3V55A

Human malt1 (334-719) in its ligand free form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
383
structure length
368
Chain Sequence
QPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNKVTANIVFGYATCQAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 368
sequence length 383
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v55A02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v55A01
1JXQA 2CNOA 3QNWA 4D3XA 3NKFA 2FUNB 3BIJA 3GJTA 2C2ZA 4JQZA 4FGUA 4NBNA 4NBKA 4QULA 5IANA 3NS7A 2CJYA 3KJNA 1RE1A 4ZVSA 4EHNA 4JR2A 2Y0BA 3UOAB 3H11A 3IBCA 2CNLA 1I51A 2XYPA 2XYGA 1F9EA 2C2MA 1RHQA 3PCXA 3PD1A 4N7JA 3ITNA 3V6MA 5IASA 3EDRA 3P45A 3R7BA 2QLJA 4QUGA 5LUAA 4HQRA 4PRYA 4QTYA 1SHLA 2H4WA 1BMQA 1ICEA 4N6OA 4I1RA 4PS1A 4DCJA 3KJFA 1SC4A 4EHLA 2HBRA 3R6LA 1RHKA 4JR0A 5LU8A 1RHRA 4QUHA 3H1PA 4HQ0A 1CVRA 2FP3A 4LSZA 4PS0A 4QUBA 1RWPA 1SC3A 3R7NA 3DEJA 4JJEA 4N7MA 5IBPA 1GFWA 3KJQA 5I9BA 5IC6A 3GJSA 3H11B 3V4LA 4NOKA 4EHFA 3UO8B 4NOLA 4D3ZA 1K86A 2H5IA 5IC4A 4QUIA 4JB8A 5JFTA 4ZVPA 1RWMA 1QX3A 5IAJA 4HVAA 3DEIA 1NMEA 3R5KA 2C1EA 2C2OA 5IBCA 4ZVQA 1PYOA 4AW9A 2XYHA 4N6GA 2QL7A 3H13A 4NOJA 3R6GA 4IEFB 3OD5A 1RHMA 2CJXA 3S8EA 2FQQA 4QUDA 1IBCA 4IYRA 4N6NA 1RWKA 3V3KA 3H0EA 4DCPA 1NMSA 2P2CA 2QLBA 4AWAA 3D6HA 2H48A 4JR1A 4I1PA 2AR9A 2CNNA 2HBZA 3D6FA 3PD0A 4QU8A 4QU5A 4EHKA 4FXOA 1RHUA 4EHHA 1KMCA 4FEAA 2H51A 1RWVA 3SIRA 4EHAA 3R5JA 1K88A 2K7ZA 1QTNA 1M72A 5LUBA 3SIPA 4QUEA 5IAKA 3E4CA 4QU9A 3EDQA 5H0IA 4EHDA 3K7EA 2QL5A 5IABA 2H54A 1RWOA 2J33A 4NOMA 3GJRA 3V6LA 1PAUA 1RHJA 3GJQA 5LU9A 1RWNA 2J30A 2J32A 4JJ7A 1SC1A 4QUAA 1QDUA 2QL9A 4QTXA 5IARA 1NMQA 2HBYA 2HBQA 3D6MA 5IAEA 4ZVTA 2DKOA 4NBLA 1F1JA 2J31A 3P4UA 4M9RA 1I3OA 3DEKA 3DEHA 3S70A 1NW9B 2C2KA 1RWWA 2H5JA 5K20A 5I9TA 4ZVRA 4QUJA 3V55A 4EJFA 3RJMA 5IBRA 4PRZA 2Y1LA 4QU0A 2CNKA 4ZVUA 1I4OA 2QLFA 4D3YA 1CP3A 2CDRA 3V4OA 2H4YA 2XZTA 3R7SA 4ZVOA 3NR2A 1RWXA 4DCOA 2WDPA 1I4EB 1SHJA 2NN3C 2XZDA 4N5DA 5IAGA 4JJ8A 4FDLA 4AWBA 3IBFA 1GQFA 4JQYA 2H65A
chains in the Genus database with same CATH superfamily
4OZFA 1JXQA 3OZAA 1NFDF 1IHDA 4PG4A 5E7FA 3QKTA 4RZQA 4Q7LA 1N8NA 4D9CA 3HRIA 3DDFA 1U5CA 1DUZA 3LA8A 3KVRA 2VDLH 3ED5A 1GLGA 3OQHA 2JAOA 2X0FA 3H1BA 4DKFL 2F2HA 1KLGA 1D2PA 2QFRA 3QE9Y 3DQQA 1NOLA 5KSAC 3UMTA 4YCAA 2WUCL 4ZVPA 2YRWA 1A7OL 3LX5A 2XIJA 3ULVL 4YDIL 4RZKA 4INOA 1UJ2A 1SGKA 3U7JA 4UF7C 3WLJA 2XY4A 2P1YA 5I6XC 1JFHA 4MJID 4P8RA 1Z2CA 4MULA 4LDRA 4R4NC 4BJHB 4XVSH 1AHPA 1R8YA 1V9CA 4Q4JA 1MA3A 3FTYA 2CE2X 2VAPA 1TTRA 4LL9A 1DSFH 3HE7A 2AZXA 5A2FA 2D8KA 4BMXA 4W8HA 4WFQA 2CUNA 4XHJD 2HWXA 1PNVA 2ZU0C 1YQUA 1PEAA 1FBTA 2D62A 2IBSA 3T0EE 4KLRA 2YXWA 1YR1A 3R0QA 4K8RL 1KNOB 1NWCA 5AM1A 2BGGA 3MBEB 1LPMA 1NVKA 1COZA 4WTQA 4B3JA 4NULA 2BEVA 2BOBB 3JV5A 3RQSA 4LBZA 4Q74A 3RVTC 1DBVO 2G5BB 1KZ1A 5C6TL 3PA8A 4ND8A 5BXQC 4HDNB 1IAKB 2N59A 2I1QA 5H02A 2OECA 3MJSA 3HZYA 2XVXA 4DZ8B 1AQLA 3MLWH 4P3DA 2E5WA 2ZUVA 5TE4H 4PX9A 4XX0A 3RFRA 1SQFA 1E5QA 4P5TB 4Z18A 2H3EA 5ICEA 3V4ZA 4HCRA 4N5NA 3B9RA 4JUDX 3VVCA 1CLYH 5FWRA 3FO0H 4NKMB 4LJYA 4DR5B 1YC7A 1YJDH 4OQEA 3G8CA 1NLYA 4HDSA 2PK3A 3SYTA 4JPWL 4CUJA 3ETGA 1RNLA 2QSYA 2ZUYA 3HO8A 1XGKA 3EVBA 2Y1FA 4K9SA 5FKPB 1YMHB 5GVRA 2PH3A 1L7OA 1TUBA 3NCFB 3CXUA 3LPLA 3CHPA 4YWGL 2BYTA 3SCZA 4KXBA 3ODGA 3CVHB 5C52B 3TBTB 1AUPA 4ZT2A 1HQ4B 5GGVH 1A2BA 4BO8A 4L9WA 4Y2QA 3ZBPA 5F89A 2Q3FA 1WWCA 2JJVA 5HNKA 4PLFA 2OBGA 2DR3A 4UIKL 2PX3A 4L7QA 2IEBA 2QUAA 2BFVH 4QNPF 3FU0A 1JNHB 1QQ7A 1FIGH 3M6DA 3ZE7A 1E0OB 5JXED 1SVZA 1V10A 3EZ6A 3CV5A 3GFOA 1Z22A 1NC4B 3ETEA 5HZGA 5TDNA 1P4AA 3AABA 5ABDE 1RRGA 4O02A 3MUNA 2VXUL 2ONJA 4MW2A 4OXIA 1VLXA 3F97A 1HINH 1FVHA 1G9SA 2I67A 4RS3A 1UP7A 5IXJA 4K1XA 1T8YA 1BW9A 4M5YH 4DJJA 5D3QA 1CI5A 4RQTA 4TSBH 2DLTA 2JZOA 3LPFA 2PO7A 1BCSA 4XKJA 5I23A 4JHLA 1SFDA 4P07A 3S2AA 1A9YA 2F17A 4FXTA 5MERA 3A27A 2GAJA 3F3KA 4DIFA 4EYGA 2C9XA 1ONNA 3R4DA 4FHGA 4NN6C 5B8CA 1XL0A 5KJ6A 1IU9A 1EAPA 4NDAA 5H82A 3JQ9A 4P0PB 1Q9LB 5J6GA 1KTCA 1XZJA 4A8TA 1Q0UA 1SLWA 4ZX6A 3TB6A 3EPHA 4DWVA 3MW8A 1G4RA 1PY4A 2DWEB 3MLZL 1QJ4A 3BGSA 3WC4A 3AL2A 3L1OH 1JZQA 4NESA 4JS7A 1B23P 5F7OA 2ZYAA 2HGSA 5BWCA 2EIBA 5DQ9A 1KSFX 4HETA 1N0HA 1TOAA 3K5WA 3T4PA 4MWSA 2XZQH 4LGVA 3GSRB 3QR1A 5D93C 5JPNA 1FGVH 5HI3C 2P90A 1QAWA 4UBOA 4GSXA 3G04A 2JBAA 3GEEA 1YVDA 3TNNA 4G8EA 2P11A 2HTEA 5CBPB 5T1LD 3TT3H 1ORSA 1T2XA 2Z3FA 3U4CA 1ZEJA 4NC2B 5LPNA 1B4LA 5IQ7L 2EIXA 3H42B 2D2XA 3QSKB 2G1JA 3SO3B 1XRSB 4Z7UB 1QBLH 1Z2PX 2GKGA 2P65A 2IAND 2VDUE 3V2GA 2B1HH 1XB6A 1YY8B 4Z7QE 1BFUA 4OIIH 3GXUB 1T5LA 4AYGA 1B0WA 4R2GB 5CCGE 5I75B 2QLFA 4PEVA 3GDBA 2WP8J 2VDNB 3CFBB 4AQAA 3G5XA 4ESHA 3ETNA 4I6GA 3V1YA 5IMMB 2CXPA 3TNFA 4CMIA 3RSZA 4ZMVA 3RA7H 5AENA 5CR9A 2KL6A 1M1YA 5HYFA 2AJYH 3STXA 1TR7A 5EG6C 1J2JA 1AFVH 2DSNA 5EXTA 4JG1H 5B1JC 4L3WA 4HEHA 3OM8A 3A37A 5HJBA 4ANWA 1EZVY 5L2JB 4B84A 4QJ5A 3UYPB 3A14A 2G6TA 3EUUA 4EKIA 4Y2VA 1AB6A 2BKAA 1PX3A 4HZUA 4PZZA 3VPHA 1WFMA 5GS1C 4DGSA 4GNRA 1HHKA 4ERSH 3HBPA 1V5WA 4KQGA 4KW7A 4KIFA 4U2BA 3UAWA 4PC3A 2Z31C 4YDKL 5PGMA 2FX7L 3R24A 5GRZA 1RPTA 4Z1MD 1G7MA 1YK1A 3EHDA 3U7IA 1Z5NA 5EIQA 2ZS9A 4G36A 1XH3A 1RUML 5DWVA 1RYYA 5D5MB 2WTRB 2W0SA 3SIXA 3PLNA 1A7AA 3W9BA 4CVXB 3D6FA 3I01M 3UHJA 3PVCA 4MA1C 4PJAB 5COBA 4GLOA 5I9LA 3RZCC 1QW9A 5JPMC 1DZIA 3AU1A 2OPHA 1R0WA 2YWXA 1L7QA 2XRAL 2RI6A 1HFKA 3ZGZA 4HYQA 4LW8A 1LEKA 4G5HA 1MVUB 4NNPA 3T1FB 4CJXA 1AXSB 1ZVQA 3D1LA 2RGBA 2J32A 1MPAH 4QEKA 2A73A 3B13B 4PN7A 4AVIA 1OPXA 3JQRA 3RRBA 4E9RA 2WZ5A 1PFVA 2HI0A 3KVDD 2YH2A 1CZRA 2VC2H 3MRGA 1SAYA 4IYJA 3L7CA 2D1SA 1DQSA 4MXWL 3VJRA 3LJ3A 3NBXX 4JW3A 4H26B 2XA9A 1GV1A 4QOKA 1PQZB 4F3FA 3W06A 4HDRA 4ZEVA 3MRIA 3L8FA 4MNHA 2VJQA 5JBIA 3VD2A 3GKZA 3MTEA 5DYTA 1K8QA 2Q9AA 2WIKA 3KQLA 4G9FB 2ZU6A 4H7FA 3NU1A 3D7LA 2OL3H 4ALAC 4HRAA 2P9BA 1Y0BA 3LTEA 4N1AA 3TQHA 3PIQB 1S9HA 2FNBA 4YAFA 1WB5A 2R0KH 4TWRA 4DDTA 2VNKA 2BELA 1NGSA 2V5SA 1FRNA 4JG5A 4MVCA 3WSWA 1CFNB 2DY1A 4N7MA 3MB8A 1BRTA 3PV0A 1PVOA 2J3SA 1PFWA 4O1IA 1ZWIA 2FBRA 1WPRA 3BPCA 1RKXA 3FT2B 3OMLA 2DHEA 1W4RA 2BIIA 3OAZH 1QXSA 1Y42X 3LXRA 3EASA 3SZMA 4DZZA 3U39A 2BVOB 1GKOA 3HZKA 4XE5B 1SBBA 4JM2B 4L15A 1M56B 4UQIM 1FDSA 3OXRB 1DKRA 1RI5A 3RNQB 1WETA 2YJ4A 2BFCA 4M53A 3RYHB 2CGRL 2K0RA 2MEJB 2JKTM 5FO0A 3KXKA 4U1MA 3UC5A 4KI5F 4P2RA 3JR3A 5EWLB 3JQCA 4KI7A 3EDFA 5DHRA 2X0EA 3P4UA 4FXLA 2D1YA 4BFRA 3R7SA 1LF0A 4FX5A 3DF7A 3QE5A 3WE6A 2F67A 2HXSA 1EB9A 3E9ZA 3QUAA 2H0EA 1AH1A 1IIKA 4E6EA 2C9BA 1K5GA 3FF7A 2W7TA 5IHZA 3WE7A 3PNQA 1NNUA 1C50A 3BQUB 4YJFA 5LGYA 1N8OE 1NGYA 3GFSA 5D3MB 4BEBA 4HCJA 5GOTA 5E9DE 2RG7A 3IKVA 3DVNA 3GDGA 2XOKD 3LDAA 3U7AA 1HC1A 4K5OA 3DMTC 1TM7E 3H97A 3WNNA 3T7IA 2I7XA 2JELH 2R83A 4KZDH 3DGDA 1T2VA 4L5FE 4C58B 2RKBA 2NW6A 1XGYH 1WUYA 1BYNA 1UCTA 3L40A 5AOKA 3NRBA 1X94A 4PRBB 2QXYA 3MGKA 5BN1A 3RQIA 2R86A 5CA0A 4OKIA 3CV3A 4F7DA 4LHUG 4S2EA 4PTUA 4OJFH 4IF6A 4GSDH 2EIEA 1N3YA 3EZNA 3M45A 3GSNH 1ZL0A 3ENQA 3KPTA 3VFMA 4HPXB 1H15B 4C5CA 3W57A 2P2LA 4K87A 1U8TA 3ZC3A 1Z38A 5LLIC 2ZB2A 2YVUA 2REXB 3O8RA 3CKKA 3NVDA 2JS7A 4IXTA 4ZAGA 1U8IA 4G6MH 4ODVH 3OZ9L 4BAGA 2XVKA 2NN3C 1JHAA 5JW4R 3JWIA 1QUEA 2B5OA 1LC3A 4OHMA 2JCCA 4PR5B 2XTAA 4JZNA 1NCTA 2ZAGA 3E0QA 3TW6A 1WZMA 2AC2A 3WCYA 1VIWA 1H0SA 3CFCL 4KE7A 1I3VA 1TYRA 5FB8A 4OKVA 2VR6A 5HRCA 1ESCA 5LDDC 5JVDF 2BMEA 2WZAA 3BAXA 3CVDA 3B3AA 1NW5A 4XMKH 1NT2A 4X97A 2OSBA 1XRQA 3TNJA 4Z53A 1BVNP 2EUXA 4P7KA 3VZRA 1DFIA 1ZWKA 5CFLA 4KK3A 1U30A 2EW1A 4ADIA 1YEHL 2D74A 2YBRB 1Q0SA 1XD2A 3G0IA 1Y34E 4CUZA 1G16A 1V26A 4ZMZA 4TLCA 4G71B 3K15A 4JL8A 4W6QA 3ID6C 1PG0A 4IIFA 4DGUA 3UMBA 3OR6B 5TMBA 3TRFA 3PWJA 2XT0A 1YR9A 2GJ6A 1KSRA 3UATA 5BSEA 2MYUA 5MENA 3C60A 3AJ8A 1EJ2A 4A2WA 5DNYB 1C80A 1QR2A 2H5LA 4GD3Q 1BE1A 3VXPA 4EVRA 2G9ZA 1VSQA 4TTDC 5LLSA 3U2QA 3PWPD 4MAUL 5EPEA 3BWVA 3GLIA 1NZJA 1NFDE 1TQUA 5KSUB 3P71T 1GZHC 4LMRA 5EEYA 3KEMA 1CDOA 2VLJD 4OLJA 4BCCA 4PJXB 4NC1E 4KDTC 3E6HA 4EJSA 1T10A 4A7PA 4ADSG 1G21B 1KYAA 3B2VH 3WN6A 1NFFA 3TSZA 4EKEA 3KBEA 4HK4A 3IBFA 2ZBPA 2BLFA 2WV7A 1Z0UA 2PW2B 1B4JH 4INAA 3F05A 3ESPA 5CEYA 2VO5A 2IPMA 2VKTA 3UFBA 3AACA 4V1CA 2I4RA 1EVYA 4MRSA 4YRIA 3PGXA 4U9HS 4O4HF 4WW2B 2Y2WA 9CGTA 1H42A 4MWGA 2I07B 1ZD2P 5M5BA 2DQ4A 5AZ2L 3W5JA 2O0JA 4IIQB 3O2JA 5LSAA 3DYOA 3IAXA 4H25B 4K9DA 3T54A 5KVDL 2JBWA 1B8OA 2EKJA 3MGAA 1RE0A 4FAAB 1R37A 2Q5QA 4HUQB 1GIGH 1SZJG 4NBXB 4O2CA 2X4GA 2WMNB 1U04A 2XCUA 3JALA 1GGKA 3RGVA 4RKYA 3RWIA 1XTRA 4E5MA 3BXHA 4PICA 5FOSA 1I1RA 3T7KA 3W90A 2CXKA 4CV1A 4KK6D 2EXXA 3HPLB 1B8UA 1T3TA 3X3GH 4NG4A 2FWPA 3B53X 2KJQA 4TMVA 3OPUA 2DQUL 4PWFA 1NQTA 4FFYL 2P8MA 1D6VH 4U0RC 2G0KA 5EHQA 3JAKA 3AYZB 4Y9FA 1PPIA 1GXEA 2P9JA 3GMPB 3MUY1 5DI3B 1SIBE 1QMUA 3E9CA 4E68A 1YB6A 1HE1C 1O9VA 3K5RA 1I0IA 3SX4A 5IT2L 1XDDA 2Y06L 4Q97A 3TYXA 2BPOA 5K2MA 2NY2C 4HMQA 1EUDA 4KBFA 2OP1A 1V3TA 2IE0A 2R4TA 5CRIA 2OZLA 2HR1A 4KO4S 4PP1D 3FZUD 1FUUA 3UYLA 3H3JA 2EADA 1PEYA 2B4QA 5EFZA 3BH8B 1NFRA 5CT4A 3C5JA 1HBJA 3CFTA 1P2CB 1UBEA 1T22A 1Y4SA 4G3YL 4P4TA 4DMLA 3T0EB 4L6CA 3IFLL 4PJEF 4RA6A 3KXDA 1HXHA 5C1BA 1JTOA 4FABH 2A5FA 5EPOA 3TH3T 2I5YH 2EZ0D 1NIAA 4H0NA 1L7EA 2OYCA 4JO4H 4IRUB 2ZCLH 4TT8A 2EUZA 4RWYL 1H2YA 1UZLA 1MRFH 4MS1B 3WS6A 4JSTA 1N8ZB 1ABBA 1JU9A 2XRMA 3KJ4C 1EQUA 3WRVA 4BDTA 3AHJA 4QNPE 1VG0B 2Q7OE 2VNIA 4I7EA 3KL5A 1ES0B 4AUEA 3EGCA 4WNAB 3DXAE 5CCBA 5DJ2A 1H4VB 2WTMA 1HDMA 5JJCA 1T2QH 4WDRA 1Y9ZA 3BVPA 4YX2L 2OAQ1 3VR5A 2GNOA 1ISPA 2ROYA 5CW1A 1FSPA 1EAMA 4YHZL 4AH2B 4CQMA 4WOKA 4YRBA 3R06A 3KZ8A 3QHFL 1GCOA 2OXEA 3I73A 5DHVH 2C5HA 4KDWA 1MZPA 2H0JA 5I1CH 4DIBA 4RVDA 3AXLA 2YZMA 6ADHA 2FSVA 3SSOA 3WJJA 1NG1A 2ESVE 1DJSA 2E7LC 5EF1A 3QM1A 5EU5A 3DLCA 3ZJ5A 3FU5A 4N65A 5KNCA 3HU2A 4N24A 3TH2T 1E2VA 3GN1A 3WYRA 3TWCH 1T4GA 1NFQA 4J75A 1Y8RB 3LGXA 3WYBA 3W3AA 5HHQB 2X2PA 2FJHB 4N2CA 3H16A 5DJDB 2PO6D 3MMEA 4OLAA 3FT4B 4Q05A 3AOGA 1KSJA 5DJ6B 1G7TA 4DNFA 2R6ZA 1CUEA 2AXWA 4I1UA 1KBVA 3L46A 3SHWA 1Q92A 1Y8QA 2NT3A 3ITDA 5BMVA 3KDPA 3G89A 4KUEA 2PKRA 4FYXA 1OA0A 1AJ7H 1C3JA 4FILA 1PZFA 1Q5PA 2JVKA 1GS7A 2E37A 1C8LA 3WNLA 4MA8L 4KQEA 3FKJA 3ZWPA 1JHKH 2I85A 4RE6A 1ILSA 4ZK8A 4MAMA 1E79D 5ARCA 3CNNA 3FFCE 1UC5B 4LQFH 1X5YA 3ETCA 4HWBL 2GM3A 1W5AA 1OROA 1OF2A 3LQFA 3C74A 3VSVA 1E1QD 1BDYA 1J1XL 1E7SA 1P18A 5B4MC 1ZPLA 1XSKA 4P04A 3RVOA 2AD1A 5IB3A 4CETA 4UOEA 3JD3A 1JPFB 1NCUA 3E2IA 1RPAA 1X2EA 2R8SL 4OJCA 1ETZB 1ZIDA 2X0IA 3BH4A 1V8DA 3G3LA 4PJ9C 1GZ3A 4QRTA 1GJRA 4PJIA 1A6TA 5FQNA 5EZYA 5KTEH 2W2PA 3ROOA 3B3GA 3VD0A 1TRHA 4M7PA 4BV8A 4L2LA 1SQ6A 4XPIA 1J05B 3LWDA 1UM8A 3FQTA 4FHFA 4AL4A 1E4KC 4LT7A 4P46B 1KWKA 4IIJA 4GM1A 5I1GL 3CEJA 5G0UA 1WHSA 1WQVT 1B15A 4RSYA 4BZ2H 3ZJVA 4POYA 5ISZD 4EO5A 2OAEA 1L5GA 3EY9A 3WNZA 4RIRA 3FUCA 3EJCA 5DTRA 1YULA 4PTTA 1XTPA 4O5LH 4Z7QB 3MCLH 5LP6A 4JUBA 2J0VA 4GMSL 2IAMD 1MFEH 3FO9A 5J4MA 4CAGA 1FBNA 2YLHA 5EFIA 4ZX3A 3GMTA 1CXLA 5AW3B 4MUEA 5E0OA 1V5FA 3MUEA 1NJ9A 1IKOP 5UKDA 3SLRA 4QGBA 2EXSA 2R00C 5BN5A 2PYZA 3ORJA 2V8OA 4NQSB 1G3QA 4BLTA 1JR3A 1IOVA 1GUAA 4B79A 2BFBB 1PLGH 3NPMA 3R5JA 5AJTA 2EBHX 3DV2A 4PYQA 3LC2O 4YHOL 2HC9A 1NL0L 3F7VB 4RZHA 5DX8A 1BX3A 4AU1A 2F4VB 5FXMA 4E5DA 3ZD6A 4EBQH 2ZXEA 1L5SA 4GP5B 2ZJ3A 1DQRA 2QVYX 2QE7A 3MV8D 4RPCA 1VZGA 1P33A 1CGUA 3IVCA 2IYFA 1YU9A 1TQ4A 3IBSA 4M83A 4KY1L 5J2UA 2JFPA 2IC5A 2CGEA 3DROA 4OP2A 4WUVA 4XOIA 1ZLUH 4PSUA 1JZFA 4ZQKA 3PHCA 4CADA 3FTEA 1M34E 5CYGA 4L8SC 1XMOB 3GJ6A 4YI3A 4W4OC 1NBZA 2GBCA 4B3CA 4WNSA 3NB0A 1VYUA 3LDBB 4S0XA 1H8EA 4FQLL 2VT0A 4LJKA 4RGMC 1PT9A 2DFDA 2FVYA 2IYAA 1U2CA 2F53E 3GJ8A 5D6OA 3UROR 1WBZA 5FAAA 5HFNA 2EAUA 4EARA 2XODA 4NLLA 1JKJB 4DLRA 3TM6A 4AO7A 3STUA 3BX1A 4H59A 2YUXA 1XK7A 3ZL2A 1H8LA 1IGYB 3WYNA 4LJRA 3UADA 3C7TA 1F6FB 1ECLA 5EO1A 3T5MA 2QKIC 3MLVH 1RZVA 5GSVB 1MCJA 3TVMD 5LWYL 2OTWA 3KKLA 2B1AH 3H9SD 4YRAA 3IVKA 2VXVH 1OXKB 4QWWD 4MCHA 1P7PA 4ODTL 4GDFA 4ZQHA 2YYSA 2RIKA 1N2BA 5GISH 4O51A 5F9JB 3KLKA 4MQSB 2FX8H 3MYRA 1VE3A 1K6QH 4UJ5A 2B3RA 4Q3AA 3REQB 1K7CA 3RB8A 3O4OC 5CDFE 4JJ7A 2GA9A 3VAEA 4N6RB 4PR0A 4Z76B 8LDHA 3N2JA 1BX1A 4K7PX 2CLZB 5CH8A 4LCCC 2Q6LA 2AJ3A 1LSSA 1VRWA 2FL5A 3UHFA 2DWUA 3L9YA 3W39A 2Y9PB 2QG6A 1XF3A 3V6OA 4G07A 2VZOA 5AQ0A 4LSDA 4PGFA 2ILVA 3JQ6A 4C0AC 1IIBA 5C1MB 4GNKA 4J7RA 2VZ8A 5GQBA 4LQLA 3AW5A 4APXA 1JLRA 5HEKA 3VVWA 3FLEA 4G5YA 3U46B 5EU7C 3K73O 2BTOA 5KQRA 3CSYA 4FMCF 3HWRA 2DRIA 4JC0A 1IOLA 4KJPC 4DB2A 2OKGA 1T21A 1M1SA 1XHEA 2WMPA 3LNHA 1EFKA 2QSCH 1T66C 2SKDA 1AD9B 5HF6A 2GHRA 2ZB8A 1WC7A 3NT2A 1J86A 5B38G 4PS7A 3KSDO 1TZAA 4AF7A 5ALPA 5IJBC 2J8UA 1G43A 1G7HA 4QTFA 1DPGA 1NJSA 1CD1A 4YCDA 1P5JA 3PDCA 3ADPA 3DE0X 1V3JA 4LRXA 5IK3A 1DBMH 1EBUA 3FRPG 1LBTA 5E8EA 4DFHA 2F59A 1B2WL 2VDRB 5E9DB 2FT6A 3T6XA 1FFSA 5JU6A 3QIUD 3NBNA 2G70A 4XWKA 1FRFS 2BCGY 2V3CC 2CJ3A 1MBZA 4X41A 3HABA 4BZZA 1TCCA 4JROA 3SYLA 1TZGH 4YJGA 2WHEA 3BAWA 1OZAA 4BASA 1U0BB 1IUNA 3Q1KA 4YC2C 1D5MB 5KSAA 5HTKA 4XNXH 4ZXBD 1KGDA 1W1WA 3K9NA 1Z3CA 4HNTA 4JFFA 1MKFA 2WOJA 4UI2A 3MT7A 1I4FA 2XV2A 1B6SA 4JV5B 4M6WA 2E7HA 3PFWO 4IM8A 3BIFA 4R05A 3S28A 3TSAA 5DTJA 3L6UA 2R69H 1GPH1 1ICEA 4JKIA 3T7TA 4LRIC 4FBLA 1E3DA 4LKCB 5A5FA 1N0LA 5CBEA 4OT1H 2FYYA 3SDCD 1EFTA 4RM2A 3WL7A 2AK1L 5KQMA 3EARA 2O2HA 1G7IB 1FL5A 5BR1A 1TPZA 2C2OA 2W2VA 4LKXB 1DVXA 4G5QA 4ZA2A 1CIDA 5E56A 4LNHA 1JR6A 1FZQA 1PQYA 4RTRA 2NSLA 4E5NA 2P3SA 3K0AB 4HK3J 2WAOA 4XI5C 1GGJA 1I1AC 1JAYA 1E0SA 4M9UA 4EI5B 1T0PA 4N3UA 1C5DB 3ZU8A 2OK8A 3DNFA 4EHAA 1PWZA 3ML9A 2VHWA 3UA3A 3V2HA 1PZAA 2WSLA 5EF0A 1XGZA 3WY3A 3NJKA 4AGLA 5A0FA 4G0ZA 2AEPH 3A06A 4IUCS 1BKYA 3ESYA 4R5VA 1FNFA 2P9QA 1QP4A 4PFSA 3FA2A 3TNDA 1A4AA 1QIFA 3KWVA 3BIOA 4X90A 3C9NB 1N1DA 5K9JH 1E6KA 4LJ5A 2ERJC 2XQKA 1EKXA 1FFCA 2PXYD 3E0GA 4JEHA 5KCZA 1D5ZB 2JKIS 2C29D 5TD4A 1E2MA 4XVJL 3W11D 3I6GB 4UMEA 4CIYA 4EPYA 2C9VA 3UPDA 4YP5A 2FATH 4MWZA 4U6HB 5F21B 2H9GB 1MX3A 5TDOA 2V2WB 2V7QA 4JYMA 3P3TA 1SVNA 4RK0A 3H1GA 3FR7A 3KL0A 4PJBE 4YAGA 2FB9A 3H1FA 2IQIA 2A30A 4K9LA 3LC0A 2O30A 3GUUA 1PSZA 1E50A 3NWEA 3OG6B 4ZTPL 3WKAA 1WJ3A 4EW1A 3UIZA 3QJ5A 1COWD 4Z54A 4UMSA 2NU8B 4Y0GA 4PJ7B 2W83A 5ILQA 3HNVH 4CNIB 1IQ0A 2YCLA 1SVMA 2FXIA 1R0CA 1IBGH 1IM3B 4OLWL 5L95A 4QX6A 3UT6A 1CFBA 4JZKA 3D69A 5DWPA 1LDEA 3FMVA 1OF1A 5BWBA 3FNGA 1JQEA 2FUCA 4R3NA 4DT1A 1XEUA 1U2RA 1W0JA 5A4IS 5EIHA 1V11A 3AERB 4Y5VB 1OD9A 4HDAA 1DJMA 1XTKA 4Z49A 1FH2A 3GH3A 4RQQB 5H35A 2OK7A 4CM9D 3DJZA 2OFQA 1LWJA 4WINA 3DOEA 3JS5A 3LL4A 2RGXA 5DDHA 5IWCA 1JG2A 2ADGA 3ZTEA 4PRLA 3KXFA 2Q87A 4O4IB 3HE7C 3X1NA 4U1JB 4LE1A 2FX2A 1MB2A 4L85A 5EMYA 2V5AA 5INCA 3RG1C 3LTNC 5JBNA 5I19L 1NVXQ 2ZOSA 3NO4A 1ZAYA 3ME0B 2D03L 4UT9A 3HADA 4YR9A 4D45A 5HYQB 4AEIL 5EC2B 1YTUA 4M02A 1UACL 4ZMSA 1JYFA 5B1DA 3JT2A 5SV2A 4CHTA 5KVSA 5DK2A 1Z32X 5CMAA 2FUKA 4YBLC 3QXAB 5MEOA 4LYFA 3NBZC 5D6DA 3VGHA 2IXBA 4PJEE 5LQRA 4MD5B 5AB2A 2R2BA 2HN7A 1EO8H 2DLNA 2MQGA 3UOAB 3IBCA 3VH8B 5IVIA 3I5XA 1CTOA 2GTPA 2ZIFA 5I01A 4ZBJA 3FSRA 3B8SA 3B2NA 4U3CA 5JECA 2JIXA 2DIBA 4M7OA 3SY0B 1Y0LA 5ECGA 4Z7UF 3UF0A 4IKOA 4OQPA 4Y30A 1DC7A 2W8BB 1SLUA 5HYSB 2O2JA 2DPMA 3D3VD 4D9QE 1UKEA 2GJZA 5DYYA 2A1IA 4BZ1A 2PRJA 1ZJ4A 1DWUA 2XBTA 1OU4A 2O4CA 4KKPA 1KCVH 4FEAA 3VBCA 3ZDZE 1XE3A 4TRRA 3K0FB 1ZXBA 2DWQA 3HDTA 2YICA 2YA1A 1H6DA 3CHYA 1MQSA 3AI3A 1LKZA 5EF2A 4AL8H 4KQ4H 1X5LA 1S9YB 3G08A 2IDZA 1QSFA 1BD2A 3EUFA 5FUOH 4K7PY 1D7CA 3DZIA 2Q7DA 3QEMB 1L4HA 3DUUA 4F8TA 1Y1TA 5GS1A 2XTJE 5LQDA 3F6EX 2ZG2A 1LW6E 4QBHA 4YNBA 3FTSA 4ZHQA 4HW6A 1EHLL 3TPFA 2IEAA 3A1EA 3O8XC 1WO2A 5D5MF 5CFOA 1PG7H 1ZE3C 1QIEA 2PXCA 2VAJA 1DBRA 3A10A 5DRZA 3PNWA 5BVPL 1DVSA 2WIIA 3G5UA 4PJAF 2DMRA 2NSJA 3DXAB 4WK4B 4YC7A 1S9KC 4FN0A 1VMIA 2Q4TA 2RMKA 2YZ2A 4OY9A 4HK0B 3UMVA 2IYLD 1YAZA 3D08A 2WLSA 4QXWA 2ZJ7A 3SDAC 1RI4A 5FWNA 4FD0A 4JFEA 4XP5L 1SLVA 2KHZA 4JJ5A 3RZCA 4FE7A 5JPMA 4WOPA 1QZ3A 3CBKB 4ZVLA 1NAKL 4IWNA 1JJVA 4CQLA 1U9KA 4X66B 4Y1RA 2OBLA 3V95A 1KJ9A 4RKEA 1THZA 2FJUA 2I8LA 3PYMA 1BE8A 2VG8A 3ZJAA 3KLHD 1Q20A 4K3UA 6FABL 4RO0A 5CD1A 5TMDA 3EN0A 4YGVB 3QCTL 3KG2A 4JHZA 4FZEH 2PHZA 4BMDA 4UM5A 1VBKA 2VWEC 3ZL4L 4HUUA 3RKPA 4A03A 3RIAK 5F7XA 1WS6A 1OX5A 1IN7A 1ZZGA 3I42A 2QHRL 4KQ2A 4DAEA 2P4QA 3WY2A 5JPNC 1H9VA 7CGTA 4ND1A 3K4HA 2A5LA 5JR1H 4PBDA 2H7WA 3MLSL 2UKDA 1QKIA 1XQXA 3QJRB 4KVZA 3RUHA 2YN3A 4B0MB 1L9QA 1P4IL 2GASA 4KK9C 5AEAA 4AZ0B 5LJIA 3C6ZA 5AUQA 2ECQA 1T1YA 4YSEA 1N5KA 3WIHH 3IT0A 2DW5A 1XNJA 1CQZA 1ZH4A 5FOTA 1P60A 4JM2F 1KEML 2DQGL 4YQXL 1ZMTA 1N6IA 4KOCA 2LT9A 3BK7A 4CG1A 4HFWA 4HIEA 3HDQA 2ISQA 2UXTA 4R0VA 1O77A 4P53A 1J5HA 3UTDA 1OMOA 4KRYA 1XWWA 4RW0A 4ND5A 4LRQA 4YBQC 5KPJA 3LT1A 1HDEA 3H6AA 5HK9A 4KNSA 1PZ5A 3N2EA 1A0QH 4JKNA 4YI5A 3IAS1 3V0DA 1KB9K 3OCCA 1GDHA 2UX6A 2DV6A 5I17A 4QOIA 1P31A 1EFPA 1KDRA 5KWIA 3SEZA 1Z6JT 4JO8A 4OF5A 2H0RA 3S1LA 5C0FA 4LOJA 1E6UA 2VQ6A 1LO3H 1PU2A 3CC5B 2Q5EA 1PDOA 3IHKA 5JNRA 1G6OA 1TVEA 1SXBA 3S37H 2AI1A 3U6RB 4DQUA 2NNFA 3T1WA 3VR3D 3VE0A 1NMCC 2K6GA 1WMBA 5KAMA 2VATA 5DJXB 2GZ3A 2KWIA 2NTVA 4UARA 5TGZA 5F0JB 3ULUL 3SKJL 2YPVL 1Y3BE 3CH6A 3COSA 1ZHNB 5JW3H 1WLSA 2Y07L 3QH3A 3VB9A 4WW0A 3B6SB 4M1OA 2GITA 3APNA 3G0DA 2IDKA 4ACTA 3H6GA 4GO6B 3V4OA 1KT2A 5L3QB 1L6XA 1UOLA 4OU3A 1XYGA 3AZOA 4IVNA 3BSZH 4BMOB 2B98A 4CTJA 1T8TA 4ZW3A 2GERA 3RUFA 4LDPA 4GI2A 1GPAA 1QOKA 1QWHA 3ETDA 3C3EA 2XN1A 2YEVB 4YWJA 4QE3A 3PDOB 1NJ5A 4I18B 4JFHD 4ZMPA 3UB3A 4P7JA 2NPLX 3DHMA 2VH5L 3R5FA 4JFQB 2C5DC 1EAOA 1LL1A 4LHUA 5H37H 2Q6VA 1XPJA 2QPSA 5GZND 1YAJA 5E2BA 2GCOB 2YOFA 5DNDA 4YV1A 4RORA 2AX3A 5FK9B 1WW2A 4PAOA 4II2A 5D8JL 2DLGA 4U33A 4GRLB 4XMLL 2V37A 4BJ3A 1P5VA 4QXUH 1FNNA 2A1WH 4N6NA 4PLKC 2P4SA 3VV2A 3MOBL 3RIMA 3ZVKA 3T4YA 3FSVA 1JSYA 2YFKA 1EFHA 2AFIB 4GMTL 2X05A 4X5PA 4IRSD 3S88L 1KN4H 3B1WA 5AVUA 2AFNA 5AK0A 2ZOKA 2CBGA 1U0SY 1T1EA 3A6ZA 2OAAA 1E1DA 2ICWB 2JA2A 4FTVD 5B7NA 3AR2A 2OBMA 1HE2A 4JPQA 1VA5A 2Q1EA 1J18A 2MYNA 5E4EB 4GYKA 5FHRA 4LLQB 2AR7A 2L7QA 5BURA 1TJNA 4D7AA 1G8KA 2GTWA 5BR7A 2GF0A 3MPOA 4OXXA 1L4NA 1FLVA 3QTTA 4WADA 3CRRA 3ZKQD 3V80A 1K8DA 5GGVY 2E4ZA 5DM0A 2PCYA 3EYWA 3CINA 3CZLA 1IGMH 1D1SA 3MNVB 4J4HA 4BWUA 4A6YL 4KXZH 2GVNA 2DKSA 4GI8A 3IETB 3TZCA 5GONA 3MUJA 1MDFA 1MJGA 3W0WA 5AAWA 3L3KA 4X1YA 3HEBA 4KYUA 2G0LA 3WAJA 2A4MA 4R9SA 4PJXF 3L3IA 3HZZA 2IPOA 2JGIA 3EXEA 3QQ5A 3N2ZB 2Y0SA 4D6PA 2F1RA 2RG1A 5MHTA 2PWGA 3OIYA 4LLUA 5AW4B 5KSBB 3IGLA 3BGDA 4GE3A 1SBSH 1E1MA 1NHWA 4QHPA 5I1EH 5JANA 2QI9F 4R4JA 2Q21A 1OAKA 3D2UA 4JDTL 2QD4A 1QHNA 4DJEC 4OHWA 1BS1A 4V0MA 4GMXA 1RWVA 4WW2F 2E76C 1RXEA 1GVNB 4MH0R 1U4NA 5DD1L 3LLMA 4V1DB 5LZ9A 1CE1L 4R7DA 4LK4A 5DOZA 2PSJA 3ZDXE 4IJ3B 3V9FA 2IIPA 1YZ3A 1Z7YA 4PV8A 1PJQA 4DC0A 4TV8A 3B70A 4F2HA 4M88A 3ETBJ 3UGKA 1C1XB 4QRSB 1KZ4A 2V6HA 2VP6A 2NNXA 1L0YA 5AI0A 3MTXA 4QYOA 3KPWA 3CX2A 2I25N 9MHTA 2O7VA 4X95A 2PDAA 3KVOA 1ZA1A 3D81A 2OSYA 3FUNA 1E1CA 5HKKA 2WJ7A 4DAGH 3PDDA 2PMEA 4B7XA 4CR8A 2WO4A 3UTTA 1GITA 2GXUA 5GRVK 4QREA 3U26A 3BMXA 5MI0C 4U05A 1UH5A 1C7JA 4WGKA 3BKCL 3ZNOA 3TTTA 1BOFA 2VYQA 2HIMA 3KBOA 2G06A 3DA8A 2A4EA 5GGYA 3Q1SL 2OCBA 2QN8A 3EXFB 4WHCA 4N87A 3ZW7A 2AJUH 2IPTL 3B7WA 1P7HL 3D25B 3HDYA 1F38A 3D43A 3OEHD 5DUMH 3DLAA 3LC7O 4HNUA 4ZI7B 1K4CB 5FTLA 4L73A 4OFBA 2HFGH 2L3BA 4MUFA 4UUQA 4L9LA 3SKUD 3H0EA 3RC1A 3ZH9B 4LLMB 5CA1B 1KMCA 4PSDA 3DNPA 4HIJB 4IU2A 2ZBUA 1Q0TA 4OCXL 1YE3A 3OLYA 2JFNA 3WA7A 5HRAA 1ORWA 2PJZA 2Z6FA 1Z68A 4A27A 2VP2A 1YRQA 3TZVB 5L8VA 4AJPA 4V1CI 3DX4A 1Y1RA 4N2LA 3SLKA 4FL4C 1QQTA 3HACA 5I4KA 3IURA 3KLOA 4MW0A 3WXWH 4ANKA 1U3YA 5C09E 2HSEA 2C4FT 1RERA 4AZSA 2EO9A 5CCHE 4OJTA 2WXIA 2FFRA 4EJSC 3B36A 1G5TA 2ZYWX 1NJGA 4MA7H 4EDWH 3Q5EA 1IL1A 2QTEA 4PPNA 1KDYA 3CH7A 1L4IA 2RALA 3RVPA 1PE0A 4MS3A 1AX9A 5ID0A 2Y22A 4DEVA 3I6LE 3VI3A 3GXNA 1P0MA 2R8YA 8FABB 1ZW6A 2GSWA 2WOOA 4BRZA 3ARFB 1GGCH 2XZOA 3QISA 3IE2A 4MHSA 1X9QA 4A3SA 3G9AB 4B5ZA 3EYQD 3MC1A 1OU0A 3KJHA 3E1SA 1H6BA 4WKZB 4X1KA 1AT1A 3H11B 5JAIA 2XGSA 3ZHVA 3FOLB 3PDIB 4FFBA 1T0JB 2V7NB 2ZX8A 4MWBA 2G28A 3DETD 3NRCA 3U1VA 1Q1EA 5EA0H 3QHTC 1CZKA 4KKCD 5DZOA 5TF4A 4LP8A 4OJNA 2E7LA 3NNDA 4UD2A 3KHSA 4BWYA 4PJBB 4LYDA 3T5PA 3RLIA 3RGVC 1T9CA 2HPAA 2OR9L 5AOCA 1SBCA 2G9VA 4PVDA 4M61B 3K6SA 1N8KA 3QY0A 5EJ6A 1YXMA 4PG5A 3GBSA 1WPQA 5EEHA 2WJ5A 2K87A 1X14A 1BG1A 1B88A 5T3XE 4PLYA 1RLIA 4KAJA 3A6DA 1E28A 5DT1L 4IW4C 1ENPA 4ZPVA 1Q12A 3EA5A 1OLZA 4OBWA 3HB9A 2V7VA 5H70A 4AVYA 4LB8A 1VCAA 1Z8NA 2XKUA 2VA9A 1GA6A 3LL7A 2VQ3A 4JQYA 3DZFA 5DNVA 4GR5A 3CF4G 3GC3A 4XWOD 1U9YA 2Z98A 4PHTA 4Q4AA 1J5EB 4X6FB 2ZJSL 1L3IA 5C0CD 3MX0B 3TIFA 4MVJG 4BKOA 3IPRA 1FK8A 1I2BA 2J1YA 5PNTA 4B27A 3DO5A 3HVUA 3PB3A 3ZWXA 3HQ4O 4ZYKB 2HJGA 4E33A 3LQAL 1EERB 1YT5A 4W6XB 1F8TH 5DSCA 5HY9A 1BF2A 4X6EB 4KFRA 3UG7A 2IPKB 4PCLA 4CXMA 3VJ6B 2XWJA 2WU0A 3BB3A 1I6LA 5AKZA 3UWDA 1BLNA 2NOAA 4KTGA 1S5IH 1T6NA 3N1PC 1X9LA 5HJ7A 1BZQK 1NPJA 2RKOA 2GTHA 1N5RA 1CO1A 3RREA 3N6XA 4XM0A 3KE0A 2GDZA 3WS6C 2GEJA 3W3BA 2BK8A 2FD6L 1MV8A 4QTHB 1E4KA 2F1BA 1P39A 1TD1A 4QBFA 3UPRB 2HFEA 4BC1A 1N3LA 1YDWA 2YWGA 3QYFA 5LB1A 1MO5A 4ARSA 3HRZB 5BNIA 4Z7QF 3ZHSA 2JI4A 1CG9A 5FM5O 1ZESA 4HEQA 1YVLA 5IB4A 4L3AA 4E9TA 4QF1B 4QVIA 4QY8B 1HIML 1NULA 2ZB7A 5CN2A 1P80A 1A25A 2DYRB 4HEA1 5JOQA 1TYEB 1QE3A 4P98A 4OKDA 2YDXA 2PRYA 3WJJC 3O4IA 2AG8A 4JFAA 2J9GA 3ZDZB 5SV3A 2XNKA 2YUWA 3THSA 2R00A 3U7QB 2JIMA 1HCZA 3KJQA 1O9BA 4IS2A 4TYYA 3K1AB 3ESMA 2FJ0A 4IUYA 2EBFX 2WUWE 1VM6A 2P9FA 2WC7A 2R8OA 4K3EL 3UAOA 4HN4B 2J6IA 3WB0A 1E65A 5F1NB 2XTJB 1TZHA 5TX7A 3TJZA 4AQYB 4MV3A 1US8A 1DKLA 4Y4HA 3WXMA 3A1DA 2RCSL 4BSVA 4H4EA 1HL5A 4P4GA 3H5LA 3NBYC 2IALA 2W2LA 3SZKC 4PPTA 5M04A 1PK9A 1SXPA 1XAGA 2DH3A 1EJ8A 3H17A 2H32H 4IOMA 1M6VA 5LN1A 3LVRE 4BJ1A 3CDGA 2R4QA 3IHTA 3DSRA 4MQXC 1G7LA 4KV7A 2CXUA 3RY4A 2JXMB 4UTAL 4JX0A 1VLLA 7AT1A 1E4XI 3TRDA 2XD9A 1PBYA 1FNDA 4IJ6A 2R8EA 2O8BB 2DPKA 1YB4A 3GPCA 3RP1A 4BPBA 4GXUN 4MSWB 1Q6YA 5J4KA 3B7TA 4G8BA 3EIXA 2KYIA 4RISH 3OAAD 5ADOL 1EEZB 4XCCL 1HSOA 1L3CA 4EHIA 2J08A 2OQJA 5F0MB 5IVXA 4YMWA 2D31A 4DADA 4H13C 1HFEL 3INNA 4YWGH 1D6MA 4RA9A 1UPTA 4MMZB 4G80A 5T8IA 1VYVA 5JI2E 1YS1X 2E6KA 1FI8C 2PYED 1N6NA 4MP6A 3R3WA 3QZWG 1YS2X 1N2RB 1U02A 1L8XA 4HGQA 5IFLA 1BRMA 1TTBA 1LI7A 4OEHA 5IDYA 2O26U 3GFUA 5T1MA 4FQIL 2OVFA 3PXGA 4LCCA 1N8SA 1JF1A 5GADl 3C87A 1PNRA 3OD5A 5LP6C 1CS0A 2V3EA 3PLAE 1KEZA 3GMOA 3A7EA 4CR6A 4XIFA 4O2BB 3TGLA 3CZCA 1OT4A 3FYDA 4W5JA 3INRA 2NTNA 3O0LA 3VWJD 2OFXA 2HKFL 2VXUH 1I8MA 1XVTA 3C1OA 4R41A 2IH3A 3NKLA 4GX5A 2CO1A 3C08L 1YVPA 5BO1H 1E1KA 1QYVA 4P33A 4PY2A 3R76A 3FJ1A 4LYYA 2ENUA 3CVUA 4OLYL 5E2JA 4BCDA 3OPXA 5KKAA 3BMOB 4XTRD 1X8XA 3VFRB 2OR3A 1J5CA 2WYUA 1A8IA 1YYLL 4WY7L 1K3UB 3IDFA 4XC3H 2NW3A 4GBGA 5TVKA 1D8AA 2AEEA 2WVVA 2JJWA 4XGZA 2CEAA 3UUFA 2PKYX 3SGDI 5B38A 2YY5A 4KP7A 1W91A 2C3PA 1YQ9A 4DUXA 1SBTA 1VMEA 3IO3A 4E2WA 3MEQA 1A8JH 4N7JA 5J43A 5BO0D 1YEIL 4H7DA 2QM0A 4V2IA 4DIXA 4GW3A 1P69B 3BE5A 3D85A 4EHLA 1B73A 4X99B 3JW8A 3O4LB 3FYUC 3FRPA 3GX1A 1UJ5A 4UV4H 3FSOA 1DJHA 2AR0A 2VE6B 3CUPA 3FYHA 4FMKA 3U4DA 1IDN1 4K71C 1UEXC 2G9HA 2AKYA 4TXHA 3MRLB 3W05A 3QUXB 3JX9A 3KEDA 1ZQ1A 3KR1A 3WFCH 3CTPA 3OHSX 1CS6A 5TQ2A 1M8JA 1SMAA 1T3ZA 2ZF9A 3PKIA 1W7AA 3PYCA 1FTNA 4I99A 1FAIL 1V55B 2IZ1A 2WT9A 2QLVB 3LG2A 2BY0A 2WIGA 4AG4H 1VYHA 2W95A 4FJ2A 3NCJL 2W2MA 1Y6JA 3NQ41 4HHGA 2NSMA 3ZCUA 1KJMB 3AQYA 1U0QA 2E89A 1YVEI 3KMDA 2B1QA 3K9BA 4HVBA 5E7JA 1CYXA 5EINA 4JVNA 3VYVA 2RQEA 4HB2A 1JSCA 5E1GA 4GFTB 1AUQA 3B3IA 4LRIA 4R8WL 4PRID 4IHKA 5I0WA 4C43A 5F9DC 4HUKB 2FOIA 2GAIA 5A62A 1EZVX 2AQTA 2J7PD 1ZG3A 3ZGXA 2NY4D 3IGFA 5F2KA 4E1AA 4YP9A 5F3HB 4YDKH 3OQ3B 4E9QA 5JEDA 2XRZA 4WLNA 5KCMA 3FYTA 1AGEA 3V6OC 4WNIA 3GJXC 5ELIA 3N2KA 1P2GA 1IGCH 3QOXA 1EUCB 4RHTA 4KC0A 3AB7A 1MELA 2PQ6A 4FM9A 4N8CL 1YAHA 5DLYA 3KJEA 1S7RA 1R9NA 1XZQA 2ZJ0A 2DHDA 5GS0L 2LDXA 4BRVA 1XF5A 1U1DA 1G21E 2A9JA 5A2GA 2F8MA 2NY0D 4I4WB 5ITZA 3V0WL 4I0PD 3UJ9A 2C99A 5JSZB 1ZEAH 3IP5A 3LA6A 2QGEA 3SGLA 3O75A 4QJIA 2ZZUT 1X39A 2WHRA 1E4JA 2F43B 4FRWA 4C06A 1G9NL 3HHMA 5DRNB 2X70B 4XA8A 4OI9A 1KB9J 2GQ0A 2WXMA 3KYMA 2G4CA 5B30A 2BEWA 5AVWB 2A2QT 2C9OA 2BZSA 4F5CE 4B96A 4QM7A 2F64A 1BJKA 4AP9A 2PLAA 3R3JA 3CGGA 5C8XA 2O6CA 3WLMA 2ZUXA 4HNAA 4BNNA 3QEGH 6ABPA 3FAKA 1VJ0A 3DZKA 3QJGA 4RGQA 3CM0A 2VM9A 3MRRB 4OAWB 3V0FA 4KVGA 2QUIA 1UJMA 4PJ7F 3KHKA 4EGAA 1JAXA 2EFDB 1URIA 5CJOH 3LS4H 4EQ6B 3MTQA 4CLXA 1AKVA 4HB0A 1AQDB 4OIBA 1S5PA 2CH8A 3ZT7A 1E7QA 1SOKA 3AP1A 4NHUB 3BL6A 1WVMA 1V7ML 2OM6A 3O93A 4AKTA 4G9DA 3M5CA 4I9HA 1E59A 1KXJA 3EJQA 3EZLA 3T08A 2BKLA 3UTSA 3VVLA 1KPGA 1WG8A 3MCG1 1ZH8A 5E94A 2AIRA 1RZIB 1SY7A 2ZI6A 1TMKA 3E22B 4ZZKA 2AV7B 4L37B 2KDYA 3ZDXB 2XKNB 3HZMA 2XDAA 5AICA 1QU3A 1HYRC 1ZSDA 3PRJA 2UXDB 4S11A 4O4IF 1M5UA 2WR8A 1AS2A 5SWQB 1Z9SB 4KN9S 4MW4A 4KU1A 1YR8A 2CGRH 1OFUX 5C81A 1SULA 4Z78A 2OW6A 3ULSB 4W9FC 2RAFA 4OHVA 3IM1A 5BQOA 3LYRA 3I9V1 2MTPA 3APFA 4CSTA 3SKNB 4F8NA 4Y0NA 2WKQA 4JWTA 4IBTA 4LYEA 3P0GB 3QUZB 4U1KB 1UMDB 3PHOA 3GHEH 3OLDA 5AVQB 2OXFA 5K3BA 3F4BA 4YHYB 3LZRA 2H0FA 3QG7L 1OI3A 3I6SA 2OSWA 3IBEA 4HDCA 1E58A 3FN9A 3VYNA 5BUPA 5H94B 3WVNA 4ISVB 3MRDA 5M2QA 2J2ZB 8ATCA 5TDPA 3PNMA 1QI5A 4AE0A 2CVFA 4IRJD 4Q3OA 1OLXA 1UXWB 4NU5A 1QIIA 3BHIA 4CCAA 1LUAA 3ZRCC 4IK6A 3CUSA 3RDTB 4NQXA 3EZJB 3M6WA 2YRZA 1HI9A 2VAXA 3TQSA 2ERYA 3BTUA 4PZUA 4EIBA 3ZJUA 2K6WA 4KH2A 4HJSA 1ZRSA 2OXIA 3GBPA 1JBJA 3W5UA 4U1IB 3FPYA 1H9CA 1FDOA 4GUPA 4KRMB 3PR1A 4WLUA 2VQFB 1EGJL 2IZ6A 3A28A 2H9AA 2J4WL 4RHFA 3W5VA 4DN3H 3CCHB 3HG0A 2E9JA 3FYSA 1VG8A 5C37A 1S7VA 2ITCA 2A94A 3R9IA 3Q6FA 2VHXA 1Y4ZA 2ZX9A 4K94C 5C09B 1R0LA 4IS3A 1PAZA 4OCWL 1HI6B 1F4VA 2WYZA 4B71A 4DMHA 2NXCA 3VPXA 4PRAA 4DP1X 5AO9A 1QQDA 3O8XA 1YO6A 3R4VA 4X7TA 1R4MA 4TSAL 1K5WA 2ET6A 3DRTA 3I64A 4RMJA 4XJTA 2A5UA 1ET8A 1VC2A 3OZ9H 1XA4A 4QPZA 1JZIA 5M94B 4LLYB 2VK8A 4OBBA 3HB0A 2NQDA 2Y7LA 3S2IA 1QRND 1T1ZA 5EU4A 3SDAA 2QPOA 3S68A 5D1XD 2R11A 4QL3A 3SPCA 3GINA 4KPFC 5BV7L 1R24A 4MR7A 2QMHA 1YJ8A 2YV5A 4RAVA 1DIHA 2XMZA 1YIOA 1NLDL 5HHXL 2M1ZA 3ESZA 4YDJB 3ZZSA 4Q0MA 5BPFA 1L4KA 5T3YA 5BOSB 4LY0A 3Q8WA 2VPTA 1S89A 1TZIB 2KPWA 4JFDE 1IPHA 1U0EA 3D31A 2N9UA 1QBAA 4NZRH 1Z29A 1X7YB 4ZYXA 2VTFA 5LNDA 4UTBL 7ADHA 4QGYA 2I2FA 3C5ZC 4HQNA 2BMKB 1JF6A 4QZVA 1RMYA 4WCFB 1QTRA 3LVFO 5D6DC 3BKYL 1PJ4A 2WAXA 3NGMA 1ORHA 4EZEA 5F8QC 2B92A 1INEL 3R6LA 2D4AA 5CSZB 4ZX5A 1HT6A 4XBGB 1YS6A 1U8AA 2J56A 2H1VA 5ECGC 3WMQA 4B9YA 2PGIA 1X5JA 4HUXB 1YKFA 4MAUH 5FL7A 5EC8A 4QGHA 1NC2B 1CIUA 1HDCA 4MQ5A 5FYJH 2N0MA 2PLFA 3ZIDA 2OMVA 5EUKB 2ORVA 1T0OA 1CUZA 1SVCP 1MWAB 1TIUA 1SD1A 3LV8A 3NAMA 1W88B 1U8QB 2VSYA 1LDPL 4BEIA 4JRLA 4S0SD 3RRMA 2P4EA 3JQAD 4I2NA 3EBIA 5EO9A 2QD3A 2NXJA 3K80A 4AGMA 4JNKA 4AN4A 2QSJA 3O95A 2H5JA 3LT2A 3IXAB 1Z2NX 3LY8A 4IGBB 1NP7A 1X15A 1QIKA 5GMOA 3FPBA 2NOYA 5AZ2H 1UT5A 1H1LA 2HLFD 1GGUA 5CJPA 1V48A 3LQ2A 4RVNA 5A4KA 3C5CA 5HHNA 3EVEA 4NBWA 4LDLB 1NG9A 5CUSL 1BN6A 4WKXA 1KIPA 2IEGA 3VFSB 2YC1B 4Y2OB 1ZVMA 4AX3A 2CDEB 4TULH 2V7BA 5IWLC 3SDDD 2V55B 3IV7A 4FLOA 4OJYA 2GVZC 5BRAA 3F6JA 2YXMA 1N2CE 3PXBA 4E41D 5AVZA 1NF9A 2VXQL 4EPRA 3ZXUB 1P2SA 3LFTA 2BY2A 4NN7B 4C4UA 3S8FB 2FIKA 2WAHA 4WZ9A 1XD8A 2F1JA 5DEGB 4LZWA 4UNSA 1ECFA 5IJCC 1CQWA 3TZHA 4OLUL 4CEHB 4QD3A 4GKSB 3R7QA 3T5CA 1EWKA 2JLYA 2WWMD 3ZUCA 1HHIB 3CTMA 3B9KC 1G0YR 5TMEA 2ZXWB 1D09A 3WA6A 4EY5A 3L8DA 4B46A 5JORA 1JLKA 1D5XA 4LVCA 2W9EL 5FDYA 4BUHA 2C3WA 3TBSB 2Z1NA 3UTPE 5L2KD 5CS7A 1CVLA 2ZS7A 3FOZA 2GIYA 1RZ8B 1JAEA 2IEYA 1E1NA 1WSST 4S0TD 4AW7A 1ECGA 1AZNA 3PWVB 4RNRA 3UWMA 5IESH 2DQJL 3T3MB 4KH0A 4G3YH 3HIZA 5H4GA 3LUFA 2JFWA 1NBHA 1RIVL 3IFLH 2W43A 2FEMA 5AKGA 1CFVL 2I29A 2BP5M 5GGRB 4NBKA 4AY5A 5JTTA 2Y5QA 1NPTO 4DYVA 5DD6B 4RWYH 3S37X 2CHEA 2W07A 1JGTA 1D9KC 1P5UB 1HE7A 1TLMA 1Z45A 1DFXA 1IE3A 2X4SA 4M98A 1HL9A 5TH2B 3A2MA 5GS2H 3TG2A 2Q0HA 1ZHKA 1AGFB 1NWHA 5DE3A 1IUPA 2G1KA 3UG4A 2D7QA 4Z5XA 2PANA 4PGBA 4KVCL 3G2HA 4JI1B 3T2NL 2D7PA 4I9XA 1EZ4A 4I9NA 1KNXA 2VAVA 3MV9A 2WFLB 2J9ZB 3OX8B 3QHFH 4KRNA 1GRQA 2AN1A 1N5LA 3EQ8A 2ZYDA 3ABGA 1XMPA 1HH9B 5DISB 3PIIA 2EIJB 3DDWA 3E81A 3A1UA 4JOCA 2FGJA 4TVPE 2ZG6A 1DE0A 2DYPB 4Y2DB 4C4ZA 1LK3L 6PAZA 3N1MC 3PFNA 5AD0A 3TCXA 3NUKA 5JJBA 4MD4B 2F3TA 5DVLA 1XNRB 3H05A 1GCFA 5KSBF 1XL4A 3NCXA 4L8DB 3S96B 3STTA 3NABL 4N9OB 1M2KA 1F1GA 3OUZA 4AMKL 4NIYE 2Q1XA 3BCHA 4D96A 5EPUA 1P2VA 1U2HA 1JIIA 4MPTA 1M5RA 2PS0A 1ICIA 2IGFL 3KM1A 1IJFA 4JI5B 1BQHB 1AKNA 4MA8H 3A6CL 3EE6A 2RHGB 1J20A 2FSPA 2DLFH 3HHRB 4DJMA 5IMOB 4AQZA 3NFRA 4ETWA 3GLVA 3GQVA 1DPFA 1MXHA 5LXTA 4XLZA 4HWBH 3WLPA 4HSCX 1GZUA 1E42A 3QY9A 2A7QA 2D2CC 2HWZL 5DJCB 1J1XH 2OHOA 3L7AA 3QPKA 2XG4B 2BFEA 1UASA 3SQLA 4I1IA 5HGAA 2XYHA 2YK1L 3DE7X 2H1OA 3AETB 4J7XA 5K0LA 5KVMC 2GJRA 3LYLA 1IK6A 4HBCH 3S44A 4X60A 1Q1JH 1QH9A 1UH3A 1ZK9A 1TCRA 1MZZA 2XN0A 1JBQA 1WSDA 3OC0A 5K2OA 4XH9B 3PX3A 2ZXUA 1AKYA 3ND5A 1J9TA 1U2EA 1ITBB 4LQ4A 4DS3A 1DDHA 2CYBA 4RY2A 5D70L 5ALQA 5EKUA 4G9GA 1D2RA 4E12A 3T0WA 1B00A 1P7KB 5BOVA 3CQQA 4JE4B 4NQDB 2XUKA 4NWIA 5I1GH 2L04A 3WV5A 4WCYL 4NBZB 1I7ZA 3MRHA 4OGQC 3EYSL 4ZI7F 3L3HB 4LFBB 4HKZB 1MHCA 4I19A 2PLRA 1EFRA 1A02N 8CGTA 1SHXA 2K45A 4I7ZC 1KO8A 1U7ZA 4BMSA 5CA1F 3FNQA 3I2CL 4ATNA 2HMYB 3QORB 5D85A 2E85A 3DAHA 4HHWA 4BB0A 4GM4A 1RRKA 4JDZB 1CRPA 4XPGL 4YXLL 3QJUB 1PLJA 1RY7B 4UNNA 4N8VB 2ZWKA 3GU3A 5IXSA 1SUDA 1VB5A 5GOZA 1N75A 2ETVA 1SJEA 4F7PA 4MCAA 1PKXA 4FZ8L 4N5EC 5AAWC 1NL0H 2YVAA 3P9NA 1ZH6A 4TV3A 3IBTA 4N0DA 5DVMA 2IHZA 1M6OB 1MRCL 5AKVA 3QG1A 2J55A 2AKRB 4YRJA 3MNZB 1C1HA 4PJ7E 1TITA 1G3MA 5AYVA 1ZA3A 5E4YA 1KJNA 4B74A 4X6YA 4CDRA 3IILA 1UDAA 2XHNA 3EDKA 4CBZA 2CKBL 3RVWD 4PP2A 3QWQB 3TBVA 2FMIA 1U8HA 1UBLS 1PK8A 1N0XL 2V2XA 5HHMD 1EIZA 1U8NA 1GAEO 2F54A 4CU7A 3DSNB 2OT3B 2OZ4H 5HGBB 3GDWA 3JSSA 4HA1A 4FQLH 2ZUCA 4XUCA 3H7BA 3MRQB 3FDZA 1T9GR 4NRXA 5GJSH 4G8AC 5IZ4A 3UJ6A 2VIRB 2M2DA 1A8HA 2W22A 1SHMA 2ZJ4A 1SM3L 4GMGA 1OSNA 3MYJB 1PUJA 5EOQH 2IW3A 4EMSA 3LZQA 2YAOA 4PJBF 1BYOA 5ALWA 1YI1A 2GN0A 2N01B 3TYGL 3TPUB 4Q24A 2AMYA 5T41A 2ZWZA 1Y4DE 2QTRA 1FVXA 4GPAA 1GDTA 4UWQB 1NGZB 4TTAA 2YRBA 4ODTH 1XHFA 4QPPA 3KPRB 1VSUA 2ZOLB 4PIRF 4N0FA 3VO8A 3SQBA 1G7JA 5I6NA 4K5LA 3EULA 3AWGA 1O89A 1PG5A 1RBZA 3NOXA 3OCJA 1O0CA 3PHBE 5CDSA 2HCZX 3PKJA 2FZ3A 2ODQA 1FU7A 3WY4A 3VOBA 5BSGA 4QRQA 2RR3A 2IXQA 3DC0A 4F1JA 5DHUA 5DIFA 3PA6A 1RRFA 1OAZL 4BNIA 2RHTA 4L9LC 1XCGB 1C1DB 3GLSA 2X7JA 4PV9A 3CF4A 3TVYA 3CO5A 2CWDA 1SMKA 4JQIH 2BISA 5CD9A 2GFHA 3QKSA 3WUZA 2XUIA 3QOWA 4MVJA 1ZH2A 2IOFA 1IFHL 4NENB 2YNMA 4FQHB 4LZZA 1AZLA 4A2GA 1U93B 1X7ZB 2ENSA 1SU4A 1UFGA 2P75A 4EY4A 4ZVUA 2QJFA 4PJ6A 4IDGA 3BBLA 1ONQA 3GHBL 2VDML 4DQXA 2ZPAA 3MSCA 3QXHA 1R3JA 2ZZKA 1FJGB 4L3EE 1Y7IA 4LWOA 3URMA 1BG9A 2DEUA 1W9XA 4R5XA 1TCVA 2GUOA 3WLQA 2I4OA 3E8SA 5B58C 2EGUA 3VDRA 1YDGA 1X7HA 3RSGA 1INQA 1Q72H 1YWGO 3K8OE 5F2EA 2VMJA 1IHXA 5ENZA 3VXQA 3ES9A 3HCEA 5F7MC 3K35A 1FORL 4CF5A 2H4JA 4GPZA 3OE1A 5DHPA 2WXPA 2WNWA 2H17A 4V3CA 1WXGA 4ZK2A 2BM1A 3RX7A 1AJEA 3V0VA 221PA 3G68A 3FKSD 4M43H 2ZRFA 5E23A 5KW9H 2DQEL 3DBHA 4EA9A 3G3EA 1XTIA 4AG5A 4DWWA 4GRMB 9ABPA 3AFMA 4L3CA 4GT0A 1K8IB 3CUWA 2BZDA 4G81A 3RWHB 2YD3A 3ZDZF 2XECA 3D9AH 4EQ3A 2X8AA 2PAAA 3GRVA 4L23A 2R7LA 3H9GA 4JN6B 1E27B 1XTJA 1THAA 3AGVA 2AI0H 5AW2B 2X4TB 2R6CA 3TR5A 2KMWA 3V0GA 4U1GC 4WUUB 3EHBC 4RJ2A 4UQCA 2FW7A 3O3AA 1WLHA 5DSXA 3MILA 3TLKA 2E0IA 4PC6A 4EBBA 4IMJB 4ZC1A 1U92B 1A3LH 4Y4FB 5CUQA 1UFRA 5KSVA 4XAKE 2FN7A 2OULB 1L5ZA 2MMGA 2CNKA 4IV5A 5J9FA 1HFJA 4A0GA 3LRKA 1O6SA 1MIEH 3FOBA 1NDMA 3IJHA 5CLJA 1POWA 5H4YA 1JHRA 1AKJD 3WS3A 3TBWB 2NXZB 1NJ6A 1VHQA 5FD8A 1JS1X 4WV1A 5ETJA 3KSZO 1SXJD 5BUQA 2XWJI 4MD0A 3BVDB 2X9VA 1QS0B 3SM3A 1TJHL 2QGBA 1R1CA 3ZT5A 1TPXC 2NYYD 1T2EA 1QV6A 2C4UA 2AUTA 2GCIA 4CGUB 4EVNA 2ZVQX 1SMOA 5DVNA 4CEJB 2LP4Y 1M6HA 4X61A 3QARA 2BFDA 4L4RA 3KWFA 2Q6OA 1DQZA 4AX8A 4J3NA 621PA 4HVAA 1EXUA 4XIJA 4TUJA 3MHZA 4YWHA 5J3JA 3QYNA 3SYPA 3JSXA 4JFDB 3O03A 1MCBA 2VP5A 5EU6A 4HTFB 1SDAB 2XSZD 3WFDL 4RFOH 2FYVA 4HAVA 5KHOC 3NMEA 1MRDL 3L4SO 3GCWA 2WJ3A 1DOAA 4P23B 1I1NA 2F68X 1TETL 3PE6A 4R2KA 4OCRH 4LHZA 4MB5A 4DGYL 2VQ1A 1H2WA 1QFWI 2AQHA 3MWJA 1PGPA 2P8LA 4XVJH 2VJXA 3N7TA 1DXHA 2WV9A 1E5XA 4F6RA 5CZXD 1CEYA 4X8XA 2Q5IA 5T1KB 1R34A 2ZI9A 4CMHB 4J0EA 5EIOA 4HAXA 4GOJA 1WRFA 1N5AA 4KRPC 3VUFA 3Q5DA 2NU6B 5CFRA 1NCOA 5FPSA 3BVWA 3H2ZA 1S7WB 3F7TA 2R6R1 1NIFA 3QZWA 3QVGA 3PL6D 4OI7A 4DGVL 2V65A 4O2BF 4N54A 4QHLA 1HOXA 2BJWA 2P6MA 3OKNA 4LMQI 5D3ZA 3ES6A 4OLWH 3WQHA 1UPUA 2RH0A 3GGOA 4PW3A 1MN6A 3OHXB 1MTZA 4UDOA 5JW6A 5E2UL 4K40A 1GKUB 3QWOB 2J1KA 2ZROA 2H8GA 1YB7A 4GLFA 5EXPA 4LPYA 4MJ5B 2Q1WA 3NUQA 2FECL 3FPKA 2M2IA 3B34A 4YH1A 5A3IC 5JJ5A 1UPAA 2PW1A 2FAUA 3VAAA 1RUKH 2OTPA 4U7WA 3NH7H 4G6JH 3NDBB 2QUKA 4EP1A 1G1MA 4MEJA 5FO8B 4RAUB 1OAUL 1N57A 4W5WA 5EBMA 4Y4HC 3WN5C 2HT6A 2M9MA 3OPYB 3IT1A 4ZVTA 1E3JA 4EF6A 4LNRB 4FGJA 4GGPA 5AVXB 1J8FA 2JQMA 4F8QA 1KBGH 2O3JA 5F35A 1H2HA 4OFQA 3INYA 4WKGA 2FE0A 5AKRA 4F5YA 4JN1L 3FUEA 4BZQA 1YYML 4LNVA 1N2CB 1X7QA 2J3JA 2FGWL 5I76B 1GG2A 1USVA 2EIHA 3KUCA 2JJUA 2ED8A 3WV4A 4DHWA 1IOWA 2Q9UA 3D54D 5I1AA 3S5LB 4C6TA 3O73A 1YDPA 5KBNC 3VYUB 3F1LA 4QDZA 4EO4A 2AFIE 2RCYA 2BGRA 4NP4L 3RY5A 3KYIB 3FYUA 1ZI6A 5HCNA 4H0CA 2IGTA 4Z3TA 2WG1A 1HSAB 2R4SL 2AG1A 5FTJA 4PRHA 3DKVA 3HI5H 3ZX4A 2ODNA 3GXFA 5FPTA 2ZSAA 3CLRD 3QJYA 1YKSA 2G9RA 4AIRA 5BV2P 4P2BA 1JA1A 2G4LA 1YRKA 5CJXA 2YXPX 3LRSB 5FFFA 5HQ3B 4HV8B 3CH1A 1O94D 5HZMA 5D7LE 4G5SA 4ZT5A 4L5BA 3WYDA 5FUZH 4JR9L 2PPVA 5C18A 1M54A 3WISA 4B2IA 2Y8EA 2WUBL 4NI5A 5EXEA 3N1QC 3FFDB 3QG6A 2E74C 3ESBA 1RABA 1CDEA 5EXDA 5K3FB 2WTBA 3OY7A 4LPWA 5EIVA 1KS2A 2RTTA 3KR2A 4ZW6A 4JFVA 2YX1A 3DHNA 2FCBA 3G23A 3I53A 3KT3A 5K0GA 4LK3A 1YDHA 3IJ7A 5NLLA 4M1GL 1YC5A 1KTLA 2BM0A 3S3PA 5KSBE 3T4EA 4HT3B 4EGQA 4NO5B 2IWRA 1QCYA 4X6LA 3Q3GA 2ATVA 4R1NA 2QL9A 3AW9A 2Z91A 1CZNA 3PRKE 1VKXA 3CKMA 4RETB 2DDQL 3EOBA 2G1PA 5LBSH 1K68A 3W5MA 1OPGL 1Z35A 5FEUA 4DCMA 4XVUD 5DEZA 4N0YL 4C56A 5ARDA 3PNRB 2JZCA 1Z1WA 4XP5H 1AO7E 3E15A 2UVFA 5HSFA 3IBOA 3NONA 1ADGA 3Q9QA 4V1DE 4ODUB 2RJNA 4E2YA 1JDBC 1WXEA 2ID9A 5CURA 3QUML 3RL1B 3BD4A 4Q7DA 2H8KA 2PL5A 2QKYA 2JKLA 1JXKA 2XUWA 4XAWL 3LCMA 1PAMA 2E5EA 2QTAA 1R8XA 1NAHA 1ZH0A 3DBLB 3X1WA 4HJXA 4RA3A 3Q3EA 3QVWA 1R0SA 3UPAA 5E2WL 1JDSA 2GYSA 4WFED 5DYIA 5EWMA 5JPCA 4YEDA 4BFIA 1DBKL 5JZSA 1F97A 4P5RA 4UDTA 3HFML 4DQOL 1HTTA 4C29A 1P6UA 2QHRH 3N9IA 3QQ9C 3KZ1E 2GK0A 5DCYA 3MLSH 2Q5LA 5CR8A 5FYLE 5JQGA 4JBSA 1XKXA 4MCMA 4QU8A 3WLWD 4UM9B 5HHVH 2O2XA 4TGLA 2R27A 1IBBA 2B2CA 2P8SA 1TW2A 4U5QA 1QPPA 3EPLA 4XO9A 1GZ7A 3ZDXF 1TGYA 3WTCA 2CHUA 3D34A 3BICA 3WP0A 4F9TA 2BNQB 2H1LA 2DQGH 3TA4D 1J6UA 3NDIA 3T0IA 4DUPA 2LW3A 3FUTA 1SVSA 2NZ9D 4YAIA 2A3RA 1E5UI 4DEPB 2Q1TA 4CGYA 1II8B 1T3FA 3TNYA 2KW5A 1FDUA 5BPHA 3RVSA 1I9IL 3OAWA 3OLZA 2MH4A 1K89A 1QI3A 2BXZA 3S8MA 3RUIA 1XBTA 1HSBA 2HG0A 3T1YB 3RK0A 4DLPA 1LE5A 4BK8A 3TTWA 1JHDA 4R4FL 3LX6A 3F12A 4PTZA 1BVYF 1DQML 1ZUNA 5C2BL 1IIRA 4JHAH 5AW1B 1YQQA 3JVUA 2ZTHA 1Q3TA 2YOCA 2ZX6A 1EI9A 2WJHA 2PLNA 2E4AA 2VPYA 4JT2A 4JGNA 3GMRA 3ZYJA 3N40P 3GCDA 1ESOA 5JQWA 2AJCA 4DCGA 4YSQA 5FKAA 1KDOA 1OHQA 2OMXB 1P0SE 5BNWA 4DK3A 3NANA 2O06A 1G7PB 4IV8A 2PXHA 3SKJH 4JZOB 2EEBA 2VCHA 5CEZE 2X3UA 3QI9B 1OH8A 2RB8A 3ARDA 4OB8A 4EDHA 2TSAA 5HTSA 4KO6A 1T5OA 1RKQA 2GPBA 2FFJA 1SCUA 5SYMA 1EHCA 2WY2D 3K46A 4BNJA 3GZ4A 5A9RA 1TZMA 4EG5A 2FRDA 1WBJB 2OKCA 3DVIA 1H8NA 2HTLD 2B35A 3FONA 3IXQA 1JMVA 5IAEA 4N5LA 2GKIA 4RK7A 5FBWB 3ZD8A 4MXVE 3QKUA 4WQMA 5IJ9B 4LOKA 1YAIA 1AO0A 3I02A 1NIPA 3JATA 1Y1QA 4NQEE 2GD1O 2J0UA 4Y2RA 5JTUA 3PHSA 2VH5H 4E13A 4ZT1A 1F2UA 3BPOC 3K2EA 3AVEA 3CPLA 4I5BA 4RHCA 4ETIA 4YRDA 1J5OH 3OOEA 1Q9WA 4BNMA 2XQJA 3AUKA 4UBKA 1G8GA 2XE6A 1XNGA 3SSNA 5EE5B 5G1NA 2ILLA 4QUGA 3BWXA 3COVA 4FMBB 3MOBH 1S78C 2NMVA 1JG9A 2WTXA 2ZIUB 3MJ9L 1U3WA 2IH9A 1NN5A 1GTFA 4A1OA 4IHQA 4JVWA 3A47A 1E94E 2PGNA 3S88H 1L9OA 3QUYD 2ZUQC 2IYOA 3OZSA 4LCVA 1TEHA 3QX3A 4QTIL 4FQ8A 3OGOE 1J0EA 1W5BA 1NGWA 3EXG2 1WXFA 3LQ1A 1DBAL 3GBNH 1VI2A 4FLQA 2A9NH 3T1HB 4K9OA 1IM9B 2OAP1 3KJGA 4O3MA 1Y9DA 3U4QA 1CVSC 1BVOA 4HH4A 5TEWA 1UZGA 4HT1L 4MGEA 1OT2A 4OCNC 1KIQB 3KCWA 4DR4B 1CB7A 3IDJB 1HL4A 5HHTA 4MDIB 3C5ZA 3CLFL 1IHUA 1MLDA 3M9LA 4PHXA 3P9CA 4PG9B 2HT1A 3LXBA 2B3DA 4WW1B 5KIAA 3KQOA 4A6YH 1R16A 3EFFB 4K8OA 3D33A 1E2UA 1CMOA 1I1YB 1BE6A 1G63A 1XROA 2CDBA 3HG5A 4JREC 3U4BL 1A1MB 4U6YA 2N75A 3A26A 1QLRA 2NXYC 4N2IA 5CP7A 1KVTA 2XA8L 4BKRA 1QE0A 2ARJA 4Y1GA 1FJXA 3HCVA 1MFDL 3IAHA 3IALA 2Z4QA 4PXAA 5TS2A 2Z8YA 4LCIH 3S2GA 3W3ZB 1Q0YH 1YEDB 4WWKB 2G2PA 4OD1H 1C3OA 5C0AD 4EZMA 1YD7A 2OXCA 1NWPA 4ZUVB 1CEQA 2JZNA 3KBFA 4JDTH 4ZYLA 4MCZB 4NYLA 1EK0A 4LYGA 1Q3HA 1EK3A 3ESOA 4FGSA 1JRLA 3DMMB 2YFQA 3MBKA 4RPLA 1BYPA 4Y2LA 1CE1H 4LEOB 1ZISA 4AYBA 2BVPB 3AXSA 1O9GA 4IXWA 3DHJA 2YFHA 1QQ5A 1W8DA 3U9LA 4P22A 4I88A 4W9LC 1L5MA 4L3EB 1VI6A 3PFHA 3HUFA 2OA9A 4GX0A 1UOQA 4JQVA 3ZOKA 4KMLB 2EE2A 3VG0H 3NQKA 5AOMA 1QUFA 1Z37A 1W4CA 1K88A 2CDFA 2VXYA 4UVHA 5DJAB 4EHDA 3KWWB 1PZUB 3GG9A 2BKUA 2J0EA 4BB5A 3QIBA 4M8LA 2H1FA 3LK7A 5ALGA 5ADPL 1Z13A 1I2DA 4MIOA 4DPRA 5IWLA 4ME6A 1SA0B 4IFIA 2BFMA 4BGUA 4CGZA 3ZQJA 4XB2A 3HN7A 2CXTA 4RKFA 4I5DA 2IPUG 4BWVA 1CUOA 2XT9A 5DMKB 5CU5A 1L0XA 2NY1D 3HI6A 3DNMA 1LJMA 1Q57A 3IHLA 3F8SA 3MUOA 4A38A 3W2IA 3HN3A 1Z6YA 2W8ZA 3Q1SH 4NQTA 2GN1A 3K6FA 4FFZH 2G08A 2FMFA 4YCSA 4QGFA 3GI8L 3VVBA 5HP4A 1KIRB 1WUTA 4H6WA 5CFMA 2R2EB 5LAPA 5FX2A 1U8MB 1DBQA 3JRWA 3B9KA 1XQ9A 3KVQA 1XGTB 2FB4H 4E3ZA 1QEXA 4CVUA 1DWQA 1IJ9A 4CKCB 3IMTA 2FI1A 2NDGA 1LLDA 3L7NA 4UUMA 1ZP6A 3QWAA 3T3MF 4YSSA 3CU7A 3HB5X 3TR0A 5I8EA 4Q9AA 4G8GA 3KOOA 3DF9A 4G85A 3A4IA 4HIHA 2A9ML 1UP4A 4KEAA 4U4BA 5ITWA 3FSGD 3FB6A 3G0OA 3GJFA 4PY7B 2RKWA 1IZ0A 2AVGA 4R9RA 5JAOA 4LLDA 2H0PA 1M72A 5E4AA 2WPDA 1JN6A 5EU3B 4EGSA 2OWDA 1AIFB 3Q98A 1IAOA 1QZNA 1E5CA 4A7SA 2KC0A 4BSWB 2QX4A 1KEEA 4WXEA 2ZPUA 3JZYA 1E4YA 2O50A 1D9KA 5E5MA 4RGNB 1VHPA 4L78A 5AL0A 4M7WA 1PCSA 1DCLA 3M17A 2PGOA 1UQSA 3K7UA 1E4EA 2X0KA 5H83A 4ARVA 1NAML 4AM0B 5BSTA 4OGKA 4NNXB 5IB5B 4AY6A 3VYRB 1NTRA 2B37A 1EGMB 2AMFA 1UQRA 5DD3L 4EUPH 2HQOA 1VB3A 1V8HA 4WZBB 4Z9YA 2RSLA 1MORA 1KMNA 1OQXA 3HB3B 3AFHA 3ENNA 2Q7AA 3ANLA 4JRYD 3WK9A 5GGQL 3UTQA 3EIFA 1H0HA 4ZRDA 4L05A 2IWFA 2ADYA 4GI5A 4JO2H 1Z63A 3QS3A 3KEFA 4QBTA 4E1VA 4K5NA 5CH5A 3V52H 2HX9A 4DMGA 1EK6A 2F6RA 1FDRA 3V9AA 4OYHA 2IMMA 4M6ML 3OX2A 4B9PA 3D39D 3FUVA 4B17A 3RTBA 3K0HA 1UEJA 2OR9H 1SZNA 2RGCA 4IGFA 4JY5H 4BFFA 2QLYA 3Q01A 4IUBS 2D5BA 1ILEA 4Z4EA 3LXMA 3MZ0A 4QHMB 4DC9A 3QCVL 1BCRA 1Y3AA 4OQXA 1RZRD 1GQQA 2OCYC 3AL0C 3UGXA 3ISTA 1FXSA 3O4LE 4KH1A 2JF1A 1IT9L 3I1FA 5DT1H 3I6KA 4FT2A 2DJIA 5DXWA 3DFFA 3EDQA 1K2DA 4HHEA 1NEZG 4ZCSA 4EN3D 1HVXA 2WYVA 3ANXA 4B87A 4MW9A 4ZT3A 4PGJA 2H4EA 4OHPA 4DBZA 2Q7YB 2WF8A 2CLKB 1QDEA 2Y3AA 3QJOA 4UQPA 1DLJA 4LF5B 4IZ6A 4HJEA 2CJSA 4JOBA 5LBTA 4ARZA 3SJVD 4EJMA 3TJPA 3T2PA 4TZTA 3TH5A 2B5IB 1OM3H 1N7MH 1P7VA 4B40A 2G76A 4PREA 3VDBA 1ZV9A 1IUZA 1P84K 1J8QA 4ANXA 4OTZA 2LXNA 1XMIA 2R0ZH 4L4VD 4FR5A 4D0DB 1B1CA 3D6GA 2G2RA 5DV9A 1HESA 1DUSA 4V2UA 5AOBA 2VDWA 4ABVA 4A1RA 3GLRA 1U7DA 4JI3B 3HFRA 5HI4D 2J6CA 2MR5A 3QXSA 1M7HA 4E03A 1QSEA 3F7RA 4GAAA 2Y05A 2KZWA 3VXOB 2FW9A 3VXSD 1KORA 4APQA 2LVEA 1GGBL 2G17A 1F4LA 1JDVA 4RENA 3X12B 3G7UA 4PXSA 1JFLA 2IYSA 1U65A 1N6QL 3L8YA 4NJEA 4ZOBA 1UYWL 2Q20A 1XF2B 4TPRH 5BSRA 4YMPA 3CXDL 4MRCA 2IP1A 3W8NA 1DWPA 2ZCJA 4LOIA 1FRVA 2UYLA 3T4AA 3CWZA 3RWEA 5D2NA 1A8SA 3WR5A 1DANT 5F8RC 2WJAA 4MYCA 2XE7A 3GVXA 3HMXA 5D7LB 1K5NA 2Z8YM 4ACAA 4BFYA 2BHFA 3SQOL 5ITFA 2CT8A 4DGIL 5F3BB 5AW7A 3FWZA 4MTLA 1OIXA 1XZ8A 3E9QA 3TLGA 3LUPA 1Z4NA 2GRAA 3C3YA 3INTA 1A7KA 5CZRA 4MDJB 2XWXA 2R29L 5DNUA 3C2AL 3QO1A 1LDMA 1ORQB 1DAIA 4Z2YA 3GPDG 3PGVA 4KROB 2BBOA 2RHRA 4ZEWA 1Y82A 2RCSH 3ZBTA 4F2FA 4MX8A 3BMWA 3DXFA 1CGYA 1F2QA 1PR9A 2CSPA 2Y5EA 3LC1O 4WTZG 5C08D 4URKA 2Y23A 3VGDA 4BUGA 4RZ3A 3JWDC 2JCBA 3BEVA 2ZDGA 4V02A 2AQKA 5B57C 1T1SA 4PFKA 5CBAB 5GV7A 3L08A 4OAOA 1INLA 1AO7B 1AQYA 3OKEB 1S02A 5G0SA 3FUIA 3VXRA 1H9DA 3MMXA 2IF2A 2CDNA 4M21A 3KPSA 4X65B 3TOZA 1AMNA 3MJRA 5IVHA 1KENL 2QQFA 4GKNB 1ILWA 1PYWB 4PYGA 4RFVA 3HE6C 5AQ1A 5G3ZA 1Z5LA 4LV8B 2BP3A 4D9GA 4FW8A 3C6BA 3IGAA 1H2FA 4ZOQI 2H8PB 3MD9A 4PIPA 3STWA 4UU0A 2N1BA 1T9HA 3FB5A 5BMOA 1WTCA 2GB4A 3A4YA 1UUNA 1C4KA 4FCVA 4XMWA 4CIAA 4N9WA 1PS8A 3HLAB 5E8PB 4ZW7A 3UJTL 5EA2A 4ZFFA 2EJUA 1ZM7A 2QR2A 4FXPA 1A4IA 3GT4A 4XN7A 1KPVB 2EXWC 3PWZA 2Y1AA 4QO7A 1RPJA 4CE6A 5IHLB 3HBZA 3HMWL 3KE9A 3M4ZA 1ZQ9A 3HI1A 1QOQB 3H4VA 3UJ7A 5I7UA 1TTTA 5EZIL 3VXMD 3GLEA 4PJ8C 1ISGA 3DTTA 3TEFA 4DY6A 1J9EA 2VL7A 3AAZB 4GSUA 1ULUA 4B43A 5JDSA 4Y9SA 4WGFA 3E2PA 3RIHA 3QO0B 4OZIA 4OGWA 3RNKA 1Y1KE 4M9QA 1GFIA 1HCVA 1KWGA 3FQ1A 3ZGLA 1Q1ZA