3V55A

Human malt1 (334-719) in its ligand free form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
383
structure length
368
Chain Sequence
QPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNKVTANIVFGYATCQAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 368
sequence length 383
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v55A02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v55A01
4I1RA 1QTNA 1M72A 4QUJA 3KJQA 3GJQA 4AW9A 3PD1A 1KMCA 2HBRA 3DEIA 4EHAA 2CNKA 4ZVPA 4EHLA 2CJXA 2H51A 1SHLA 4NBNA 1RWXA 4PS0A 4NBKA 2J32A 3R7NA 1QX3A 4EHHA 1I51A 3GJSA 3V4LA 1RHUA 2K7ZA 2QLJA 3D6HA 3EDRA 3R6GA 4AWAA 3H11B 5IABA 4HQRA 4N5DA 2C2ZA 3GJRA 5LU8A 1ICEA 3OD5A 4ZVRA 4HVAA 4JR0A 3UOAB 5IARA 1RE1A 2H54A 3BIJA 4JJ7A 1F9EA 3GJTA 5IAGA 5IBRA 1RWOA 5IANA 3P45A 1K88A 4JR1A 4M9RA 1RWKA 3KJFA 3PD0A 2CNNA 1RWNA 3R5KA 4ZVUA 4ZVSA 3R7BA 4QUHA 2C2MA 4FXOA 1I3OA 2QLFA 3H13A 1I4EB 4QUDA 3SIRA 1NMEA 3NS7A 1F1JA 4JJ8A 1I4OA 2QL7A 4JQYA 4JR2A 3K7EA 4NOMA 4QUBA 5JFTA 4I1PA 5LUBA 2H4WA 4DCJA 2Y0BA 1RHMA 1RHQA 4AWBA 2C2KA 5IAKA 2HBZA 4QU8A 3H1PA 3S70A 4PRZA 4QULA 5I9BA 1SC4A 1CVRA 5IASA 3UO8B 5K20A 1RWMA 4N6NA 2J31A 4PS1A 2Y1LA 2XYPA 1NMQA 1BMQA 2DKOA 2FQQA 3DEHA 4D3ZA 2WDPA 4FGUA 4NOJA 4QUEA 2CNLA 3V6MA 4EHDA 1CP3A 2H5JA 4IEFB 3S8EA 3V55A 3V6LA 1IBCA 3DEJA 4N6GA 3D6FA 4EHKA 2H65A 4N7MA 2C1EA 3H11A 2J30A 4QU5A 1PAUA 2QLBA 2HBYA 1GQFA 2P2CA 5IBPA 4FEAA 4QU0A 4QUGA 3NKFA 2CJYA 3R6LA 5IAEA 2QL5A 2CNOA 3DEKA 4QUAA 1RHJA 2FUNB 3IBFA 3V3KA 3KJNA 2XYHA 4QTYA 3ITNA 1GFWA 5LU9A 4HQ0A 4EJFA 4JB8A 4QUIA 2NN3C 2XZTA 4ZVQA 5I9TA 4NOKA 4D3XA 1RWWA 2C2OA 3SIPA 2J33A 5IAJA 1PYOA 4PRYA 2FP3A 2AR9A 5IBCA 1RWVA 1JXQA 1RHRA 2H48A 4IYRA 4NBLA 1RHKA 4DCOA 1RWPA 4DCPA 1NMSA 1SC1A 5H0IA 1SC3A 2QL9A 2H4YA 3E4CA 4QTXA 3H0EA 3NR2A 4EHNA 4N6OA 3D6MA 5LUAA 2HBQA 4ZVOA 4JJEA 5IC4A 4LSZA 1K86A 4JQZA 4N7JA 2XYGA 4NOLA 2H5IA 5IC6A 4D3YA 3R5JA 2CDRA 4ZVTA 4EHFA 3R7SA 3RJMA 3V4OA 4QU9A 2XZDA 1SHJA 1NW9B 3EDQA 3IBCA 4FDLA 3P4UA 3PCXA 1QDUA 3QNWA
chains in the Genus database with same CATH superfamily
2B35A 2R79A 1WHOA 4XPTH 1IXRC 4NJEA 1RHFA 4AL8H 1KWKA 4KV7A 3TWOA 3M17A 3QOXA 5HYJD 1JZ2A 4NCBA 2G2RB 3PA8A 3KJ4B 3ABZA 1T9CA 1E5YA 4ANWA 2QDVA 4D92A 4WDIA 1RY7B 5JNLA 5AQ1A 1EI9A 4MQ4A 4WZBB 4YHKH 2I67A 2P77A 3BZWA 1KELL 2E4FA 1N0HA 1IBDA 5C6PB 3SIRA 1ZONA 4UNIA 1MCJA 4IYJA 5SZIA 5D7NA 1PTZA 1JWSA 3L3OB 5DFWH 4GFDA 5AVQA 5E0QA 4FOTA 5JOQA 3V5KA 4Q9NA 3JVFC 2VDOB 2ITEA 1SVIA 5ILQA 5IMMA 2CHXA 4BMDA 5CDHA 1U31A 4HIHB 3B3JA 2UUOA 5I1KH 1U7UA 2G9QA 2FSSA 1ZGJA 3GLHA 2NLJB 1U8LA 3KJNA 1JZFA 5C2BL 5I76A 4B46A 4JFQA 1HHGB 3QUZC 2Q8BL 1N0LA 4S1QL 2XN2A 1ZE3H 5ECGC 2F43B 3JV4B 2XAUA 4B73A 3Q2NA 2CLRB 3KFXA 1E40A 4FFOA 1G5RA 4XUGB 2KB0A 1PD0A 2ID8A 4M1YA 3TIXB 2PXHA 1TJ4A 3VNQA 4C3OB 3PNWA 1QQTA 5I16B 3A0UA 3TAHA 4PBWD 4XMLH 2B9VA 1R33A 4C78A 3M7OA 5FEUA 4I1RA 2N7BA 3AILA 5FO7B 3G2NA 4WDQA 1YA5A 3OWHA 1K4DA 5DUBA 1KI2A 4PS0A 1NUDA 4ENVA 1R0BA 2P79A 2XSZD 4DLUA 4JZJC 3K6JA 3QCVH 3T99A 2KQNA 4JJ7A 3LK6A 3H8JA 4Q9QL 1E6EA 4AZ8B 3G5WA 3ZQUA 4V1DA 2WPDA 2D03L 2NNRA 1U0RA 1NCNA 3L4YA 3W9EB 2GAAA 1G87A 1OLUB 2P40A 1SXJC 3QUSA 1U9YA 4ZJUA 4WK4B 2Q86B 1MFAH 2XXAA 1NUQA 1PLGH 3BGSA 3CXDH 4P2BA 3AMLA 4PAWA 4K9OA 5GPRA 4LWOA 3ATBA 3IT8D 5JWRA 3LTEA 2ICAA 3HKCB 5A02A 1T91A 2CXQA 1MF7A 3SC3A 3LKRA 3FCCA 4J0IA 2CZQA 3GSWA 5A2FA 5A3VA 4KDCA 2DBYA 4XVHA 3BVNA 3PWVA 2CDEA 3CRVA 3DUFA 1T20A 4YECA 1MAHA 4E2WA 1J0YA 3WYFA 3AR5A 3GHBL 2QIOA 4C0SA 4K15A 2DQFA 2QY6A 1GCOA 3WWPA 2CO7B 4L5FE 2D1QA 2VK2A 4FFBA 2AI0L 4F4DA 5B3JC 3DMMB 5C5DA 4HZIA 5AXBA 1NR1A 3WXVH 1TENA 3ZDBA 4TSAH 4GB9A 4B0MB 5AWNL 5FB8B 3P11L 1EVEA 3H5WA 4UAUA 1WCBA 3WJMB 5BUPA 1JP5A 1JHDA 4JE0A 2WNHA 1XZPA 3DYIA 4GRLA 2VRAA 3OF3A 4MJLA 3QDMD 4UM7A 2O0HA 4RGVA 4C01A 1JSCA 4R6UA 1E5UI 1F4PA 1FVEA 3RB7A 3FLMA 2B4CH 4J0DA 3OSZA 4HCRH 4DOMA 4R9VA 1ZISA 1UEXC 4IKOA 2W38A 4H6PA 2Z65C 3BWYA 3WV4A 4W9LC 5EEZA 4TNVK 1U8KA 3UV6A 2CVZA 4DIBA 1TF5A 5JW3H 1D2MA 1Z45A 4RA9B 3UICA 1OGIA 3SDCC 3LP6A 1QVRA 4PV7A 1ZH8A 4Y9BA 4RIIA 3F12A 4MS4B 5B2ZA 4QODA 1OLXB 4WESB 2W88A 1XF5B 3DVGB 3TLZA 3D2UD 4QYAA 5D1QB 1DEHA 2AVDA 3NAAH 4LKCB 3L81A 4QKQA 4RM2A 1XZLA 1SF5A 3JV6A 5JQGB 1H3XA 1TCRB 3AS1A 1ECGA 1RWWA 2A67A 4COKA 5A4MS 2R0KH 3TBCA 3E6AA 2GK6A 2E27H 2CBOA 5EULV 3FNKA 2HAEA 3SHFA 3O82A 1RIFA 4DLVA 3NO4A 5CD3A 4FKBA 5HILA 3MZTA 4G9FB 3ZE7A 3I9V6 1MJ8L 3ANXA 2VIRA 2VXQH 4TKVB 3X1YA 3Q0TA 1RAMA 2QBYA 1CJSA 5K01A 4JRYE 3DPDA 4K2UL 2BFBA 2CGZA 3TM6A 4RF3A 2FQYA 4GT1A 5D4IA 1ZVKA 3OEED 1BXZA 4RMIA 2QRNA 3HFMH 3GG2A 4UUBA 4C4OA 1UZ6E 4I3SH 1NBYA 1LK0A 2QTVB 3G7TA 1OCZB 2R59A 4MXWH 4CQJA 3LTVA 3DC7A 1E2MA 3RQ3A 2H1RA 4BWUA 4NNPL 2WUBH 3HG2A 1GXSB 1KGCE 1QVVA 1XXHA 3ZJAA 3NALA 4Y4KD 5IUSA 3L7EA 3W0WD 3POCA 4Q3CA 5EOCL 1E9DA 4C7OB 2K4WA 1KL7A 1JDVA 2RJ3A 4Q3BA 3NCHA 5ARDA 1Q6ZA 3SKOA 1RXEA 3WLKX 2ADIB 1N0WA 1LPOA 4OIIH 5HPYB 5DYYA 2Y23A 4MK4A 1GVNB 4C2TA 2ZSHA 2ZULA 4AO6A 2AOUA 2HWZH 4C30A 3BDAA 4GMFA 4BAUA 4JP3A 4F1KA 3MXWL 1GR1A 2AMLA 3VWKD 2ZUXA 4TTIA 4KWCA 3ROOA 1BMZA 3DUSB 5J4LA 2WTPA 4UW9A 3SIWA 2I7OA 5BVHB 1D7FA 2X6BA 3U4BH 3DBHA 2ED6A 4CEIB 3QQ4A 1I9IH 4WFED 1TQ8A 3CT4A 3ESVF 4EZBA 2F08A 3UZVA 5DEIA 1JBJA 1R4ZA 1A6AB 3S68A 1ZAKA 3DE2X 2AEPL 4TROA 2J5QA 4PJ8A 4O2BA 4B7ZA 4HKXA 1I2MA 2BLNA 4X20B 1NVWQ 2OL4A 3TUJC 5EO9A 4J1TC 4RD4A 5AKIA 2GUGA 3ZT7A 2VT7A 4XJSA 3NDPA 1YMHA 4GKJB 1KYZA 3GI1A 3JZYA 2BKUA 5K3CA 3UAWA 4NENB 4UV7L 4O4HA 2JCCE 5F1OB 4HH1A 5FIUA 1OPRA 1N2HA 4Y1SA 1WO8A 3GPCA 4L23A 1AT1A 1PJTA 2P43B 1G84A 2I26N 4ZMBA 3LXXA 2B5IC 4KE9A 4F2HA 5E2BA 2EC9T 2R84A 5EHNA 3ZQ4A 5LXTA 3F5MA 2C4FT 5EU5A 1S89A 2XFXA 3KJ4C 3R6WA 4FE9A 4KO9A 1N6UA 1F6WA 2F54D 3SMVA 4MW1A 5FUVA 5GS0C 5CLJA 3EYQC 3JQBA 4QFBA 1BE8A 1IOWA 5GOTA 5JQIB 1SOAA 3KKZA 4XE0A 4B4UA 3FU5A 2QD1A 2PX6A 3DE7X 4QRRA 3K9BA 1Y6KR 3L3OC 3LEXA 1XZIA 1EBPA 2AD1A 3PNPA 3PEEA 3L01A 3FBKA 5E1DA 3RCBA 3TFQA 4J3OC 3G0BA 2RH9B 1V95A 4DPLA 4HYEA 3ND5A 2KBEA 3MCUA 1KI9A 4XP4L 4NOLA 3KWUA 1TTBA 3H3XA 3V4VH 4K94H 1XEXA 5BNTA 3MUGB 1JILA 2XWPA 3T06B 1T8UA 1TTGA 2CB9A 3FSRA 2RGBA 4Q7QA 2EEZA 1RLTA 2BNRE 3A1SA 4EUSA 1LO5A 1O96A 1XG5A 2H1PH 4B5EA 4KQ9A 2GILA 2XNSA 2XCMC 2BTQB 3P1VA 1IM3B 1E0KA 2QAGA 4DGSA 2HMTA 1WU7A 4OUOA 3PWPA 1JEEA 2FL5A 1NLBL 4RMGA 1U0JA 1A97A 3IFPB 4PLTA 3VFMB 3Q7QA 4RFVA 2PR4H 1GPWB 2NSXA 1MVOA 1CFBA 4DEYA 2CKBH 1AA9A 5E1OA 1B8VA 4LEOB 2CJUH 1CFQB 5KVMC 3VR4H 4C4KT 1CUXA 4XN2A 3QRWA 1KKMA 2BISA 5C1MB 3T52A 3KYOA 1R2QA 2G1PA 4V0MA 1RXCA 3RVWD 1M7DA 3PYXA 4E0BA 5HHME 5EORH 1GV1A 5EZJA 5TE7L 2G4EA 1F90L 1PV4A 1FNMA 5CX1A 4U4AA 3L4JA 1G1OA 3S35L 4EB3A 3ZL1A 3NHYA 4PWZA 1SG9A 4B6OA 5I0DA 2DBJA 4ELMF 4JIGA 4TWRA 4B43A 1A0QL 1UZ8A 1TPYA 5SWQB 3EZNA 3HDJA 2ZQKA 3UO1L 1MCWW 2X9XA 3K4PA 1NBEA 3MMEA 4ZUSA 1A1NB 2D5CA 1SOUA 4FI3F 4PG7A 3T1TA 2YD7A 4HHGA 4CN4A 3LMKA 2X2UA 3INNA 3N1UA 3AUVA 4BZ1H 1K89A 5I7AA 5HPOA 1KMHB 5E6SA 4GYBA 4UT7L 4QDGA 3EXG1 4J3BA 3WISA 2PWFA 3GZTB 5ISMA 1C8LA 3LUCA 2EX4A 1OAZH 1QAWA 2FRGP 5FPSA 3VHXA 3ARYA 1Y9EA 4I1SA 2YS4A 1QFUH 3PQDA 1HE1C 4RHTA 3G6JF 4TTSA 3BK7A 2IDQA 1IAKB 3KZVA 3VQTA 3TJEH 3U62A 4O4JA 3WELA 1OE2A 3QXSA 2OV0A 2DEXX 3FQTB 3NJHA 5EBLB 5B4MD 1CZNA 4I4WA 3DMMC 25C8L 3PQ3A 1H2BA 1J0DA 4DMGA 5HF6A 3HLAA 4E2YA 1W6UA 3V48A 4RQQA 4BJ3A 2X89A 3BKXA 1UP7A 1U8FO 3W2DL 2PX0A 4OFIA 2AZDA 4FN0A 4N25A 3EE6A 4U33A 1SBYA 4JKMA 1HEYA 2AK1L 5AG8A 1R8QA 3FPHA 2ADFA 4KKRA 3G5UA 5H3HA 2P3OA 2VZLA 2AQNA 4HGZA 3EZ9A 4P5EA 3M9LA 2J4WH 4QXMA 1FDSA 4OLXL 4AIIA 2C61A 2H2WA 4M54A 3RHWF 1Z18A 1DVYA 2OCDA 2HQOA 4I8IA 4DARA 3QXUA 1DAPA 2F19H 5AAMA 3RU8L 3PR2B 3LMJL 1NBMD 4JT9A 3MGAA 4AQZA 3FQ2A 4NRYA 1Y1TA 3DO5A 2R1UA 4ZK2A 3WHPA 1F00I 4PJGA 4ZFNA 4CW1A 4WFFE 4H40A 5D1QC 3MWEB 5ENDA 3FBTA 3UGJA 3QULA 1YUHA 4BQNA 1DEXA 4CKXA 4IMRA 1IVNA 3CO0S 3E22A 1WUYA 3HNTH 2PMBA 1XBDA 1HE4A 2VDWB 3WN5B 1FFOB 4NBKA 2W1NA 5JZSA 4EDXA 1TEHA 2IXTA 1Z6GA 2IDFA 4L9DA 3TIDB 4TMXA 3ZH2A 5C71A 4P49A 2IDZA 1T10A 3ITEA 5IQMA 3QCTL 4Z49A 4NZTH 1VPDA 4IBWA 1V8DA 4JQIH 3TIGA 1F17A 2WSDA 1L7DA 3KJHA 1OAQL 3GIZH 2V5AA 1BECA 3I72A 4JWKA 4YCNA 3BA1A 3N50A 4XCEB 4EG3A 2XUJA 3HKDB 4PS1A 2B7LA 4Y6RA 3UAZA 3T5MA 3VI4A 3ZV3A 4PJFE 3EPHA 5JJCA 2V9QA 2X09A 3OKLA 4HIXH 2EFDB 2HG0A 1OUMA 2JB6A 2VN6A 3ZWAA 3X3GL 2AZ4A 2CSPA 4C3UA 1L0QA 3L02A 1BIFA 4TKMA 4QQNA 4ZUUB 4K3HA 3IFNH 4J3UA 1IVTA 3HM2A 3CN9A 1X8XA 3B3AA 3QELB 2OJEA 4OI0A 1K7FB 4MYUA 4OXNA 1RQ5A 4Q1DA 1M6EX 3QPAA 4YASA 2IS6A 3OJMB 3HJTA 4MYWB 1ZUD1 2I4MA 3KNBA 2EADA 1PZEA 3LY7A 3GFPA 3W06A 3CRMA 2BEKA 5CVJA 1L7IL 5JLJA 3F9IA 4ANKA 3D1JA 2FX9H 3V4UH 3S5LB 1L3NA 5JMOC 2FDRA 2UZIH 3T3MB 3P2MA 4M5ZL 3UK2A 3N2KB 5LQNA 1X9HA 2X4QB 2H0AA 4GOND 5EZLA 5JIKA 3MUOA 4INOA 4BH7B 1Z13A 1KKLA 4QKXB 1AKWA 4GG8A 3TBWB 4R2MA 3IIIA 4EVIA 4NO0B 1E60A 3C3XA 4K6KA 4V0OA 1P69B 3BXXA 4DJAA 4DNLA 3T3PB 1WEJH 1UFQA 3R7QA 3OIFA 4YR6A 4XRRA 1NIDA 3AXIA 5BSWA 1WQ1R 3KAQA 1S7SA 4RX4D 2W6JD 3Q6IA 1GTJ1 5E4JA 4XGZB 1I9RH 3NJIA 1FORH 5AZEH 3OJDA 5L95A 1RYZA 3MBXL 1PGQA 5JCXA 3C5XA 4K7PL 1RKRA 2P5EE 3N2LA 1VJDA 2HOQA 3CHXA 3GKWL 1IQ0A 4X85A 2ZRQA 2EH7H 1WBBA 2XQBL 4DDKA 4PJDB 4P84A 1MHEB 4JI0B 3TT1H 4A8JB 2DMKA 1MCKA 4OQTA 4UBNA 5DM1A 4HGMA 2JQMA 2HB0A 5D1HA 4R1TA 2E5WA 1DEKA 1JV2A 5HDBE 4CT5A 1J8HD 4RLFA 3LY8A 3O6LL 2WM9B 1FJ1A 1JPSL 2OFOA 1OH5A 3IMRA 3QEBZ 4KHXH 2W6IA 2JI1A 4C07A 1Q50A 1J09A 1ESDA 3QQ3B 4NUGH 3RFUA 1RYFA 4GHWA 2GJAA 1AMYA 4HMDA 2ZIXB 3LWZA 1TGYA 2VF8A 1GV0A 1MX3A 5M3BA 2IYXA 1TPXB 4RZHA 2QPSA 2XDHA 3CX5J 1N26A 3T6VA 5KCMA 5JNYB 3KZCA 3NOIA 2FFQA 2YMPA 2ZAMA 3KD4A 1U11A 2H06A 4YV2A 2YZ2A 1O95A 1IKNC 3KW7A 1YQUA 1L4HA 1POWA 3G0HA 3ADBA 2P80D 4EQZA 1RTKA 1NVVQ 2WKGA 4L5CA 5JH7A 2H0QA 1MCRA 3IGUA 2HW8A 1R50A 1E0DA 4J7RA 3U7QB 3E3OA 3QOFA 2GZ3A 1ADWA 2AQ1A 3IRVA 1IBLB 3O8XD 1G9NL 4OZGA 3KYMB 1U7TA 2P75A 1WE2A 1I3OA 3LUBA 4KR0A 4L3CA 4AJHA 2YZNA 1RHQA 1DCLA 1JIIA 4HISA 4FQXB 3H1PA 2ZXWB 1QABA 2VHZA 2DWEA 5DZLA 3TRKA 3LD9A 2JVKA 1GFZA 1IBCA 2ZQZA 2C1EA 4DIEA 5IVXE 1E9QA 4O1MA 4U3SB 1MWAB 3SLKA 4QXQA 3RI5K 4EN2A 3SJUA 2I5YH 3WS6C 3EOBA 2XJKA 1S9XB 3GQBA 4X8XA 4DA6A 2G4CA 2Q46A 2A6IA 1EXHA 5IB2B 1MR3F 4U2FA 4MUNA 4YRTA 2O3TA 4ZVKA 2C8JA 2QYOA 4Q9LA 2CFSA 5T33H 1O6VA 4XNDA 1BVHA 5DT1H 4IBOA 4XYEA 1QU2A 3MBEA 4OZHB 3BBLA 3Q7PA 2VRCD 4BC1A 4I0KA 1I7TB 1OT5A 2FW7A 3DHVA 3HZKA 1OVGA 1CUDA 1UL1X 3AUJB 3CX2A 5IKMA 3U60B 2GN8A 4IDHA 3GAMA 2C98A 4EFDA 3L6CA 5B58T 1HSAB 4IHAA 5KBLA 1GPJA 4DLSA 2OSBA 2EVJA 3FZEA 5TR9A 4ER6A 1WLYA 4J90A 1N2XA 1Z0FA 1V4NA 4G25A 2A58A 3FUHA 2OPHA 5DM0A 1E2FA 3MRCA 3K2BA 4GBJA 1KLGB 1JL8A 3P9LB 5FGCE 5IEHB 4ITUA 1Q9LB 2IQ9H 3EF3A 4YR9A 2CLOB 2ZI3A 3EZ6A 1M2HA 1JPFA 3NJNA 3HQ4O 3Q5EA 4LJ4A 4PRHA 3I37X 4K4KA 1NF8A 4I7EA 2VDKL 2OZKA 2Q27A 4KLZA 2R8ZA 3D6FA 5I1JL 3V8NA 1KOFA 4R7NA 1TLLA 1L8AA 4HIQA 1CJBA 3BK1A 2ZSFA 3WK9A 3ZE1B 3FQUB 2E8YA 4ZS6C 4ZANA 5EOTA 5IW8A 4GKBA 3OR6A 5D5MF 2Y68A 1DCFA 4PJAF 1Q1GA 1WW2A 4JYPA 3NJRA 4MGXA 4I4TA 3W79A 1YFJA 3M6WA 1XFPA 5IHZA 4OG2A 3W6ZA 1A4CA 3SZGA 4EHIA 3RAJL 2L4OA 4FYQA 2I24N 4LBEA 4I13B 4R84A 2W65B 1N2IA 2CDRA 5FECB 3RWHB 4MHSA 2G1UA 4GKSB 3HBLA 4EK9A 1KGUA 2IH8A 3SGEH 3A11A 4L73A 4BZQA 4Q7DA 2V3VA 1ONPA 2FB4H 3K9HA 1BD2E 4YBHA 2HSWA 3WAKA 5DZNA 4KVCL 1P2FA 4R31A 1RLOA 4V0QA 3HAEB 3QDGE 3GMSA 3HY3A 4P4KA 3C3AA 2H1SA 2A9NL 1P5JA 2Z98A 4ZIRB 1UXMA 3ZGXA 5I1IL 5I9IA 5L8VA 4H77A 4TSCL 1OAKH 1YEDB 3O2WL 5AVWA 5AIAA 1AGEA 5KSBF 3HEBA 4FYVA 5DTQA 3WKMH 1PIGA 4NZNA 2Y4OA 1GYAA 5JMWA 1H69A 2EG9A 4FLHA 1V16B 1RIHH 1ENOA 1VGEL 1CD1A 4TM9A 1GYCA 3WN5C 2FPWA 4E42B 3EDDA 4R2XA 4FGWA 1KY5A 4RCYA 3FSGD 5GGTA 4R5TA 2VQ1B 1XVUA 4NDZA 1EEYA 1V9SA 3L9WA 1BSIA 4MXQD 3NTCH 2O57A 2ESVD 3EFOB 4P3WA 1INLA 2PYFA 2WF9A 2GPBA 3IXTB 3K9CA 5CILH 1PL3A 4MA4A 3RWEB 1ONNA 1N70A 3MRPA 1TRKA 3RWFB 5HE8A 1KCSL 1E63A 1PKQB 3VRLF 4QRIA 1RZ8A 4AVYA 2QTZA 3L6OO 1UENA 3AU0A 4X99B 1I10A 4RAHA 1PG7L 3L5HA 3GSRB 5IQOA 2QRPA 4BNDB 3DIVA 4G9BA 4QRPB 1A3LH 1V48A 4WKZB 4XEUA 3MFYA 3R7AA 1CC3A 3X2EA 1PVHA 3MUY1 3BO8A 2YWDA 1OI7A 4J9UE 4XC3H 2HREA 4CLDA 3UBXA 4BXSV 3ZU8A 1P1FA 3BVXA 1TTCA 1W87A 1O6FA 3QNMA 4DJ5X 1ONOA 4H26B 3M9WA 3L2NA 3PGDB 3RJTA 3AKZA 4ATTA 1JZHA 4FOOA 3EJTA 3ESXA 3MLXL 3QWRA 4GS5A 2HJ9A 4KAQL 3ZL4L 1UMDB 1QZ1A 2VJAA 2ZVJA 3MTBA 2XB8A 4JM2B 1P2SA 3CDZA 3NNDA 4GE0A 1NCBH 1SHMA 1IBHA 1OYOA 1YR7A 3RS3A 3PSAA 3TAXA 3RSLA 3WYBA 3L5WA 2HRBA 3NVAA 2IDMA 3KL3A 1VF5C 2HLAA 4DQ0A 4JVSB 3V7FA 4QUEA 3GI8H 5A7GA 5J1AB 2C4UA 4IOMA 4P5DA 5LNK1 1I1OA 3H7LA 3BHIA 2LIVA 1HZHL 1ZS2A 2EP6A 3Q5DA 3IKTA 5AWFC 4ZS7H 4FMCF 2QV7A 1P5ZB 2HA2A 4YXHL 4CLOA 2QUHA 4YDVB 1F3LA 4XWKA 1AS2A 3TS8A 5A2BA 3FONB 3X1WA 5CLQA 4EPRA 1ZOOA 1JZ6A 3DR3A 3Q8EA 2A9CA 3VU2A 2C7QA 3BI9X 1PN3A 1MCBA 1DJOA 3QDJD 3CZMA 4ND3A 4X5XB 4OCSL 4A8JC 3BE8A 1S3KL 3JYLA 3FB7A 3ESNA 1GU7A 3QTTA 5IY5B 1CGWA 3QB7C 4DCGA 5JU6A 4NLLA 3DEIA 2CNKA 2CVQA 4MQ7B 1Q95A 2H6PA 1G9MH 4Z53A 3R0NA 3WQQA 4O33A 2H32A 4AQEB 1B9ZA 1II9A 1TUBB 2VHUA 3FDZB 2GBIA 1GQ2A 2FPIA 3S37X 1TPXC 1ZKAA 3Q0HA 2PV0A 4JB9L 4RZQA 4M48H 2FR4B 2D2CC 3PWZA 2IU3A 4R8WL 3HB3D 2OSWA 2G0KA 4LARL 5I8KH 2A9OA 1GDDA 2IP2A 1L7AA 2WG0A 3TE6A 3HI1A 2YAHA 3H04A 1XDBA 1JEQB 3RAPR 1T7YA 2NW6A 5F72S 3FFDB 4ZD3H 2OBXA 4U2BA 4K9JA 3ROLB 1NKOA 3KZXA 1JI2A 3ASVA 1XMJA 5J6GA 3ARZA 3FOMA 4Q4EA 3EARA 1QA9B 4M56A 2GMWA 3UYRH 3V4RA 5TFSH 1JHLL 2EECA 5IJCC 4XUDA 4B6EA 4EJSB 5DQJB 1UOPA 4BWGA 3B2EA 1NZJA 2JAHA 4Z5XA 1JQLB 4FQXC 2OXHA 5SY4A 4GAEA 5I8WA 4RNRA 3AR7A 2Y1DA 4YDQA 1OL0A 2W8BA 4RSMA 5FEBA 4D9MA 3QPUA 3V0FA 1SZJG 1MIOA 3PC4A 3QNZA 3RVKA 5DM60 5AW9A 4D3YA 4LCWB 4MBOA 5CU7A 3ESUF 3G6AB 1CDGA 4Y6SA 3KXDA 3ZDXE 3IXLA 3LW8A 1JHPA 1XH3B 5GJTH 3REVB 3MLYH 1PHRA 3D0QA 1AKRA 2I6FA 5DUPH 1XZQA 4AKIA 4IRJD 2XI9A 5DPMA 3L1OH 5BV0A 3EJZD 4YSCA 4YVNA 4NPYB 1DVQA 2H54A 4Z1PA 5D72H 2CZCA 4KXVA 7AT1A 2XQJA 3TWYA 1G98A 5H2BB 2WOYA 4P8RA 5FYKH 2PPDA 3O8CA 1AQ8A 5KOHA 2QROA 3VPSA 5K8TA 4XFKA 2VUYA 1G43A 2H1LM 5E2UL 2Y0BA 1K4CB 2L7JA 4DA7A 4TNEA 1UJ3A 1UD6A 2C9RA 4WA8A 3ROXA 4CEJA 3M6DA 1F1AA 3FTGA 5ERGB 3EIFA 1ZC4A 4H1LB 4JASB 3UTZB 4B8YA 2WDZA 4FSXA 4K1XA 3VR3D 5EQJB 2HU7A 4J2QA 1FYDA 5DXAA 3GSOB 3KBEA 5LGHH 4AQOA 4MUYA 2DIAA 3CEPB 4HADA 2BGUA 4X92A 2HCTA 2VLRA 2QEQA 5GHWH 5I8CA 4FFDA 4X4YB 2Y2UA 2Z4QB 1XB8A 3B83A 2EFEB 3LHPL 5F7MC 2O5CA 1JKIA 2VSFA 2OGWA 3THYB 4HETA 2P2GA 3LXAA 3WB9A 1E58A 3A05A 2J8UB 4JLSA 2XSKA 4RCVA 5ALBH 1HMPA 5DD3L 4C7MA 3W7VA 5JZ9A 1MHCB 2J8HA 5EE1A 4LDQA 1ZUHA 3EWIA 4O5LL 4R97B 2O8FB 1ITBB 3PS6A 3WYCA 1XO1A 3JATB 3H16A 3RHZA 3BFKA 1I7SB 1HKLH 3K5WA 5DRZB 3Q9UA 1NR5A 1GRRA 4XCFH 3DV6A 4MMXB 2W8ZA 3BIWA 2YJ5A 2BELA 3BZDA 1BLNA 3V8BA 3RIGA 4JFUA 1EFXB 4F20A 2GNAA 3WEAA 2H52A 4EARA 1J8MF 3CFDA 5IESL 2P9QA 4YBQD 4D4GA 1K4MA 4LYJA 4OQQA 1XSIA 3IEIA 2XPGB 2GXQA 2CNZA 2HLDD 4MJIE 1JFFA 1F4YL 3QHFL 3T1HB 5JOFA 3WDIA 3RS5A 2CWRA 4DP5X 3QE5A 5F0LB 4KBPA 3IPFA 5I8OH 4H27A 2JW5A 4FFMA 2BHLA 3SPHA 3NH6A 1M57B 4G2AA 2NUPA 3UWPA 4BA0A 1OA0A 3RIXA 1TQHA 4ZX4A 3CLFL 3DBXA 4YO0A 2FQEA 5L4FA 5COQA 2FQDA 3QIWA 4HYYA 4IJ5A 4MV7A 3H18A 4HGWA 4QY8B 1X2BA 4PD4J 1RWQA 3SB3A 3ZCSA 2ENUA 3FNRA 4OUKX 2H7XA 1SD1A 2JI3A 5C8JA 2J5XA 3AVEA 4FC3E 1UT9A 2H08A 5B6IA 4EI0A 1DE0A 3KKNA 2BMKB 5I1AA 2R27A 3C5ZA 4ZT5A 1F1BA 3IMVA 4GQ9H 3DRTB 5FLYA 3RA7H 2OHFA 3KM0A 5BXFA 2OD9A 2EUVA 3AR9A 1TB4A 2XKJE 4KHPB 4ZOBA 3RVJA 4U2GA 4DLLA 2PFKA 2J32A 3PJSB 1GDTA 1U2QA 2F8TA 2G6TA 1TZOA 3L7FB 2G0NA 4M4RB 2KQUA 4TVSa 5E2TL 3IR5A 4H9GA 3REOA 5MN6A 3O8NA 1DYZA 3RRXA 1XVIA 5EMLA 1CCZA 3ZDYE 2XT0A 3G7UA 1Z32X 4LEEA 4RANA 4MB1A 1FC1A 5D7SH 4HH8A 1YL7A 43CAB 3CLTC 1NTRA 1A1OB 3PXHA 4X6EB 2FN8A 1B9KA 3CE9A 1Z9PA 1E2ZA 2AQ8A 3BWSA 4P8QA 3ULVD 5AK0A 1NDMA 1M1NB 3D8RA 2AUMA 1ZAGA 2GYVA 4HUWB 2AN1A 2CVOA 3DD5A 3GHHA 5MEOB 1P45A 1UM4L 2VK8A 2YXNA 3GFSA 4OOFA 4FS8A 3MTQA 2C9PA 3B7YA 2A5JA 1TQDA 4XAWL 2QTMA 3L7OA 3L3JB 5EMNA 3WJ2A 2XLLA 4JM2C 2JGKA 5EN2A 3BJRA 3UJ7A 3K0BA 2APFA 3I9GL 1DAOA 2Q4DA 4EG0A 1UKVY 3T4EA 1S4MA 4KH1A 1KFGA 3C1AA 2AZUA 4I1NB 3RL1A 3ALXA 2CGYA 3LQYA 4LFCB 5ELLA 4JV5B 1KB3A 1RZRA 5IKCA 1WKVA 1ADBA 1EAQA 3NGXA 4GKOA 2ZRHA 1OHHD 4JC0A 3KPSB 4JFXA 4IPTA 4D4KA 5C0BB 4MW2A 4UHHA 5DP1A 1A2BA 4I6EA 1C3OA 3ZVNA 2XGGA 1HFJA 1W4AA 1OWRM 3BHNA 1ZJ5A 2ZRMA 1QGYA 1TYBE 2F6RA 4QWWC 3UC0L 3C6QA 3WICA 3FQWA 3JX9A 3CLSD 5IB4A 1JPNA 4BH8A 4CODB 5L9DL 3MIZA 1L5QA 1K7XB 3WYAA 2PEZA 1DBJH 3CW2A 1Z5LA 4PV8B 2C3UA 5C0RL 1ERNA 3BKCH 5DF0A 1FYTD 1N5IA 2FUG6 4NK4A 1QVOA 1DRKA 4KGXA 2Q6TA 1KN2H 1XGPA 4JLAA 4EBQH 1V5JA 4MLIA 2H65A 1FCJA 3K81A 4C56A 2V6GA 3PP8A 1J7KA 3PE4A 3WLHA 1EJ0A 3LX5A 5ILTH 1N6QH 4WW2B 1TO6A 1QTIA 1DBSA 3V8MA 3QA3A 5KNCA 3QQDB 5DK2B 4LOUC 3JAMA 2WE8A 4Y2TA 4F27A 1DBAH 2R83A 4TV8A 1GAWA 4GS7B 3ZUNC 3I1JA 5EUOB 3WEMA 1JA1A 5I15H 3KXFB 3BMNB 1CTOA 4BK8A 5D7KE 3VXMB 5LNDA 1NFFA 3G49A 2YUIA 5A0FA 3BMCA 2PUVA 2CXNA 2JI6A 3QC5X 4EJSC 2OCGA 4BO8A 1CE6A 1YPZE 4PVBA 4IBSA 1IGTA 4IIQB 2EFHB 3QZOA 4KZDH 4YCAA 4MV5A 4CXMA 3ZI0A 2RI1A 5INDB 4R96A 2XG5B 4G1EB 2FEOA 1DQJB 2I07B 3IEXA 3RZWA 3LFTA 5KYUA 1V0JA 3HJBA 1SVCP 1LX6A 4K8RH 4PW4A 1NDUA 3L0YA 3QZWB 3LCYA 2XIBA 4K0RA 1VE9A 5IMKA 4M7ZB 5HZGA 2X4RB 3CKKA 1IXSB 1A95A 3ENEA 1EBFA 3K4ZA 3KG5A 1A9BA 3M6XA 3PFBA 4PSDA 4QGHA 5EE0A 3H42L 3RC9A 1CG6A 3RL2B 4P83A 5FOQA 2O2XA 2VQ3A 5LLIC 1T8RA 4XNYL 3LDUA 3M4ZA 1AP2B 5FA3A 4NS4A 3TXXA 1QE3A 4YTEA 4S11A 2IVFC 3WR5A 4EFLA 2F5AH 1R8XA 3F73A 4L6CA 2C5HA 1C8VB 2VSQA 4PYRA 1LC3A 1NQVA 3RWGB 3ZCVA 1ITZA 4W9MC 1FNSL 1CUSA 2DWDA 1CG9A 4CMBA 1PJ8A 1JGIA 1LS1A 3A6PC 2IADB 1MG5A 2AX4A 1KTLB 2DULA 2OCLA 4ZMSA 3Q8KA 4ZTPL 4Z23A 2WYHA 3OSUA 5BVGB 4MAMA 1EFVA 3PP3H 5JHMA 4N2OA 4M9SA 5IQNA 2P5WB 2LE0A 1G5AA 1V7ML 4DVBB 3QG7H 5B38B 4MW0A 1MZPA 3SP1A 2IY7A 2WJ3A 4NO5B 3DZKA 1P84J 1FBIH 4ALAH 4N8UA 4EM6A 5EEYA 4JC8A 4D9CA 2TRSB 1FMFA 2SECE 2A1WH 2H5LA 4Q7MB 4J2TA 2HFGL 1EB9A 1L3CA 3HYSA 3M46A 1DSYA 4XOBA 1ORSA 3EJYC 3FNEA 3MOAH 2C9UA 4R97C 2G9HA 1FRQA 3AGPA 1MJUL 1BYIA 4HZGA 1FP1D 3EVCA 3HXPA 4NCHA 2FJPA 3V7YA 3D1VA 3VNAA 3RC7A 2Y3AA 3EG9A 4EKNB 5I9QB 1NG1A 4MMXC 5JXED 2H3EA 1YA6A 5J12B 4LXGA 4FDMA 3UHPA 4GQAA 3UFBA 3A6CL 4JU9A 3W5HA 1IB5A 2H0FA 3V2IA 5CEZH 4DMRA 3OMAB 1OCEA 5E1HB 2LVCA 2IHYA 4J3VA 1A6ZA 1G7CA 5CT9A 5CO1A 2BFEA 4XPHH 2W98A 3BD8A 3RVLA 4K73A 4K6OA 3FB1A 4HEJA 3JVUA 1SBQA 2C78A 4O2LA 5A6SA 4KK5C 2BEUB 4F9PA 1MQ8A 3PPYA 3OPUA 1WXXA 3FU7A 2E1RA 4ESKA 1W0YT 3MGTB 1U8AA 4OQMA 3SGEI 2XNKA 2B21A 4IF6A 4B3EA 4AP5A 2MSWA 2GBLA 5LZ8A 2VC2H 1FVDB 3ATDA 1KP9A 3MV8A 2ZX6A 1VL2A 3DCIA 4ODTH 4ZMVA 4G5ZH 4S0ZA 2HH0H 4R3SB 3ARBA 3VDAA 3HG7A 4BSJA 1VFNA 3IPLA 3PQFA 1R15A 4ILKA 1A02N 4YCJA 4MS1A 3H0CA 3FW1A 2V7QD 4M1DH 3BRCA 5JC1A 3GGSA 2A77L 4PS7A 4V0NA 2BOCA 3B85A 5I7UA 3FUWA 4Q6KA 3NP7A 4WO4A 5EJEA 3FBWA 4JY5H 1JHQA 2CLIB 5JSKA 1M9NA 1RSZA 3DECA 3WGUB 4XX1G 1JEDA 2OBFA 3OTWA 4JPQA 3H2YA 2UZ3A 4LCIL 2G0LA 4YRKA 621PA 4LZZA 5HGDB 3HB0A 2YWFA 1P6QA 4I9GA 3FRJA 5IJAA 5A3JA 2FHSA 1C1EL 4QQ8A 2MDTA 2GD6A 4QNRA 1NOJA 3COOA 1TVKB 4Q21A 4CLHA 3H1FA 3DO7B 4MDRA 3V0DA 1UJ2A 4L4RA 3JZIA 3UJ6A 5T1JA 5CDSA 1JR3D 4WI9A 3CDGB 1HZZC 5CEYA 4HPXB 4V3CA 3DVNA 4J8RB 2G60L 2EH8H 5JHHB 1PHPA 3UJTL 4RIFA 4TGLA 2GCOB 2NT1A 1ORHA 1J0JA 1HGXA 2AFIA 1JN0A 5HDQL 8CGTA 3ARDB 1QBKC 3T3HA 5BUQA 4DDWA 3CH7A 4U1GB 4XPIB 4JFEA 5DEJA 2XYGA 3NONA 1EJFA 5ALLA 1TCCA 4XD7A 4GQZA 4HMPA 1R88A 5HTKA 1WUTA 4G5GA 3I6IA 5ULLA 4U6TA 3NANA 2EE0A 4F7TB 4D3CH 5FBHA 1Q0HA 3GFUA 2YW9A 3DLTA 5C08A 1S5IH 4S1PA 2A1UB 5FPQA 4IK6A 2C9OA 4EMTA 2NZ9C 3E0GA 3PGFH 4X7PA 4F9GA 1ZWIB 3KW8A 2W7TA 2WG1A 4B81A 3QVJA 1W8DA 3DCNA 1DCEA 1YNTB 4E41D 1N6OA 4APQD 1QJ4A 4DV2B 2AXWA 2JVUA 1XTMA 5DRXA 1UADA 1EH9A 5DVLA 1BW9B 2ORED 3QVSA 4DLZA 5BMVF 4TLAA 1EA9C 2QTFA 1ATIA 3QWOA 3E5RA 5LCVA 2Y6VA 1B88A 3RC8A 2PUWA 3VUFA 1WBDA 4E1BA 3GK8H 2FH6A 4GAGL 4U7TB 2GEFA 1P2BA 3ICEA 1NC4B 3DOHA 4D2NA 3ITNA 3W11D 1CK0H 2Z7UA 3T2OA 3ZKND 1RHHB 4PWJA 4J2XA 2XW6A 5IW6A 1MW3A 2P5SA 2LVEA 4M6WB 1EWQA 5B53A 1A5TA 5IBCA 3U1VA 3X13A 1WULS 4DGYH 3CVJA 4DLWA 1R3KB 4LLVA 1VERA 5E6IB 1U91B 2QSCH 1C30B 4XRCB 2I4OA 1KJIA 3Q7JA 3ILQD 3RG1C 2X05A 5DEGA 5LBIA 2J59A 3VXTA 3D1MC 2GRUA 3OKFA 1HKHA 2HV9A 3YASA 3GVXA 1T34A 5HDOA 1GU0A 2Q3MA 3RANA 2AEEA 3WGHA 3TV3H 4EWLA 4MYPA 4MKGA 4WW2C 3ISYA 4OY9A 3S98A 4WKOA 2UU9B 1D5MA 4HRAA 2ADFL 1ZW6A 3WC4A 2ZT8A 3QE9Y 3ETGA 4DWHA 4I18B 4GS7C 3G0DA 3JQDA 4CR7A 2V0AA 1XB6A 3HZOA 3OUUA 2ZPTX 5EIAA 1UPUA 4RJLA 2DWPA 4QF1A 2VF7A 1QK4A 3KDMA 3K71B 1DTSA 2FWPA 3R5KA 4KY1L 4HGRA 5F3DA 1XVTA 3L4XA 1X7YB 3B3FA 4IIQC 3MRBB 1L1RA 4JLBA 4QBIA 1O9ZA 4Z7VB 3NACL 4OF6A 1MHPA 1VFPA 2O3QA 1RUPL 4XOCA 3JZDA 3ZTNH 4HQQH 4PGJA 1J9EA 1TCBA 3HL0A 1KIRB 1KDJA 1JLHA 5ER6A 2OESA 5CIPA 3LK7A 4UMFA 4E6EA 3C14C 3RUPA 1X1TA 3R6LA 1HNZB 4XBGA 2Z1NA 5KMGB 3VR5H 1RJ9A 4WXRA 4M7ZC 5ALCH 4F37K 3DVSX 4M9UA 3P8ZA 4LLDB 3L3IA 3HI5L 4W7HA 3S5UA 1Q83A 4QBGB 4L8VA 3IQIX 4NCDA 1UXJA 2L0XA 2BUAA 1LLAA 1YB7A 2J7LA 1AH1A 1BG9A 1QR6A 2R8OA 4U7KA 3UG4A 3BG5A 1EJ2A 4FMPA 1CQJA 1MFNA 4QREA 2PH1A 3CZJA 3QG6A 2GVYA 5K9JH 4BFUA 4G72B 2ZR7A 5KHLB 1JB9A 3TLJA 1A2KC 2DBLL 4OO3A 1D5XA 4FFPA 3UBGA 1HL8A 1PFOA 2Q8AL 3EXHA 1WWKA 4M3JA 4IOFC 4TXJA 1CFNB 3HE6A 2FX7L 1RLBA 2QADC 3HUJF 4DIMA 3UUFA 3HJCA 4FOPA 4POZD 3FRPG 2ODWA 5IF9A 2VR1A 1NGXB 3I39X 5AK3A 1SZPA 3ZTWA 4PAMA 2QQNL 4HF5L 2E4ZA 1YK1A 5C35A 4PAQA 3M8OL 1DVFA 3QNYB 1IM2A 2L17A 4F1WA 3O3EA 2ID9A 3L4SO 5KJ4A 4PIVA 2AV1B 4GSXA 4ASUA 2R7NA 2HMID 5J89A 5EZYB 3X44A 4F9LC 3U9UB 15C8L 2YQBA 4HHAB 1E5QA 3WRYC 4NYLB 5JS6A 2IHBA 1S9VB 3N3AC 2GJZB 3C7CB 1KEPA 4QJ3B 1ORQA 2OL3A 3AB0B 4LJ5A 3V0EA 1RJYA 3USCS 3C8HA 2JLPA 4FQHB 1ZXXA 4M9ZA 2PGJA 3SDBA 4F84A 3AG3B 4JXJA 3EIUA 1WVGA 4ZUWB 4DN3L 1P0MA 2C5BA 4GKNA 1DSSG 2VXTL 1LBQA 4ZFFB 2D0DA 2GF9A 2WAYA 1UWLA 4D46A 3EA5A 5I9QC 3LY5A 1NIBA 3TCXA 3CU7A 2ALJA 5J12C 1WUKS 4CI0B 3TH5A 1JNLH 4AXBA 1DP0A 5D6OA 2LOEA 4KPEC 4JR9H 4XOAA 4OLUH 4HP8A 4FHEA 2BFAA 3N87A 1IQWH 1IZ7A 3QP9A 3SDXA 3IS3A 4PJIE 4GZ5A 3GRAA 3RTQD 5ID1A 1U1GA 2FPKA 1H3WM 1HCYA 3BM5A 4JVLA 3K6SA 2NU9A 1TUGA 4LDEB 1YB1A 3AIKA 3VH4A 4HB2A 3G2MA 3ERCA 3KV3O 4YT8A 1U80A 4PS4H 5AJXA 4KHTL 3ZY4A 3VKWA 1XAJA 5DN6A 4W9NA 1KB9K 5EOQL 2CXHA 4Z3FA 1AJ7H 4HUJA 4CL3A 3TJZA 3VGHA 2PD4A 4J03A 4JUSA 5CN3A 4ZMZA 1K1EA 3EDYA 3DF9A 4M8VA 5EC1A 2P4EA 4OFYA 5HVWA 3O41B 4UAVA 4U1HA 2I8LA 1HEZA 2ZDHA 2RHTA 1M2VB 3CJQA 4LOKA 5F1NA 2OQVA 3QY0A 4S3MA 4XMVA 1M2GA 1DC6A 3MPCA 3NCTA 5L7TA 4U1NB 2PETA 3CPHA 2NY6D 1KPRB 3FZNA 4Q37A 4DSUA 5KOJA 1RIIA 2VMFA 5CGYD 2FFRA 2PXCA 2P11A 5E8JA 1DPGA 4FYIA 3WL5A 3RKSA 3OKDA 4Z7WB 1B26A 4X80L 4XBPA 1TM3E 4LRNH 3D2BA 5IVZB 4FLSA 4X7RA 2VUHB 2F8SA 3NBZC 1SQGA 3GARA 4CMEC 4TXLA 2IPMA 2AG8A 4PH8A 5G4KB 2C3MA 3P3SA 5AW6B 1FLVA 2PMFA 4HJJL 1U58A 1FLRL 1ZOIA 4TTTS 1BMTA 2X9WA 4G11A 5IW1A 1NINA 1SCQA 2AC0A 3DLAA 4OIFA 1P91A 3NBXX 5ESRA 2OILA 3E15A 1CVSC 3P4NA 1P4JA 2NO4A 2AFIE 1LEGB 3DAHA 5D2CA 2UUDH 2JLLA 3V0JA 5F77A 3QUMA 2C07A 1R4NA 4JFEE 3BN9D 1SULA 3F9RA 2RGRA 3ARDC 5A6IA 1DLJA 4I55A 2XMBA 2QSUA 4U1GC 4RVDA 1H2RS 2RKWA 2O7SA 4ONOA 3THWB 5C0CD 2XEDA 4TPKA 2NP6A 1CB7A 3P0JA 3I9PA 3DO3A 3QH3B 4AKGA 1YC2A 4QO7A 2CD0A 4JRWA 1LEHA 4Y8DC 4URZR 4UV4L 5DGQA 2B1IA 2XWCA 1XGUA 4JN6B 3CX4A 3WWCA 3PIQB 4A63A 3I2CL 1EJBA 4U7FA 4HDNA 2GN1A 5JO9A 3QBVA 4F7WA 4U6QA 3WIHH 4JB2A 4U5QA 4WVFA 4A27A 4GW1B 2FZ4A 3EEOA 3RWCA 3WV5A 1XR9B 1CR1A 1R8YA 4MDJA 3W2FA 4MD4B 1H4QA 2MOVA 4AG5A 5K51A 5FAXA 4Q4HB 1MCLA 3O6MH 3O7WA 1OGTB 3B20A 1RMFL 3MRDB 5DCLA 4G80B 4EDWH 1L9OA 2GTIA 5GINE 2PUFA 1X1AA 1NLFA 4HPHA 2IAMD 3VE0B 1W15A 3IIKA 3UPRA 1I8LC 1QGED 4UQ3B 4QU9A 5ENZA 35C8H 1AS7A 3AF0A 5DS1A 3U7RA 1IM9D 4MVJG 3K6KA 5DC0A 4C0HA 1G8FA 3EK2A 3GGWA 5FPHA 4ZAKD 1OSYA 4BAZA 2IP1A 5E6IC 3OJVC 1T5XB 2NTFB 3D2LA 1KDPA 4TV9F 3JQPA 1ROCA 2D2EA 3DMTA 5K2OA 2GASA 4D81A 4R05A 3BL5A 1UWYA 2XI4A 5FD8A 3FW6A 4S12A 4KITB 1BG6A 1HKFA 4X7TA 2VDQB 4DLAA 1MRDH 1UDRA 4C1BA 2XY2A 4Q1EA 3EYFB 4R3WA 5JNVA 4WOJA 5AMXA 4I18C 3OZFA 1PUXA 5FI5A 2AKYA 3BVTA 1H2ZA 4YV7A 4JG9A 3G89A 1IJEA 1SOVA 1TTFA 2EHDA 4B96A 5E08H 2GN9A 4PM4A 4CVXB 2VN3A 3IGLA 2Y77A 1CQIB 3IS0X 3S34H 1ZH2A 1CIPA 3DVRX 1ODTC 3MXTA 1ELOA 4I9WE 1OX5A 3OR7B 1XQ9A 1U2DC 1AKJB 4RIEA 1KG0B 4R0LB 4LP5A 2B0SL 1WPQA 2XCSB 3VGBA 5AW3A 2PTVA 1DO5A 1ZA3A 3D0RA 1BGXL 3ER6A 2XBZA 2YZ1A 4FN5A 3QI2A 4LJ7A 5ISZE 1H0RA 2JFHA 3JTSA 1NW8A 1JU9A 3NJVA 5JTTA 3HZRA 3SD5A 1S7VB 1FX0B 2DQEL 1SQ2N 3SC6A 2W43A 1CYEA 3FPLA 4TKZA 5DSTA 4LPUA 4U5XA 4W63A 5HWSA 4AGLA 1RRPA 5IBRA 1FUEA 4QFDA 1FDRA 1RZ7L 3WVNA 7REQB 4GMHA 4NP6A 4Z95H 1HH4A 2QPLA 4HPJB 4ZT1A 5DEOA 4DV4B 4BKTC 1OAOA 3UUWA 1C9DB 4PZPA 1JJAA 3N42F 4KFTA 2BIOA 3M3HA 5A7FA 4ODHL 1BZYA 1N4AA 4WBXC 3ZUPA 1ZZGA 4GIBA 4LGVA 1XJWA 2JIZA 4MW6A 1J5PA 4BNHA 4JL1A 2NX5A 4HB3A 2IX3A 1NX9A 4IEFB 4GMSH 2E74C 4X4XB 5I1EL 1ZHKA 3OB8A 3A1EA 5EMJA 3PABA 2AJVH 4LSWA 3O8OA 3CFCH 4P6VF 5FHBL 3EXFA 1BVNP 3ANYB 3FT1A 3KDSE 3ZZMA 5JW5B 2TRYA 5FWDA 2AHRA 5LDUA 1J07A 1TM4E 2FA9A 2XU9A 2ZIGA 5E1BA 3N8GA 4LHWA 1RAEA 1KAEA 4D42A 1IC6A 5FHAH 1KENL 1X5XA 3AB0C 2NYAA 2E87A 2ZTVA 3NYWA 1JMYA 1YS1X 5FYLL 3I4CA 1R5IB 1ZRNA 5TJWK 5FF9A 1BKDR 2MSCB 1FFCA 1WHSB 3NOXA 4RBNA 1OAXL 3TDMA 1TQTA 2WF8A 2ZJ1A 4X6BA 1N6RA 5CZVL 3SDXE 3B5GA 2H2AA 5LG1A 2FBOJ 4MHTA 4Y2VA 4AN4A 2EE2A 1UCBH 5IR1A 2VDLL 1MCEA 1TW3A 2ZJ4A 2J9GA 2RGYA 2BYTA 1BXRB 1ZEAL 1WZLA 5DLLA 3RE1A 4YXKL 1K8DB 1YZYA 1FNEB 2I2CA 3OHSX 3CLUD 4KWTA 4MRAA 5ETUA 1I7LA 2WF7A 4BYGA 4UM9A 1OBOA 3O3MB 2XMCA 4QYSA 1UT6A 4ZCPA 4QG7A 3SWWA 5TPWA 4MZ2A 4LE2A 3MFGB 5F7YC 4BO9A 3I6MA 4JB8A 3RQSA 4ODXA 721PA 1LO4H 4WWHA 1NPDA 1KJVA 2WUCH 3MJEA 2PV7A 3MCLH 3MTJA 2BK8A 5F8QC 3DDHA 1VXOA 1MQKL 2CWWA 3VD3A 4Y8VA 3F1KA 1F3JA 3QFRA 2H5IA 4LYHA 4X64B 1ECCA 1A7QL 1CUYA 1SQ5A 2G3MA 3WMFA 5CB6A 3WY1A 5T1LB 2VKXA 1H6FA 2XWXA 5DQDH 2SODB 3CPUA 3IB4A 1N3BA 3DNPA 4MR8B 7TAAA 5AW0A 1E8WA 1TDJA 1IJKA 1Z9NA 2UZIR 1IAIM 4CN9A 3FU9A 4KO1S 4K55A 1LS6A 3JWDC 1KSRA 1RAGA 4Y16D 2NW2A 1IPHA 2BFVL 5L3SB 2F3SA 4E07A 3ZIDA 4LQLA 1OALA 2RDMA 2OP1A 3NN8B 5A06A 3DHUA 5ABZA 2YQ2A 3V8OA 1V6SA 5B1EA 4LGMA 3AEUA 3HEAA 2G75B 4II7A 3ES6B 3MRIB 4CM6A 5D2LA 2WANA 3WIIH 2QX6A 1A5FL 2NSHA 4ERSH 4D4JA 2F15A 3QUTA 1NYQA 1ZGLP 1J0AA 1PFVA 4C83B 3ZD8A 5CJOL 1L4MA 4GIPD 4XI5D 1QP1A 2CM5A 2N4IA 2FWAA 4R69A 4C4BA 4WNJA 5DMJB 4HUKB 5DMGD 3BSHA 2ZT6A 2YJNA 1KCVH 4AMBA 2DD8H 3ZWNA 3NYQA 2YD3A 1MOPA 2MIIA 4IILA 4QHLA 1LUAA 3HCFA 4HSCX 5EJ9A 3LOWA 1TNDA 3T6ZA 4O8ZA 4QTXA 5HJEA 3X1FA 3MLAA 3QLTA 3SKUD 2DQJH 5DNWA 4ZZ0A 2VUOA 4G6MH 4XH2A 3Q7SA 3WKPA 2FP4B 3WXMA 3HG1B 2QJOA 1BEEA 2DF3A 5DR5H 3MG9A 4N1AA 3NCJH 1UOOA 4AG4L 3UVEA 2UWEE 5T6MA 3I01M 1KP3A 5MHTA 1T0OA 1H9CA 4R5VA 1E9PB 2VXUL 1XGTA 2O5RA 4XB3A 3A4MA 2XMGA 2WYIA 3ZVRA 1GZHB 4FYSA 1Q1EA 3OKOB 3G8BA 3IQEA 3NDYE 5C2UB 1XGRA 5FULA 1M2JA 3LX4A 5BJTA 2DQDH 4J12A 1Z22A 4RMRA 3OX4A 1A3ZA 3B60A 2TMGA 3APNA 2B82A 1QO3B 2VNAA 5EPEA 1IAQA 1SMOA 4K0KB 1XD0A 3PQYD 1AXGA 3WS7A 4IUCS 4IIXA 2WAMA 5F6IB 3C5WP 5IYZA 4HKJA 5A3RA 3MLSL 1AHHA 2PGDA 4DM7A 4YJKA 1DUYA 4B9CA 3U3RA 4JT4A 3TJMA 4F2MB 3SKYA 4D0BA 1F4VA 1FDLH 1XGYL 3P3UA 1IC7H 3U4EB 3E9RA 3QGVA 1VPTA 5AYQA 5TNXA 2OO5C 4N6RA 5EHGA 4E88A 1WMBA 3RS8A 5K7SA 4DCTA 4RLSA 1BU8A 1ZOSA 2CO3A 4ZEWA 5KTNA 1NZFA 4K3UA 4Q3DA 3S1AA 2C00A 1HLDA 4XNAA 3T95A 2ZVQX 3JVGA 1AX9A 4IDDA 3OJCA 3UJDA 4NQCE 1RMYA 2MSEB 4IUDS 2I34A 2GTWA 3MJ9H 1QSFB 1P4LA 3MUEA 3DI3B 2NXEA 4UMDA 2IIVA 3L1VA 2EBUA 4A8PA 2DDQH 4LNRA 4RWYL 2AXFA 3RWIB 3QKTA 1H65A 4NCJA 1R18A 1CO1A 2VSKB 4R0LC 4BINA 2BCKA 2V4LA 1IK6A 3K15A 2VQDA 4WBSA 4LHSA 3BD7A 2E9GA 1QZNA 2YTZA 3SE6A 3CVHB 4J0QA 3KM1A 1XK6A 1U8MB 4MCZB 3SZUA 1U92B 4D9HA 1QHPA 4W4TA 2OCCB 4D4MA 4WZ6A 4K0OA 1K97A 3ANLA 5FQOA 4HOWA 4Z7AA 4TSFA 5BV7B 3NDJA 5DWVA 3C6LA 3CDYA 2UVPA 4L8CB 3MF4A 4ZJPA 4XIGS 2B1OA 5KYNA 5F35A 3A58B 4MPDA 3K0FB 2Q5CA 1TJGH 3CN1A 1BVNT 2HJKB 3VFVA 4BQPA 3TW4A 3QQ9C 3T71A 3GLHE 3LX6A 1YEIH 1J49A 3KSUA 3TEXA 3MSCA 4UE3S 1MZZA 2YNMA 3NQ41 4JKPH 4DLNA 2P2NA 1WAEA 3T3EA 3TZKA 4UZUA 1QGOA 3C3MA 2Y8EA 4MA7L 4MDHA 3HDVA 5L4SA 3OX8B 5EEXA 2XTJD 3V32A 5GRJH 2EDQA 2R4SH 2JIRA 3DIDA 1KMGA 2VLJA 3U1TA 5I4KA 2AQHA 4X6YA 4KUZL 1B6DA 4X61A 2A0LD 3LSOA 4HUUB 4MVJI 5KPJA 2QT6A 2ZXEB 5DJAA 1VGRA 1GSAA 3NCXA 1E4KC 3NFRA 4Q00A 4PB0L 5CP3H 1FH2A 2XIJA 3AUTA 1JNHA 5BZDA 5I2IB 5SWSD 3S81A 5A1AA 2XKNB 4NPJA 3FO0L 3T0GA 1HZLA 4Z7OF 5TTRA 4A2FA 3PWLB 2HTEA 3UWOA 1MJJB 3ZNOA 3AG1B 2O5XL 4XLTA 1P7PA 2O2SA 4MD5B 1TZGL 1OZHA 2W9EH 1KAMA 3H9SD 3DEZA 2VR3A 4RV4A 2PN5A 3SDDB 3S2UA 1T3FB 5TS3A 2ZIAA 3AI7A 1K92A 2IMNA 2H31A 4OQFA 3PA6A 4V1DE 1JSXA 4BTEA 4BNKA 3QXWA 2BGLA 1K7EB 4NPHA 1NGYA 1TF2A 2HT3D 1SVUA 2Y72A 1X8JA 1TMCB 2YA1A 3WRXC 2FDXA 1T0MA 3SU8A 4NQSA 1U4FA 3I23A 2RAUA 4LU5H 2R68A 4D9BA 5KWVA 3K73O 2BIPA 2QBWA 2F64A 5GGVL 4RVBA 3MRFA 1Q0YH 2RIPA 1O54A 1ONQA 1A9VA 3SEFA 2XQYA 4ABQA 4I89A 4Y1RB 5H3CA 4M1MA 1IY1A 3IAS1 5IG7A 3R19A 2VHYA 1BS9A 4TYQA 3GMRB 4MSWA 3OOHA 3EJQA 4AGMA 1RE0A 4MS3A 4RQUA 4UTNA 5F2KA 2AQ3A 1IN7A 3MRLA 4M00A 1YJDH 1L4LA 4BDTA 2WLNA 4XGKA 3WSTA 1GUBA 4XGRA 1U4NA 2PCFA 4NUPA 2HFKA 3N70A 2NY0B 1WEKA 4NB7A 5T1MA 2NT3A 4OJYA 4IDNA 4OJEH 1KDOA 4XD2A 2EUZA 1DFXA 1ZT1B 2F53A 3V9EA 1MOSA 3OOYA 4DDHA 1AQDB 2E5LB 4DV5B 4I0PD 1RFDH 3KSBC 3ZO9A 5K3FA 2IZZA 1U9KA 3LHIA 2OM2A 4LHQB 1BAFH 3ARED 3H2WA 1PSWA 4MXDA 2NZWA 4D9QD 2WLYA 3VC2A 3AYXB 4NQQA 2WB7A 4PJ5D 4DBLC 1FZOB 3IT2A 4ZVPA 2C2HA 1IFRA 4P3PA 4FLEA 4H20H 2JBAB 2REBA 3KD2A 1AZNA 1JPTH 2HTLD 3N0RA 4NZPA 3NWOA 3OJWA 1T0JB 3AFNA 3CFKA 1AQKL 2O50A 1GGIH 2OA9A 4ER3A 3WKNA 4V1CB 4Z4FA 1KEGH 2A2QT 5FYJD 2M2DA 1SB8A 1QGAA 1H93A 1Z7JA 1UHVA 3CNHA 1SHZA 1RPZA 2WSLA 3W5CA 4JEUA 1XGQB 2FZ5A 3TZEA 3UJ8A 2UXVA 1WSAA 1TQ4A 2J5WA 1PEKE 4Y1AA 4CC1A 4NE9A 2F5BH 1PNOA 3W5NA 1KQGA 3HFJA 2R751 5BRZD 3J27A 2EYSA 4X45A 3OZWA 5DU2A 5DYFA 1F2TB 3FETA 2O3UA 2V8LA 4JB3A 1POXA 1NC2A 3DHWC 2XN1A 4G42B 1SWWA 1P1CA 5SYAA 5TSDA 1WAAA 1MV5A 1I3VA 1NDHA 3OPYI 3RDTB 1WUZA 3TXYA 4ZU3A 4FMVA 2VQ6A 4AJEA 5AVXB 2HK9A 4YI5A 2HFTA 4KMRA 1CGYA 4NPKA 5K6AC 4Z5RA 3DOUA 5CU5A 4F06A 3QCUH 1SCUB 5DULA 1SXSA 3V52L 4ONGH 3UFXB 2MSPA 1L5RA 4N6OA 2XC8A 4GICA 4OMCA 4YSSA 1IEHA 1INDH 3RNOA 3HE7B 1L3IA 3D0KA 1WCIA 4H8HA 3I9KA 3GXFA 5A5EA 5K69A 2PP8A 4WJLA 5TC4A 2HJLA 1WP9A 2BVQB 4CJXA 3GP5A 3GR6A 4YI3A 3BEDA 5D84A 1G6RB 3B4NA 1PK7A 3QVVA 3TM4A 3BWAA 5TK4A 1XDDA 2DI9A 4YFVA 2EZ8A 5F1IB 2HWKA 3CWZA 3ZE0B 3IJYB 4DFIA 2OZ4H 1R3LB 3D0LA 4N7BA 1RM5A 4L22A 1QTSA 2OKGA 3GDGA 2HIGA 4PIPA 2L7QA 1NU6A 2AA3A 2JAXA 5DZAA 5FBZA 2J3EA 1XXHE 1GZVA 4FXTA 1TSRA 1JSRA 4G81A 5G0TA 3MODH 3F90A 4LSTH 2NDGA 2IC2A 2YD5A 2RGCA 1AO7B 3KCWA 4PLKC 2OYRA 4CM8B 5D1ZD 3D05A 1VL1A 1D7DA 4JUAA 4NLHA 3PWKA 4FG6C 1GZHC 2JFBA 4QXTA 4ZMQA 3N06B 2V2WA 3N6RA 3WIAA 4JO4H 5ELMA 4PUBH 1CVLA 1ZR4A 1CUZA 3UIZA 2G4VA 3LYAA 3GBMH 2DWTA 3HUUA 3ORRA 1XDSA 2GO1A 3OM0A 1U2GA 3FHAA 4TMFA 3S6CA 2Q3JA 1BHSA 3L6UA 3K91A 2EQ5A 3BSZH 1U41A 2D2VA 5F6IC 3B8EA 4N47A 4PLVA 3TLAA 1A8JH 4PG9A 4PRPD 5AKVA 2APTA 3WS3B 2YAFA 1ZN9A 1J18A 4QQKA 1VLVA 2G5GX 3OF6A 4PQEA 3QORB 1YZTA 3CSYB 3OECA 3RT9A 1KMIY 3OHXA 4JO3H 3BVDB 1QWUA 3UMRA 2O30A 4A03A 4R9SA 3VM7A 3H9HA 1K5NA 3NYIA 4JYCA 4XB2A 5GJWC 1NLYA 1V2GA 2VG8A 1R0YA 2XQKA 3E3LA 4GYKA 2J08A 3CSUA 5GRZA 3GD5A 1RTTA 2KUTA 4C6HA 3AVVA 2UZXA 1QCYA 2P0AA 2RMKA 2H4HA 5CSZA 3T0VA 1N12A 2Y7QB 5I6LA 5AVTA 2JJYA 2QJTA 4ZEMA 3AZOA 2AIRA 1FS6A 4N01A 1CZKA 3DMPA 2WHQA 1N6VA 4DKEL 1FQOA 5DLQC 2OTUB 4WT7A 4FXOA 2QLFA 4IG9A 3RTLA 3NS7A 4ZO6A 4P5KB 1TO4A 4OZIA 4R4ND 1U63A 3L7LA 4GP6A 1KJ3H 1NJ9A 2AOTA 2E89A 2V9UA 4P7KA 3Q87B 3RVBA 2VLME 3WQBA 1NCCL 3AU1B 4AS1A 1NXPA 2VR4A 2NNWB 2BSQA 3DBRA 1M6UA 4G3XA 5C0AA 3DSFH 3H1ZA 1O4WA 1ZT4A 3VFGL 5C0EB 2XKUA 1FIEA 1LNQA 2E6KA 5B37A 2ZU0C 3O9ZA 1AR1D 1FW8A 1TYAE 1WB4A 3WGGA 5EHZA 4MNQB 1R10A 4K5NA 2VDJA 3JQEA 1FIUA 4GUPB 3TH2T 4QRRE 1BV8A 3PNOA 5I7SA 4J0FA 2PMZA 5F9WB 2R6ZA 3OT4A 1X9LA 2NO1A 1ZRSA 3MV7B 2B92A 3T7IA 1C16B 4JDZB 2ZQYA 3K1KC 4I4CA 1DL7H 2E0IA 2ENPA 4JPIA 2QTEA 4J16A 1PS9A 4ERNA 2V7UA 3F97A 3P73A 1PFKA 1OW3B 1AE1A 2AP2A 7YASA 3MV11 3DJZA 2XVYA 3LWNA 2IAAC 3GA5A 2AK4B 3ULKA 4ZFQA 4C0KA 5EERA 3ANNA 4UDYX 1WCV1 1OB1A 2WSKA 3EBLA 2NX2A 4AM8A 2EC9U 3OIVA 2C4FU 3PWPE 1WOMA 4QHYA 3KJ6H 1VDGA 4DK6A 1QBLL 4O3FA 2GXUA 4ETNA 3FO9B 2IANB 2YVAA 4M89A 3KPOA 4F7MA 1A7NL 4M1GH 1EMTL 5B1IA 4OI8A 4I5BB 3BFXA 3TZVB 1X80A 3TOSA 4W9CC 1XR3A 4PJEA 2H1FA 4WUTA 1QRRA 3TJRA 1MIML 1XMXA 3BRWA 3VVMA 4BKPA 3DO6A 2D5BA 3V8VA 4FFWD 3SDDC 4V0ME 5FORA 3USES 4DGUA 3EDKA 2IUYA 4RL6A 2A4CA 3SKXA 3TASA 4MOWA 2Y6SC 4MZ3A 5AW1A 1ROWA 1EGQA 4BE4A 5DHVB 5AL8A 2XY1A 2BM8A 3CZRA 4UMGA 4TM7A 4H8WL 4Z78B 3GH1A 2UUAB 1W88A 4QTZA 1E4JA 1K98A 2B77A 2OOSA 3U3ZA 2HXAA 2YEVB 2V1UA 3UNXA 3ZIAD 4E30A 7PAZA 4ON9A 3GXMA 5CLZA 4TUYA 4UQOA 4CBZA 2GDJA 2V6BA 4B3VA 4FQQA 3K8LA 1P4BH 1VJGA 2IEPA 4MLPA 5HJ2A 2J1WA 3OY2A 4D0SA 2Z5GA 1RZKH 3KHUA 32C2A 1OXMA 2WSSA 1XI2A 2RGDA 1P9LA 2V7EA 4M1CC 5HE9A 5IJ9B 5K0EA 1E3FA 2OQIA 5FGBC 1PEZA 4R1UA 2JLCA 2F53E 2O2EA 4K9LA 4FI8A 5GRUH 2NY0C 1FPTH 4O51B 2QVCA 1J99A 5I26A 3AOEC 2QV2A 1MFCL 3QXJA 1ZT7A 1KO1A 2ZBQA 2BDNL 3B2QA 3VB9A 5LCVL 4UUJB 1RP9A 3L48A 1JMKC 2VXCA 2A86A 1EEZB 1SBSL 3G9AB 1AOHA 3QWHA 4TQGA 4LRIA 2ENJA 1I4FB 4JFDA 5FWAA 2MKWA 1ONSA 4LSSH 3OAAD 3H3KA 1XZKA 4CL2A 2BNQB 2WXFA 5KNBH 1JD9A 1XRLA 4BIKA 3KL5A 2EXYD 4RS3A 4DH2A 1W6LA 4N4AA 4TWZA 3BUPA 2TSYB 3F6BX 2H5JA 4P0PB 1QNZL 4B44A 1NOKA 1JNYA 1KPIA 2D4FA 4MRRA 6TAAA 4JSRA 3HEMA 1A1MA 2XZQL 3GJFB 2WIBA 4E13A 6AT1A 1OCWL 4G8AC 2ITCA 3QIUD 5CXUA 3FYEB 1AB6A 3QJZA 1PYOA 2CHUA 3SXUA 3FOBA 1VADB 4PGGA 4CEHB 5T3XL 4TWAA 1U8HB 4AUMA 4PJGE 1E3ZA 1QAOA 1VCBC 1XAGA 1CZUA 4N2IA 2ITFA 4QDXA 1Y1PA 1YO4A 3KQLA 1ULUA 3RDTC 4XIYA 1QHHB 1O5DT 2Y1KA 2PW1A 5ICCA 1WFIA 3ZZQA 5DP2A 3GLUA 2CCVA 5KS9A 2WSPA 3D06A 1EGHA 2RBGA 4G5FA 1NLZA 1XKQA 5U1PA 4FCCA 2N7SA 4TQEH 3HNVL 4AJ0A 4DCNA 2QPUA 3VPXA 3TNFA 3WGOA 4TX1A 3SBRA 3HE7C 2GJ9A 3F58L 3N6VA 1I4WA 3BRDA 4NARA 1JIBA 3OPMA 5FUMA 5A71A 2VRBA 1K75A 2Q76B 3S8YA 4HK4A 1D0SA 5HQTA 3W6PA 3ULSA 3VI4E 3SCMA 2IX9A 2QSZA 5TH2A 4KMSA 3LKSA 4JG1H 4N4YB 2BSSB 3RVMA 5EKXA 4XNQA 4LUCA 1NUAA 1E6UA 5F3BB 5ITZA 4UVEA 1PW3A 3APFA 4N8VG 3HJGA 5IM7A 3BH9A 3LQZA 1YDFA 2AW5A 4J3JA 1NL0L 1BQSA 3QVXA 2ES4A 4JLRB 2BKVA 4ZEVA 3TPUB 3EEYA 4OIBA 4JRYD 5K0NA 3AY4A 2J0EA 4C54A 1KYIA 2NU8B 1FRGL 4EGAA 4R71A 5B3AA 2QZJA 1REQB 2G4LA 4GPVA 3OSVA 5ENWB 3VACA 4AYMC 3UT5B 2HA5A 2H2PD 3VAYA 4B3IA 4CGZA 1DHTA 2HCFA 3GMOA 3B13B 3TZ6A 2V5SA 2D0OB 4AVKA 4U1SA 3LI2A 1KGCD 1JXMA 1Y1LA 1EX6A 3QORC 1WD8A 3MAAC 4N68A 4X3PA 2H2SC 2OL3L 4XE5B 1D1PA 4P2QA 4AYSA 4MP8A 3VNZA 3T5AA 3EGSA 4GP9A 1PYWA 3H4MA 2DIBA 5E5MA 5LWHA 5AVSB 1QI5A 1QCDA 1M1SA 3S2FA 2ZUTA 5C0DA 2L7EA 5I3CA 4I1IA 3AVOA 1G66A 3PEFA 3K2KA 3CBJB 1SZNA 2NSMA 3IM1A 1NVTA 4CKYA 5EBWB 4O59O 3ETBJ 1JLKA 1QIMA 5G5DB 3WY9A 4JL5A 1RLWA 2WNXA 1AUPA 5IZCC 2COQA 2HN7A 2D3WA 5KZCD 2GZSA 4WUUA 3ILHA 5EESA 4IAOA 3CYFA 3VXUB 3NABH 2G8NA 3PKZA 5C0AE 2KZBA 4EPYA 4X9BA 5B58C 3DPBA 1S9DA 1ASOA 3GWGA 3S88H 2ZAIA 1I4TD 4LVUA 2QVMA 3EQ6A 1AMXA 3H5IA 1KDIA 4GRWE 4JLJA 3JQ8B 2EQBA 3WK4A 2OG1A 3ZHYA 3GUTA 5BMFH 3L9XA 4P98A 2JCSA 4JYZA 3O0RH 1TJHL 3QNUA 5F9WC 4P4LA 3P71T 4YMIA 4W9IC 1SKYE 1PSDA 3B1JA 2JKYA 1EK3A 3GNMH 4P46B 4I3HA 5BCAA 3GHEL 3M1BB 3R09A 3DBLB 4OZGE 2ZLBA 3ZR4B 4O29A 3AL3A 5SV4A 1G8SA 5HDRA 5F0JB 3PG5A 3VTAA 4RJKA 3NCWA 1KIUA 1YI1A 3C39A 4E5NA 5KINB 2PSDA 4ZI8A 4IG4A 4Y2JA 4BXOB 2J88L 4LCYB 3BD9A 1TVHB 1O7DE 3UTTA 2YY6A 1UWKA 1N34B 1QH1B 1FL6B 4QRFA 1Z83A 4UT6H 1ZN2A 3RE0A 5C0NC 3G0OA 4B4WA 3TZVC 4OOEA 5GONB 2B20A 1B6TA 3UAVA 1ZIPA 4X7SH 3BQMB 4DUGD 5CA1B 4MQXD 4OGAC 3CVCA 4NCNA 2FWJA 4NYIQ 4BLUA 4CL0A 12E8L 1D3AA 1QUFA 1H1DA 4JO2L 5FUYA 1X5MA 4ZPTA 4UDOA 1NGWB 1QEWA 1PV1A 1E4YA 3QUML 3VX0A 5BN4B 2MEJB 1OJLA 3VPHA 1RM0A 3O4RA 1P2DA 2D3NA 2GSIB 2BNRD 2GR9A 4PJHA 1JXKA 3VTMA 4CADB 1IWBB 2A6PA 1QKJA 4FL4B 3OFNA 1HNNA 3TONA 2V7WA 4U9UA 4MAYA 3O03A 5EO1A 3ISVA 3WGZA 4BCBA 5H81A 5IJKA 3UMMA 3WB2A 1P75A 3TKAA 1SMDA 4X1KB 7FABH 1KSJA 5EC2B 1O6SB 4OJFL 2DLFL 3RHWK 2I3ZA 3W1VA 5E03A 4MYHA 3VZPA 4UAOB 4BK5A 1C3JA 1K85A 2XQFA 4ZHQA 2YK1H 1MFZA 1P1ZA 4YIQA 2JFPA 1XFAA 3F85A 2GVZC 4JI3B 4ZSOA 3T34A 1KRXA 2EEDA 2YO3A 2GEKA 4JHAH 1X6VA 1D5RA 1F8FA 1AFVL 4LF5B 5HHMD 4ANUA 4PRHE 3BWBA 3ZTEA 1WQVT 1KYUA 1YHPA 3LUAA 5DT9A 5JUEL 3QYJA 2WF5A 5CSGA 1NVMB 3FTFA 4EHBA 5JSZB 1Q0UA 4B4KA 4UFPA 4N6GA 5FF6A 1EUZA 5T5QA 2Q4RA 3VXNA 4YRLA 2WVVB 1JIKA 4MA8H 3TCLA 4LVHB 2Y05A 3BMQA 4D0NA 4I1YA 3UACA 1Z28A 5C0GB 4AI7A 2FPSA 4TMTA 3A9TA 2GKOA 1UWEL 3JV7A 5JQHC 1JTPA 4JLMA 3HVJA 4BJLA 2C5GA 2WM3A 3K8QA 1Z5NA 3EDJA 4PJCA 1J39A 4FYYA 1XAIA 4JI1B 3SYNA 2X88A 3RY6A 3QNWA 5DHTA 4KQFA 2DUNA 2BE9A 4I50F 4NBZB 2O61A 4XGNA 2YWHA 5DTEA 1FU4A 2ZROA 3D85D 4IBZA 4FDVA 3WTUA 5A3SA 3VDXA 1TLKA 1ZESA 4GZ6A 2Z1KA 3H0KA 4KYUA 4RLHA 4LBWA 2HRRA 4OX9B 4PAGA 3FT4A 4MWTA 5AOZA 3IH5A 3ZMNA 1OT2A 5E6YA 2AD5A 4NFDA 4NO3B 1G16A 1XNGA 4YXWA 4LY9A 2DB8A 1YZFA 2GB4A 4CZ2A 2EDFA 2C9XA 5IK3B 1A9QA 5KVEL 4FIDA 1MXDA 4FXKB 2IZ6A 2E6JA 5D55A 3VA2C 1J2JA 1SLVA 3MI6A 5FO8B 4S0XA 1DC8A 4Y6GB 1QGZA 1R37A 4DM3A 4NESA 2AHIA 4ZXBD 1XLUA 4LLUB 1OGJA 3BH8A 3RSSA 1HL3A 2M98A 5LVEA 3OCXA 4OX9Y 2CRIA 3KOWA 4H16A 2Y7SA 3ETTA 1D07A 1W4RA 3BEVA 5CINH 4OB5L 1UMBA 4AZ3B 2WLZA 4LGPB 3INOA 4JY6A 3TG8A 1GGTA 1C8KA 3ZE8A 4WFFD 2W5UA 4J0JA 4UM8B 1SXCA 3N55A 3D4NA 4XP6H 2OCXA 2QN2A 4Y8AA 3CMCO 2G06A 3E3QC 5I19L 4EKEA 1WKBA 5LUAA 4MYCA 1CT8A 4RGNB 4TNGA 5D1XB 5LYYA 1F5NA 2RCNA 3LZFH 2ZJ3A 2YOAA 1UH5A 5T4HA 1E9OA 1NW9B 2DUJA 3TIIA 2X13A 1XIWB 3IYLW 1L5LA 1QG0A 2WI8A 4N5HX 1NRIA 1WU8A 4RDCA 2BIMA 1M8GA 2A2ZA 3QJOA 1YNOA 5TQ2B 4JDVB 1B4JH 4R8VA 3HB7A 1GKIA 4LJLA 1LMKA 4INPA 2GF2A 4TTJA 5DJYB 1Y6QA 4L37A 3TZBA 4LOFA 4N9GA 3K6IA 5FYLE 3KPRA 43C9A 1VA5A 2X9GA 2FMFA 2WXLA 5I9NA 3MRKB 2ZE8A 1AGDA 3VMOA 4ETQA 5L2JA 4CV3A 1A69A 2YLHA 3RB5A 4OHRA 5EZIL 5DMIH 4M6OH 1T1XA 1XTTA 3QZMA 3FPCA 4X4KA 2VAWA 2GIXA 2OECA 1QSZA 2ID7A 2QGBA 4G0ZA 4ZQFA 4GBXA 4QHPA 4G24A 4P86A 1FV1A 4F8LA 1NMAH 3OE4A 1YMMB 1ES0A 3ZDZE 2DFPA 1ZOLA 2QTBA 3BAJA 3GSNA 1XQ1A 1L0BA 1XHLA 1YD7A 2R6R1 5K59F 2JD2A 3TO4B 2BCMA 3GT0A 2DXIA 1XZEA 5LA6F 3W5BA 3BP6A 1CSEE 3ZDCA 1I7DA 3KAPA 3EYVB 1M66A 1ZCRA 3IMTA 1V4BA 2V03A 5AM1A 1ILEA 2B34A 1IE4A 2PH3A 1JPGB 1Z4PX 3MNWA 2YXVA 3VD2A 2MU1A 2HLFD 1RQGA 1AN0A 3VZQA 1U8XX 1A27A 3FCSB 2RGGA 1KYQA 2UYQA 3V4SA 4N0UA 2WJHA 1DWOA 4X9IA 4OBEA 2W60A 3O9WB 1XA4A 3T2LA 5K0GA 3R1IA 4TULH 4HIJB 3LGSA 1FL3A 5M2QA 5B55A 5IMOB 3MKKA 2JNZA 2K3TA 1FC0A 5DLMH 1QEXA 1D9KA 3D25B 1QLRB 5K1VA 4YHZL 5JHLH 3B1YA 2YQGA 2WM8A 2RI6A 3LLMA 1PZMA 1ZVQA 4HAVA 1I3MA 2X0UA 1RWOA 1QRNA 3EYUL 2M6SA 3V97A 5B1JC 4JDEB 3CVYA 1UQSB 2GN4A 3IQHX 4KG7A 5EFIB 4PIMA 4ZNCD 3RFTA 4MS6A 2MKLC 3WDKA 2P5ED 4J29A 2M1KA 4LDPA 4KK8C 1RQPA 1YKSA 3T3DA 3ZXUB 1GTFA 3G5YA 5GWXA 1M83A 1EUTA 2DQIH 2RQ8A 3JALB 1L7BA 3HHMA 3G1TA 4P46C 3L95A 2DJ5A 3DZDA 5AM0A 3BCSA 3DZBA 4GX2A 4D3ZA 3DX7B 3ATAA 2FX8H 1UINA 1ULAA 2F17A 4S2EA 3KBFA 3UJIH 4X6CF 3GGPA 5DFVD 3IA2A 3ARGD 3EH3B 4ARIA 4PJBB 2P7TA 1G9XA 2ZXCA 3N75A 5CVTA 4KQWA 4G6AD 1VPOL 2OYCA 1T6NA 2ZD0A 1FXSA 1P5FA 3IDYB 3EEIA 1NXSA 2ZQ5A 3UTSA 4U1KA 2NVUA 1BHQ1 1QYCA 3RIEA 1UM6H 4I3RL 1FEZA 3UYPB 3MBWA 3DG9A 5FWXA 4L0QA 2Q3AA 2QTTA 4WNAB 3RFFA 4KMTH 5IUKC 1XWFA 1UWGL 2Z31D 4K86A 1T3HA 4X6DB 1ZTXE 3TYGL 2QB5A 3ZY3A 4DTGL 4DZ8A 2WSIA 3O6VA 4XQEA 1J6UA 3PRHA 5JEEA 2CZNA 5GJSH 4ORGB 5JR1L 1ZD3A 4EPVA 1ZD4A 4EEKA 1IY2A 4L9LB 2DH2A 2VMCA 3M6UA 1Z5WA 4A6YB 2R11A 2QMKA 4UC0A 2EERA 1XAKA 5LQBL 3VNBA 1NCDH 4A55A 4PJHE 4LRTB 1KCRH 4KIGA 1QPPA 1B8PA 4MWBA 2G36A 4QYIA 1U8UA 2Y2VA 1Z4IA 2QYHA 3PWPD 1N5OX 4FL4C 4R9UC 4JI7B 2I71A 4JQXA 3GMNB 4RV9A 5KYTA 1Z26A 4GGOA 3GA7A 4GEJA 3O8LA 1ETJA 1PZ2A 3U7WH 1IQDA 1V3TA 2GCYB 3HC3H 4QM6A 4WKBA 1QK5A 5HHNB 4E46A 1UM8A 4BX8A 3K80A 4Y9RA 5JPNB 1Z38A 4YSEA 1BWMA 3DD1A 3B9BA 2EZ9A 4UAOC 1NSNH 1HWYA 1P53A 3TRFA 2QSJA 1BPVA 1E5AA 3HV0A 3ZLJA 3THRA 3SDAD 4TYNA 1RJFA 2PJRA 1ZVHA 3BAIA 3TR0A 2WLJA 4NYMQ 3U5TA 1SK8A 2PS1A 2VLRE 2I1LA 2GB2A 2GHWB 4TNWF 1V3UA 2C4HA 2A7QA 3GRWH 1TKRA 2ZKYA 1AF7A 4FTWA 4NQVA 4HALA 3HDHA 4GD3Q 4NE7A 4LVHC 2WU1A 4MKMA 5DI3B 4TUOB 3PY9A 3J81k 3K9QO 2V54A 2IPLA 4HO1X 4KWEA 1OGAA 2JH2A 3TX6A 3ZJUA 3LB6D 2KS0A 4PMFA 3W7AA 5DJ6A 2JMRA 3PT5A 5E51A 4LZAA 1DQQB 1EE9A 1WQ4A 1LP9B 5LC1A 3A36A 4UTVA 4MYSA 1ML3A 4A2EA 5CM2Z 4MDYA 2KJQA 3JWNE 5IS2A 3CJJA 3Q40A 2PX2A 1WB9A 3MAJA 3RUAA 2CDNA 4C6TB 3KZMA 3PFHA 5A43C 1S1CA 4DR1B 4OHYA 5D85A 5FBWB 3RGGA 7CGTA 9GPBA 4Q1BA 3C3DA 1MNQA 3GJ7A 3UPCA 2FMTA 3OKMA 2QLLA 2QORA 4PWHA 3FCBA 3UZEA 2UZYA 2WXKA 2KH2B 2Z3WA 1DBKH 3NLLA 3GLGB 3R06B 4OBBA 4KO3S 3NVQA 2V8MA 1OIOA 2W70A 1E0AA 2EKLA 5A2KH 5J43A 3BVVA 1MN4A 4FXKC