3V55A

Human malt1 (334-719) in its ligand free form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
383
structure length
368
Chain Sequence
b'QPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNKVTANIVFGYATCQAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
total genus 106
structure length 368
sequence length 383
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v55A02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v55A01
2C2OA 1GFWA 2QL9A 1K88A 4IEFB 4FGUA 2HBZA 4NOLA 4ZVOA 2XZTA 4PRYA 4QUHA 2J30A 3E4CA 5IAGA 2H4WA 4FXOA 2H54A 1F9EA 3V4OA 1RHJA 4QUJA 5IANA 3V3KA 3RJMA 5JFTA 4N5DA 4HQRA 4EHAA 3R7NA 4QTYA 4NOMA 1K86A 1QTNA 3H1PA 5LU8A 2HBYA 3NR2A 2J31A 3NS7A 4I1PA 4JB8A 2QL5A 2Y0BA 4N7JA 3NKFA 4ZVPA 4D3YA 1ICEA 3DEHA 2DKOA 4N7MA 4QU0A 5IAKA 2CDRA 4JJ7A 3R7BA 1KMCA 2FP3A 2J33A 2XYHA 2WDPA 1RWXA 4JR1A 2AR9A 1F1JA 4N6OA 4JR2A 2HBQA 3OD5A 4QUEA 3D6HA 1RWVA 2H5IA 3IBFA 3R5KA 4NOJA 3SIRA 2FUNB 1RE1A 3SIPA 1I4EB 1SC3A 2XYGA 3DEIA 3IBCA 3K7EA 3DEKA 2CNNA 3V55A 1NMQA 1RHRA 3GJRA 4EHHA 1RWNA 1RWKA 2XYPA 4PRZA 2H5JA 1QDUA 1PAUA 4EJFA 2C2ZA 5IARA 2P2CA 2CNLA 2H48A 4N6NA 4ZVQA 3D6MA 4AWBA 2C2KA 2QLFA 3GJTA 4QUAA 5I9TA 3KJFA 2QLJA 3S8EA 1I4OA 3S70A 3V6MA 4QTXA 5IBCA 4PS1A 4QU9A 4EHLA 5IABA 5IC4A 1M72A 2CNKA 4M9RA 1RWOA 4QUGA 3PCXA 4EHKA 1RHQA 4JQZA 2C1EA 4PS0A 2Y1LA 1RWWA 3KJNA 4EHFA 5H0IA 1RHKA 2H4YA 1RWMA 4D3ZA 3QNWA 2CJYA 4FEAA 4NBLA 4D3XA 4JJ8A 1I3OA 1SHJA 2FQQA 4LSZA 1NW9B 1PYOA 4NBKA 4I1RA 1I51A 4N6GA 4IYRA 5I9BA 3PD1A 1CP3A 4AW9A 5K20A 4QUDA 5LUAA 3PD0A 4JJEA 3GJQA 2H51A 1CVRA 1QX3A 5IC6A 1RHUA 2CJXA 4EHDA 3DEJA 4QUIA 4QULA 3V4LA 1GQFA 3P45A 3V6LA 1SC4A 3GJSA 2NN3C 3ITNA 4HVAA 3EDRA 3H11A 3R6LA 4ZVRA 5IAEA 5IBPA 4DCOA 4JQYA 3KJQA 2CNOA 4JR0A 4ZVSA 2QLBA 3D6FA 1JXQA 4HQ0A 4QU8A 2QL7A 5IBRA 3BIJA 3EDQA 4NBNA 4DCJA 5LU9A 3R7SA 3H11B 4FDLA 1IBCA 1BMQA 1SC1A 3P4UA 4ZVTA 2H65A 2C2MA 1NMSA 4AWAA 2K7ZA 3R6GA 5IAJA 2XZDA 4QU5A 5LUBA 4DCPA 3H0EA 5IASA 4ZVUA 1NMEA 1RHMA 3R5JA 1SHLA 3H13A 1RWPA 2J32A 4QUBA 4EHNA 4NOKA 3UOAB 2HBRA 3UO8B
chains in the Genus database with same CATH superfamily
2CLRB 4FMDB 3ARGC 2WVAA 1ZD3A 3RVTD 2XCSB 4WFHD 5FAAA 2XZPA 2O8FB 1NIEA 4JT8A 3EGVA 1SC9A 4UAOC 1IN6A 5KG9A 2F53E 1ICIA 4YSCA 2DWPA 2ZXBA 4PRHE 2FEPA 4NUJA 1VG8A 3KZCA 2RIPA 1H66A 1GGBH 5H4ZA 1ISSA 3WNPA 2RHHA 3P9PA 5F6HI 4RY2A 1C7FA 1KS2A 4OCNC 1QLWA 5J58A 2PNDA 5BMVA 3MLSH 2FGWL 2C3MA 4BQEA 2HADA 2CPCA 1HURA 1NG1A 2PANA 5KTOA 4LCIL 1T3ZA 1KY6A 1QFYA 3FT1A 5G55A 2D4DA 1ZWIA 4QOKE 5BY2A 4JA0A 3TLJA 1UF9A 3CHRA 3KNZA 3QJZA 3TYGL 5CCJA 3VFMB 5EIVA 3A6CH 2WJ4A 3CFJB 1XTQA 3I6LD 1CZ8H 1NCUA 3F12A 1MX1A 2NY4D 4CCAA 5F35A 3GMQB 4MGIR 1T24A 1HEYA 1WP9A 2X3AA 5AKGA 3CGTA 3TNMA 5KSVA 5I8CA 4D8OA 2VT7A 4OF5A 2GPSA 4IGBD 1TPYA 3HO6A 4XDZA 2AS5M 5J5CA 2QVYX 3MUGA 4CSTA 5GS0H 2NY1C 1BE0A 1KDJA 2EVWX 1FJHA 4LHXA 2OV2A 4RK6A 4DPKA 3BVTA 3F6SA 4CHGA 1T36B 3GZQA 4OMUA 2OK0L 5C3UA 2M32A 1Z3IX 3JVFC 4PJAE 1KTJA 3ZNNA 1E8DA 1GRVA 3LLMA 5AOAA 3C2SA 1P60A 1WAAE 4XD2A 3UGKA 1U92A 1NC3A 5I1AA 2XUPA 1TZAA 3ILPA 5JJ5A 1C8PA 5FX3A 2EKPA 35C8H 3G04B 3H2QA 1G291 1FE8A 1RFGE 4XCCH 4RMBA 3K7EA 1P73A 2MEJB 1N5OX 3QUXA 4TQ9A 1XQ6A 2WXKA 1K7FB 1N0UA 2GBLC 4YL9A 3NCBB 1QFUL 2VNHA 1CE6A 3PJSA 2P90A 1F4AA 2IE8A 3MACH 2IH1B 4J5VA 1MB9A 4JYZA 1AQIA 3PXAA 5T1KA 5DIFA 4I0PA 1XXLA 1UTDA 2INGX 3QULB 1U0EA 5TMBA 4W9DC 1JYVA 2IMMA 1HKHA 4IRZH 3QEMA 1DWPA 1ZL2A 3S5ZA 5K0CA 2VM3A 5E2AA 1E5YA 1ZK3A 3LW8A 3V8CA 3DUWA 4P36A 2UZYA 4Z8FH 3TCLB 3LLCA 4DVGA 5L9AA 1MWOA 1NFAA 5EDSA 3EOBA 5E8JA 3LN9A 3LD8C 2J4CA 1YZ3A 4ZCLA 5HGAB 5DRWA 3TBTA 3QITA 4XP4H 2CEAA 4DKDC 3O3DB 2KDYA 4G24A 1G8YA 2EWMA 2HX1A 3JBG7 3GNTA 3WLWD 4OD3L 4JPIA 1W72A 1T4KB 3IELA 3LAWA 3C8MA 2GZRA 1R18A 5EWIL 4B6QA 4TWIA 3LX4A 4RCZA 3N43F 3DXAE 3EYAA 1MIOB 1O4WA 4GC9A 3CUYA 4LZJA 2FWRA 4YCAA 4IRUB 2G5RA 1BEZA 3E22B 2QU8A 3ILPB 5KVGH 4YVFA 2B1GA 2FLWA 4ZYZA 1VJSA 1L1FA 3IDXH 2CALA 5M04A 4KITB 4CBVA 4MJJA 3RZCA 2IVZA 1VACB 4QTTB 4PTUA 4KKNA 5LBTA 3NOOA 2GSGA 2ZR0A 1DO5A 3HV0A 1DAGA 1Z75A 4YUWA 1FMLA 4X3CA 2DHRA 2E7ZA 2DKFA 3IDQA 3DHVA 4G7YL 1X5KA 3QA3B 4JY5L 3BHMA 4CVNA 3ETCA 4H7VA 1NBHA 5FLUA 4AZTA 1Z5HA 2Q6KA 4MRAA 4O4LF 4J9VA 2ZSKA 3QS2A 4MV6A 2FWNA 4GF5A 4A92A 2Z34A 1RK0A 3DR5A 3EDRA 3ZGXA 3DMFA 2OE2A 1RY7B 1PSKL 1USIA 4OBWA 2VLKA 3UTTB 1KO4A 1VL6A 2NYRA 5ID0B 3TP4A 4M62H 5FXCH 3W6ZA 3UTOA 1AS7A 2NXZC 1P7ZA 1INDH 4A2FA 1GZ4A 1XZCA 3OKMB 3CTMA 4YAIA 4QUKA 4X42A 4RMSA 4GZ6A 2O8VA 4Z77B 3BA6A 4BMXA 2MSCB 3LGSA 3QEGH 5TNXA 1MHPA 3IURA 4L4UA 1L2TA 3SDDD 5KOVC 3C7TA 3FTQA 1JKIA 2A1WL 1RRCA 3RUGF 3OOHA 4WCYH 3RUIA 2AV1A 1YK0A 4M7LT 1O0CA 5I16B 2Q4OA 1HQRB 1G4UR 2O8BB 1G60A 4D8WA 1XSIA 1ISFA 3BTOA 2Y1YA 3BJ91 4DMKA 1MPAH 3BW9B 2XE6A 3QU5A 5CEZD 2H8KA 3PNWA 2XF8A 1A6UL 1TE2A 2W2LA 2H3NA 3V7AE 4O8ZA 4EIWA 4PBXA 5EUOB 3QUYD 3S4SG 1XLWA 2EDCA 3D6MA 2ZSBA 4I18C 5JIPA 3IAUA 2CWRA 5CVDA 1L4MA 3T4YB 3AUUA 4DJAA 3KL5A 3MTBA 3P4LA 2OKGA 3OZGA 3TJHD 2ZAYA 1C7ZA 3PGKA 3DSRA 2L69A 1CIDA 3SE8H 4I9XA 4OP3A 5IQ7L 1PL6A 2C94A 3VFOB 3EZNA 4FFOA 5AW6B 3HP1A 4G71B 4XWKA 1H6EA 5IULC 1I4FB 4N5LA 2H6PA 4HA1A 4EKDA 5DTRA 1SCIA 3D0LB 3LK7A 4UULA 1W0JD 1A9EA 4IHQA 3S28A 1IAOB 1GZ5A 3FH5A 3ESZA 5H4HA 1I1FB 2MJWA 1AP2B 1M67A 4Y6SA 2FH5B 1Z0SA 2I4OA 4HMQA 4G0OA 4BNGA 1BCRB 4Y2HA 4ZX5A 3RFFA 1ID5I 4C6HA 5ES4B 4DMCA 4P7FA 2F8SA 1ED3A 1ITCA 1YUMA 4DCUA 4E5SA 4LFBB 2FQDA 3FU3A 3S35X 3F5WB 3FUIA 4JN1H 4C2AA 3Q6FA 3NC4A 5C7XH 2YXWA 2OOKA 3DX6B 4AKOA 2IU4A 3ERXA 2VRBA 4J9UE 1Q3KA 4Q4IA 3O4LA 2JGNA 3MNDA 3T0BA 2X4SA 3IILA 1MVUB 1X7WA 3U2JA 2BGMA 3KCQA 3GZJA 4L73A 1IEAA 1BVUA 3DAHA 4HGOA 4CEHB 1YJDH 3UP1A 2JK5B 2O4CA 5IB5B 4Z9AA 3C5ZB 4C4KT 1HWHB 3VXSB 1O96A 5CHNA 5SX5H 4BZPA 4CU2A 1Z7GA 2G9HA 1KORA 1P0SE 5AW3B 1J9SA 2QKIB 1QG0A 2NV0A 4MLCA 4LF5B 1JD7A 1QWUA 4AYID 3PQ3A 5ALPA 1ZVNA 4MLDA 2CHVA 2QRQA 1NWPA 2FR1A 4D9KA 2IEBA 3QBJA 3F3HA 1UEMA 2E9WA 2WIIA 4HJRA 1P2FA 3DXAB 4F8OA 1NANI 4F56A 1RRGA 2WVGA 4M7RA 4AW4A 1LWOA 1KS9A 2PH3A 4JBXA 4ZK6A 1I3VA 3GI8H 4AVKA 3PTZA 2ZUBA 3HUJB 1L5SA 2HSJA 1M5TA 2XB6A 2J3DA 3OQOA 3DVAB 1COWD 1B76A 4PLYA 3IDAA 4DYDA 3NASA 2VLKE 3IBOA 2IIVA 4ZVOA 1TEVA 1GLGA 3MUY1 1JNHB 4KG7A 5IEKB 3NRPA 1AV6A 4JAMB 5FPKA 2A1TR 5FCUL 3FGNA 2XNHA 4DBZA 2Y4SA 2ID5A 5DJYA 3PQ5A 2K4AA 4Y16A 1RZFH 2YS6A 4YXKH 3X3GH 3QQ5A 2C20A 4JQXA 2X9YA 1KUMA 3V6OC 3KQOA 1RV6X 3D8HA 1ZGBA 4EUSA 2Y2UA 4XVHA 3FETA 1CK0H 4OHMA 1WMFA 1MMFB 3O9WD 2WKWA 1PEKE 1LTHR 4TLUA 4LG1A 1C16A 1ZVJA 2EYSB 1T04B 1KWGA 3H1AA 1Z5VA 3UANA 3ZWPA 2DYPA 4OEHA 2EDXA 4HWZA 1JXKA 1DEDA 3JQAD 4F9LA 5IESL 1Q0YL 1QV9A 3ZDRA 3W7BA 2AVGA 1GKEA 2WVTA 6TAAA 1S7SA 3RA7H 1RULL 3PUZA 1N4XH 1EXWA 1I8IB 2GA8A 2BTQB 3VR6D 1SBYA 2FGJA 4FCHA 4NE7A 2LVCA 1BXXA 4HFRA 2Y2TA 2R4RL 2BSBA 4YHIA 3U4BH 2TSAA 4PJDB 2VJDA 2EEAA 1WOMA 1YQXA 3VR5A 3CHQA 3QUZA 3JALB 4J39A 3P4OB 3BGIA 4JE4B 2OLEA 3WGUB 5KCZA 3BKYH 4D8XA 4UUNA 1NLYA 3Q2KA 1I7QB 4W9JC 1O6TA 1IJ9A 1ISMA 2IP2A 3I2IA 2WV9A 4GI6A 4HXAH 4KROD 3SQDA 3RUGB 2XD4A 2IS2A 3NTLA 1KETA 5AXAA 4PANA 3ESNA 1RNLA 2Z57A 3RWDA 1XLTC 1Y6GA 2XVKA 3V8VA 2J25A 3KZ1E 3PDUA 2A5YB 2OQ2A 2XFXA 4Z76A 1J39A 2AEQL 3BIWA 5SZHB 5EJ9A 2GPZA 3RGGA 1GXSA 1TZ2A 4EHAA 1J97A 4F4IA 1U8OA 2C9AA 4DP7X 4JG1H 3GVXA 1OE0A 5AQ0A 4ZXBA 4XPHH 3MLRH 2Y3IA 5D7EA 3IAGC 1BMZA 5HR5A 1E60A 1N1MA 3OVMA 2LDBA 3D3VA 5E8NA 3DR3A 1LGVA 4WXPA 1G4MA 2UZYB 4DMRA 5D7JA 4XR9A 2RH5A 4JGJA 4IDJH 3I62A 3WMGA 4P4RA 1O89A 1IATA 2ZATA 1IGFL 5IV2B 1YMUA 3UZEA 1K6IA 2GXQA 4A0RA 3DGGA 1LB1B 4WXHA 4RL4A 2J8UB 5M94B 4AZ8A 4NAVA 1J12A 5B8CB 4MA5A 1RFDL 4EMTA 1OBOA 1FRVA 1GGMA 2MSDB 2HRQA 3FPFA 4EB0A 4LSZA 4ZVMA 2P2YA 4OGYH 3ZXSA 3TVMA 3INNA 4FXGC 3HYSA 3OJLA 1T1YB 4YAJA 4PAGA 2YWDA 4Z2AA 2C5DC 3LEXB 4MAYC 2DI7A 4FTDA 4F4FA 2ZVPX 1OB1A 1QYGL 5CVTA 4UEKA 1NCOA 2WF6A 3WZ2A 2WKPA 4AQAB 3D51A 4CILA 2O1XA 2X8JB 3WIOA 2ORYA 2W4MA 2QYTA 1A27A 5PCYA 1Z35A 1KGWA 4CMMB 3DYMA 1QF6A 1WLYA 3MCYA 3DLIA 1V3KA 3FOEC 4PZEA 2NXEA 4KXVA 2WQRA 4LLYB 2DKMA 4EABA 5T3XH 4OB7A 3OIYA 2YAOA 3HDQA 2YPKB 3O7WA 2XOKD 1BFVH 4FR2A 3AVPA 4D7AA 1MCDA 4FZ3A 3PQYD 5I5JA 3C16C 3G0IA 3WJAA 1PY9A 4OJKA 2RGXA 5JZOA 3SFVA 3D2UD 2RCYA 3EXEA 1NMCC 4PJBA 3AG2B 4JRWA 3R5FA 4KBGA 5I7AA 3UL4A 3QG6A 4TYPA 4OV6F 5A4AA 1Y6ZA 1BECA 2NQTA 1OGTB 3T2OA 1F6FB 2BS71 4M5ZH 1FWXA 3MHPA 3BRQA 3S48A 2XGSA 3MCKB 1JZHA 4Y4FA 4TSBH 1SXJA 1UBSB 3S9DB 2IHVA 2HRBA 4WW2A 3P2BA 3UC5A 5CLWA 4G97A 4PJFE 2OI9B 3O41B 1MVYA 4RLHA 4C0SA 4DV5B 1UZAA 3GC6A 1UFOA 4MGZR 1J48A 1T2VA 2P8JA 2BMJA 3CYFA 4U1NA 4N0UE 5E6ID 1B73A 1L5OA 4FDLA 2AZDA 3KCWA 2Z1DA 1AYRA 2V9CA 3FNIA 4YH6A 4YBLB 3H0TA 3D43A 3ENWA 5EWLA 4RF2A 4MXQD 2IIPA 4WJ5B 5KCMA 1IE5A 3DJZA 3GSXB 4FYIA 3V0AC 2VDLB 2F53B 3ZTNL 4R5TA 1JIIA 2V4MA 1JZEA 4F8LA 5I23A 3X12B 5DVLA 3VCLA 3TO5A 1E28A 1U42A 3Q8EA 2JKRM 3DJ9A 4Y5XB 4GP4B 4NN7B 1DMSA 3E80A 3QAZC 2E2WA 1FMJA 5HJGA 4UEOA 4MCIA 4NSKA 1ZVQA 4EVQA 4EO5A 1UZ8A 3QEBZ 1OUMA 1V10A 1QI4A 1IEXA 3DEHA 2WXPA 1WTLA 2J56A 3QWRA 4S2SA 4IX1A 2ONYA 4GYYA 2E7LC 4YZWA 2GJ6B 1D6EA 1VPLA 2XCOA 2D2XA 2F67A 2E4WA 2UUDK 3CZNA 1P5UA 3CDGA 4FJ6A 1K7YA 2QX6A 2VN4A 5D6CB 4FHFA 3ORSA 3AUWB 1YNKH 1L7XA 4PTTA 3EPRA 4A63A 2FHSA 4KK6D 2IEAA 2Z2KA 4ZC8A 5FHBL 3AONB 2QRKA 1RWMA 2BNQB 5I45A 5I1EL 3K9NA 3IAM1 4KQHA 5DK2B 4IO1A 1E2NA 3IE9A 1P62B 2X2FA 3PD0A 2WBWB 5D2LB 1W8EA 3LS4L 3DECA 3LX9A 4PN3A 3TAXA 3GO1L 5DM4A 5DA4A 3EFBA 4DVBA 5DI3A 3VKUA 3OZSA 2DFVA 1UC5B 1OFUX 3U26A 3TNYA 2WTNA 1S78D 4RNRA 4LSTH 1DU4A 2ZR9A 3G7SA 5HF5A 4UDOA 1HSBA 3EYOA 4NPYB 5ELXA 2PU5A 4JPQA 2EX4A 5SY9A 1K7SN 5AUOB 4UZGA 3DLBA 3W2DH 1JJVA 2B2XA 3T54A 1SOXA 4W7IA 5TDOA 2FPGB 1NDMB 1LQUA 2QSTA 3UQYS 4C59B 5A3RA 2E56A 1KACB 2DGDA 1EFDN 3H56A 3DFKA 3CGGA 1R3LB 2KBEA 3SQBA 3L3IA 2JFFA 1Z6QA 2AJBA 2R0LL 3R3WA 3I83A 1BE8A 4JDZA 1N68A 1JT2A 3V4UH 1C08A 5DQ9B 3VYNA 5DMGD 4AKQA 2VF7A 1VC2A 4HL6A 3DJYA 3D2UA 3PYXA 4TVKA 2BGNA 3KAJA 4IQ0A 1U8ZA 5F5LA 3PG2A 2JCBA 1AB5A 1S5HB 3WKCA 1QQDB 4LOLA 4P0TA 1J10A 2ZOOA 4U49A 2Q10A 5HILA 3VR4H 4RIRA 1ZH0A 1BFVL 1UMBA 2XUOA 5AVOA 1UEXC 4AE1A 1FP1D 2H1SA 2YY7A 3M34A 4NATA 1H2FA 1LJMA 3KX2A 3ENZA 3U7FB 2GK2A 2HJKB 3GSVA 3MLPA 2G4VA 5AK6A 2IPTH 4RF5A 3IJEA 3FRPB 4YHYB 3UM9A 2JL1A 4ZUVA 4J8RA 2JWYA 5SX4I 1OOAA 3BKXA 5CD9A 1AGEA 1EUZA 2EIJB 2J0EA 5EUMA 4JBYA 4G42A 4AJNA 2PBRA 2XXCB 2QHXA 3NUZA 4F9TA 1CQYA 3IU3B 4EJ0A 4X3PA 1PZBA 1AKRA 1GPJA 4W4NA 1FZKB 2D5LA 2I8CA 5GRJL 3I6GA 3AYZB 1P44A 3VUFA 4FNMA 1HM5A 4ALAC 4GKZA 2PMFA 1UCTA 3PG5A 5FPYA 5BWCA 3PX3A 1G20B 3EARA 3TTXA 3QUHA 4PJ5B 3IDFA 1XPRA 4X7FC 4KRMB 3OR6A 5KDDA 4AXBA 3HB3C 1ZMTA 2AOUB 5IHLB 2LU3A 4ZTPH 1DKPA 1FSSA 3GSXA 4ZGBA 4ND8A 4RULA 4WJ5A 3A67L 3DHUA 1SC6A 2HFFA 5DJ8B 4KC0A 2O2IA 4CNQA 4WXRA 1BFOA 1V4VA 3ZTYA 4UOQA 5DHQA 3IEKA 4RCVA 1C1DB 5HDRA 4EN3C 2A5DA 3KPOA 3QMWA 3CZCA 1FMCA 1NEUA 4Z3DA 3HG1B 4BK5A 3L6CA 3OPYB 4ZT3A 4KQ1A 2Y3NA 1AIFA 3D1MC 5H35A 4EWLA 4PPNA 1NLDL 4TM7A 3K6KA 1X1AA 2YRFA 1V7PC 4Z0TA 4Q6BA 4M9XA 4Z9BA 5C8YB 1JK8A 2ERJC 1FFSA 4BHUI 3SZLA 3L0IB 4INJA 4M4RA 2Z64C 1JWUB 4RXTA 2CFOA 5E8DH 1A7RH 4O2FA 3FOWA 3DV9A 5J2TF 2C3WA 3IRPX 5KYYB 2MR5A 4PJGE 3FLBA 1MN6A 2A78A 3ABLB 2Y9MB 1O94A 1TVDA 2FSUA 1N2EA 2GTZA 7MDHA 4PJ5A 2Q8NA 3OX8B 1NHWA 2J5BA 1LO4H 1W25A 4LCUB 1A4JA 4EUPA 3CAFA 1X74A 5MHTA 2XWTA 2WJ7A 3IIJA 4G37A 4TGLA 3BB1A 2E7MA 3EDFA 3WUWB 2RKWA 1MB4A 3QSGA 3IL2A 1BD2A 4Y9RA 3NH9A 3P2IA 5IQ9B 3ZE2B 5H8WA 4ENEC 3G5XB 1BMGA 5DCLA 4XOCA 1A0QH 1BDJA 1B0RB 3ZI0A 1A7AA 4ZX6A 2V7UA 4HT3B 5E2IA 5DVKA 1IG0A 1ZH8A 2WUWE 1OVZA 3BN9C 1M0TA 1QVOB 4L5YA 4R7DA 1AGBB 3B3IA 1MY5A 1RW4A 1KDZA 1UAYA 2BFGA 3FW1A 2A9NL 1MP0A 3NRFA 4L8BB 5LP6B 3MCZA 2Y1AA 1X7GA 4WZ6A 3T4PA 3RI5K 1N5AB 3E82A 4EHHA 3GXPA 3T0IA 3IPYA 4PHXA 1O95D 2OEPA 3ZE7A 3LZRA 5ITBL 4GMSL 4DWWA 1OC2A 5I1KL 1O08A 1TQBC 2F1OA 3STZA 4YDJB 2C5EA 3TEWA 5GP1A 5G5DB 2B94A 1EVIA 1ES0A 2CMGA 4D8PB 1P7QA 1C81A 4YAUA 1FL5A 3BB4A 1HQYE 4UQPA 1N5JA 5FUOH 1ZJWA 4HAIA 3G5AA 1OGSA 2WJ6A 4JMLA 1IGTB 4N8EA 1Z6GA 4DZTA 4JUIA 4CT0A 2FG7C 3SQWA 3O6ML 3CCBA 3K72B 2QGEA 4MCYA 5LNK6 1G7JA 2PYEE 4YHKH 4D6PA 4M46A 3D8NA 1PV1A 1PQWA 5A0VA 2QROA 1HEZA 3L3GA 3GELA 4OAQA 5KNLA 1KV7A 2ODQA 5HVGB 5KAQG 3IO5A 1E2EA 3FZUC 4HWBL 1QP8A 4P35A 1CJBA 1P4SA 2X4QA 3IM1A 4KI0A 4MS1B 1KMQA 2H26A 3IFPA 2AAVA 1CGUA 2XGMA 2A9AA 4HX1A 3WL8A 3H17A 3R5TA 1F6LL 1G6RL 1QWHA 1YDWA 4WI5A 4OK5A 4K28A 1WFJA 2GJJA 3CMMA 5MN6A 1X5XA 5EMMA 1MJJA 3N6VA 3NTVA 1IY2A 4ANFA 3MWFA 3NVKI 1TLFA 4OGGA 2FWIA 1G8GA 4R2XA 5KSBB 4JGNA 4HEA1 3O3EA 2H2IA 4YDIH 4JVWA 2P1YA 1ACMA 1D5MB 1BIIB 4J1UA 1VJGA 3GD5A 2WIKA 5IBUB 3N1PC 5MF6A 3E84A 1JEYA 4UUPA 5I6XB 1QQDA 1ZD5A 1XEDA 3KE9A 3ARFC 4BA0A 2VO8A 4O59O 4EJMA 1ZD8A 2NY5C 4UTPA 4IZHA 2D0OB 3HQ4O 3NORA 3ARPA 3N3AC 3OAAD 3EODA 3EO0A 5JHLL 4KCGA 3VPHA 1G7IA 2ENPA 5KSAA 4MW6A 3OZRA 3EDDA 2HJLB 4G0YA 2IALA 1WDWB 2EXWD 1G6Q1 1D5XA 1K5PA 3MZ0A 1PY0A 1WE5A 2VJXA 1QPPA 5E3HA 3KAAA 4M9UA 2ZR8A 4V1DD 1L8QA 4F3KA 4B5EA 4U6QA 1REQB 3GM8A 4JM2B 3KPRB 3PQYA 5HHVH 1XDDA 1WW8A 4WNJA 1DRUA 3L08A 1J42A 5A5FA 4U1HB 5CGTA 1ST2A 4C7JA 2WQUA 4IMRA 1W8DA 4W1RA 4YHHB 4TL6A 2ZWAA 2XXAA 1SXJB 4FHBD 2X4TB 3P0EA 3V52H 5DRNB 1G8AA 3FWKA 1H42A 3HG7A 4A73A 4N7BA 5DRXB 5EU6B 1H3NA 3CXFA 3FQ2A 1XR9A 5FWAA 3LQAC 1KYVA 2G30A 2CDBA 2V17H 2CV2A 1BX2A 5MGNA 5D5MB 4NN6B 3B2PA 4ZXBD 2AS0A 4NYMR 3WG7B 5AB1A 1UH3A 1Z3RA 3NHZA 4P4KD 1YQGA 3M7OA 3TPZA 3QISA 2HFGH 3KLLA 1PR1A 3F5FA 3EXEB 2C07A 1H1LA 3T77B 3OE5A 3L8MA 4EFLA 3WTUA 1NDGB 1JWMB 4TLMB 2FSFA 5AW3A 3OM3B 2ZM6B 2PSFA 4BAUA 1HEJC 4HHAB 3MWYW 3THXB 3U7WL 3NIFE 2GFIA 5IP4A 2I55A 4Z78A 1IVLA 3GI9L 5F1IB 4PLJD 4XWWA 2HJLA 2Q1YA 3MBXH 3UTPD 4NRXA 3BPLB 1BO6A 2QT0A 3BO8A 2YIHA 4AIOA 3NAAL 3Q11A 3ZLBA 4ZDWA 5JAOA 3UAOA 4R3SA 2NY7H 5B1KA 3I12A 1WA2X 2IX3A 1W93A 1OF1A 3PDWA 4BBZA 2BS9A 4UM9B 1RBZA 4MO9A 2WKOA 4UXIA 2FJPA 1GNTA 1T7WA 4P23C 2WO3B 4LU5H 3UWSA 1TAUA 2X0DA 4W6ZA 1MW9X 3SGEH 2A4MA 1KAGA 1MQSA 4ABVA 3LUKA 1S7WA 4QTYA 2CE6A 3WJJA 4II7A 1ZSHA 5LAXB 1MVLA 4I5BB 3WNNA 2B0SH 3W39A 1EVYA 3ELYA 5FUVA 1K8ZB 4DAGL 1RZPA 3U6BA 5D3MA 4E03A 3CF4G 4XOUA 4B9IA 3LHKA 4LJRA 4WW2B 3KZMA 3DH0A 1U1IA 3E9RA 1XR3A 3W3AA 3QIWB 3GBNL 2PZJA 2E5EA 1IT9L 3X1DA 2GCIA 4AJIA 2KI6A 1J8FA 3L40A 3GLFB 4MCHA 3DK2A 4DLYA 5J2UB 4WO4D 1RLMA 2C1EA 1P6QA 4KJYA 2NXYC 3A2LA 3CEMA 5D96C 3JU3A 4IBQA 4BIKA 4Z7NB 3I9OA 3UWDA 2PU7A 4PX3A 3QR0A 5B1AB 1BW9B 1XRSB 3TZVD 3U44B 2Y7QA 4ETYA 1YKFA 3BKCH 5A3JA 3H75A 1W49A 1LEIA 4B31A 3GNMH 1T5HX 3MLXL 3ZKWA 5A2CA 2J6EH 5E0QA 3DLCA 2G2RB 1CR6A 2OXGB 2ED7A 3FDZA 5I7SA 4OZHB 4E70A 4WI3A 4U0QB 1HFJA 3QWRD 3LY9A 3UCQA 4ZJ9A 3LPLA 5EU3A 1NVWQ 4APQA 5CD5D 4A6YH 3QDJB 2O1EA 2IZ1A 4KHPB 2G7MC 2OHVA 4BN0A 4I55F 1FGNH 2ZU6A 1R47A 1DB3A 4FHEA 1YSOA 1P6XA 3DBXB 5BJTA 5I1DA 2DIBA 3IXQA 4DHLA 2YKKA 4U33A 4NBYB 3ZWBA 1DQDL 1MT0A 2AQIA 4I89A 1SCDA 2VITB 4XX1E 3PL6B 3PRZA 3OKFA 1NFIB 1WWCA 3FF8A 1JPGB 1XRRA 2IYUA 3C6YA 5CEEA 5GRUH 3EEBA 1HL3A 4I1OA 3RLSA 5CT6A 4ZVQA 1JGDA 4YR6B 3D06A 2B1AL 2V58A 2ZCHL 1FL3B 3RS8A 4Q1CA 4PYRA 4LCBA 2YMMA 5EEZA 4NO0D 3VNYA 5LB2A 3HNPA 2XVLA 4M7LL 2CXTA 4EO9A 5LXGH 3TTTA 4ZT1A 3H1GA 4GNRA 4US1R 3JXAA 5IH3A 2OR8A 1ZCBA 1V37A 2YWJA 2UZ1A 4GKVA 2VTKA 4RW0A 1ISHA 3CFUA 2XA3A 2DQGL 4ELMF 3QYNA 3RTGA 3T06B 5I8ZA 1EAQA 1EP3B 3N2LA 4MJ5B 2VSCA 2PWFA 4I1NB 2X41A 3U4HA 4F37K 1C30B 3LBAA 1EIZA 2CLDX 3SGKC 4UBOA 3CVHL 2GAAA 3A04A 1CETA 2H0QA 4TS6A 2R0KH 1K6MA 3S3BB 4AL8H 3G8CA 3BXHA 3OY2A 1FF9A 5HHVL 3TIDB 2PXCA 1RYFA 1CXKA 4RJLA 3SF0A 3JATB 2A6PA 4MR9B 2VMDA 5ALMA 3WGUA 1FS6A 1PNQA 4HDIB 1H85A 1T4KA 2H17A 1RACA 1I82A 4U1SA 3WJJC 4L5FL 2ZRCA 4YJDA 2ZPKL 2WWYA 3T0VA 1NI4B 4IR7A 3GEPA 2NU9B 1AHWA 4JO1H 2HIMA 3FR7A 3MQIA 2W93A 5DJ8A 3ZU2A 5LQCA 2AV7B 3QR2A 4NO0B 1V7QA 3V4PB 4QTHA 3BH4A 3KPLB 1P1VA 2VHQA 1OLOA 2I9LB 1Q0TA 1PJAA 4O2RA 4I77H 4JEMA 3RKSA 5DSXA 3O2WL 1E1QD 5D1ZD 4QRRA 5KVQA 1LP9B 4B2YA 3QXCA 2P6UA 1KIUB 4O2AA 1UZUA 1Z2PX 1QYCA 3AUXA 3HU2A 1X5IA 2X1QA 3V5DB 4TT8A 1QUFA 4HZUB 4LKCB 2R51A 4U5XA 1NDQA 1G7MB 1CLZH 2QL7A 1T83A 4GYBA 3DZBA 2OBGA 2IF0A 5JXEA 2HVKB 2HQSA 4HD8A 2MINB 2O50A 4RELA 2CVPA 3OZ9L 2Z2JA 2N4IA 2AJXH 3UPAA 4Q9JA 5ICCA 4ZVVA 3RBGA 5DWVA 1TVCA 3VFTB 4N2MA 3MRFA 1C29B 1KZ4A 1DHTA 4MMZB 1G2IA 2DMGA 2C9VA 2I25N 2A0YA 3GEHA 5TPWA 3BCSA 1E18A 2F19L 2Y6TE 4UB0H 1KKLA 2Q9BA 4JBNA 3GHPA 1GUBA 3NN8B 2N56A 2QP9X 2R4TA 1VENA 2FUQA 1QSFD 1N34B 4GBGA 4IIQC 2GSIB 4I7EA 4RGMB 4CEJA 2PPLA 5JIMA 1HK6A 1BKDR 2CDRA 1XZEA 3KKKA 1JQKA 3JZIA 2NP7A 1YPZA 2QMOA 3LYHA 2ZKLA 4Y3UA 4JFSA 5LDGA 1FSKC 4JBHA 2VT2A 4I46A 2CCGA 2R8BA 1QNFA 2VW7A 3SYAA 2H1CA 2W8BB 2J45A 2A4EA 1Y9DA 1DSYA 3S6CA 4QRFA 4NLLA 5IQNA 2B8EA 2O8DA 1UZLA 4I2XE 1FUUA 5AOKA 1U2EA 4C4RA 5CH8A 2X0FA 3NYIA 2GK3A 1Z5LB 5GV8A 4JRYE 4HFNA 5LJLA 2L18A 4GSLA 5K3FB 3TBKA 4LVNB 2LW7A 1IBYA 5B2FA 2DBJA 4XVQA 4YJ3F 2Q5FA 2ZYAA 2HGZA 2YV1A 3ID6C 4R51A 5HQTA 3BZDA 3V6LA 1U9IC 4BFCA 4N5MA 2HT1A 3HPJB 4ROTA 2VNSA 4PJ8C 3Q0HA 1P0MA 1Z73A 4MEAA 2AUTA 2JCCB 7REQA 4ENWA 3QNFA 4ANUA 2PPVA 3AXHA 1UXJA 3H5OA 3Q6FB 2BFMA 4X44A 1IPHA 2Q6LA 2H5LA 2ZXUA 2BM9A 3ZL4H 2FMKA 4IUBS 1I85A 4DKXA 1NUFA 1CDOA 1AKVA 5IB4B 3CCHA 2SCUB 3LTVA 2ONCA 4RD4A 3CH7A 4YNBA 3LZDA 2JRCA 1HH4A 1EDBA 4Z4QA 1L8XA 3O31A 2P5YA 1BF8A 2XMPA 4N6QA 5T3ZD 4KVPA 1SN5A 1Q0RA 5ECDA 4DZBB 3RU9A 2MMCA 1SBSH 4JLSA 1LO4L 3GSWB 4BMOB 4GP5B 3VXSA 3VD2A 4FGJA 3D09A 4LCWA 3NA9H 4A15A 2M6RA 4INOA 1LX7A 2YHAA 1LW6E 4HBCH 4NOFA 3P9ZA 4B4OA 2JG3A 3H84A 2B1HH 2BT4A 1G43A 5DLDA 1SU6A 4N1HB 1TUBB 4Q3EA 4ZYTA 4CSZA 1GGCL 4LAQL 35C8L 4DLWA 1X3DA 2VSQA 3SY6A 4Z3HA 3NSFA 4IFEA 5I1GH 3CXDH 4TTRA 4OTXH 4N8DA 2JAQA 2PXYB 2ORWA 2O8EB 3ZDAA 1QTSA 2HKIA 1YT5A 3L6BA 4ALAH 3NV7A 3IP8A 1WITA 1W88A 1KFAH 2Y1WA 4GRWF 5I16A 5F1OB 2XA8L 4E0RA 1MO2A 4ZMTA 2G09A 1MENA 3A1WA 3PCRB 4Q3AA 1QLFA 1X7HA 3MM4A 3Q87B 1IWOA 3MFYA 2MSPA 4HK4A 3N55A 3P9CA 4CTMA 3R8FA 2N1TE 2W11A 3KPRD 3DOFA 5FBQB 1Z0AA 4C55A 1Z4QA 4AXWB 1I0IA 5I6PA 1VLZA 4PBWD 1PZDA 3C3CA 4RZSA 1I7UA 1K8IB 3H5TA 3BWUF 2VAWA 3M6FA 2P1RA 4NWUH 4RZHA 1VCBC 2DZDA 3HCFA 4G5HA 3ZTDC 1V35A 1GTVA 3EXAA 4BELD 2VT3A 5KIAA 1N8OE 2CUKA 1SOUA 5EUOE 2ZKIA 4TVPL 2AJSH 1IVTA 4Y2SA 1GDTA 1HNYA 2VAVA 2I66A 3ONVA 2WSKA 3D5EA 5DGTA 2APVA 2FHPA 3F7MA 3I04A 4D4KA 2YINC 1PG2A 4M9ZA 3IMRA 2XY4A 3LQZA 5J5AA 3N2EA 4WN9B 4FQIL 1N19A 5CXXA 2OCAA 4PRNA 2HA7A 3E9NA 3ZW8A 3VFRA 2QSCH 2WICA 4W5JA 3RUGA 1XIVA 2BONA 3LP6A 2B7DT 1DZIA 1NUSA 4KW7A 1X1SA 2EQAA 4MB5A 4KB5A 1RKBA 3DDCA 1C41A 1NSNH 2J6BA 5ALTA 3CDFA 2GEEA 1PEZA 1A9BB 3A3YB 4B3FX 2ZUDA 2IMNA 5CWSB 5IEHB 4PXSA 4X7CC 3HKFA 4EENA 3PJLA 3K0YA 5EZIH 1FO0L 1B4JH 2VYVD 1C5CH 2J7KA 1COBA 3D8MA 4JDTL 1QORA 4JYAB 2FGZA 4GHWA 3ILEA 4G65A 5AT1A 1Z5UA 4QNNA 1WWKA 3TZCA 3PWVB 2W6PA 1S2EA 1QK4A 3UG5A 4LHEA 1TM2A 4LOAA 2WB1A 4B4WA 3X11A 4MXWH 3VH3A 3HRHA 1C0LA 4XVTH 5EEUA 1JNLL 4FFZH 1KAHA 3KPLA 4UFOA 4D8TA 2FN8A 4MCZA 4KC3B 2XETA 4N82A 4B50A 4KPFC 4ILEA 4OKSA 3I50H 3BP7A 4PW9A 2NLJA 1BD2D 1VM6A 2RDMA 2XXGA 3PDCA 3OTHA 3CKMA 1I24A 3ZKQD 1G9MC 4A6YA 1WCIA 3MW8A 2XDWA 3Q9LA 3CZSA 4EUPG 4I18B 4BO9A 4OB8A 3NSDA 4LSUL 5LCVL 3PICA 5D3QA 4MR9A 1U3ZA 2EZ9A 5L0QC 5KBDA 1UVQB 1BZDA 3F4LA 4B47A 3IQZA 5CVCA 2ALAA 2IGFL 3MGOA 4AGOA 2J6EA 4Q7EA 4ZANA 1RLOA 2YDYA 4CM9D 1HXYA 3WGJA 3EFEA 2PS9A 3F58H 3P0IA 4R8LA 2F3QA 3RGVD 1KI3A 3VG0H 3VPAA 3NIWA 3H42L 4J6FA 2NOAA 3BPSA 2ZYVX 1RJYB 4F24A 2ZB7A 1TM4E 1ZK1A 4IOIB 1XL6A 4GT0A 3DULA 2IEPA 1PCXA 1W0YT 1V55B 4LISA 4RLFA 4DR6B 2K7ZA 2Z5FA 5FTMA 1BQLH 3W2IA 1GGUA 1WB5A 4ONGL 3JTBA 3Q6GH 3ML9A 2WA2A 5EU4B 4XGKA 4Q1DA 4W8GA 1EDOA 3QELA 4XB7A 2ZRJA 3F2VA 3IKMB 3LIZL 4IK7A 3V6FA 5I24A 3MJ6A 1JR3D 3LPPA 4EARA 4B87A 4YSUA 2ATKA 2H9GB 3BVWA 3CFEB 5CJOH 2DLIA 1XMWA 5E9WA 4F1SA 2P5EA 4MA1B 4BO0A 821PA 5B1JC 5KMGA 1KYOJ 3WV4A 5CAEA 4KYIB 1XVIA 1JHOA 1AGDA 5B38A 2BFVL 2JLLA 2ZG1A 5DTFA 3SSGA 3P96A 1RXVA 4KPUB 1I9IH 1YNLL 4CIXA 3OWHA 3GK3A 1CP2A 1TA9A 5IUJC 3DBHB 1MB2A 3C7AA 1NNUA 1I3UA 2YLHA 4WY7H 3SJVD 3P2YA 2OP1A 5I8PA 1TTUA 4TXVB 5LSAA 2R11A 2R66A 4NG4A 2VWEC 2X40A 4DEYA 1IXZA 4WBXC 3JD4A 3DHNA 3FTWA 4NBWA 3AZQA 5LP6F 2YMPA 5E8PA 1ZE3H 1NCNA 4P9ML 3O4OB 1SJVA 1SF3A 5E9DB 3NEYA 1CZLA 1W75A 3BMCB 1W1WA 3OB0K 5JNWA 3V0VB 1A4UA 1OJ7A 3APDA 3VMMA 3T7CA 1WUZA 5AKHA 3GSRB 4JPWH 5D5PA 1EXNA 4AVHA 4D9IA 1RRPA 2IEYA 1H6UA 3BAEL 3PI6A 3HBMA 4X20A 2WU0A 4FJ2A 3H5RA 4UZSA 4QQFA 4S1DC 4XIGS 2VDNB 2NY5H 2EP5A 3OMZA 4FQ8A 1H8EA 2Q7YA 5CLTA 3QBTA 1L5WA 4OBEA 1RHRA 1Y3CE 3LRTA 1ZHOA 3UMCA 2QBYA 1J25A 2DJIA 1JSLA 3ZZUA 5JIHA 1VZHA 1LX6A 1I1AC 1R6UA 1NKOA 4QQRA 1QSEB 1PJRA 2BP5M 1UWVA 4YP7A 1VI6A 3QDJD 4NB7A 3RWMB 2K70A 3QEKA 4CE6A 3HS0A 5J89A 5D7IA 3JTSB 3RADC 3CBKB 4IOSD 2W58A 2MCPL 3SPCA 4F1JA 3T1TA 3BSZH 5CILH 3KD3A 2AEQH 2H9YA 2Q99A 2YASA 4I4CA 3RAEC 2QI9C 1QIIA 2FWMX 4BZWA 4XM2A 2AMJA 3BSYA 1YJCA 5LNGA 2K4MA 1S7VA 3RIYA 2D8KA 1A3QA 4I14A 3QB7C 4FL4B 2JLSA 2I1LA 2QJDA 3S27A 1FXWF 4IGFA 4JFED 1K5NA 2Q20A 3UWOA 1NVDA 5AVZB 3ENEA 3LPWA 1DVQA 4OHYA 4JRXD 3SDCD 1C4KA 2GYWA 2GVYA 2ZK7A 1XJ5A 3RFTA 1H8NA 3QUAA 4MPDA 3ZLQC 1XDTT 1TT5A 1YA5A 1YECL 5KYVA 5DIZA 5E4IA 3GXMA 1CUEA 4C83A 4LSSH 3TWOA 3WK8A 4L4XA 4KKPA 4DSZA 4ATNA 4P05A 4EATA 4W5RA 4EJSB 2HX8A 4PJHE 3C41J 4RESA 1MIOA 5I1IL 4ZXFA 5H3HA 2WLLA 5ECGC 3MV11 4F91B 4KFRA 4FB5A 5BVJA 3N5CA 5C1BA 2OXCA 3MQFA 1X7XA 3LU1A 5IDYA 3DZDA 3PYLA 3PNKA 3HNTL 3VQLA 3AWDA 1FGVL 3FTDA 4HJ0C 4GKSA 2ZIWB 4JITA 1FDWA 4FNTA 4KMTH 3FYCA 4LDPA 3SZRA 1CY1A 4MUIA 4EY8A 3SOPA 4DRXA 4YJGB 5D1ZI 2JIDA 3ZWMA 3BWZA 3INOA 3AM5A 3IAEA 5DGIA 2O6DA 2BBTA 2WQAA 1CYWA 4RA6B 1N36B 1VPOL 3U1PA 2WKQA 5EL0A 1Z17A 1FPMA 2IAMC 4B3JA 3AITA 3GSQA 2V3FA 4HN2A 2VGLM 4OF4A 1HNZB 3CNHA 1ZEJA 1MFNA 4OOFA 4QJ3B 3KYBA 4ND5A 1YUBA 1ICTA 4B9PA 1ZJAA 3WY2A 1KJ9A 2WD9A 4BX3A 4UOW1 5K39B 1WO8A 1S4QA 2NUAA 4I5FA 1W59A 1J0ZA 4IJQA 4KACA 3V5NA 1QGOA 2ZJ6A 3DPUA 4YAWA 3WVNA 1MNUL 2G60L 2IKQA 4X8JB 1FUKA 4HX5A 1T36A 3GZ4A 3HLAA 1Z4PX 3ZWAA 5GGSA 2JGDA 2PW1A 2V65A 5HI5D 3VDMA 3HZVB 2CLMB 3CFQA 5KOHB 2PGXA 3VFRB 3GGOA 4YRAA 4G8IB 4W5NA 5BORA 2AK1H 3Q8XB 2Q2LA 4RFLA 2M8XA 4GG6A 3RTQD 3JZAA 2ZVJA 3HPLA 5CH5A 5GQBA 4QDUA 1A6VL 3QG5A 2AABH 3U3KA 5ABAA 4OZIA 4J0FA 3UV6A 3WNZA 4B43A 3R5HA 4KROC 3RL1A 4DRZA 2QPDB 1RBYA 3B9EA 2IZ5A 3IAPA 1BJ1J 4YO0B 3T8XA 1QQ6A 3H42H 2ZBUA 1L5GB 1I2BA 1IGML 2ETWA 1Q0LA 1E3SA 4UNUA 4BPRA 3MLTB 2QX8A 1XX6A 2D5CA 5C0GB 5C18A 1HEHC 5FLVA 1OYVA 4OAWA 4MTCA 2IXFA 4DPRA 2VQDA 5JD4A 4EW6A 1NKSA 2A74B 1LHZA 4D4MA 2ZE6A 3DKRA 4JW3A 5COAA 4PS7A 5LJIA 1FL5B 1RWPA 1GGKA 1D9KA 4AZ3A 1V8FA 2X5JO 4AG4H 2GZSA 3BD9A 3IESA 3WICA 4QXQA 1BHO1 3FUHA 4RHUA 1T5WB 3JT0A 3V52L 1KR5A 3HB3D 1ZTXH 3V4OA 3F1KA 3IEAA 2D7TL 3REWB 4M00A 4BNMA 4KJQD 3I0MA 1TGVA 4JPWL 4L4JA 3OOJA 4TKVA 1A3ZA 3V5HA 2YAHA 3VFGH 4LQDA 1ZXKA 3TKYA 2XBUA 2HT2D 4YRPA 1DE0A 2VYQA 1U8MA 1D3CA 5DLEA 2B99A 1CSEE 2WRZA 4U6VL 3SZGA 1EHLL 1AE6L 4IQ4A 2NUTA 2UZ1B 3NT2A 1TTBA 2WBJD 1ORWA 3I05A 1NVTA 1RVFH 4DQXA 4BO4A 4P23D 1M34B 3IQWA 1COWA 1UKBA 5HKLA 5EZIL 3UTTE 4GMTL 3KRTA 3MC0A 2BZSA 1I7DA 3BQUC 3K6IA 4BNFA 1VKOA 1U3CA 3TSOA 2ZI6A 1UBOS 1QRNB 3WY4A 3EDQA 3BL5A 4NPCA 2W7TA 3N2YA 3ROOA 3KYCB 4QECA 1IH8A 3ZNQA 2F7SA 4OBSA 3ZIAA 4JQOA 3H8VA 4WCYL 4PLJC 3RSSA 1GUYA 3GBVA 5KS2A 4G25A 1HJCA 2Q7DA 1HQ4A 4PYKA 3MR9A 3JARB 3NCTA 1A7BA 1AH1A 3CEHA 4BJ5A 3ZN6A 4IU2A 3QJFA 1Q1BA 2I3BA 3LZ6A 2FJFA 1GRCA 1K7EB 3BZWA 3PRJA 2WTUA 4DETA 4Y4KD 1TMOA 4JI0B 3KYNA 3MJGX 3VI3F 1K3FA 4TSAL 3VUEA 3L3OA 2LLGA 3WYGA 3KU1A 1XIWB 3SYQA 1B4TA 4YXHL 3T6XA 3N2IA 3IDUA 4UUQA 1WF5A 1Z9OA 4LB8A 2A0WA 1HCYA 4QHSA 2VP3A 1Y0LB 3QKRA 3UBXI 3VFNA 5FYDA 2IYNA 5EN2B 2YRZA 3F58L 1CZNA 4AG4L 2WNSA 2IPTL 3HNVL 1GAXA 4PJ8D 1GCAA 3VH1A 4PGDA 5CJBA 5LMCA 5TSDA 4Q3NA 5ICZB 4XJXA 4RBPK 1R5OA 4DR7B 1R4ZA 5LMNB 3DBLB 1BIIA 3B7PA 1Q44A 3BKML 2FQFA 3H6KA 1CJSA 5KSBA 2I6UA 3GC3A 1QIDA 4BD4A 2P3SA 4ZCRA 4J2XA 3FDWA 5C0CD 1KO8A 4H20L 2D7JA 2OD9A 2ZFUA 4MUMA 1DGQA 3GO4A 3SGJC 1QOZA 4OSOA 5EJIA 5EWMA 3TX4A 4LDQA 5TQ0H 2WYHA 3FU9A 4AYFA 5BOPA 5E0OA 2M6LA 2A9NH 1KI8A 3IUPA 4TSKA 2WD7B 2GZ1A 3B2NA 4OJNA 1EWYA 1F8YA 4K6OA 3BFQG 2APXA 1LJLA 3Q6MA 4DMFA 4GOJA 3TE6A 4XARA 2R1YA 3WRXC 2P2DA 5JEDA 3MRLA 3HXKA 1IFHH 1XZ0A 3KWJA 1ZJBA 3MLWH 3NBZC 4JPKH 5ABPA 4BB5A 4XCEB 4MRSA 2AJYL 4RTMA 3P4NB 4PJDF 4E51A 4Y4KC 4XE0A 1DJIA 1Z7WA 4LPKA 1RWNA 1B0GA 3EBHA 4N54A 2VQEB 1NX9A 3MYRA 3WNJA 2R00C 2GYVA 3ME0B 3GA0A 4QO8A 3ULVE 3STUA 5C09D 2NPFA 3AEUA 1NAIA 4ZW8A 3GHBH 4EUHA 1ZJ6A 3KPJA 1A7OH 1FYDA 3MB5A 2UZ4A 3TQQA 4BNHA 4PZLA 4OFYD 3SQXA 2WJGA 4CUZA 3LZOA 2JEZA 4X00A 3ND9A 4K8OA 4DEVA 2YPVH 3DDOA 2CK3D 1Z7BA 3M4YA 4D94A 3M33A 2A84A 4R26H 1QAOA 3JQ6A 2O4EA 1CN4A 3QWBA 5FL3A 4BO6A 5EULV 1BXRB 1WAEA 3KBHE 5FBWB 2X7LB 1A5AB 3FPAA 3Q7SA 1R5JA 1Z5GA 1KZQA 2XUJA 4PGBA 2ZYSA 2E9IA 4AQEB 2CUZA 4WI1A 4UMSA 5F51A 2WPDA 1S9XA 4ODHH 5GS0L 4I3SL 5DC4B 2QR5A 3MBWA 1NW6A 5DKFA 1UP7A 4JFWA 4TOYH 2IFTA 1KAMA 4KVCL 3G17A 4K07A 4Q9AA 2JGAA 4ZFFA 3OG9A 4LCWE 4HQNA 4DGQA 4AQ1C 1DT3A 2ORBH 1S2NA 3ZDYF 3MJRA 3IT2A 4BUQA 2IANA 1JLMA 1X8XA 4QTIH 3OAZH 4GPBA 3VDNB 5DXFA 5K8IA 4YXWA 1EG7A 4HLEA 4TPRH 3AADB 2C83A 3I2YX 3ASUA 3I2HA 4GQ9L 3TLGB 5FO2A 5K93A 3FA2A 5HZHA 2ICWI 1FL6B 2EXYC 1FW8A 2WZPD 1NBVL 1ONBA 1WTGT 3BD5A 4AF6A 3KXFD 4DADA 2BHLA 2WWNA 5J9PA 2CIKB 2C2WA 3U1BA 1MDFA 1LTKA 2ZQ5A 3CO0S 4ELDA 2X4GA 1MC8A 2XE4A 3RC2A 3BQVA 2H2HA 4URHA 1PDWA 4U1NB 2PV7A 3NRBA 2JFCA 1MJHA 5FO8A 2AX3A 4MS6A 2R65A 2FE1A 2H65A 3K0AB 3M88A 5HDQH 5KSOA 2VDWA 3DRTB 1KXVA 1F9AA 4UV4L 4O6VA 3AR3A 2W98A 3S3JA 1DXQA 2B3DA 2GJAA 4KOEC 3S3TA 3B9KB 2VLRD 3OWOA 3MJFA 3SVZA 1D9XA 2ZUYA 4M7JL 4PO3X 3EZFA 4MB1A 3V6OE 4LJLA 1B2WL 1L4EA 3D3KA 1B15A 2H4XA 2BR4A 1KEEA 4LASH 1FW6A 5D6DC 5GOTA 1K86A 1FZOA 2OMUA 1A7JA 2QM3A 1V1RA 4X8GA 5I6MA 1AQ8A 3C3MA 1PDVA 2GCYA 5FECA 3AMLA 3GRZA 3VR5D 1EJOL 5LPNA 3WRXA 1WHSA 4K0RA 4K9KA 4EPYA 1C7IA 1WIPA 1I3KA 3HI5L 1NC2A 1TJMA 1QCDA 3O4JA 3L0SA 4B1FA 3EZLA 5DD6B 3U82B 3CISA 3IU3A 2FZEA 5I18H 1Q57A 2VJMB 3AUYA 1DCMA 4OTZA 3VM7A 5J13B 2OFQA 4I5DA 1I3OA 4TTTS 2YWYA 3RGHA 2EXYD 1T1EA 4NBKA 4PR0A 5C09E 1KIQA 4BLWA 4X1IB 3CMCO 5HXMA 3QE3A 3D3VE 3VYUB 1AHKA 4NPJA 4WU7A 4TKVB 4YPVA 4A1FA 1R24A 5EXDA 2YZ8A 3UIYA 1DQPA 5P21A 5JMOA 5I47A 5HIIA 1N6RA 4PWKA 4JM2D 2Y5TB 4O9HL 1RXSA 1YJQA 2QPTA 1FTQA 4I3GA 3N1FC 3T4EA 3DO7B 5EF3A 2FW0A 3NFNA 1D1PA 2B4CL 1I4WA 1ZRNA 3NPMA 1H3PL 4K71B 4G9GA 1JNXX 1G7SA 3MXWL 3DW1X 5KBLA 5T3ZE 2ZJSH 3L3IB 4IS6B 4YE0A 5EJ6A 5C37A 2G0AA 3DAPA 4RZUA 3ZVMA 5F9AC 3D05A 4V2UA 5G4MA 1E2IA 1LO5A 3V34A 2FP4A 4L6AA 4WVRA 3T99A 1XP5A 3Q9PA 2QPLA 3S2ZA 1JD9A 3COVA 3SIRA 1EXUA 3QORA 2IPNA 4XCEA 1WBZA 3PLNA 4O4LB 3L7EA 4IGBB 3WNKA 1GXSB 1OAZH 3S8EA 4P46D 2AQ8A 5D5MA 2NXCA 1Q0QA 1V6CA 3ESOA 4JZJA 3FT2A 3M5PA 4HN4B 1TSHA 1O5DT 3E3AA 4U1IB 1MTOA 5B58C 1V16A 3ILDA 5BOJA 1YU6A 3MTDA 5E1GA 2JB5L 4HULB 1M6VB 1DQLL 5DTEA 3NJLA 1OWNA 2WC7A 4KUCD 4OGWA 2GJKA 5FYLH 2HWKA 4G1UC 4AYWA 5CSBA 4RNCA 4JDPA 1DHRA 3KPRA 1JZ3A 3LC1O 2GY7B 4NYLB 1J87A 1G8JA 2MSEB 3UH8A 3PWTA 5IOPA 4D42A 2HPZA 3KGUA 1S3KL 2VBGA 5JVDF 4NBRA 2QMJA 4YWGH 2XJ9A 1P7BA 5JMOC 3DTYA 4ZHSA 4NHUA 3G7UA 3PV0A 2YQ4A 4IUDS 1NG9A 3MMZA 4J0HA 4IBTA 4UT6H 3OZAA 5C08E 3LX8A 3M1YA 1QFPA 3E2PA 2J55A 5EFIA 3PS9A 5ADVA 1OGAB 4XHQA 3TNNA 4NKRA 4MD4B 1HIMH 4RKWA 3KDPB 4YFDB 1X7YA 2C9SA 1CDUA 1INEL 1GL4B 4PB9H 3QUXD 3B2VL 1RI3A 1GPYA 3L0DA 2F15A 4Z3EA 4PV9A 1L0QA 3K9CA 1UT6A 2BSSB 3UZQA 1E3WB 2YUIA 3QOYA 2FSVC 4FN4A 1X7SA 4JI5B 1KO1A 3PL6D 1SUSA 5HVWA 4Z7OB 2FVXA 3QPVA 4N90D 4KWCA 2GQHA 5D7KD 3DOJA 2IO5A 1JJUA 3BLKA 4DMGA 5JO0A 4NQTA 1N59A 5K51A 5INCB 5ISZA 1FTSA 3MUUA 4JVSB 2G5CA 3DCNA 3PFKA 3BP5A 3WFZA 4GPIB 1G5HA 3HUTA 2HJKA 4NCBA 1CLOL 1DKOA 4OR1A 1BW8A 1K0UA 1YJXA 4JGBA 4BAGA 3LSOB 2EJ1A 2MJLA 3KXFE 4WKBA 3NBMA 2Y1GA 3PUXA 5IBLC 1C0KA 4D46A 5I4KA 4EJSA 4JJAA 3GLGB 4C83B 2WFLB 4PY7B 5B1CA 3ROFA 1RYDA 4L5FE 4IDJL 4GB9A 4J3OD 3TQHA 1A6VH 4UV4H 1NXPA 2IDKA 4PSAA 4NZPA 3BGFC 1HTTA 2V98A 4YZFF 2BCMA 3BH7A 4FD0A 4JO3H 3SQBB 3NFPB 4H6VA 2FUCA 3HABA 3K72A 4GQIA 1NW5A 1BE1A 3O9WB 5FM5M 2E49A 1PZCA 3MUEA 4MRBA 2H0FA 4DV2B 3Q8AA 3C4VA 3QENA 2ITDB 3MBEA 3RS5A 4HGYA 4URFA 3L43A 4QTIL 2B4YA 2EJUA 1KFGA 4EELA 3VQMA 4CKXA 5D7JD 1U7DA 4RACA 3HFJA 5KYNA 1N64H 4FWBA 4UNNA 4XCYB 3X1JA 4XCQA 4NCC1 1OLXB 3BPOC 1KGDA 4DYVA 1S8OA 3TK1A 4ZNEA 4FYPA 2IY8A 5KTMA 3EYSL 4Q14A 4GKNA 3LUGA 2C88A 2YVKA 4WKGA 4HI0E 4XNBA 1T20A 4TMWA 2KPWA 1E2LA 4MMXB 1AVAA 3L5KA 1O7DE 3STLA 2EFCB 4OZ4B 2O2EA 2P2GA 2QXTA 3PZRA 3RA7L 3F5MA 3Q0EA 4MWEA 2HRPH 1F13A 3TSWA 1H5BC 4QOKB 4K8RD 4KJXA 1RIVL 1A9EB 3EJUA 4FMVA 1KGJA 3F6YA 1KNOA 1WXHA 3CLEH 2IIJA 1PVOA 4K3UA 3E1GA 4DKFL 1I4FA 3Q2NA 4HBZA 4BXVA 2Z0UA 3RYMA 2A9RA 4XVSH 1ILSA 3T04D 1MCRA 1ZHLA 1U04A 1ESZA 1D5BA 3U7QB 3MNFA 6GPBA 3DBLA 3RGVC 3QHQA 1FLDA 1XGYL 4IDBA 3D3VB 4OD1H 4EUPB 4BHTA 1O95C 2HP4A 3PY9A 1QC5B 4Z0HO 1UENA 4EG3A 1N77A 3OIVA 1DDOA 3P9NA 5DGDA 3WS7A 2VL7A 4IDFA 1OALA 4YO0A 3HBLA 2W2KB 2QQKL 5JCZA 4L27A 3AUVA 4JC4A 2XFXB 4Z76B 4JXXA 4L1LA 3V3KA 5B30A 3L6RA 2DYPD 4R3WA 1B23P 2V54A 1I30A 2JB5H 2UVPA 2XA1A 4CLOA 2OA9A 2MOQA 1USUA 1SXPA 4MX7B 2ODNA 3G2IA 4AJWA 5EPEA 3RC7A 4QT4A 3OZCA 2X4PA 3HOGA 3VGAC 4A27A 2YFKA 4I08A 3OAYK 4MO2A 1HQRA 5JYCA 4R5MA 3ZGZA 4R96A 1M1UA 1Q5PA 1U95A 3JALA 1HFUA 5IBQA 3ETGA 3MOBH 2RI6A 2DXIA 4LE0A 2VJAA 3S8MA 3OGCB 1UDRA 5CFAA 1YOVB 5E8RA 5C1OA 2E4FA 2QSVA 4PVDA 4UNRA 1RU9H 4DR1B 4QWWD 3QEOA 4JFYB 1OQXA 2JPDA 4ZEMA 2LTQB 1ORQA 3LKSB 4RBPH 5I51A 1Z9BA 3RTQC 1BRTA 4WNAA 1AZZC 5ID0A 3UBGA 5LXVA 3RU3A 2YUWA 2XUFA 5C9JA 5ED0A 3QJRB 3EBLA 3S2UA 5HHTA 3ZD6A 1EEXB 2EKSB 2HH0L 4BUCA 3DT9A 4B9ZA 1UWXH 3QRBA 5I7WA 2OC4A 4RTOA 4MZ2A 3FQUB 4WI0A 4MWGA 3MNWB 4ONGH 3D18A 3ULVH 3GUCA 2IANB 4IH1A 4NYJR 2C84A 3Q8CA 1IO4C 1I01A 5BS0E 2F9LA 2XVXA 1Q50A 3I1FA 3TXXA 4CDHA 1WPXA 2FUG6 5SWZD 4FA6A 3DLTA 1ZP6A 1YQ2A 4NFLA 1JPEA 4OGKA 4KZKA 2O14A 4PTLA 5FHRA 3VRIB 3EISA 2F7PA 4PG4A 1DDTA 4RA9A 2HT3C 1YZFA 2YRPA 1KOLA 1FA4A 4J07A 3B5HA 1GGYA 2RK6A 4QNMA 2YIVX 3IQFA 4PMEA 5ICGA 1CXHA 1WXIA 4G4IA 3J81k 2FRVA 3RHSA 5FR1A 2BEWB 1SJHA 5D7LE 4HPYH 2OCLA 2BM8A 1E1QA 1UAGA 2QUKA 3TD9A 1IXKA 1ESDA 4OSPA 5DUJA 5IIEB 3ZDCA 2ARJQ 3OPZH 3VA7A 4BYHA 1A8ZA 4AMYA 2V3DA 2QJRA 1E0DA 4WQMA 3PXGA 4CMCA 5EH1A 2C9XA 5TT1A 2ZZUT 5GZ6A 1YNTA 1B4DA 5C52B 3VYVA 3KQSA 1XZNA 2Z2XA 5EEGA 2MQGA 5A4KA 5C09A 3WDIA 2OFWA 4QKTA 4C58B 1HVXA 3IJ5A 4JN2A 2WV7A 4DSYA 1QFUH 3QCVH 2ZZMA 4JQYA 2CNOA 1YN7B 3LVQE 3VA2C 1U3UA 3VR1A 1XRJA 4C4AA 5L4LA 1MWAA 1TAGA 3ON5A 3ARFB 3KLHC 4L8WB 1U8XX 4AWAA 5JVDB 4MUFA 3VFVA 5HMLA 1KPVB 4KSBA 4C4BA 4NMXB 4OVUA 3PR1A 3QC5X 1RRMA 1X3LA 1ZKAA 3X2QB 2DP4E 1H0KA 4ZV9A 3K2QA 4LRXA 5ALHA 3TSCA 1JKFA 1NTOA 3LNIA 3RL1B 3JQAB 4IJ6A 3T6WA 3I74A 2J8ZA 2XUAA 2YWHA 2XUHA 5T3ZH 4KKLD 4YDIL 1U8QB 1W2WB 1FN4B 5DHUA 2XZQL 3SDXE 2QF7A 1XMEB 3HE7C 4KRPC 5IDVA 3OKEA 1QTNA 2P1ZA 2ESRA 3KJ6H 1QGZA 1E4WL 1YVRA 3ITDA 1HT2E 3AHEA 4GR4A 3LH2L 4PJ7F 1YJBA 4F45A 4EIUA 2D4HA 4PG7A 4DCMA 3W5CA 4YHLH 4D97A 1FO0A 4M1DH 3F5SA 4PM4A 1I7TB 3ED5A 4R8WH 1DN0A 4BKOA 1PN3A 1WRBA 1U8PB 2V0GA 4NNPA 4X6CB 4S1PA 4LL4A 2EW2A 3A4MA 2PABA 3NV9A 1F41A 4DILA 2FAXA 3LS4H 3V6ZB 1SMAA 4Z53A 4HB2A 1GPOH 3HWRA 2HJFA 4DG8A 5D7SL 1WUNT 4U0JA 4CVUA 1LKZA 4U3CA 2NQCA 1KMGA 4PJCB 3ZEIA 5KOJB 1QIKA 2EDLA 4M1GL 1T9AA 3NOVA 5EMNA 5K6TA 4K5OA 4Z18A 3GH1A 4BFTA 1BLIA 1OAQL 3IDIB 4EIZC 3ER6A 3KHTA 1D09A 1TZCA 3GJFH 2C5SA 5T3XE 3D52A 5A62A 2NQ8A 2JHGA 3VV3A 2NX5E 3X0DA 2C9ZA 5KZCB 3UHFA 3IGAA 4FE7A 2XRYA 3QXHA 4EEKA 3CXUA 1NN0A 1L9TA 1K06A 4NOLA 1DBJH 3AZPA 5CYGA 4EKJA 1WXWA 1OZAA 2PMWB 1E9EA 1MQ9A 4XQCA 2Y07H 1QLFB 4GM4A 1GL3A 2ARJB 3G5ZA 4X8MA 4ZALA 3A10A 4HIXL 4PJ7A 5I5EA 1QBBA 2Z6QA 5HUJA 4HGPA 3QWOA 3H97A 1H3GA 2IYPA 4WEBH 4G6AC 4P23B 2VATA 3EF4A 4MPTA 2VDPL 1KLGB 3KEDA 4ONFL 3WLFA 4G3XA 4NYIQ 4GE3A 3UENA 2ZWOA 4GXVH 2VHCA 3F71A 3UMNA 4J3OC 2NSHA 1H2AS 5KN5A 5SZJA 5JRDS 1PD1A 4RPLA 1JEDA 2ZKXA 2X14A 4QO1A 1R5VB 1LD9B 3GZTB 4DA6A 3PNYA 2WXQA 4KI5F 5CUSH 1JHAA 2P80D 5DM2A 4PJXE 3BH8A 3GLZA 3QIVA 2OZVA 5A9SB 1IM3B 3LC7O 1IM5A 4KMLB 1OZUA 4XCCL 2BHSA 2GN8A 4X6FB 2AJUH 4CRPA 5I4BA 1AR1C 3QQ3A 3N50A 3CW2A 2PDAA 1I1AD 4BM7A 1HE1C 3DWTA 5JTUA 1KIRA 4LSTL 3EZ2A 2VISB 4H8VA 2PKEA 5FKPA 2Q6VA 5GGVY 3QEHB 4K03A 4UDXX 3IJPA 5E5MA 5TDHA 4IKLA 2QHRH 1HOCA 1A5ZA 1ZJ4A 5C8JB 3UATA 3E8VA 2J41A 3PXCX 4J7UA 4L22A 4OLBA 2IBBA 2IXAA 1Y7LA 2QQKH 1R3KA 3ZTTA 4GMTH 3HHEA 3FQXB 4CW7A 4OB5L 2QP4A 1MHEB 2VAJA 5D1QB 4XE5B 2EFJA 4G36A 2HQ1A 3QU7A 3F6LA 1DIOB 3UOWA 3DARA 2J59A 2R0KL 2BIMA 4PZUA 4NQSB 2OK0H 2WK1A 4EB6B 3T1FA 4RK7A 1MZVA 4LWQA 3QVLA 5T4BA 1U8NA 4XODA 5EZQA 3QRGH 3LUBA 2IYFA 2DMHA 1WY7A 2NTNA 3N0WA 4UILH 5D1XC 4CNIA 1Q19A 4HNAB 5EGNA 3ISWA 1XCOA 3U36A 4C3ZA 1CLYL 1LWNA 2OM2A 3B1JA 3JV7A 5AHKA 3I9V1 1GZHC 3O45A 5K3EA 3PABB 1O6SB 3T9CA 4RKQA 4BX9A 3TH3T 3VYSB 1MLBB 3O4LD 5K0BA 1EGQA 4JXJA 2ICEC 1P8AA 4ZQEA 1VGEL 4Y1RB 2D8MA 4B3IA 1IU1A 4BFVA 4C0KA 3MOIA 4MAYD 4E41A 5AW5B 3R3JA 2W1NA 4B3DA 3TESA 2ZYIA 3PHCA 3BP6A 5E38A 3JWDC 4OZIB 2AJXL 4RIHA 3KQQA 1EESA 1QP1A 3NTUA 4CKCB 4ZZFA 4HWSA 1IJBA 5JYMA 2QLBA 4RS4A 3ECVA 2HWXA 2R9VA 3DOSA 3OSKA 3JYOA 1OP5H 3T3PB 4AW7A 2CFRA 2ILTA 1OX6A 1G5QA 1ZBDA 2JHPA 4JEGB 4D5GA 3C0KA 5AAPA 4RY8A 4BV2A 3OZBA 1EHXA 5DTQA 5D4JA 2WAMA 5DEJA 4AN0A 1BG6A 5TPWB 4BU1A 4FKHA 1YPZE 3TBWA 3QWFA 1G66A 3CPUA 3FOFC 3EA0A 1XE3A 3RYFA 3KLMX 2QDWA 3F46A 4RM3A 1D2OA 2VSMB 3MRRA 3BCHA 1T2DA 3ZR4B 3AR8A 2FJSA 1HLGA 2VDUE 8ABPA 2LKDA 3D0VA 3Q15C 4PIMA 1GVNB 3FUDA 3ZHBA 3NSXA 3M9LA 3AHDA 4A6YL 2CBGA 4PPQA 1EEHA 1BBJB 4M7PA 1OARH 5BMVF 3L7DA 1HI6B 2XD9A 2IDQA 4WK4B 2AP2A 3PFCA 1MLCA 1KYTA 3U0TA 3BT0A 1KRWA 2LU4A 1RZGB 2UZAA 3L8DA 3P5BA 4PH8A 3AMVA 3DE5X 4MPJA 3CC1A 4F2HA 3BKYL 4QRRB 2G0KA 1E59A 2XE7A 4OUUA 1RD6A 1P75A 1SYSB 4WWPA 1B0WA 5BQFA 4K9PA 3F12B 3TGLA 2AI0H 5GONF 5G4KB 3D2BA 3SY0A 3UFBA 1Z9PA 3HJTA 2R0WH 1CQIA 2O7SA 2PQ0A 3W11D 1XQ4A 2JGRA 3T2NH 2EJWA 4PIBA 3QBVA 1S8FA 2IRWA 1MAAA 4OIMA 2J1LA 3LQMA 4LRNL 3S29A 4BZ2A 4W9KC 3ULSA 4C7OB 2VRCD 3RVPA 4KUHA 4LPUA 3RVNA 3T3OA 3QUGA 5L6LB 1VHQA 1QFWI 3GKWH 1KGXA 3GTTA 4GMKA 4QU5A 4KKAC 3FAZA 3V1UA 4UT6A 1ZUIA 4G23A 3QWIA 1ZTMA 4M1SA 3ROMA 1J22A 2ZJ3A 2DTMH 1KE1A 3DUUA 2VB5A 1CJMA 7ABPA 4WNIA 5JMWA 5EHIA 4W9NC 3BZEB 1OF2A 3CK0L 4L9DA 4OZGE 4D4GA 2JKWA 4W9FC 4C4YA 3VXRA 2H32A 4ZD3H 3EXJA 2XX1A 4NOBA 3QNUA 4RBNA 2ZSDA 4HB0A 1UKSA 4JQVA 4LF8B 4NFSA 5F1KA 5KX5A 1ENOA 3AREB 3AI3A 1TXGA 2HJRA 3ZQXA 2NDGA 1ZT4B 5AG9A 3VZDA 5P8WA 2JAPA 2WMNB 4JG1L 5TB5A 4HJ1A 3L4ZA 3G5YB 1MCHA 4Z99A 2WG0A 2Y1CA 1ZNZA 2VDMB 1LD9A 3RNOA 1GXEA 5LDSA 3A4NA 2BNRE 4OATA 2GXSA 3STXA 4TN1A 1RLIA 2APWA 2HXSA 4HUNB 2AMGA 2AEJA 3U16A 2FPPB 3SXUA 2JBAB 5ACZB 4Z7UF 3B3AA 1JIVA 3RSQA 1T5XB 1EKXA 2IQIA 3ZRCC 1R0XA 2MYTA 4GR9A 2KUTA 5FYLE 4ACBA 2UWEE 4HIEA 5SX4H 3I6MA 4ADSG 5TE4L 1BQ4A 5HDOA 3GY0A 3R77A 4HV8A 1KCUH 1KDIA 4Z7QF 5CILL 4AJYV 4KWEA 3KUUA 3IE1A 5F7OA 4PC1A 3G6DL 5JI3E 2DLGA 1SFRA 1CC1S 2ZI3A 3BUYA 5BZWB 1YG9A 1Q2XA 4QOFA 3LRSA 3RUGE 1L4FA 4MQEB 4X3OA 3PF8A 1TQVA 3HE6A 4DDVA 3W5IA 4NS1A 2RGGA 5FF9A 6YASA 4ZA2A 4HXYA 3ZKWB 4YPOA 2FG6C 5DN6D 4AQ1A 3LNFA 3TB6A 1QLRA 2Q3ZA 3AG3B 2MPAH 3H99A 4B3RB 1XK6A 3ASVA 4CKCA 3B2QA 1O5IA 3ARBD 4FABL 1ZSVA 3AFOA 3SD5A 1ZUNB 2CEKA 4FILA 3ZXAC 1R6AA 1URLA 4EG5A 3NPAA 1KJMA 4OLXH 4JNCA 1CQKA 1P0CA 4PG6A 1H9AA 3ZDZB 2CF5A 4K8RH 5EAIA 4J16C 3O26A 3S3DB 4OLWH 4P9MH 4LXTA 3M81A 2X4RB 1C80A 2CFIA 4NZMA 1O6SA 2ADFH 2I7TA 4ZPTB 4CIYA 2OXFA 1IUPA 1UODA 1XA4A 3FKQA 1YAZA 2HSEA 1YZLA 3ARVA 3LQRA 1W36C 1C1EL 4OQNA 1XRLA 2XIIA 3EIUA 4Z77A 4UDYX 3PJFA 5E6SA 1IGIL 4E0RB 4MJ4A 4GMGA 5E1DA 1AQ6A 2YEQA 2LWIA 2B82A 3TPKA 2Z6VA 1BM3H 2EUWA 3QIWD 4X50A 2FDRA 3BJMA 1DEKA 1EHCA 3Q7QA 4NJOA 5HJ7A 2QUAA 4BEWA 1OZGA 2IDSA 5GJTH 2WYZA 3E3QC 4PG2C 3D39E 3A70A 2FEAA 3EHBD 1D7DA 5HDQA 4ROSA 3V1TC 2R00A 3ZY4A 4Q6IA 5EOCH 1ESNA 1OLXA 2J1ZA 2HRGA 4U2BA 4UD6A 2RALA 1KGIA 3NLLA 3LOPA 1XB3A 3QY0A 4HKJA 4REOA 5F9JA 3DEAA 3QRLA 3IKCB 3TJPA 3WC4A 2XGGA 4XJVA 1LBTA 3FO0L 3OE4A 4M62L 4LJSA 2XWQA 4J28A 3IJHB 1GDDA 1FFDA 1T0PB 4HZIA 2BCKB 3R1GH 4RGNB 1JJAA 4CLXA 5CG2A 4H35A 5LBSA 5AK4A 1K75A 4EHKA 2NO9A 5C1MB 1UBMS 2CHXA 3BDVA 3I02A 4CDMA 3IPXA 3TWCH 1NDHA 5SWQB 2J6EL 4D98A 3PQ4A 2HA6A 1KSGA 2G82A 2ZOWA 2R0QC 4D02A 4RK0A 1KZ7B 3TCNA 5LQKA 1UFRA 3MWKA 3WMEA 4K5MA 1Q38A 4HIIA 2BZDA 5I71C 2R56H 4ZD3L 2FRDA 4MPRA 5B53A 3G5ZB 4DR4B 4PGGA 1HHKA 2R4SL 2B9BA 1BPVA 2RAVA 5FNZA 4OIBA 3LCRA 1XGYH 1X7ZA 5JXGA 1JXDA 1MGOA 4CKBB 2C61A 3R3XA 4PLKD 4IIXA 1I3NA 2I32A 3NJRA 3HE6D 1VHPA 4RLDA 1THMA 3KSRA 2XUQA 1WHTA 3Q3IA 3ZQWA 1OAOC 3GNLA 4XTRD 4YXKL 5T1MA 1ZDMA 3L3HA 3MT0A 1QTQA 3GBNH 1O6GA 4XP4L 2C5LA 4FFSA 4YIQB 4YJHA 4NBSA 2X9XA 1P6AB 4KE6A 2BHUA 4MQ7B 2I7CA 3RWEA 2JELH 3STTA 4DTGL 3HE7D 4UINH 3MYYA 1LEGB 5JCPA 4FMBB 2BFVH 1JDDA 1NV8A 1THTA 1TKAA 3JQQA 2IADA 4XVTL 4FFYL 3KPMA 5ALCL 1DC6A 2QPFA 3W5SA 4WENB 3DUHA 3NBNA 2XPGA 1NR1A 4JR9H 1PKQB 3PNVA 5BXFA 2HMUA 2Q8QA 4C04A 1KZGB 5F71A 5IM7A 1W80A 4O58H 4YPFA 3P9IA 4JOBA 1TK3A 4QPZA 5C80A 1XEXA 4AXXA 1B2WH 3IIKA 1PW7A 1VSCA 1I85C 1V8BA 4F4HA 1WBBA 3BSWA 4ILDA 2J46A 4YLQT 2ED9A 3R8CA 2CE7A 4X9YA 4N7RA 2DX7A 4WEBL 4HYYA 3FWYA 4AS1A 5FCDA 3RE0A 4ASUA 3O2DA 3GRRA 4L1DA 2XBMA 1NGWA 2H3HA 4DLNA 3OJ2C 4N9GA 1N5YH 4KZ0A 5F9DC 4AKEA 2L04A 3D8RA 4DJDC 4K9SA 2BX5A 3OZEA 4B3CA 4KKAD 4Z5RA 4Y2RA 5LYJF 1L6PA 3PGVA 3ARBB 5HSGA 2VLKD 5FV4A 5JNRA 4MW7A 3ET9F 1VIVA 4PF1A 1EHKB 2PGIA 2Z5GA 2XEXA 2J4DA 5AH0A 1YEWA 1ZESA 3B56A 4YXHH 1N3NB 4K6GA 5DCCA 1PUXA 2NY1D 2A7XA 3H3PL 4R2GC 5J06A 1E9RA 3UK6A 2HA1A 1LNUB 4D6YA 3I6QA 1OAQH 1Y7HA 2VQ3A 5C0FB 1C3OB 5A3ID 4TSFA 3ULVC 4N8PA 2OK7A 4RFVA 3IP6A 4OUDA 4M6OH 5EYPA 4LO9A 3FJTA 1QHEA 4Q1EA 4WFGE 5BUCA 5I74B 2O8EA 4E94A 2Z0BA 1PEYA 1S9WA 1M05A 1UKQA 2PL9A 3LUHA 3NHPA 4TQGA 1KYDA 3QIUD 1CJVC 4R7DB 4L8DB 4Y2LA 3S5LA 5HYIA 2ID4A 4U7TB 3DBOB 3RIXA 2Z9TA 1JHRA 5E1AA 3E48A 3RRQA 2R85A 1HT1E 1GZQB 3JAKB 3VRIA 1TO2E 1T6NA 1FPQA 3KP1A 1VHJA 2IZ0A 3WJ7A 1QVZA 1F18A 1XAIA 1ZMYA 4HZLB 2I27N 3PWUB 3MMPA 2GSWA 3DNPA 3Q48A 4FTVA 2K7FA 3DO5A 2R8SL 1PJ9A 3HI6L 1DKRA 3IYLW 1RRVA 4H5SA 4H7IA 4U8GA 5B3NA 3MRBA 2A33A 1Z2AA 4K15A 3MREB 3BCDA 3OF6A 5TQ2H 5JQ6L 1JPGA 5BS0D 3EFOB 3FQNB 4LSRL 1TCRB 2VF5X 4OM1L 2QMKA 3V5KB 3IHLA 2C99A 5FKAA 3CC5B 5CEZE 1YZZA 1PJTA 1Z47A 4CMIA 3NNDA 4WLVA 2I22A 3ZHXA 3LQQA 3F00A 5K8UA 3RYHA 1LO3H 4L3EB 3M2TA 1NL0H 3L4YA 3LV3A 1CR4A 1D2MA 1Q0ZA 2ZXAA 5F89B 3HG1A 2L4OA 5FPPA 2YWEA 3NO4A 5ICXA 2JJTA 3CWCA 1MFAH 5JZSA 1LRKA 3WTXA 5GXBB 1FFPB 1WIUA 4WNCA 4BO2A 4RZXA 2B5IB 5EU5B 1CE8B 4PJXB 4FAAB 2I4LA 1H5QA 4ABUA 3C6ZA 4G5OA 4E33A 2CAKA 2C9UA 2E6UX 4D1YA 3NHMA 4DPMA 1ETHA 4B5ZA 4RD1A 4XMLH 1F90H 1JV5B 3MTIA 4E32A 4Y2JA 1L5LA 2DL2A 2A0UA 4H20H 1Y81A 3L1JA 2RGDA 2OFXA 1ZSYA 4OI9A 3L6FB 1PZFA 1RSYA 4Y1TA 3W37A 1SQ5A 5LQBL 4H26A 3MCTA 5CM8B 2QQFA 4MKIA 1UC9A 4KMRA 5CURA 3V4PH 3ANYB 1H3FA 5B64A 2PRSA 4O5OA 2W9LA 3WLAA 2CN1A 1VLXA 2SHKA 2D3JA 2QN7A 1ASQA 2Z2IA 1I2DA 1NRIA 3CZLA 2V7WA 5IUKC 1FL9A 3TI7A 1S7XA 3KPUA 2CXSA 3EG9A 2FI1A 3L54A 5DJAB 5F2KA 2OW7A 2MCG1 3VNQA 3OKYA 1OCEA 4WH0A 2PWZA 4E0BA 3H2PA 2J7LA 1AM4D 1QO0A 4FEAA 3VXUD 1J0DA 2C1XA 1GPAA 1GRNA 3CBJB 3DXAD 5ESVB 1TT7A 1BJRE 2FHBA 5D7LA 1P7CA 1FVCA 3C5HA 2B1HL 3M45A 1U8TA 2B4AA 2ENSA 4Z7VA 3O1JC 1YS6A 2VEDA 3G5LA 3RG1C 2DY2A 4JDZB 4D4LA 2L2QA 3NA4A 3ABRB 2ZWPA 1QPGA 4TM9A 2N1BA 2J3QA 1PJWA 1UWGH 3GP3A 2Z5LA 1VG0B 3IAXA 2P28B 1GA4A 4M1WA 4MD0A 3TXYA 1PGPA 3U6XA 3KKEA 3NYQA 3EEYA 3UC2A 2EFEB 2P5SA 4XNQB 3D5TA 4W1PA 1ODIA 1V2HE 2D0HA 2JIPA 3PJNA 3EVDA 5HJ3A 2ZEJA 4K6KA 5ANRB 2BVOB 4CTNA 2ETXA 2KHAA 5DCWA 1S7UB 4GI1A 1SGKA 1NVUQ 3TIDA 2E6KA 1HDRA 3E0GA 4DV6B 1IKFH 1IX2A 5HYFA 2H0JA 5E95B 1XTUA 2BNRD 4BB0A 4U7GA 2D0GA 1NCIA 2BEWA 4GZ5A 1TZJA 3UAGA 2FZKA 3B60A 1A4AA 3W06A 1P4IH 1BAFL 3UAJD 1BZYA 1P7PA 3G0CA 4D3SA 3KYAA 2VTEA 4XZ4A 3BL8A 2IS6A 1QU2A 1FFAA 5J13C 4XW2A 3S2SA 1KEPA 2NY3B 3HUJF 2VTFA 1K8DB 1KJZA 1J5IA 2JGEA 2GH1A 2ZPTX 3LYLA 4QXUL 1N2HA 4YRTA 1PT5A 3L3OC 4NU8X 3TB4A 3VVWA 2I9TA 3VXNA 3QXJA 1U8CB 2H18A 3COYA 4B7XA 3EO0B 5FFNA 1JXOA 5E00A 2FZ5A 3DB2A 3H9CA 1KEEB 2JIZD 4BX8A 3H4IA 5H82A 3UIZA 4U6YB 4G1MA 3UFIA 4TROA 2XQBH 2FR4A 4AEEA 1TJHH 5GGQL 1M8FA 4O08A 1II9A 3ZWQA 3ZH9B 3UJNA 13PKA 4YV0A 4DQOH 5LXGL 2B9VA 4WU5B 1QRUA 4JO5A 1I3LA 3MLSL 2OQIA 1FNBA 3L84A 1IGMH 4PCKA 3JWHA 3WLIA 3R20A 2PZLA 1CY8A 4LBYA 4PNPA 2JSFA 5HHNA 4N2HA 3GZNB 4WADA 3BAZA 1N2IA 2MIIA 5ICXB 1PV4A 1E6OL 2WM9B 5AAWA 1GAEO 2HCFA 3FF1A 4AKGA 4K94H 1G8KA 1YMMA 1CJCA 2G60H 4JZKA 5GGTL 1OPGL 1YN6A 4RKFA 1ZBQA 4EI8A 3UNXA 1ZNWA 4ZT2A 3EK2A 2HFFB 1EUCB 1M6WA 3SX2A 3OKDB 1FNDA 3G5TA 1A3RL 4D0DA 4JKKA 3WZLA 2HT2C 5KNCD 3DBSA 4A2EA 5EKDA 4BVJA 5DBOA 3SBWC 3RIEA 1SN0A 3IJSB 5JANA 4A6EA 2QX4A 4MV4A 4GI2A 1U8CA 3HR7A 3D39D 3RFCA 1MNUH