08A 3D4FA 3MQQA 1SKFA 4HIAA 5EE8A 4R6LA 4GS9A 3LR3A 1G68A 3IF6B 3GTCA 4ZJ2A 4OP8A 3OBFA 2XSSA 3UPPA 3OPHA 4JXWA 2HGVA 4PKYA 2EWWA 5CERA 3G30A 1ES5A 3LGOA 3B42A 3BLSA 3HUNA 3PBTA 1M40A 4KZ8A 2O0YA 2CC1A 1W7FA 2ZJ9A 4CPKA 4EUZA 1CQAA 3PBSA 4HHDA 1TS7A 2Y2LA 3JPUA 3OCNA 4N92A 3WRZA 2ZQ9A 2QKPA 3TJZC 1SDEA 4ZAMA 3HCYA 4I3AA 3G32A 1K38A 4E04A 3LIEA 3QP4A 4KZ5A 4BWIA 2IWBA 1H5XA 3T4OA 2WKRA 3IF6C 1MXOA 3H7WB 3RJUA 2VZWA 1RP5A 4UEYA 3CZDA 5KSCA 1XKZA 3S1YA 4MN6A 2OWJA 3IX8A 2X71A 3MBZA 1AWIA 4GD8A 1FSWA 4AFIA 5AQ9A 4FD8A 1PIOA 2OLUA 5CEDA 1ZG4A 2IA2A 2Z2MB 4ID4A 5EPHA 1XXMA 4Y5FA 4K91A 3SS4A 2WKQA 1ODVA 4S2NC 3IXBA 3VFFA 4KZ7A 4S2LA 4EBNA 5L8MA 2JCHA 1JWPA 4FTXA 1S66L 1ESIA 4F94A 1WYBA 3B3XA 3QP8A 2V8CA 2Q9MA 2JKTM 1LHYA 5GLDA 1ES3A 1XJ6A 3DTEA 3GECA 3JVUA 1W79A 3DW0A 3MFXA 3VP1A 4QY6A 3FKWA 4H6JA 3PXPA 5A93A 3CPTB 3UB9A 2QZ6A 2AVXA 2A2LA 4IJGA 3VMAA 1FCOA 1IFQA 2MJ6A 1PW8A 3UE0A 3I7JA 4GOGA 4PKYG 3CUEC 4BL3A 1XGIA 4B93A 3VOZA 3RXWA 4EESA 3CI6A 4WZ5C 2M7UA 5FAPA 2VX8A 1Y54A 4R3BA 5L09A 2HP9A 4UHUA 5F68A 2FFYA 4CLCE 3DTKA 2PR6A 3LY3A 1PRQA
chains in the Genus database with same CATH topology
4X55A 1GCEA 3IXGA 3GVBA 1E25A 3C4PA 3C4OA 4S2OA 3FKVA 1BLHA 3Q1FA 1AXBA 1E3UD 3BFFA 5CHJA 3UN7A 1LLBA 5E43A 4LENA 4E3JA 3IWOA 1IYOA 3LY4A 2E8IA 5CEBA 2XR0A 1KDWA 3DTMA 3MFDA 3AGFA 4B88A 2WKEA 2XFSA 2ZC4B 4DDSA 3ZG0A 3CJMA 2JC7A 2WUQA 4N1XA 2ZD8A 3EQVA 1BZAA 3HBRA 3ZCZA 4HESA 5DF8A 1YLWA 2V1ZA 3OPRA 3HUOA 4OONA 2EX2A 1H8YA 3WRTA 3SH8A 4RX2A 4N9KA 2WGVA 2R9XA 4R4SA 3NIAA 4OVDA 4DE0A 3BRMA 4Z9QA 3IXDA 4X68A 1W8QA 2ZQ7A 5KMWA 3HLDA 4HEFA 4S2IA 4E3LA 3QNCA 4Q8IA 4JBFA 3BM6A 3WS1A 5I94A 1TVFA 4BD0A 1K54C 3TSGA 2Z2LB 4JF5A 5GHXA 5EVID 5M1AA 4WMCA 1JTDA 5CHMA 1BLPA 3PBNA 5FQKA 1KE3A 5DF7A 3UY6A 3A3EA 4EWFA 3IWQA 5DTSA 2Y2KA 1K4EA 3Q82A 3EQUA 3V50A 3ZDJA 1JVJA 1BTLA 3TG9A 4M3KA 3IT9A 3M6HA 2XGNA 1QMEA 1K6RA 2EX8A 1PWDA 3M2KA 3NY4A 3Q7ZA 4C3QA 1G6AA 5FDHA 1YLYA 2OSUA 4Y0UA 2ZLYA 5E2EA 1IKGA 3W8KA 4X56A 1KDSA 4E3NA 4UA7A 3BYDA 2XD1A 4L0LA 4LV2A 4E3OA 1Q2QA 4N9LA 5DF9A 5FI6A 1BLSA 2XK1A 5AQ7A 5G18A 4IVKA 4WELA 2ZC7A 1JWZA 4Y0OA 1ALQA 5A92A 3S4XA 3FWLA 3UPOA 4PM6A 3HVFA 3HL9A 1YM1A 3OZHA 4D2OA 4GN2A 5JYOA 2WADA 2HDUA 3P09A 3W4QA 2XH9A 3UO9A 4ZDXA 2WGWB 1IEMA 2ZQCA 5EECA 5FAOA 4WBGA 5A90A 1RCJA 3SH9A 4BJPA 4KQRA 4DRTA 2OLVA 5HAQA 1L0FA 2HDSA 4IBRA 5EVIB 4ZJ3A 3MZFA 4FSFA 3OC2A 5JYPA 1FR6A 2Y2GA 4R0QA 2J7VA 4BLMA 3G31A 4P6BA 1LI9A 5CTMA 4OOMA 5AQBA 5HL1A 1YLPA 4WZ5A 1L0DA 3DWZA 1CI9A 1K56D 4HBUA 5E2HA 3SH7A 2C6WB 5IHVA 1K55A 3HREA 1LL5A 1IYPA 4GKUA 5CGXA 3CMZA 3ZG8B 4B4XA 4KZBA 3O3VA 2QMIA 1W5DA 1BUEA 4N1HA 1QMFA 2QPNA 4A5RA 3VP0A 1IYSA 1WYCA 3VP2A 5EOEA 4C75A 3ZFZA 4E6XA 4P87A 2PBYA 3VFHA 1PYYA 1S6RA 2PU2A 4RA7A 3N4IA 5FATA 4KG2A 3ZG9B 3G2ZA 2VGKA 4PPRA 2Q9NA 5J8XA 5GLAA 3NBLA 3IF6A 4KQQA 3PAEA 5DTKA 1DJAA 3JYIA 2ZM8A 4X6TA 4WZ4A 3ISGA 1EROA 4OLDA 4R23A 3BFGA 4QJGA 3UDXA 2JBFA 2WAFA 4IVIA 1K54A 4KQOA 1XA7A 4MBHA 4U3TA 2G2WA 2Y55A 4Y7PA 4DKIA 4E3KA 3C7UA 4DE1A 1C3BA 2EX6A 1PI4A 5HAPA 5BOHA 5AQAA 5GL9A 5FSRA 1SDNA 2EXBA 2XF3A 3BEBA 3IQAA 1MWSA 1NZOA 2WGWA 5CGWA 3HLEA 4K0XA 2X02A 3V39A 4MEZA 4UAAA 4LV0A 3VSKA 1GA0A 1MBLA 4JXGA 5DVAA 2XD5A 2ZC6B 5CHUA 1GHMA 4OOLA 5EVIA 4OQIA 3MZDA 3NDEA 4GDNA 5GHYA 4GB7A 1SHVA 4MLLA 1YLTA 3G2YA 5TR7A 4ZJ1A 1YMSA 2JE5A 3A3DA 1DJBA 2Y2QA 1BSGA 4IBXA 1MWTA 1IYQA 4KZ3A 3ZGAB 2Y2PA 1BULA 3HLCA 4B4ZA 4DF6A 4MNRA 1OMEA 3WS4A 1RGYA 4DXBA 1HD8A 5EVLA 3WWXA 4GZBA 3RXXA 3MXSA 2WZZA 2PU4A 3IF5A 1ZG6A 1Q2PA 4WM9A 1WE4A 1KE4A 3IH8A 3BFEA 3QHYA 5EOOA 3WS5A 3ZHHA 3Q81A 4EQIA 3PTEA 1SCWA 2H5SA 4Y0TA 1PZOA 4GDBA 2V2FF 5CGSA 2EFUA 1MWUA 1ERQA 1L2SA 3W4PA 1VM1A 3N8LA 1W8YA 2ZC3B 4RX3A 1YQSA 3ZNTA 5CXWA 3PBQA 4OPYA 4RVAA 1NRFA 1KGGA 4WMCD 2XLNA 2Y2MA 3SS3A 1XPBA 3C5AA 4OKPA 1ESUA 3N8SA 2H0TA 3LO7A 3O87A 4OQ0A 4X69A 3VP3A 4DDYA 4E3IA 3PBOA 3VP4A 2ZMAA 2EXAA 2FFFB 3IXHA 3OPLA 4DE2A 1DJCA 3UPNA 4PM9A 2A49A 1PWCA 3E2KA 4LCMA 2P9VB 4DXCA 4OQHA 1LL9A 4O7DA 4S2NA 4S2PA 4RYEA 1K57A 4KENB 3VSLA 3FZCA 2J8YA 3O86A 3Q07A 5HFOA 3Q7VA 3AGEA 5CTNA 1ES4A 4OP5A 1YT4A 3UDFA 1K6SA 5CECA 5FQMA 3N8RA 4KZAA 1J9MA 2XEPA 3TOIA 2DRWA 4GNUA 5KSHA 1I2WA 4UA9A 2XQZA 3E2LA 4QU3A 4FCFA 2XFTA 4WEJA 5TFQA 5F1FA 3UE3A 4QD4A 3D4FA 4OPQA 1SKFA 1ZC2A 3MKFA 4LV1A 3SOIA 2IWCA 1DY6A 5EE8A 1MWRA 1XGJA 5HARA 3GR2A 4JXSA 1G68A 1HVBA 4E3MA 3IF6B 3GTCA 4ZJ2A 4OQGA 4OP8A 2Y59A 1NY0A 3M6BA 5KZHA 1S0WA 1GHPA 1MY8A 3N6IA 3M2JA 3UPPA 3OPHA 4JXWA 3W4OA 3UE1A 4QY5A 4BQMA 4OH0A 2Y2HA 1K55C 2P74A 3NCKA 3A3JA 2BG1A 3G4PA 3BFDA 5CERA 2GDNA 3G30A 1XA1A 1MPLA 1JTGA 1KVLA 5TGFA 1ES5A 3ZG5A 3BLSA 3HUNA 4JLFA 3PBTA 1M40A 4KZ8A 1BLCA 5FQJA 2V20A 4E6WA 1I5QA 4NK3A 3ZVWA 3O88A 4CJNA 2CC1A 1L0GA 1W7FA 3V3SA 2ZJ9A 3HLWA 4CPKA 4EUZA 3ITAA 1O07A 1LI0A 5FQ9A 5E2FA 2HP6A 3FV7A 3PBSA 5FA7A 1YLJA 3CG5A 4WEKA 2Y2OA 4H8RA 4NETA 5GLCA 4QHCA 3ZVTA 1Z6FA 4R3JA 4ZTKA 2HDRA 4OPZA 2Y2LA 1FSYA 4X53A 3IHAA 1EWZA 3OCNA 4JPMA 4N92A 3OCLA 3WRZA 3WS0A 2H0YA 3ITBA 2ZQ9A 1TDGA 2WKHA 1TEMA 2Y2JA 4K0WA 3VOYA 1BT5A 1SDEA 2WGIA 4ZAMA 1FQGA 2WAEA 3HUMA 4GD6A 3HLFA 3G32A 4MBKA 1K38A 1VQQA 4EBPA 4KZ5A 5E2GA 5L2FA 1NYYA 2ZQDA 2IWBA 1FR1A 2A3UA 3A3IA 2VGJA 1H5XA 1FCMA 3ZNYA 3IF6C 1MXOA 3RJUA 1NZUA 2UWXA 3FYZA 4EBLA 2RCXA 4EV4A 1EI5A 3GMWA 3V5MA 1HZOA 3HLBA 1RP5A 4PMAA 2XDMA 4FH4A 4JF4A 1KGFA 4KG5A 3CZDA 5KSCA 1XKZA 4OLGA 5HAIA 3S1YA 2X71A 4BL2A 3DWKA 4U0TA 5FQQA 1FCNA 3MBZA 5HX9A 4HBTA 4XUXA 4GD8A 3S22A 4XXRA 4P0MA 1FSWA 5AQ9A 3GRJA 1PWGA 4FD8A 2IWDA 5D3OA 1PIOA 1NYMA 1H8ZA 2OLUA 3A3FA 5CEDA 1ERMA 5U47A 5EUAA 1K25A 3GSGA 3MXRA 1K56A 1ZG4A 3N7WA 4JXVA 5F1GA 2Z2MB 4S2KA 1E3UA 4ID4A 4KZ9A 1CEFA 1L0EA 1XXMA 3C7VA 1KGEA 5EPHA 2X01A 3ZG7B 3PBRA 1I2SA 5FI7A 2WK0A 4K91A 2Y2IA 3SS4A 2HDQA 1GHIA 1HTZA 4YFMA 2EFXA 2HP5A 2Y2NA 4BD1A 5FASA 4ZBEA 1ES2A 4U0XA 4S2NC 3WS2A 1IELA 5HW3A 4OPRA 4PM8A 3IXBA 3P98A 3VFFA 5F83A 2DNSA 2ZM0A 3NI9A 1CI8A 4KZ7A 4S2LA 5FAQA 4EBNA 2G2UA 2JCHA 1JWPA 1ONGA 2H10A 3G34A 1ESIA 3GQZA 3LEZA 4P85A 4F94A 1WYBA 3B3XA 1PZPA 3IH9A 3GV9A 2R9WA 5GHZA 2Q9MA 1PW1A 4R4RA 3MZEA 2Y4AA 3SS5A 1LHYA 2Y91A 2J9PA 2C5WB 5GLDA 1ES3A 2WYXA 2I72A 2ZQ8A 3QNBA 2ZC5B 3IWIA 3NC8A 4S2JA 1W79A 3DW0A 4YINA 3VP1A 4JKTA 4KG6A 3FKWA 4QY6A 1CEGA 3OPPA 5F82A 5A93A 4FH2A 3UDIA 4MBFA 2QZ6A 4R1GA 4WYYA 5GLBA 3UNWA 1N4OA 2ZQAA 1N9BA 5FQIA 1RGZA 2ZM2A 4XUZA 4OOYA 3V3RA 5M18A 1GA9A 2HPBA 1KVMA 1CK3A 1JWVA 3G35A 1U60A 2WZXA 3VMAA 1NXYA 1FCOA 1ZKJA 1XX2A 4UA6A 5EVIC 1PW8A 3BLMA 3I7JA 4GOGA 3UE0A 4C6YA 1XP4A 3LCEA 1YLZA 1IKIA 2B5RA 4BL3A 1XGIA 1FOFA 1NJ4A 3VOZA 3BECA 3MKEA 3RXWA 1MKIA 4DE3A 4WZ5C 4KZ6A 1YMXA 5M19A 5CRFA 2EX9A 4JF6A 2RL3A 1KE0A 1K57C 5A91A 4BENA 3HLGA 5FAPA 5DTTA 4PM7A 4IEDA 1E4DA 3PAGA 1Y54A 4R3BA 2WKIA 4LCLA 2P9VA 2HP9A 1TDLA 1ONHA 4KZ4A 4UHUA 4LV3A 3IHBA 1PI5A 4S2MA 1O7EA 5FI2A 2J9OA 2FFYA 2DCFA 3Q7VB 2BLSA 2OV5A 1M6KA 1K4FA 3AGDA 3NDGA 4QB8A 3LY3A 3BFCA 4PM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X55 A;  1GCE A;  3IXG A;  3GVB A;  1E25 A;  3C4P A;  3C4O A;  4S2O A;  3FKV A;  1BLH A;  3Q1F A;  1AXB A;  1E3U D;  3BFF A;  5CHJ A;  3UN7 A;  1LLB A;  5E43 A;  4LEN A;  4E3J A;  3IWO A;  1IYO A;  3LY4 A;  2E8I A;  5CEB A;  2XR0 A;  1KDW A;  3DTM A;  3MFD A;  3AGF A;  4B88 A;  2WKE A;  2XFS A;  2ZC4 B;  4DDS A;  3ZG0 A;  3CJM A;  2JC7 A;  2WUQ A;  4N1X A;  2ZD8 A;  3EQV A;  1BZA A;  3HBR A;  3ZCZ A;  4HES A;  5DF8 A;  1YLW A;  2V1Z A;  3OPR A;  3HUO A;  4OON A;  2EX2 A;  1H8Y A;  3WRT A;  3SH8 A;  4RX2 A;  4N9K A;  2WGV A;  2R9X A;  4R4S A;  3NIA A;  4OVD A;  4DE0 A;  3BRM A;  4Z9Q A;  3IXD A;  4X68 A;  1W8Q A;  2ZQ7 A;  5KMW A;  3HLD A;  4HEF A;  4S2I A;  4E3L A;  3QNC A;  4Q8I A;  4JBF A;  3BM6 A;  3WS1 A;  5I94 A;  1TVF A;  4BD0 A;  1K54 C;  3TSG A;  2Z2L B;  4JF5 A;  5GHX A;  5EVI D;  5M1A A;  4WMC A;  1JTD A;  5CHM A;  1BLP A;  3PBN A;  5FQK A;  1KE3 A;  5DF7 A;  3UY6 A;  3A3E A;  4EWF A;  3IWQ A;  5DTS A;  2Y2K A;  1K4E A;  3Q82 A;  3EQU A;  3V50 A;  3ZDJ A;  1JVJ A;  1BTL A;  3TG9 A;  4M3K A;  3IT9 A;  3M6H A;  2XGN A;  1QME A;  1K6R A;  2EX8 A;  1PWD A;  3M2K A;  3NY4 A;  3Q7Z A;  4C3Q A;  1G6A A;  5FDH A;  1YLY A;  2OSU A;  4Y0U A;  2ZLY A;  5E2E A;  1IKG A;  3W8K A;  4X56 A;  1KDS A;  4E3N A;  4UA7 A;  3BYD A;  2XD1 A;  4L0L A;  4LV2 A;  4E3O A;  1Q2Q A;  4N9L A;  5DF9 A;  5FI6 A;  1BLS A;  2XK1 A;  5AQ7 A;  5G18 A;  4IVK A;  4WEL A;  2ZC7 A;  1JWZ A;  4Y0O A;  1ALQ A;  5A92 A;  3S4X A;  3FWL A;  3UPO A;  4PM6 A;  3HVF A;  3HL9 A;  1YM1 A;  3OZH A;  4D2O A;  4GN2 A;  5JYO A;  2WAD A;  2HDU A;  3P09 A;  3W4Q A;  2XH9 A;  3UO9 A;  4ZDX A;  2WGW B;  1IEM A;  2ZQC A;  5EEC A;  5FAO A;  4WBG A;  5A90 A;  1RCJ A;  3SH9 A;  4BJP A;  4KQR A;  4DRT A;  2OLV A;  5HAQ A;  1L0F A;  2HDS A;  4IBR A;  5EVI B;  4ZJ3 A;  3MZF A;  4FSF A;  3OC2 A;  5JYP A;  1FR6 A;  2Y2G A;  4R0Q A;  2J7V A;  4BLM A;  3G31 A;  4P6B A;  1LI9 A;  5CTM A;  4OOM A;  5AQB A;  5HL1 A;  1YLP A;  4WZ5 A;  1L0D A;  3DWZ A;  1CI9 A;  1K56 D;  4HBU A;  5E2H A;  3SH7 A;  2C6W B;  5IHV A;  1K55 A;  3HRE A;  1LL5 A;  1IYP A;  4GKU A;  5CGX A;  3CMZ A;  3ZG8 B;  4B4X A;  4KZB A;  3O3V A;  2QMI A;  1W5D A;  1BUE A;  4N1H A;  1QMF A;  2QPN A;  4A5R A;  3VP0 A;  1IYS A;  1WYC A;  3VP2 A;  5EOE A;  4C75 A;  3ZFZ A;  4E6X A;  4P87 A;  2PBY A;  3VFH A;  1PYY A;  1S6R A;  2PU2 A;  4RA7 A;  3N4I A;  5FAT A;  4KG2 A;  3ZG9 B;  3G2Z A;  2VGK A;  4PPR A;  2Q9N A;  5J8X A;  5GLA A;  3NBL A;  3IF6 A;  4KQQ A;  3PAE A;  5DTK A;  1DJA A;  3JYI A;  2ZM8 A;  4X6T A;  4WZ4 A;  3ISG A;  1ERO A;  4OLD A;  4R23 A;  3BFG A;  4QJG A;  3UDX A;  2JBF A;  2WAF A;  4IVI A;  1K54 A;  4KQO A;  1XA7 A;  4MBH A;  4U3T A;  2G2W A;  2Y55 A;  4Y7P A;  4DKI A;  4E3K A;  3C7U A;  4DE1 A;  1C3B A;  2EX6 A;  1PI4 A;  5HAP A;  5BOH A;  5AQA A;  5GL9 A;  5FSR A;  1SDN A;  2EXB A;  2XF3 A;  3BEB A;  3IQA A;  1MWS A;  1NZO A;  2WGW A;  5CGW A;  3HLE A;  4K0X A;  2X02 A;  3V39 A;  4MEZ A;  4UAA A;  4LV0 A;  3VSK A;  1GA0 A;  1MBL A;  4JXG A;  5DVA A;  2XD5 A;  2ZC6 B;  5CHU A;  1GHM A;  4OOL A;  5EVI A;  4OQI A;  3MZD A;  3NDE A;  4GDN A;  5GHY A;  4GB7 A;  1SHV A;  4MLL A;  1YLT A;  3G2Y A;  5TR7 A;  4ZJ1 A;  1YMS A;  2JE5 A;  3A3D A;  1DJB A;  2Y2Q A;  1BSG A;  4IBX A;  1MWT A;  1IYQ A;  4KZ3 A;  3ZGA B;  2Y2P A;  1BUL A;  3HLC A;  4B4Z A;  4DF6 A;  4MNR A;  1OME A;  3WS4 A;  1RGY A;  4DXB A;  1HD8 A;  5EVL A;  3WWX A;  4GZB A;  3RXX A;  3MXS A;  2WZZ A;  2PU4 A;  3IF5 A;  1ZG6 A;  1Q2P A;  4WM9 A;  1WE4 A;  1KE4 A;  3IH8 A;  3BFE A;  3QHY A;  5EOO A;  3WS5 A;  3ZHH A;  3Q81 A;  4EQI A;  3PTE A;  1SCW A;  2H5S A;  4Y0T A;  1PZO A;  4GDB A;  2V2F F;  5CGS A;  2EFU A;  1MWU A;  1ERQ A;  1L2S A;  3W4P A;  1VM1 A;  3N8L A;  1W8Y A;  2ZC3 B;  4RX3 A;  1YQS A;  3ZNT A;  5CXW A;  3PBQ A;  4OPY A;  4RVA A;  1NRF A;  1KGG A;  4WMC D;  2XLN A;  2Y2M A;  3SS3 A;  1XPB A;  3C5A A;  4OKP A;  1ESU A;  3N8S A;  2H0T A;  3LO7 A;  3O87 A;  4OQ0 A;  4X69 A;  3VP3 A;  4DDY A;  4E3I A;  3PBO A;  3VP4 A;  2ZMA A;  2EXA A;  2FFF B;  3IXH A;  3OPL A;  4DE2 A;  1DJC A;  3UPN A;  4PM9 A;  2A49 A;  1PWC A;  3E2K A;  4LCM A;  2P9V B;  4DXC A;  4OQH A;  1LL9 A;  4O7D A;  4S2N A;  4S2P A;  4RYE A;  1K57 A;  4KEN B;  3VSL A;  3FZC A;  2J8Y A;  3O86 A;  3Q07 A;  5HFO A;  3Q7V A;  3AGE A;  5CTN A;  1ES4 A;  4OP5 A;  1YT4 A;  3UDF A;  1K6S A;  5CEC A;  5FQM A;  3N8R A;  4KZA A;  1J9M A;  2XEP A;  3TOI A;  2DRW A;  4GNU A;  5KSH A;  1I2W A;  4UA9 A;  2XQZ A;  3E2L A;  4QU3 A;  4FCF A;  2XFT A;  4WEJ A;  5TFQ A;  5F1F A;  3UE3 A;  4QD4 A;  3D4F A;  4OPQ A;  1SKF A;  1ZC2 A;  3MKF A;  4LV1 A;  3SOI A;  2IWC A;  1DY6 A;  5EE8 A;  1MWR A;  1XGJ A;  5HAR A;  3GR2 A;  4JXS A;  1G68 A;  1HVB A;  4E3M A;  3IF6 B;  3GTC A;  4ZJ2 A;  4OQG A;  4OP8 A;  2Y59 A;  1NY0 A;  3M6B A;  5KZH A;  1S0W A;  1GHP A;  1MY8 A;  3N6I A;  3M2J A;  3UPP A;  3OPH A;  4JXW A;  3W4O A;  3UE1 A;  4QY5 A;  4BQM A;  4OH0 A;  2Y2H A;  1K55 C;  2P74 A;  3NCK A;  3A3J A;  2BG1 A;  3G4P A;  3BFD A;  5CER A;  2GDN A;  3G30 A;  1XA1 A;  1MPL A;  1JTG A;  1KVL A;  5TGF A;  1ES5 A;  3ZG5 A;  3BLS A;  3HUN A;  4JLF A;  3PBT A;  1M40 A;  4KZ8 A;  1BLC A;  5FQJ A;  2V20 A;  4E6W A;  1I5Q A;  4NK3 A;  3ZVW A;  3O88 A;  4CJN A;  2CC1 A;  1L0G A;  1W7F A;  3V3S A;  2ZJ9 A;  3HLW A;  4CPK A;  4EUZ A;  3ITA A;  1O07 A;  1LI0 A;  5FQ9 A;  5E2F A;  2HP6 A;  3FV7 A;  3PBS A;  5FA7 A;  1YLJ A;  3CG5 A;  4WEK A;  2Y2O A;  4H8R A;  4NET A;  5GLC A;  4QHC A;  3ZVT A;  1Z6F A;  4R3J A;  4ZTK A;  2HDR A;  4OPZ A;  2Y2L A;  1FSY A;  4X53 A;  3IHA A;  1EWZ A;  3OCN A;  4JPM A;  4N92 A;  3OCL A;  3WRZ A;  3WS0 A;  2H0Y A;  3ITB A;  2ZQ9 A;  1TDG A;  2WKH A;  1TEM A;  2Y2J A;  4K0W A;  3VOY A;  1BT5 A;  1SDE A;  2WGI A;  4ZAM A;  1FQG A;  2WAE A;  3HUM A;  4GD6 A;  3HLF A;  3G32 A;  4MBK A;  1K38 A;  1VQQ A;  4EBP A;  4KZ5 A;  5E2G A;  5L2F A;  1NYY A;  2ZQD A;  2IWB A;  1FR1 A;  2A3U A;  3A3I A;  2VGJ A;  1H5X A;  1FCM A;  3ZNY A;  3IF6 C;  1MXO A;  3RJU A;  1NZU A;  2UWX A;  3FYZ A;  4EBL A;  2RCX A;  4EV4 A;  1EI5 A;  3GMW A;  3V5M A;  1HZO A;  3HLB A;  1RP5 A;  4PMA A;  2XDM A;  4FH4 A;  4JF4 A;  1KGF A;  4KG5 A;  3CZD A;  5KSC A;  1XKZ A;  4OLG A;  5HAI A;  3S1Y A;  2X71 A;  4BL2 A;  3DWK A;  4U0T A;  5FQQ A;  1FCN A;  3MBZ A;  5HX9 A;  4HBT A;  4XUX A;  4GD8 A;  3S22 A;  4XXR A;  4P0M A;  1FSW A;  5AQ9 A;  3GRJ A;  1PWG A;  4FD8 A;  2IWD A;  5D3O A;  1PIO A;  1NYM A;  1H8Z A;  2OLU A;  3A3F A;  5CED A;  1ERM A;  5U47 A;  5EUA A;  1K25 A;  3GSG A;  3MXR A;  1K56 A;  1ZG4 A;  3N7W A;  4JXV A;  5F1G A;  2Z2M B;  4S2K A;  1E3U A;  4ID4 A;  4KZ9 A;  1CEF A;  1L0E A;  1XXM A;  3C7V A;  1KGE A;  5EPH A;  2X01 A;  3ZG7 B;  3PBR A;  1I2S A;  5FI7 A;  2WK0 A;  4K91 A;  2Y2I A;  3SS4 A;  2HDQ A;  1GHI A;  1HTZ A;  4YFM A;  2EFX A;  2HP5 A;  2Y2N A;  4BD1 A;  5FAS A;  4ZBE A;  1ES2 A;  4U0X A;  4S2N C;  3WS2 A;  1IEL A;  5HW3 A;  4OPR A;  4PM8 A;  3IXB A;  3P98 A;  3VFF A;  5F83 A;  2DNS A;  2ZM0 A;  3NI9 A;  1CI8 A;  4KZ7 A;  4S2L A;  5FAQ A;  4EBN A;  2G2U A;  2JCH A;  1JWP A;  1ONG A;  2H10 A;  3G34 A;  1ESI A;  3GQZ A;  3LEZ A;  4P85 A;  4F94 A;  1WYB A;  3B3X A;  1PZP A;  3IH9 A;  3GV9 A;  2R9W A;  5GHZ A;  2Q9M A;  1PW1 A;  4R4R A;  3MZE A;  2Y4A A;  3SS5 A;  1LHY A;  2Y91 A;  2J9P A;  2C5W B;  5GLD A;  1ES3 A;  2WYX A;  2I72 A;  2ZQ8 A;  3QNB A;  2ZC5 B;  3IWI A;  3NC8 A;  4S2J A;  1W79 A;  3DW0 A;  4YIN A;  3VP1 A;  4JKT A;  4KG6 A;  3FKW A;  4QY6 A;  1CEG A;  3OPP A;  5F82 A;  5A93 A;  4FH2 A;  3UDI A;  4MBF A;  2QZ6 A;  4R1G A;  4WYY A;  5GLB A;  3UNW A;  1N4O A;  2ZQA A;  1N9B A;  5FQI A;  1RGZ A;  2ZM2 A;  4XUZ A;  4OOY A;  3V3R A;  5M18 A;  1GA9 A;  2HPB A;  1KVM A;  1CK3 A;  1JWV A;  3G35 A;  1U60 A;  2WZX A;  3VMA A;  1NXY A;  1FCO A;  1ZKJ A;  1XX2 A;  4UA6 A;  5EVI C;  1PW8 A;  3BLM A;  3I7J A;  4GOG A;  3UE0 A;  4C6Y A;  1XP4 A;  3LCE A;  1YLZ A;  1IKI A;  2B5R A;  4BL3 A;  1XGI A;  1FOF A;  1NJ4 A;  3VOZ A;  3BEC A;  3MKE A;  3RXW A;  1MKI A;  4DE3 A;  4WZ5 C;  4KZ6 A;  1YMX A;  5M19 A;  5CRF A;  2EX9 A;  4JF6 A;  2RL3 A;  1KE0 A;  1K57 C;  5A91 A;  4BEN A;  3HLG A;  5FAP A;  5DTT A;  4PM7 A;  4IED A;  1E4D A;  3PAG A;  1Y54 A;  4R3B A;  2WKI A;  4LCL A;  2P9V A;  2HP9 A;  1TDL A;  1ONH A;  4KZ4 A;  4UHU A;  4LV3 A;  3IHB A;  1PI5 A;  4S2M A;  1O7E A;  5FI2 A;  2J9O A;  2FFY A;  2DCF A;  3Q7V B;  2BLS A;  2OV5 A;  1M6K A;  1K4F A;  3AGD A;  3NDG A;  4QB8 A;  3LY3 A;  3BFC A;  4PM5 A; 
#chains in the Genus database with same CATH topology
 3C4P A;  1BLH A;  3Q1F A;  1E3U D;  5CHJ A;  3DTI A;  2W1R A;  4MN7 A;  2XR0 A;  3DAV A;  4ESP A;  2XFS A;  3KO6 A;  2ZC4 B;  3ZG0 A;  4N1X A;  1BZA A;  2W1T B;  2V1Z A;  3OPR A;  4D60 A;  2GJ3 A;  4OON A;  3WRT A;  2K7S A;  2HJE A;  3OOV A;  2R9X A;  3NIA A;  4OVD A;  3BRM A;  4Z9Q A;  4X68 A;  1W8Q A;  4E3L A;  4Q8I A;  1S4R A;  4JBF A;  3BQA A;  3TSG A;  2DMW A;  3CAX A;  3QP5 A;  4R38 A;  1K4E A;  3UB7 A;  3V50 A;  2KDK A;  4NEE D;  1HLU P;  4M3K A;  1G5U A;  3IT9 A;  3M6H A;  1YKD A;  3ZYT A;  1PWD A;  2V8F A;  2ZLY A;  5E2E A;  2VA0 A;  3W8K A;  3G6O A;  4E3N A;  4L0L A;  4QPR A;  1S1Y A;  4GLQ A;  2XK1 A;  3A0V A;  4IVK A;  1JWZ A;  2ZC7 A;  5A92 A;  2VV6 A;  3OZH A;  3P09 A;  1VEU B;  2XH9 A;  2Z6D A;  3MXQ A;  2ZQC A;  4KQR A;  4Z1W A;  1L0F A;  2HDS A;  4IBR A;  4ZJ3 A;  3KSH A;  4FSF A;  3OC2 A;  4X1M A;  4CLC C;  1FR6 A;  3IBR A;  5HL1 A;  4L9G A;  4WZ5 A;  4Y15 A;  1CI9 A;  5IHV A;  3HRE A;  1IYP A;  3CMZ A;  3ZG8 B;  4ARZ A;  3O3V A;  1W5D A;  4N1H A;  1QMF A;  1WYC A;  4C75 A;  3ZFZ A;  3KYZ A;  2R78 A;  5DFY A;  3UME A;  5FAT A;  2VGK A;  1V9Z A;  2PAV P;  2JKF A;  3IF6 A;  5DTK A;  1DJA A;  2PR5 A;  4HNB A;  2JBF A;  4EBP A;  1DP9 A;  4MBH A;  4E3K A;  3OLO A;  4IUH A;  5BOH A;  5AQA A;  3BEB A;  5CGW A;  3VSK A;  4JXG A;  5DVA A;  4G3V A;  1SHV A;  2W3E A;  3G2Y A;  1T1C A;  2VKS A;  1YMS A;  4EEP A;  4BBU A;  4IBX A;  2GNX A;  1IYQ A;  4KZ3 A;  3KSI A;  4GHI B;  1OME A;  3NOT C;  5EVE A;  3WWX A;  1F5M A;  4O0P A;  1ZG6 A;  4WM9 A;  1WE4 A;  3QHY A;  4EQI A;  4GDB A;  3W4P A;  1VM1 A;  1YQS A;  4PHT A;  2XA7 S;  4RVA A;  1NRF A;  4WMC D;  2H0T A;  1OJ5 A;  2EXA A;  3OPL A;  4PM9 A;  2A49 A;  4BMW A;  4FUW A;  1ZTU A;  4KEN B;  3VSL A;  1YPR A;  5C5K A;  3O86 A;  3NOU C;  1K6S A;  5CEC A;  4EQ1 A;  4KZA A;  1P0Z A;  4UA9 A;  4EUV A;  4WEJ A;  5TFQ A;  5F1F A;  3LR5 A;  4OPQ A;  4QD4 A;  1ZC2 A;  4UQI M;  1K0K A;  1DY6 A;  1MWR A;  1XGJ A;  5HAR A;  2NUP C;  4E3M A;  2HV1 A;  2EWV A;  2Y59 A;  1NY0 A;  5KZH A;  1S0W A;  3M2J A;  3RH8 B;  1EW0 A;  3W4O A;  3D72 A;  4BQM A;  3T50 A;  4DN0 A;  2Y2H A;  5FEG A;  5EM0 A;  3NCK A;  2BG1 A;  5F6A A;  4KUK A;  3EWK A;  3ZG5 A;  4JLF A;  1BLC A;  3T4K A;  5FQJ A;  4NK3 A;  4LGW A;  1DP6 A;  1LSW A;  2VK3 A;  4Q0J A;  1O07 A;  3ICY A;  1UGU A;  5E2F A;  2HP6 A;  4H8R A;  2B95 A;  4HJ3 A;  4QHC A;  2ZL1 A;  3T4Q A;  1EWZ A;  3WS0 A;  4HI4 A;  2H0Y A;  1TDG A;  2WKH A;  3VOY A;  2WGI A;  5MC7 A;  2WAE A;  3HUM A;  4GD6 A;  3HLF A;  2M7V A;  3EEA A;  2ZQD A;  3S7Q A;  2O9C A;  2HF6 A;  1ZHH B;  3FYZ A;  4EBL A;  4I39 A;  3GMW A;  3V5M A;  4FH4 A;  4G3K A;  4JF4 A;  4KG5 A;  3UMD A;  4OLG A;  3EGX C;  4HY8 A;  3CPT A;  3DWK A;  4U0T A;  2H28 A;  1FCN A;  3L9K A;  1NYM A;  4UQI S;  5F1G A;  2W3F A;  1L0E A;  2O99 A;  1KGE A;  3ZG7 B;  1G6O A;  2WK0 A;  2Y2I A;  2HDQ A;  1HTZ A;  3UB5 P;  5HPF A;  1KOU A;  1ES2 A;  4U0X A;  3T1X A;  1IEL A;  1J3W A;  4P6Z S;  4OPR A;  5F83 A;  2DNS A;  2ZM0 A;  5FAQ A;  4RQ9 A;  2G2U A;  3VOL A;  1ONG A;  2H10 A;  3G34 A;  4BBV A;  4P85 A;  1PZP A;  2GZA A;  3GV9 A;  5FDS A;  5G4Z A;  2Y4A A;  2Y91 A;  2J9P A;  2C5W B;  2WYX A;  2Z6C A;  5IT5 A;  4IUK A;  2ZC5 B;  3NC8 A;  2PT7 A;  5J3W A;  4KG6 A;  1CEG A;  3OPP A;  5FEF A;  1TS0 A;  4LRZ E;  1TS8 A;  3LIB A;  4WYY A;  1YSP A;  5L10 A;  2ZQA A;  3NJA A;  1RGZ A;  2A24 B;  3V3R A;  3E0Y A;  1GA9 A;  1Y4O A;  2HPB A;  1JWV A;  1XX2 A;  3BLM A;  1XP4 A;  1YLZ A;  4EU0 A;  3BEC A;  3MKE A;  3SW1 A;  1YMX A;  1OTB A;  5CRF A;  4JF6 A;  2K2N A;  1KE0 A;  5IS1 A;  3P01 A;  5HPI A;  3PAG A;  4CQH A;  2WKI A;  4KZ4 A;  4Y17 A;  1DP8 A;  1PI5 A;  4S2M A;  1D06 A;  1O7E A;  5FI2 A;  3BFC A;  1GCE A;  1E25 A;  1H8M A;  3LIC A;  3FKV A;  3BFF A;  3UN7 A;  5LBR A;  5CEB A;  3MFD A;  2ZL1 B;  1D1J A;  2PBD P;  2W3D A;  2VJW A;  3D9Y A;  4DDS A;  1TD5 A;  2JC7 A;  3T4S A;  2ZD8 A;  3EQV A;  3ZCZ A;  4HES A;  5DF8 A;  1H8Y A;  3SH8 A;  4N9K A;  2WGV A;  4R4S A;  1GSW A;  4F3L A;  2Q0O A;  3IXD A;  3K3C A;  2LB9 A;  2ZQ7 A;  3HLD A;  4HEF A;  3BM6 A;  1TVF A;  1K54 C;  4HH3 A;  3VV4 A;  3H82 A;  5M1A A;  1XJ2 A;  3A3E A;  1VHM A;  2Y2K A;  3Q82 A;  3EQU A;  1JVJ A;  1BTL A;  1NLY A;  1OT6 A;  2XGN A;  2JKG A;  3M2K A;  1G6A A;  5FDH A;  1YLY A;  3UB6 A;  1IKG A;  5K5B A;  2XD1 A;  4N9L A;  4I3I A;  5G18 A;  1P97 A;  3S4X A;  3UPO A;  2ZOI A;  3HVF A;  4R3A A;  1YM1 A;  4D2O A;  4X1L A;  3W4Q A;  4GCZ A;  3UO9 A;  2WGW B;  3SH9 A;  3F1N A;  5EVI B;  3CLO A;  3MZF A;  5JYP A;  1OTE A;  2Y2G A;  2J7V A;  3G31 A;  1LI9 A;  5AQB A;  1YLP A;  1L0D A;  3UB8 A;  5E2H A;  3SH7 A;  3BQ8 A;  4NG2 A;  1K55 A;  1LL5 A;  5CX7 A;  4JGR A;  4B4X A;  5KIZ A;  4X25 A;  4LRX C;  3VP0 A;  1IYS A;  2QYB A;  4P87 A;  4JGO A;  4RA7 A;  3G2Z A;  5J8X A;  4PPR A;  4KQQ A;  3PAE A;  4KQD A;  2KLI A;  3JYI A;  4WZ4 A;  4KUO A;  3BFG A;  4QJG A;  4DKI A;  3MF0 A;  3NHQ A;  4DE1 A;  4EXO A;  5HAP A;  3FPW A;  1SDN A;  2EXB A;  3IQA A;  3HLE A;  2ZMF A;  3T12 B;  4LV0 A;  1GA0 A;  1UWP X;  1GHM A;  4GB7 A;  4MLL A;  4Q0H A;  1Y28 A;  5TR7 A;  4EET B;  3NUL A;  5EM1 A;  1VET A;  1MWT A;  3RTY A;  3HLC A;  4B4Z A;  5HWT A;  2A24 A;  4GZB A;  3RXX A;  2WZZ A;  4MCW A;  2PU4 A;  3IF5 A;  3IH8 A;  4EEU A;  3BFE A;  3KYE A;  5EOO A;  3WS5 A;  3KYQ A;  2H5S A;  1MKM A;  1MWU A;  3PBQ A;  4OKP A;  4YNR A;  3VP3 A;  4OQ0 A;  3PBO A;  2ZMA A;  3C30 A;  1STZ A;  4CLC B;  3LIF A;  3IXH A;  2L1M A;  1YSQ A;  3E2K A;  4LCM A;  1LL9 A;  3E4O A;  4S2P A;  2J80 A;  2J8Y A;  5HFO A;  3Q7V A;  1ES4 A;  1YT4 A;  5AVF A;  2PHY A;  2XEP A;  2DRW A;  3BJN A;  4GNU A;  5KSH A;  2XQZ A;  3E2L A;  2Y79 A;  2XFT A;  2V9A A;  1D7E A;  5AVE A;  3UE3 A;  4LV1 A;  3SOI A;  3GR2 A;  3CUE A;  1HVB A;  4M4X A;  1GHP A;  2PRF A;  3N6I A;  1XJ4 A;  3UE1 A;  1BYW A;  1K55 C;  4G3W A;  3BFD A;  3O5Y A;  1XA1 A;  1JTG A;  5TGF A;  2OOL A;  4EER A;  4E6W A;  1I5Q A;  3H82 B;  4CJN A;  5HDD A;  3ITA A;  3FV7 A;  3C8C A;  5FA7 A;  4WEK A;  5GLC A;  4ZTK A;  1FSY A;  3IHA A;  5EV0 A;  3OCL A;  3ZQ5 A;  1TEM A;  1BT5 A;  4ZRR A;  2VLG A;  1VQQ A;  5L2F A;  1FR1 A;  3A3I A;  3ZNY A;  1NZU A;  1XFQ A;  4XT2 B;  4PMA A;  2O9A A;  4FOF A;  5FQQ A;  3VE3 A;  3MJQ A;  4CLC D;  2INW A;  3TW8 A;  3K3D A;  3S22 A;  3U4L P;  4P0M A;  3GRJ A;  1PWG A;  3KSG A;  5D3O A;  3V67 A;  3MXR A;  4S2K A;  1LL8 A;  3BY9 A;  4KZ9 A;  1CEF A;  3C7V A;  4B9O A;  3PBR A;  1I2S A;  4YFM A;  4WN5 A;  2HP5 A;  4BD1 A;  3WS2 A;  4PM8 A;  4DJ2 A;  3C38 A;  3IX4 A;  1CI8 A;  3LEZ A;  1YAX A;  3IH9 A;  5IU1 A;  2R9W A;  4HH2 A;  3F1N B;  5GHZ A;  1PW1 A;  4R4R A;  3SS5 A;  4YWZ A;  1OJG A;  2I72 A;  5TBM A;  3IWI A;  4YIN A;  4JKT A;  4FH2 A;  3UDI A;  2ACG A;  4MBF A;  4ETX A;  3UNW A;  3F1P A;  1N9B A;  3LYX A;  1CJF A;  4XUZ A;  3PYP A;  4OOY A;  2V0W A;  1H0M A;  3T1Q B;  2UV0 E;  1CK3 A;  3G35 A;  1U60 A;  2WZX A;  1NXY A;  1NLZ A;  3IBJ A;  4C6Y A;  2B5R A;  1W63 Q;  2FZ0 A;  4KZ6 A;  2P04 A;  4BEN A;  3F1O B;  3CWF A;  5DTT A;  4IED A;  4YOF A;  2B02 A;  1GSV A;  4LCL A;  2CMN A;  1TDL A;  1ONH A;  4HOI A;  4WUJ A;  2J9O A;  2DCF A;  3A0S A;  2OV5 A;  1M6K A;  1K4F A;  3LI9 A;  3NDG A;  5A8B A;  4PM5 A;  3IXG A;  3GVB A;  4IHQ A;  3EGD C;  1AXB A;  5HD3 A;  5E43 A;  4LEN A;  3TRC A;  4E3J A;  3IWO A;  1IYO A;  2E8I A;  1KDW A;  3DTM A;  5I5L A;  4B88 A;  2V1B A;  1NWZ A;  3CJM A;  1OTI A;  4RX2 A;  4GJ4 A;  4DE0 A;  2NUT C;  4NKP A;  3MSH A;  3FC7 A;  3IX3 A;  5I94 A;  5HL6 A;  4JF5 A;  5EVI D;  4WMC A;  5CHM A;  3PBN A;  5DF7 A;  3IWQ A;  5DTS A;  3LR0 A;  2PDR A;  3ZDJ A;  1T1B A;  3TG9 A;  2EX8 A;  1K6R A;  1N9L A;  2YKH A;  4QWO A;  4Y13 A;  1NRJ A;  1CF0 A;  4GHI A;  3BYD A;  3IS2 B;  3LR4 A;  4LV2 A;  5FI6 A;  1BLS A;  4WEL A;  3HL9 A;  4GN2 A;  1SKO A;  2WAD A;  2ZOH A;  3H7W A;  4ZDX A;  4WBG A;  5A90 A;  1RCJ A;  3LFV A;  4DRT A;  5HAQ A;  4XT2 A;  5EFW A;  2ZBB A;  4R0Q A;  2BTF P;  1ACF A;  2WKP A;  1VET B;  4MN5 A;  3DWZ A;  2VGL S;  1K56 D;  5HDC A;  4HBU A;  4PAU A;  3T4T A;  2C6W B;  4LPZ A;  4GKU A;  2QMI A;  2JKT I;  1BUE A;  3H9W A;  4A5R A;  4WF0 A;  3VP2 A;  5HZH A;  2V0U A;  3VFH A;  1S6R A;  3B47 A;  2PD7 A;  3ZG9 B;  2Q9N A;  2JKR M;  2QWS A;  3PHY A;  1P9R A;  4X6T A;  2E8J A;  3ISG A;  1ERO A;  1T1A A;  4R23 A;  5TBM B;  2WAF A;  1XA7 A;  1GSX A;  2G2W A;  2L4R A;  3C7U A;  1C3B A;  1PI4 A;  5GL9 A;  5FSR A;  5HWV A;  3CIT A;  2I9V A;  1NZO A;  2WGW A;  3E4Q A;  4UAA A;  1MBL A;  1LSX A;  2XD5 A;  2ZC6 B;  1G28 A;  4R70 A;  5EVI A;  3MZD A;  3NDE A;  4GDN A;  2JKR I;  2W3H A;  3KSF A;  4ME4 A;  2JE5 A;  3PR6 A;  1W63 M;  1BSG A;  2PYR A;  1BUL A;  4DF6 A;  1N9O A;  3WS4 A;  1RGY A;  3MS6 A;  4GS9 B;  4DXB A;  5EVL A;  3MXS A;  1Q2P A;  2J3T D;  3ZHH A;  2QJ7 A;  1PNE A;  3Q81 A;  4WL9 A;  1PZO A;  3LUQ A;  2V2F F;  4JGP A;  5CGS A;  4L9F A;  2EFU A;  1ERQ A;  3R7W B;  3ZNT A;  2ZC3 B;  2ZMV A;  4LLO B;  5G4Y A;  2XLN A;  2Y2M A;  3SS3 A;  1XPB A;  3C5A A;  4MMN A;  1ESU A;  4X69 A;  3LO7 A;  3F1O A;  4E3I A;  4Q0I A;  4DE2 A;  2W27 A;  5DJU A;  3UPN A;  1PWC A;  4RYE A;  3FZC A;  4Y3I A;  3LI8 A;  3AGE A;  4OP5 A;  5FQM A;  3N8R A;  3TOI A;  4DJ3 A;  1I2W A;  3MQO A;  4FCF A;  2OAQ 1;  3T4J A;  2J3T C;  3ULF A;  2Y8H A;  3MKF A;  2IWC A;  4JXS A;  2OAP 1;  3LID A;  4OQG A;  3M6B A;  1MY8 A;  4F3L B;  2BAS A;  1P9W A;  5TJJ A;  4QY5 A;  4II7 A;  4OH0 A;  2P74 A;  3A3J A;  2J3W A;  3G4P A;  2GDN A;  1MPL A;  1KVL A;  3U2A A;  3E98 A;  1X0O A;  3QP2 A;  2D01 A;  2V20 A;  3ZVW A;  3O88 A;  1L0G A;  3V3S A;  5HDS A;  5F69 A;  3HLW A;  1LI0 A;  2W3G A;  2QHK A;  4H6J B;  5FQ9 A;  3BW6 A;  1YLJ A;  1S1Z A;  3CG5 A;  2Y2O A;  4NET A;  3ZVT A;  1Z6F A;  4R3J A;  2HDR A;  4OPZ A;  2VGL M;  4X53 A;  4JPM A;  4O01 A;  3ITB A;  4K0W A;  2QJ5 A;  2Y2J A;  2L0W A;  4MDZ A;  2W1T A;  1FQG A;  2JHE A;  4MBK A;  4WLA A;  5E2G A;  1NYY A;  3LIA A;  2A3U A;  1FCM A;  2VGJ A;  2FH5 A;  2UWX A;  2OWH A;  2RCX A;  4EV4 A;  3C2W A;  1XFN A;  2KX6 A;  1EI5 A;  4P6Z M;  1HZO A;  3HLB A;  2XDM A;  1KGF A;  2W0N A;  5HAI A;  1WA9 A;  4BL2 A;  3MR0 A;  5HSQ A;  5HX9 A;  4HBT A;  4XUX A;  2XRO A;  4XXR A;  1S4S A;  3UE6 A;  2IWD A;  3A3F A;  1H8Z A;  1ERM A;  3EOI A;  5U47 A;  5EUA A;  1K25 A;  3GSG A;  3N7W A;  1K56 A;  4JXV A;  1E3U A;  2X01 A;  4I3J A;  5FI7 A;  2HJ9 C;  1GHI A;  1OTA A;  2EFX A;  2Y2N A;  5FAS A;  4ZBE A;  5DKK A;  5HW3 A;  3P98 A;  1T19 A;  1TF1 A;  3NI9 A;  1LT0 A;  3GQZ A;  3L7H A;  1OTD A;  5DJT A;  2XA7 M;  3EEH A;  4LFU A;  3MZE A;  2ZQ8 A;  3QNB A;  3SZT A;  4S2J A;  4CLC A;  5F82 A;  1SZV A;  2EA9 A;  3LEQ A;  1DRM A;  4R1G A;  3HJI A;  5GLB A;  1N4O A;  2O9B A;  5FQI A;  2VEA A;  2ZM2 A;  3QP1 A;  5J7E A;  5M18 A;  4ETZ A;  1F98 A;  1KVM A;  3NEC A;  1ZKJ A;  4UA6 A;  1MZU A;  5EVI C;  2YKF A;  3LCE A;  3R7W A;  1IKI A;  4NXG A;  2KOI A;  2D02 A;  1FOF A;  1NJ4 A;  4BBT A;  5DKL A;  2PD8 A;  1MKI A;  4DE3 A;  1MC0 A;  5M19 A;  2EX9 A;  2RL3 A;  1FIK A;  1K57 C;  5A91 A;  3S7P A;  3HLG A;  4PM7 A;  1E4D A;  2HZ5 A;  2P9V A;  5DFX A;  5AJG A;  4LV3 A;  3IHB A;  3T1R A;  2JN7 A;  4HJ6 A;  3Q7V B;  2BLS A;  3AGD A;  5HWW A;  4I5S A;  4QB8 A;  4X55 A;  3GDI A;  3C4O A;  4S2O A;  1N9N A;  4GW9 A;  4DMZ A;  1LLB A;  1PFL A;  3LY4 A;  4NXF A;  2G7U A;  3AGF A;  2WKE A;  4Y2F A;  2PYP A;  2WUQ A;  3HBR A;  1YLW A;  4HQA A;  3HUO A;  2EX2 A;  1UWN X;  3E4P A;  5KMW A;  4O8G A;  4S2I A;  3QNC A;  1F2K A;  1T18 A;  3WS1 A;  2M1C A;  1V9Y A;  4BD0 A;  3MMH A;  4NXE A;  2Z2L B;  3RFB A;  3FG8 A;  5GHX A;  5FQK A;  1JTD A;  1BLP A;  3UY6 A;  1KE3 A;  3FPV A;  4EWF A;  2P7J A;  4ARZ B;  1XJ3 A;  1QME A;  3NY4 A;  3Q7Z A;  5HD5 A;  4C3Q A;  2OSU A;  4Y0U A;  3BY8 A;  1OPX A;  4X56 A;  1L3L A;  1KDS A;  4UA7 A;  5F5Y A;  3S7N A;  3DBA A;  4E3O A;  1Q2Q A;  5DF9 A;  5AQ7 A;  2GX5 A;  4Y0O A;  1ALQ A;  3FWL A;  3A0R A;  4PM6 A;  4I38 A;  5JYO A;  3P7N A;  3TE8 A;  2HDU A;  3NOP C;  3R4K A;  2V1A A;  1IEM A;  3QP6 A;  5EEC A;  5FAO A;  4BJP A;  2K31 A;  2OLV A;  4HP4 A;  1OT9 A;  4L9E A;  4BLM A;  4P6B A;  5CTM A;  4OOM A;  1JNU A;  4EW7 A;  3CHW P;  5CGX A;  5FL3 A;  1S67 L;  4HJ4 A;  4KZB A;  2XRN A;  2QPN A;  3JVV A;  5EOE A;  4E6X A;  3BWL A;  3D3O A;  1IOU A;  2PBY A;  1PYY A;  2PU2 A;  3N4I A;  4KG2 A;  3IS2 A;  3T1S A;  5GLA A;  3NBL A;  2LB5 A;  3HJK A;  3B33 A;  1F9I A;  4LRY C;  1A0K A;  2ZM8 A;  4OLD A;  3UDX A;  4KQO A;  4IVI A;  1K54 A;  4U3T A;  2Y55 A;  4Y7P A;  2EX6 A;  2XF3 A;  3T4L A;  1MWS A;  4K0X A;  2X02 A;  3V39 A;  4MEZ A;  5CHU A;  4OOL A;  4OQI A;  5GHY A;  1YLT A;  4ZJ1 A;  5L07 A;  3A3D A;  1DJB A;  2Y2Q A;  3MQ0 A;  3ZGA B;  2Y2P A;  4MNR A;  3F1P B;  1HD8 A;  3S7O A;  4JGQ A;  4NXB A;  3KX0 X;  1KE4 A;  3PTE A;  1SCW A;  4Y0T A;  1SKO B;  1VEU A;  1L2S A;  3N8L A;  4RX3 A;  1W8Y A;  5CXW A;  4K08 A;  4OPY A;  1KGG A;  3O87 A;  3N8S A;  4DDY A;  3VP4 A;  4HP9 A;  2FFF B;  1DJC A;  1FIL A;  3W2Z A;  3VE4 A;  2P9V B;  3K2N A;  4DXC A;  2VV8 A;  4OQH A;  1Z09 A;  4O7D A;  4S2N A;  1TS6 A;  1K57 A;  3Q07 A;  5CTN A;  1H3Q A;  3UDF A;  1J9M A;  5J4E A;  2VV7 A;  4QU3 A;  2B18 A;  1LSV A;  1VB6 A;  2P08 A;  3D4F A;  3MQQ A;  1SKF A;  4HIA A;  5EE8 A;  4R6L A;  4GS9 A;  3LR3 A;  1G68 A;  3IF6 B;  3GTC A;  4ZJ2 A;  4OP8 A;  3OBF A;  2XSS A;  3UPP A;  3OPH A;  4JXW A;  2HGV A;  4PKY A;  2EWW A;  5CER A;  3G30 A;  1ES5 A;  3LGO A;  3B42 A;  3BLS A;  3HUN A;  3PBT A;  1M40 A;  4KZ8 A;  2O0Y A;  2CC1 A;  1W7F A;  2ZJ9 A;  4CPK A;  4EUZ A;  1CQA A;  3PBS A;  4HHD A;  1TS7 A;  2Y2L A;  3JPU A;  3OCN A;  4N92 A;  3WRZ A;  2ZQ9 A;  2QKP A;  3TJZ C;  1SDE A;  4ZAM A;  3HCY A;  4I3A A;  3G32 A;  1K38 A;  4E04 A;  3LIE A;  3QP4 A;  4KZ5 A;  4BWI A;  2IWB A;  1H5X A;  3T4O A;  2WKR A;  3IF6 C;  1MXO A;  3H7W B;  3RJU A;  2VZW A;  1RP5 A;  4UEY A;  3CZD A;  5KSC A;  1XKZ A;  3S1Y A;  4MN6 A;  2OWJ A;  3IX8 A;  2X71 A;  3MBZ A;  1AWI A;  4GD8 A;  1FSW A;  4AFI A;  5AQ9 A;  4FD8 A;  1PIO A;  2OLU A;  5CED A;  1ZG4 A;  2IA2 A;  2Z2M B;  4ID4 A;  5EPH A;  1XXM A;  4Y5F A;  4K91 A;  3SS4 A;  2WKQ A;  1ODV A;  4S2N C;  3IXB A;  3VFF A;  4KZ7 A;  4S2L A;  4EBN A;  5L8M A;  2JCH A;  1JWP A;  4FTX A;  1S66 L;  1ESI A;  4F94 A;  1WYB A;  3B3X A;  3QP8 A;  2V8C A;  2Q9M A;  2JKT M;  1LHY A;  5GLD A;  1ES3 A;  1XJ6 A;  3DTE A;  3GEC A;  3JVU A;  1W79 A;  3DW0 A;  3MFX A;  3VP1 A;  4QY6 A;  3FKW A;  4H6J A;  3PXP A;  5A93 A;  3CPT B;  3UB9 A;  2QZ6 A;  2AVX A;  2A2L A;  4IJG A;  3VMA A;  1FCO A;  1IFQ A;  2MJ6 A;  1PW8 A;  3UE0 A;  3I7J A;  4GOG A;  4PKY G;  3CUE C;  4BL3 A;  1XGI A;  4B93 A;  3VOZ A;  3RXW A;  4EES A;  3CI6 A;  4WZ5 C;  2M7U A;  5FAP A;  2VX8 A;  1Y54 A;  4R3B A;  5L09 A;  2HP9 A;  4UHU A;  5F68 A;  2FFY A;  4CLC E;  3DTK A;  2PR6 A;  3LY3 A;  1PRQ A; 
#chains in the Genus database with same CATH homology
 4X55 A;  1GCE A;  3IXG A;  3GVB A;  1E25 A;  3C4P A;  3C4O A;  4S2O A;  3FKV A;  1BLH A;  3Q1F A;  1AXB A;  1E3U D;  3BFF A;  5CHJ A;  3UN7 A;  1LLB A;  5E43 A;  4LEN A;  4E3J A;  3IWO A;  1IYO A;  3LY4 A;  2E8I A;  5CEB A;  2XR0 A;  1KDW A;  3DTM A;  3MFD A;  3AGF A;  4B88 A;  2WKE A;  2XFS A;  2ZC4 B;  4DDS A;  3ZG0 A;  3CJM A;  2JC7 A;  2WUQ A;  4N1X A;  2ZD8 A;  3EQV A;  1BZA A;  3HBR A;  3ZCZ A;  4HES A;  5DF8 A;  1YLW A;  2V1Z A;  3OPR A;  3HUO A;  4OON A;  2EX2 A;  1H8Y A;  3WRT A;  3SH8 A;  4RX2 A;  4N9K A;  2WGV A;  2R9X A;  4R4S A;  3NIA A;  4OVD A;  4DE0 A;  3BRM A;  4Z9Q A;  3IXD A;  4X68 A;  1W8Q A;  2ZQ7 A;  5KMW A;  3HLD A;  4HEF A;  4S2I A;  4E3L A;  3QNC A;  4Q8I A;  4JBF A;  3BM6 A;  3WS1 A;  5I94 A;  1TVF A;  4BD0 A;  1K54 C;  3TSG A;  2Z2L B;  4JF5 A;  5GHX A;  5EVI D;  5M1A A;  4WMC A;  1JTD A;  5CHM A;  1BLP A;  3PBN A;  5FQK A;  1KE3 A;  5DF7 A;  3UY6 A;  3A3E A;  4EWF A;  3IWQ A;  5DTS A;  2Y2K A;  1K4E A;  3Q82 A;  3EQU A;  3V50 A;  3ZDJ A;  1JVJ A;  1BTL A;  3TG9 A;  4M3K A;  3IT9 A;  3M6H A;  2XGN A;  1QME A;  1K6R A;  2EX8 A;  1PWD A;  3M2K A;  3NY4 A;  3Q7Z A;  4C3Q A;  1G6A A;  5FDH A;  1YLY A;  2OSU A;  4Y0U A;  2ZLY A;  5E2E A;  1IKG A;  3W8K A;  4X56 A;  1KDS A;  4E3N A;  4UA7 A;  3BYD A;  2XD1 A;  4L0L A;  4LV2 A;  4E3O A;  1Q2Q A;  4N9L A;  5DF9 A;  5FI6 A;  1BLS A;  2XK1 A;  5AQ7 A;  5G18 A;  4IVK A;  4WEL A;  2ZC7 A;  1JWZ A;  4Y0O A;  1ALQ A;  5A92 A;  3S4X A;  3FWL A;  3UPO A;  4PM6 A;  3HVF A;  3HL9 A;  1YM1 A;  3OZH A;  4D2O A;  4GN2 A;  5JYO A;  2WAD A;  2HDU A;  3P09 A;  3W4Q A;  2XH9 A;  3UO9 A;  4ZDX A;  2WGW B;  1IEM A;  2ZQC A;  5EEC A;  5FAO A;  4WBG A;  5A90 A;  1RCJ A;  3SH9 A;  4BJP A;  4KQR A;  4DRT A;  2OLV A;  5HAQ A;  1L0F A;  2HDS A;  4IBR A;  5EVI B;  4ZJ3 A;  3MZF A;  4FSF A;  3OC2 A;  5JYP A;  1FR6 A;  2Y2G A;  4R0Q A;  2J7V A;  4BLM A;  3G31 A;  4P6B A;  1LI9 A;  5CTM A;  4OOM A;  5AQB A;  5HL1 A;  1YLP A;  4WZ5 A;  1L0D A;  3DWZ A;  1CI9 A;  1K56 D;  4HBU A;  5E2H A;  3SH7 A;  2C6W B;  5IHV A;  1K55 A;  3HRE A;  1LL5 A;  1IYP A;  4GKU A;  5CGX A;  3CMZ A;  3ZG8 B;  4B4X A;  4KZB A;  3O3V A;  2QMI A;  1W5D A;  1BUE A;  4N1H A;  1QMF A;  2QPN A;  4A5R A;  3VP0 A;  1IYS A;  1WYC A;  3VP2 A;  5EOE A;  4C75 A;  3ZFZ A;  4E6X A;  4P87 A;  2PBY A;  3VFH A;  1PYY A;  1S6R A;  2PU2 A;  4RA7 A;  3N4I A;  5FAT A;  4KG2 A;  3ZG9 B;  3G2Z A;  2VGK A;  4PPR A;  2Q9N A;  5J8X A;  5GLA A;  3NBL A;  3IF6 A;  4KQQ A;  3PAE A;  5DTK A;  1DJA A;  3JYI A;  2ZM8 A;  4X6T A;  4WZ4 A;  3ISG A;  1ERO A;  4OLD A;  4R23 A;  3BFG A;  4QJG A;  3UDX A;  2JBF A;  2WAF A;  4IVI A;  1K54 A;  4KQO A;  1XA7 A;  4MBH A;  4U3T A;  2G2W A;  2Y55 A;  4Y7P A;  4DKI A;  4E3K A;  3C7U A;  4DE1 A;  1C3B A;  2EX6 A;  1PI4 A;  5HAP A;  5BOH A;  5AQA A;  5GL9 A;  5FSR A;  1SDN A;  2EXB A;  2XF3 A;  3BEB A;  3IQA A;  1MWS A;  1NZO A;  2WGW A;  5CGW A;  3HLE A;  4K0X A;  2X02 A;  3V39 A;  4MEZ A;  4UAA A;  4LV0 A;  3VSK A;  1GA0 A;  1MBL A;  4JXG A;  5DVA A;  2XD5 A;  2ZC6 B;  5CHU A;  1GHM A;  4OOL A;  5EVI A;  4OQI A;  3MZD A;  3NDE A;  4GDN A;  5GHY A;  4GB7 A;  1SHV A;  4MLL A;  1YLT A;  3G2Y A;  5TR7 A;  4ZJ1 A;  1YMS A;  2JE5 A;  3A3D A;  1DJB A;  2Y2Q A;  1BSG A;  4IBX A;  1MWT A;  1IYQ A;  4KZ3 A;  3ZGA B;  2Y2P A;  1BUL A;  3HLC A;  4B4Z A;  4DF6 A;  4MNR A;  1OME A;  3WS4 A;  1RGY A;  4DXB A;  1HD8 A;  5EVL A;  3WWX A;  4GZB A;  3RXX A;  3MXS A;  2WZZ A;  2PU4 A;  3IF5 A;  1ZG6 A;  1Q2P A;  4WM9 A;  1WE4 A;  1KE4 A;  3IH8 A;  3BFE A;  3QHY A;  5EOO A;  3WS5 A;  3ZHH A;  3Q81 A;  4EQI A;  3PTE A;  1SCW A;  2H5S A;  4Y0T A;  1PZO A;  4GDB A;  2V2F F;  5CGS A;  2EFU A;  1MWU A;  1ERQ A;  1L2S A;  3W4P A;  1VM1 A;  3N8L A;  1W8Y A;  2ZC3 B;  4RX3 A;  1YQS A;  3ZNT A;  5CXW A;  3PBQ A;  4OPY A;  4RVA A;  1NRF A;  1KGG A;  4WMC D;  2XLN A;  2Y2M A;  3SS3 A;  1XPB A;  3C5A A;  4OKP A;  1ESU A;  3N8S A;  2H0T A;  3LO7 A;  3O87 A;  4OQ0 A;  4X69 A;  3VP3 A;  4DDY A;  4E3I A;  3PBO A;  3VP4 A;  2ZMA A;  2EXA A;  2FFF B;  3IXH A;  3OPL A;  4DE2 A;  1DJC A;  3UPN A;  4PM9 A;  2A49 A;  1PWC A;  3E2K A;  4LCM A;  2P9V B;  4DXC A;  4OQH A;  1LL9 A;  4O7D A;  4S2N A;  4S2P A;  4RYE A;  1K57 A;  4KEN B;  3VSL A;  3FZC A;  2J8Y A;  3O86 A;  3Q07 A;  5HFO A;  3Q7V A;  3AGE A;  5CTN A;  1ES4 A;  4OP5 A;  1YT4 A;  3UDF A;  1K6S A;  5CEC A;  5FQM A;  3N8R A;  4KZA A;  1J9M A;  2XEP A;  3TOI A;  2DRW A;  4GNU A;  5KSH A;  1I2W A;  4UA9 A;  2XQZ A;  3E2L A;  4QU3 A;  4FCF A;  2XFT A;  4WEJ A;  5TFQ A;  5F1F A;  3UE3 A;  4QD4 A;  3D4F A;  4OPQ A;  1SKF A;  1ZC2 A;  3MKF A;  4LV1 A;  3SOI A;  2IWC A;  1DY6 A;  5EE8 A;  1MWR A;  1XGJ A;  5HAR A;  3GR2 A;  4JXS A;  1G68 A;  1HVB A;  4E3M A;  3IF6 B;  3GTC A;  4ZJ2 A;  4OQG A;  4OP8 A;  2Y59 A;  1NY0 A;  3M6B A;  5KZH A;  1S0W A;  1GHP A;  1MY8 A;  3N6I A;  3M2J A;  3UPP A;  3OPH A;  4JXW A;  3W4O A;  3UE1 A;  4QY5 A;  4BQM A;  4OH0 A;  2Y2H A;  1K55 C;  2P74 A;  3NCK A;  3A3J A;  2BG1 A;  3G4P A;  3BFD A;  5CER A;  2GDN A;  3G30 A;  1XA1 A;  1MPL A;  1JTG A;  1KVL A;  5TGF A;  1ES5 A;  3ZG5 A;  3BLS A;  3HUN A;  4JLF A;  3PBT A;  1M40 A;  4KZ8 A;  1BLC A;  5FQJ A;  2V20 A;  4E6W A;  1I5Q A;  4NK3 A;  3ZVW A;  3O88 A;  4CJN A;  2CC1 A;  1L0G A;  1W7F A;  3V3S A;  2ZJ9 A;  3HLW A;  4CPK A;  4EUZ A;  3ITA A;  1O07 A;  1LI0 A;  5FQ9 A;  5E2F A;  2HP6 A;  3FV7 A;  3PBS A;  5FA7 A;  1YLJ A;  3CG5 A;  4WEK A;  2Y2O A;  4H8R A;  4NET A;  5GLC A;  4QHC A;  3ZVT A;  1Z6F A;  4R3J A;  4ZTK A;  2HDR A;  4OPZ A;  2Y2L A;  1FSY A;  4X53 A;  3IHA A;  1EWZ A;  3OCN A;  4JPM A;  4N92 A;  3OCL A;  3WRZ A;  3WS0 A;  2H0Y A;  3ITB A;  2ZQ9 A;  1TDG A;  2WKH A;  1TEM A;  2Y2J A;  4K0W A;  3VOY A;  1BT5 A;  1SDE A;  2WGI A;  4ZAM A;  1FQG A;  2WAE A;  3HUM A;  4GD6 A;  3HLF A;  3G32 A;  4MBK A;  1K38 A;  1VQQ A;  4EBP A;  4KZ5 A;  5E2G A;  5L2F A;  1NYY A;  2ZQD A;  2IWB A;  1FR1 A;  2A3U A;  3A3I A;  2VGJ A;  1H5X A;  1FCM A;  3ZNY A;  3IF6 C;  1MXO A;  3RJU A;  1NZU A;  2UWX A;  3FYZ A;  4EBL A;  2RCX A;  4EV4 A;  1EI5 A;  3GMW A;  3V5M A;  1HZO A;  3HLB A;  1RP5 A;  4PMA A;  2XDM A;  4FH4 A;  4JF4 A;  1KGF A;  4KG5 A;  3CZD A;  5KSC A;  1XKZ A;  4OLG A;  5HAI A;  3S1Y A;  2X71 A;  4BL2 A;  3DWK A;  4U0T A;  5FQQ A;  1FCN A;  3MBZ A;  5HX9 A;  4HBT A;  4XUX A;  4GD8 A;  3S22 A;  4XXR A;  4P0M A;  1FSW A;  5AQ9 A;  3GRJ A;  1PWG A;  4FD8 A;  2IWD A;  5D3O A;  1PIO A;  1NYM A;  1H8Z A;  2OLU A;  3A3F A;  5CED A;  1ERM A;  5U47 A;  5EUA A;  1K25 A;  3GSG A;  3MXR A;  1K56 A;  1ZG4 A;  3N7W A;  4JXV A;  5F1G A;  2Z2M B;  4S2K A;  1E3U A;  4ID4 A;  4KZ9 A;  1CEF A;  1L0E A;  1XXM A;  3C7V A;  1KGE A;  5EPH A;  2X01 A;  3ZG7 B;  3PBR A;  1I2S A;  5FI7 A;  2WK0 A;  4K91 A;  2Y2I A;  3SS4 A;  2HDQ A;  1GHI A;  1HTZ A;  4YFM A;  2EFX A;  2HP5 A;  2Y2N A;  4BD1 A;  5FAS A;  4ZBE A;  1ES2 A;  4U0X A;  4S2N C;  3WS2 A;  1IEL A;  5HW3 A;  4OPR A;  4PM8 A;  3IXB A;  3P98 A;  3VFF A;  5F83 A;  2DNS A;  2ZM0 A;  3NI9 A;  1CI8 A;  4KZ7 A;  4S2L A;  5FAQ A;  4EBN A;  2G2U A;  2JCH A;  1JWP A;  1ONG A;  2H10 A;  3G34 A;  1ESI A;  3GQZ A;  3LEZ A;  4P85 A;  4F94 A;  1WYB A;  3B3X A;  1PZP A;  3IH9 A;  3GV9 A;  2R9W A;  5GHZ A;  2Q9M A;  1PW1 A;  4R4R A;  3MZE A;  2Y4A A;  3SS5 A;  1LHY A;  2Y91 A;  2J9P A;  2C5W B;  5GLD A;  1ES3 A;  2WYX A;  2I72 A;  2ZQ8 A;  3QNB A;  2ZC5 B;  3IWI A;  3NC8 A;  4S2J A;  1W79 A;  3DW0 A;  4YIN A;  3VP1 A;  4JKT A;  4KG6 A;  3FKW A;  4QY6 A;  1CEG A;  3OPP A;  5F82 A;  5A93 A;  4FH2 A;  3UDI A;  4MBF A;  2QZ6 A;  4R1G A;  4WYY A;  5GLB A;  3UNW A;  1N4O A;  2ZQA A;  1N9B A;  5FQI A;  1RGZ A;  2ZM2 A;  4XUZ A;  4OOY A;  3V3R A;  5M18 A;  1GA9 A;  2HPB A;  1KVM A;  1CK3 A;  1JWV A;  3G35 A;  1U60 A;  2WZX A;  3VMA A;  1NXY A;  1FCO A;  1ZKJ A;  1XX2 A;  4UA6 A;  5EVI C;  1PW8 A;  3BLM A;  3I7J A;  4GOG A;  3UE0 A;  4C6Y A;  1XP4 A;  3LCE A;  1YLZ A;  1IKI A;  2B5R A;  4BL3 A;  1XGI A;  1FOF A;  1NJ4 A;  3VOZ A;  3BEC A;  3MKE A;  3RXW A;  1MKI A;  4DE3 A;  4WZ5 C;  4KZ6 A;  1YMX A;  5M19 A;  5CRF A;  2EX9 A;  4JF6 A;  2RL3 A;  1KE0 A;  1K57 C;  5A91 A;  4BEN A;  3HLG A;  5FAP A;  5DTT A;  4PM7 A;  4IED A;  1E4D A;  3PAG A;  1Y54 A;  4R3B A;  2WKI A;  4LCL A;  2P9V A;  2HP9 A;  1TDL A;  1ONH A;  4KZ4 A;  4UHU A;  4LV3 A;  3IHB A;  1PI5 A;  4S2M A;  1O7E A;  5FI2 A;  2J9O A;  2FFY A;  2DCF A;  3Q7V B;  2BLS A;  2OV5 A;  1M6K A;  1K4F A;  3AGD A;  3NDG A;  4QB8 A;  3LY3 A;  3BFC A;  4PM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...