3V55A

Human malt1 (334-719) in its ligand free form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
383
structure length
368
Chain Sequence
QPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNKVTANIVFGYATCQAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 106
structure length 368
sequence length 383
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v55A02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v55A01
2QLJA 4QUBA 2J31A 3P4UA 1RWVA 4DCJA 4FXOA 1CP3A 2CNLA 3V4LA 4FGUA 4QU5A 4NOMA 5IAJA 3R7SA 4QUGA 3H11A 4QU9A 3ITNA 3UOAB 4NBLA 1PAUA 2H5IA 2FUNB 3DEJA 3H1PA 4QUHA 1I51A 2Y1LA 4JJEA 3NKFA 5I9BA 4N6NA 4DCOA 4N5DA 4JB8A 4PRZA 4QUDA 2QLBA 1RHJA 4QUEA 3DEIA 4EHLA 3SIRA 5IARA 3R6GA 5LU8A 1CVRA 4HVAA 1F9EA 4JQZA 1SHJA 2QLFA 3D6MA 4AWAA 4FEAA 4HQ0A 5IAKA 3V6MA 4ZVPA 1I3OA 5IBPA 2QL9A 4AWBA 3V4OA 4EJFA 5IBCA 2C2OA 4NBKA 1RWXA 2H65A 2XYHA 1F1JA 3GJTA 4QULA 1RWNA 3R7NA 1RHMA 2NN3C 1SC3A 2XZTA 1RWKA 1NW9B 4JQYA 3GJQA 2C2KA 1RWOA 1RWMA 2FP3A 4JR2A 5IAEA 2Y0BA 1NMSA 2P2CA 3IBCA 1BMQA 1SC4A 5IANA 5IC6A 4EHDA 3OD5A 1SC1A 2H4YA 4NOKA 2HBQA 1NMEA 2H5JA 2C2MA 4JJ8A 4N7MA 3KJQA 1RHRA 1SHLA 2CNNA 4IYRA 1QDUA 2WDPA 3V55A 1JXQA 1RHUA 3EDRA 2DKOA 3GJSA 3PD0A 4EHNA 3E4CA 3UO8B 2HBYA 2FQQA 1NMQA 2J33A 5IAGA 2XYGA 4NOLA 4QU8A 2J30A 2HBZA 4IEFB 5JFTA 3R5JA 3PCXA 4FDLA 2C1EA 2XYPA 1QTNA 4I1RA 2H4WA 3DEHA 4JR0A 4N7JA 4QUAA 3DEKA 3GJRA 5LUBA 2K7ZA 3H11B 4EHFA 4JR1A 1RHKA 5IBRA 1I4OA 5LU9A 3NS7A 4I1PA 2H48A 4EHHA 3H0EA 4N6OA 1IBCA 3S8EA 5LUAA 1KMCA 1RHQA 5IASA 3K7EA 4ZVSA 3EDQA 3NR2A 5K20A 4D3XA 1M72A 2QL5A 2AR9A 3R6LA 4EHAA 4LSZA 2H51A 4QUJA 3V3KA 5IABA 1PYOA 4PRYA 2QL7A 4HQRA 3RJMA 5IC4A 3R5KA 3R7BA 3S70A 4ZVQA 1ICEA 1GFWA 1RWPA 1K86A 3KJFA 4D3ZA 4ZVTA 1RE1A 1K88A 4JJ7A 1GQFA 1QX3A 4NOJA 2CNOA 3P45A 4ZVRA 2C2ZA 2J32A 3D6HA 4QU0A 4QTYA 2CDRA 5I9TA 1RWWA 3H13A 4EHKA 2CNKA 2XZDA 4ZVOA 3V6LA 4AW9A 4DCPA 3BIJA 3KJNA 4NBNA 4PS0A 4QTXA 4M9RA 4PS1A 4QUIA 2CJYA 3D6FA 2CJXA 3IBFA 3QNWA 3SIPA 4N6GA 5H0IA 4D3YA 3PD1A 2H54A 2HBRA 4ZVUA 1I4EB
chains in the Genus database with same CATH superfamily
4RPLA 1S2MA 4R4BA 3O41A 4JM2B 2M1XA 4QL3A 3FQXB 4NRXB 3TZHA 3TR6A 2ZYRA 3IUJA 4P8QA 4I9GA 1KEGH 5K3AA 4UZSA 3TD9A 3A05A 1ZM2A 1B43A 5JZOA 5I8KL 3FPAA 4FEEA 4ZNCD 3SBWA 2BV3A 2JFBA 3AESB 3ULUE 2N01B 4F2WA 2DF8A 2VATA 4FFYL 3QVGB 4YXHL 5LLIC 5EU7E 3L2OB 1DJMA 1T3FB 3VZQA 1AUVA 4G4GA 4DDTA 4EATA 3DPBB 4BBZA 3OCVA 1RIVL 3IUQA 5D7NA 2C61A 2XVYA 3L1FA 1MVUB 3QG7L 1AGXA 2VDLH 4QYAA 4LLDA 2ZDQA 2ZKIA 3NA4A 2ECOA 1DSYA 2GT1A 5IBLC 1A3RH 5EBLB 4CL3A 4UDUA 3GMTA 5I4BA 1Z4OA 4QRAA 5ECWA 4TUKL 2B4QA 3I12A 4L3CB 4GMSH 2C78A 4PV1C 3VXSA 4WT7A 1YZVA 3KUKA 2P9TA 4PBXA 1OSEA 1KBGL 2WNKA 1TO6A 5BYBA 4LJ6A 2YUXA 1SIBE 1WZ2A 4G6AC 4IS3A 4NZ9A 4XP1L 4HRAA 1Z28A 3P0VL 3ETGA 3DPBA 5IMBA 2P0EA 2XC8A 3MRDB 4QBIA 1JFFA 2C8VA 4FQQB 4OZFB 1XA3A 5ENWA 1JE1A 2QZPA 5EOTB 4OA5A 1MCLA 4YRZA 4AO6A 2C7QA 2LE9A 3ORYA 3FH7A 4X5WB 1QRDA 4LCJA 1MC5A 1L9TA 2H54A 3VI4F 4HAIA 3PGLA 2G4CA 4UHHA 4O2EB 4LRNL 7ADHA 4EKXA 1IL0A 2V5MA 4YQXH 4TNFA 3JQDA 4NQEA 5F9HA 2CXRA 1FP4B 3PHSA 4YHLL 1IWPB 3L0BA 3M9WA 3K0CC 4OY3A 1NG9A 6FABL 2CVPA 3U25A 4F21A 3FTPA 2Q6KA 3UZEA 3GRPA 2X6UA 5CW2A 3A3NA 5A40E 2RK3A 4Y4FA 2ZWAA 1XQ4A 2Z2JA 3CWCA 5IM4A 4G8FA 3RWDB 3NTQA 2VABB 3MWEA 2HT6A 4MZ3A 1L5YA 3CNLA 3VVMA 1JQAA 3GCDA 4FAAB 3L4JA 4G6JH 3WX0A 3F67A 4PS3A 5BWBA 1FP2A 2DQIL 4Q6BA 2GA8A 1CYWA 3ZTYA 4CMAA 4L4YA 5JDSA 3DS8A 2A5FA 1BFSA 2Q5BA 5EKTA 1MAVA 2YMLA 3CRQA 3DP7A 3IUSA 5BZWB 1NM4A 2EHDA 1BJKA 5C0RL 4DC9A 2AFHE 4Y5YA 3ZZ0A 1KYXA 3FAWA 5TMBA 3ZV5A 4E5DA 1QEXA 3P9LB 1P1HA 1Q9OA 1MPXA 1N6UA 3TZEA 3M89A 2P6OA 2VNSA 4S0SD 4MZDA 2WXRA 4P46D 4UC0A 3SDXA 5TMDA 1GJUA 4WFGE 3V4LA 5F0LB 3N0PB 3O3CA 4F9PA 2QY6A 1RQLA 4OCYH 5E2WL 2D7NA 2RR3A 3LTNC 3W77A 4RLQA 4ACBA 2JIBA 3FCSB 2CUZA 1AS3A 5BWNA 4CM5A 5FOUA 3CXDH 2PXYC 1RRKA 2C9QA 5JD5A 1OD9A 2IADB 5K0CA 2BDTA 1CYXA 3EOYG 3DBLB 3QNZB 4AOFA 4JSTA 2NUAB 1T1EA 4RIHA 3RNOA 2BTOA 3O83A 3F7QA 1JHRA 3S29A 4D7AA 2HFEB 5J63A 1YCGA 4Y9SA 4CQJA 5L51A 2BSQA 4PO9A 4UM8B 1V7CA 2ICAA 3RVTC 1DO8A 4JW3A 5HF5A 2I7TA 1U63A 3GR6A 2V4MA 2R4RH 5C08E 3SY0A 4E7PA 1IN4A 3IFPB 2ZS8A 4Y0AA 3C5EA 3BAYA 4LVOB 1J56A 1JEOA 3R74A 5F73A 5C80A 4CNQA 1IGJB 1WKVA 3WGQA 4TMYA 3COJA 3IO3A 4TTVA 3E27A 3LQZA 3CKLA 1G41A 4PZEA 4P59L 1MAJA 1YJCA 4ZCPA 1Z6PA 3EBAA 2W94A 3CZNA 4LOAA 1YV9A 4Z9YA 2GCNA 3N75A 4BFRA 4R68A 4YBZA 3UXMA 3WXWH 5IFLA 3ZLVA 4Q18A 4OSEA 2ZKHH 4BO6A 1DAKA 3DEAA 5EY5B 3MRFA 4M7KH 4Z7VB 3GXOA 1Z7WA 2E6QA 3MGOB 4NQXB 3NUGA 2ZYAA 2NY2C 3GYRA 1FLNA 3L1EA 1FZMB 4LZKA 4C4RA 2O6PA 3K1JA 5JW5A 2E49A 3CN2A 4FL4B 1Y5RA 5CRIA 1GY1A 3JRNA 5E3JA 5L6LB 1DBAL 1ML3A 2X44D 1D7OA 3LCYA 2Q4BA 4YJHA 6AT1A 1XX9C 1DJQA 3P9KA 1WZKA 1HI6A 2ZQYA 4DLSA 4BLWA 4N7MA 4R05A 3GVCA 3SY6A 4I9FA 4CIVA 1OTXA 3VDMA 3FKUS 2ZTHA 1V7MH 2BIOA 1F2TA 2B4KA 5B37A 4BP9A 4F5CA 5EHFA 3A10A 3QDHA 2A1UB 3OIFA 4M7ZC 5JCZA 2WWIA 1PQUA 1OCEA 2E9BA 3MR9B 1DGQA 2VMFA 4MHHI 1T80A 1M3JA 1ZJYA 1EA9C 4KKAC 4KO6A 1K4DA 5AYQA 2VF4X 2WOYA 3JV0A 1Y6QA 5EUBA 4GC9A 5TJHA 1UA7A 4G37A 2LWIA 4F6LA 5TXGA 5T41A 4TNGA 2R0WL 2VDQH 4XUCA 4JBSA 3ZDRA 1T1GA 3GBMH 3A04A 2QGZA 2D3LA 4PJ9B 3M6FA 1SXJD 4RD0A 1CLVA 4GG6E 2XXBA 5F44A 2NY5C 1PAUA 1BVYF 3R4VA 1BROA 2ZDGA 4URKA 4EDXB 3IL2A 4AMKL 4DILA 1HYBA 4WI7A 5MERA 2WUCH 1CZNA 4WLVA 4M9XA 3TDKA 1J12A 3CSUA 1VJSA 1KJIA 3FTGA 3BKCL 3PPVA 4YGAB 3EODA 4MQ7B 3QA3E 3H5TA 1IGCL 5ITWA 4J76A 2Y66A 3MCVA 3OHPA 5CX1A 1CUDA 2VA9A 1A6TA 2FEPA 4JC5A 2WXLA 4GG6F 3IBGA 5JH7A 2VO1A 4GWLA 1UJ5A 5TX7A 1IGYA 2JG3A 5BV0A 4K5OA 1GQOA 3VQMA 3VXUE 3W4KA 3NCYP 3QEJA 1YI8A 3CUWA 4H7DA 1NLYA 5FPQA 3ARSA 1W36D 1FFTB 1NTDA 2I2DA 1HJCA 5DO9A 1ETZB 3V4UH 5DUJA 2GKGA 3KYCB 4Z0PA 3EPRA 2OFPA 2HSEA 4LJ7A 4B83A 4PQFA 4NI3A 3ZTNL 3L7BA 2BVTA 1RVV1 1H85A 2OK7A 5DZSA 4QYOA 4JC0A 1I36A 1JHDA 4NN6C 1KFGA 4J75A 4Q66C 2EYRA 5HGJA 5IT9A 2VUYA 4AY4A 4I4TA 2ORWA 2A0LD 4X8JB 3PTZA 5F97E 4OVVA 4W4OA 2AMLA 4L74A 4PLGA 5L4LA 1K8YB 1NCWL 2P49B 5C0AB 1CDJA 4FXOA 1P6XA 1K3TA 4EPVA 1DJGA 3VXPA 4L0MA 3K1AA 5K6AC 2ADGA 5LZ4A 4X6CB 4XTRD 2YXBA 3TO4B 3C5VA 4OLUL 2HW8A 5DX0A 3WN6A 4GKSB 1MG0A 2W7TA 5IUJC 3PQYB 1OZ0A 3OAUH 3GKZA 4R2GC 5JRJA 1CI3M 3TOSA 4KR9A 1DE4B 1H2HA 2CXKA 1F7VA 1XMPA 4PZAA 2MNJB 2NQ3A 2X2OA 3R3UA 4HY3A 5EMNA 2PUJA 2ITDB 2J08A 1DJSA 5IEKA 5JDIA 4R7NB 43CAB 2BSED 3DOIA 5C0CB 1DWOA 2HRZA 3V2IA 2Q3AA 2IDJA 2P4HX 2HRLA 1KYVA 5HGXA 1MLCB 3SDCD 3IE2A 4R6WA 4B85A 2GUWA 3K32A 4QM6A 2HT3D 2A9ML 4NV3A 3VFOB 1JKJA 2BGRA 1ILWA 3ZKSD 3VHLB 2BSRB 2CMRL 3BHMA 1GCGA 1QLJA 2PXYB 2E37A 1ORSB 1ZT1B 4XM0A 3K53A 2ZTMA 2K6ZA 1PEZA 4D46A 2OGTA 2COQA 2C4VA 2YQ4A 4D3CL 1QQ6A 1NBYB 1M9WA 4Z1MA 5EWLB 5AW4A 1QG6A 2YUTA 4NAQA 5D2LA 1PJRA 3OZDA 4XXCC 1SVUA 4NPKA 2O5ZL 4OZFH 2NNAA 3MINB 3KR3H 4JLDA 4PR3A 1XL6A 3I3DA 2LGNA 1TQ2A 2B69A 1GGNA 3W6ZA 3W5NA 3UTQB 3ZW3A 2O5YH 4D4IA 5I30L 3RYHA 2J3IA 5TR9A 2A38A 4LF8B 5ANMA 3MOAH 1TQDA 3KGRA 4WGFA 5ABZA 1NUQA 4RTNA 5M29A 4KXZH 4MVBC 4Z4EA 1TTGA 1CY7A 3SE3A 4BLTA 2WAQA 2DY0A 2NXJA 1UXJA 2R1XA 1NT4A 1U8CA 1XEFA 2QUJA 3U6KA 2C2OA 4M0PA 4EH1A 3F5QA 2EQ5A 1E3WB 2GEVA 4P84A 3AERA 4EIBA 5MN6A 4JB3A 5LXVA 5NULA 4OUUB 2NT0A 4XOAA 1JGUL 3GEWB 1DXOA 5F9OL 2C2GA 1MVYA 4UAHA 4JO1L 1NGYB 1QGDA 1CSEE 5DGIA 1QW8A 5JZMA 3GMDA 3T4UA 2O61B 1G9NH 5ANMB 2QU8A 2ZYVX 3UIZA 5BR4A 1DFHA 1UDRA 1SG0A 1SKYB 3DTXA 1NNEA 2RHDA 1S9YA 2R8XA 5HIMA 3GRAA 4ENPA 1K06A 4ECAA 5KAQF 3HFRA 4B9PA 2B98A 4A6PA 3AL3A 4P06A 5I76B 3STLA 5DK3A 5DI3B 3QI9D 1PZGA 2EFDB 4ELKB 4HOMA 1GTMA 2BCKA 4WFIA 3WJJA 2R51A 3IGUA 1V1JA 1WUKS 3RABA 4HX1B 2CNZA 1UKYA 1S7SA 4PIBA 4JFEA 3V1UA 5BCAA 3L93A 3I83A 5C0BA 3AHHA 3UOWA 2GC4C 3FHAA 4MWFB 5B53A 4LQ4A 1ZITA 1DHKA 1E7UA 4GI6A 2P44B 621PA 1P5UC 2BBTA 4I3GA 3SS7X 2W37A 4GS5A 3FOWA 5HK9A 3OEED 2HLDA 3D3EA 3LQKA 2NY4D 4BDSA 3HQ4O 1JNNH 3HMKA 3C7TA 3GKWH 1Y5LA 2DEUA 1AZVA 1C3VA 3WBBA 3WN5B 3FOAA 1XA0A 1PQPA 2YLKA 1NVBA 5CSBA 4CF3A 2CKBA 3O47A 2H0JA 5I17B 3WUWB 1JZ8A 1GZHA 3NCBB 4A16A 2IGFL 3VOSA 1YU9A 5E00A 2R2BA 3BAEH 3CN4A 3FFBA 1INDL 5EO0A 4GX2A 3TVYA 2P3SA 2OR8A 1MLBA 5F96L 3W04A 4WLFA 3RUGF 1C4XA 1NFAA 4DAOA 4U6XB 2P6UA 1XGZA 2XYVA 5DQJB 5CNHA 4BZYA 1JSLA 2YVQA 1JPGB 4QTHA 3COPA 2YMPA 1S3SA 4R4FL 2X0JA 2O2CA 2X9GA 4LRIC 2GLTA 1ET5A 2J5RA 4M3HA 2CKBB 1GVHA 2ADOA 2QTFA 3HJTA 4K3GA 4IDGA 2VXVH 1EHKB 4KWTA 4LJLA 3OGCB 1N59B 1S9KC 5JQWA 3SBRA 2FN3A 5D71L 5COBA 3P54A 1W0YT 2BOVA 2WWFA 4FFNA 3C6ZA 2PLFA 3NK3A 4PJAF 1BHO1 4NICA 5J57B 4QGSA 5H7XA 2ZB2A 2FEJA 1I3GH 5DF0A 1T34A 2VERA 2VBCA 4BQEA 3S2IA 5L6YH 2P9EA 3GJ3A 3KOZA 2VCEA 2H6PA 2WF6A 1A5FL 1KP2A 4UVGA 5A16A 5FLKA 4RJTA 3PWNB 5CFLA 3WL3A 2IX3A 3MRBB 2E5EA 3D09A 4C22A 1GW0A 5LC1A 3INTA 2PL3A 1E79D 4LWZA 5FX3A 1YJDC 4LUCA 3VE0B 2ATEA 5IJ0A 5CVUA 4X0NA 5LUMA 4ZXPA 1ED3A 2PCLA 4V2CB 1U9ZA 5I7VA 2A73A 2Q7NA 4QATA 1CEQA 2JRLA 3QQ3B 3BMOB 3JV5A 3F8SA 3FCBA 4ZS7H 3MJ9A 1DTUA 4UWQB 3UW3A 2PKEA 2VL7A 3NYIA 4M6AA 4EZKA 2EXXA 1HIMH 3R40A 4NH4A 2P40A 1EFAA 2GK6A 2HTKC 2PRIA 3BAZA 1N0VC 1I7UB 1X5GA 5CWSB 1YUHB 3W9EB 1OX4A 1SMOA 1MLDA 3FYUC 3ZU8A 1A95A 5JCOC 4HWBL 4DQXA 2W9EH 3WYRA 4B45A 1KULA 3U9UB 1ORTA 4EW3A 1ROCA 3C5ZB 1FYTD 4KGDA 4UAVA 1JWSA 3W5JA 4FG2A 3CNQS 3WY4A 4YUAA 4AQZA 1S4MA 5C86A 2CCGA 5DVKA 2BS8A 2C9OA 3V7YA 5JPDA 2BW0A 3QU9A 3CA8A 5CYOA 2WUGA 4MUFA 3VM7A 3SNKA 2L19A 3ARBA 3CPUA 3JXAA 2AF4C 4RJKA 5LAPA 2YGQA 1QYDA 4GXFA 4WQMA 4KZEL 1G7SA 1LMKA 3UDWC 4J0KA 4LOUD 1ZT7B 2P5UA 4PJ7A 3E8UH 1GAEO 3LIZA 3CM0A 3E4DA 1JPFB 1I3OA 2V9PA 5AJWA 3ZZLA 5JQ6H 1U3FA 4R3SA 2C4NA 2QV2A 3T1NA 3LKVA 3QCUL 1KYOJ 3WNPA 1BE8A 3LCJA 1NCAH 3TDNA 2FDXA 1EDOA 3U7JA 3BBPA 1W5EA 2ZYSA 2OYSA 1N3NA 4UNIA 2F9MA 2QTBA 3WDKA 4O6VA 1R4MA 2AJ8A 1DBML 2XZQH 1T7YA 4MUMA 3D18B 2WTPA 1F5SA 1RI1A 1UK8A 1P5ZB 2OWEA 4QY8B 5LBTA 3UHJA 5LXTA 2GJPA 1DKMA 3A6CL 1IULA 1H1TA 4Z9BA 5JCJA 3BMNA 4KV9A 5D3MA 2INGX 2FLKA 3X2SA 1OIXA 3TMKA 4ZVMA 2PMEA 3GXFA 4K9EH 3MB8A 3JAKA 1XCLA 1KVUA 4LDRA 1GZQA 4DO5A 4O4IF 2R7MA 3RYCB 2EYSA 1E96A 3TQHA 3ZWQA 3EXEB 3KQUA 2OE2A 3I5MA 1R8QA 2J46A 3VYWA 4D9QE 1JILA 3QO0B 1W1WA 3WELA 3US1A 1K6QL 3UABA 2JIZA 4O2RA 3RDTD 3IVAA 2A6DA 2MQGA 5FYKE 2CD7A 1U1FA 3F5MA 3D4LA 2MHCA 3NJHA 5CGYD 3SJVE 5DZOA 5DJXA 4LOKA 4ZARA 1NNSA 5TH2A 3DMDA 2VERN 1Z0AA 3DXXA 4NN5C 1ECGA 4IVPA 3V00A 3MNZB 1I9RH 4HF5H 3AR5A 3K09A 3EJYC 1F5NA 3ZCVA 5HJ3A 1PZCA 1BMWA 1ZHNB 4EIUA 3DQQA 4GL2A 2VHQA 2BFWA 3QTLA 4NB7A 3QX8A 4ZDHB 4Y1TA 2AC4A 3OJEA 4JVUA 3FHLA 3BJZA 2J56A 2HWUA 4NM8L 3FC8A 4GRMB 4IQ4A 5D7LE 4CHGA 5HIKA 5JLZA 1YZUA 4LLUA 1D6EA 3WIHA 3TVMB 3LGXA 4RAHA 3I01A 4QARA 1FNCA 1T9BA 2E4FA 3LYRA 4B4OA 4OXNA 4OUOA 3O95A 3VR3A 5E9QA 4U1LB 4E5XG 3E5RA 1SBTA 3SCMC 1M6HA 4Y19E 1R3KA 3PI7A 1SBYA 5A5DA 1CFVL 1GZPA 5LQCA 4JQXC 2C3VA 1V1MB 1XPJA 3O8XD 5K3OA 1G98A 1EEZB 1G84A 2Q76B 1GPH1 2J1KA 3ANTA 1DUYB 4MRBA 4LSSH 3TTUA 5A0FA 4MJID 5KVDL 1GT91 2LAGB 3WGMA 1UWEL 2QXTA 4HMOA 1PK7A 3K71A 2FWOB 4OF0A 4LGVA 3LFUA 1C0EA 1LI5A 2CFSA 1MCPL 4GMTL 3TG2A 1SM4A 3KP1A 3KLAA 1FQ9C 1CE1H 2CNYA 5BUGA 1NCNA 1C12A 2WVAA 5AVRB 3CX2A 1E2BA 2VTBA 4LSRH 2AWOA 2MHAA 4OM7A 2O54A 4PS4H 4WU7B 3B9KB 5FECA 2WF8A 2FQGA 2NY0D 3BIOA 1A6PA 5GGUB 3DMNA 3PDIB 3MV8A 3G02A 5IHBA 4KHXH 4Q0XL 1PKXA 3PTLA 1DBBL 5B39G 1LZKA 5J7CC 1PTKA 1XR9B 2F00A 3DETD 4QGBA 1N5OX 5AAMA 4QGYA 1QVVA 2HA4A 2NNLD 4H25B 3IT2A 4DNXA 5D6CA 3F4LA 4TN9A 5KN5A 3NHFA 1WK0A 4MD5B 3BG5A 4DL9A 5JXED 2ZBPA 1JDJA 4UBIA 2VTFA 1A7UA 3Q0EA 3AS0A 1Z07A 3DMTA 3IELA 1OV8A 5DHVH 4MW1A 2G5RA 2G3NA 2P24B 1T5XA 3WQSB 4IOLA 1GV1A 4OCWH 1GUZA 3E03A 3A9TA 4ENSA 1RI3A 3D7SA 5DRNA 2P80D 3AK4A 3ZVRA 5KTNA 3LNHA 5GIRB 4PGAA 3QH3B 1GZ7A 4U3JA 2OHJA 3HU1A 2VLJB 4G6AD 3IFSA 2WXFA 2WAMA 3LJ3A 1J90A 5AOMA 1CUAA 4X1IA 2HT2D 3B38A 5T3XD 3RC8A 1HEIA 3ARFD 1NE2A 3IAM6 2VLJD 2QUBA 2X4OB 3TA3A 3M1CA 2RH0A 3QXDA 2X0WA 4EDHA 2RHOA 3G6DH 4MW0A 3ZE8A 1A2BA 1S9WA 4HLNA 3ZL4L 3I73A 2DBVO 5EEGA 1UJ3A 5K0FA 1PWYE 2Z31D 5EOCJ 4D4JA 3OAUL 2D0HA 2CPCA 1PSZA 4X6EB 5FV1L 4PBDA 4ZMQA 5HEKA 3H3PH 1T1JA 3HEAA 1YMME 5BW6B 3RM3A 3GXBA 4QUDA 4JY5L 1I2DA 3ROPA 1QUNB 4J9VA 2K3HA 3O3UN 1W5AA 3QEQD 2LQRA 1S2OA 4EG1A 3PYMA 3UYLA 4TQ9A 3KZXA 4QO1B 3CLFH 1ND6A 3WHPA 2A6KA 4PLJC 2IITA 5FEBA 1NFFA 3T65B 2QSQA 2R83A 2AEMA 3MNFA 5BMVF 2AQPA 4D0BB 1KMGA 1FI8C 5LCVL 1V96A 5FUOH 1KIFA 5CEJA 5IK3A 3BDYL 1MAAA 1NMBL 2PSHA 3L8QA 5ECDA 3MR9A 1KJZA 4MV8A 2JEZA 1KIQB 3CGTA 5DYOB 1JPUA 2R1ZA 4C0WA 5FR3A 4QYWA 3QIBC 5AYUL 1WMBA 1N92A 2Y2UA 1T1XA 3FFXA 3C3DA 3K8LA 4TUUA 4JOSA 3OCWA 3CV3A 1UZNA 2CIKB 2R7KA 2JASA 3C6KA 5HPMB 3ZYJA 4AZ3B 4PC7A 4P2YA 2GAFA 3L6FB 3M17A 1FMCA 3O2WL 1G8SA 4WA8A 3THXB 1YJBA 1AZWA 3D0RA 1A3LH 2L2QA 2Z8YA 3SGKA 1KPRA 3V6FA 1JJFA 1S7WB 5IPFA 2G72A 5I9SA 3L8CA 4BVFA 4X4YB 5EWMB 3KVOA 1ID1A 4Q37A 4RSVA 2GAZA 1NUAA 2HDNB 1UM6H 2I4MA 3RS7A 2QR0B 1QDLB 2Z6AA 2Y7SA 2WD7B 1N70A 3R2JA 4YPGB 2H2SC 1ODLA 3THXA 4WY8A 1NF9A 1WJ3A 4QWWC 1FNSA 3CEJA 4OF3A 4II2A 2HXGA 4M0KA 4R01A 3IETB 1PKOA 5SWZE 1RK0A 5AZEH 1GNRA 4WSKA 3ZVNA 2W07A 2Z93B 2B0CA 3I5UA 5D7KD 3B1JA 2YTZA 1MHHA 2PN5A 4LXTA 4J1UA 3IMEA 3F3MA 4ZO7A 3TZVA 5AOLA 4QPCA 5CA1B 1QYWA 5EZJA 3EDJA 1LTHR 4C05A 1NIEA 1Q0RA 2P4SA 1D5IL 4M62H 1RQRA 2IJ0C 4NEGA 2SODB 4EDFA 2R1YA 5CS7A 3AREA 3IAPA 1FXUA 2VF8A 3D6TB 5J6SA 3QFRA 4Y2TA 5ADOH 3BRFA 5F2OA 4FN5A 1U11A 1W36B 4AT1A 3QVMA 3EGIA 3L5JA 4Y4FC 3TL5A 5G1NA 3L3KA 1A69A 4QVIA 4G6FD 1PEDA 1K8DA 1ZRMA 2RBEA 5ABPA 4UDYX 1ZLUH 4R5VA 5B30A 2W91A 5AJYA 4NOKA 2APSA 4TSAL 5E6IB 3CF4G 1EWRA 5SICE 2HPHA 5DW3A 5ICCA 1TRHA 3KPSD 2NXCA 1GYUA 4IIEA 1TTAA 5KHLB 4JQCA 3FETA 5BT9A 2VN7A 3O2QB 5AVKA 3JQGB 5AVUB 3MLSH 1AO7E 3IA2A 3QG6A 3EEBA 4JDEA 1EVZA 4BAZA 2JW5A 1EE1A 3QOXA 3BOSA 2XITA 1V05A 4OIFA 2NN3C 5BNIA 1G1AA 2QRKA 1IIRA 2UX7A 1LH0A 3QLUC 1ZS8A 5G4NA 3ZMEA 3HWSA 4L9RA 5AW2B 1WH0A 5LIPA 3CV5A 2XVXA 3OX8A 3ZVVA 1VKXA 2ZRFA 3NBFA 2HA5A 3D1MC 3QFDB 3U49A 2R62A 3CF6R 3E0GA 1Z3IX 4NCC1 4X45A 1V5FA 1P6AB 2WNWA 3DWTA 4CGZA 1ECYA 4OFVA 1FSGA 3U4QA 4JWKA 1KJ3L 1YUNA 5LSAA 1GRVA 1B3IA 2IUTA 2AP2A 1JR3A 4R40A 1PYOA 4PSAA 4DMLA 2OG2A 3O8NA 3VFSB 3SOBL 4UEKA 5D7BA 4RTSA 3FQWA 3GT7A 3X3HA 4LKRA 3PVCA 4MSUA 2OORC 3WJ2A 4A67A 2GAIA 5KZMB 3MYJA 5EU6A 1CRZA 4N6RB 3VR4A 2X89A 1MCPH 3NZHL 1CUSA 2QJTA 1KDVA 5DQ9B 1TMGE 1LI4A 4P0QB 4N5DA 1KO4A 2P7TB 4G9FB 3M6UA 3LUBA 1H0RA 1HE4A 5FOSA 4D9KA 1PD6A 3QS2A 3EBIA 1AANA 5AHOA 3L54A 2BY4A 5CUQA 1BE6A 3GA0A 2AMFA 4QJIA 1XKQA 1NIPA 2X1WL 3ECWA 2OO5A 4WWKD 5F1OB 1QMGA 3OWXA 1B2LA 1XQ9A 2P65A 2QD1A 1OHHD 3KQWA 3DYIA 5EF3A 1AACA 5EIQA 5DA4A 3I9GL 3VNUA 2Y07L 5KJFA 5A4MS 3DX3A 5FO0A 3HR5A 3FN3A 2YGPA 1FUIA 4G80A 2AIRA 3HH8A 5CB6A 3VI4A 4X84A 5BWMA 2DBJA 1T5WB 5E4EB 1BH6A 3H17A 4BXVA 3ZTJH 3CSPA 5C0AD 4ELMF 5DJAB 1C9NA 3PGDA 4REQA 1JN6B 2IHJA 1I13A 3HDHA 5K3BA 3ZMRA 5JARA 1QIIA 5CEZD 1NCUA 3VSAA 4EJSC 2B5IC 3H1AA 2PD4A 3FCOA 1SJHB 4EMSA 3DBXA 3AFIA 2VQ3A 2G76A 2Z4RA 1V95A 3A11A 3IIJA 2O6EA 3NAMA 4G8CA 4XNAA 3VH8G 3SOTA 5T1LB 4MCAA 1L9NA 2YQ5A 1MKFA 2PYEE 4IOKA 5K8TA 4NN6B 4TT3A 4G80B 1QYCA 3JQQA 4CLRA 1QEWB 5I9TA 3O3BA 1M34E 1AY1H 3NBKA 4J3XA 4ARBA 5HPOA 3QNFA 5E5RB 2VRCD 3AKZA 1O94C 1RYHA 2FK7A 3JBG7 1QVOB 4WECA 1Y48E 4XT1C 3GOHA 2OZ4A 1P6QA 5FYJH 1RQXA 4MDJA 2V5YA 1X5LA 3B52X 2R0KH 3C3MA 4E31A 4YR6A 4GQRA 2QE7D 1F4AA 4LCIH 1H0DA 2Q1WA 1O95A 1EK1A 2PR9A 3NFSL 1ZIYA 2PCFB 5A3QA 4LE1A 4YSCA 1GFIA 1CY6A 2XXMB 1I30A 4N0UE 5DJYA 3W9YA 3B85A 4KQMA 1THMA 3I05A 2WTMA 1FSPA 2CC2A 2O9JA 4F37K 1QKIA 1LO3L 3W1WA 3NJMA 1LVGA 5F4BA 4FZEL 4RVBA 5CFNA 1EP2B 4KK5C 2E27H 5FO2A 1XCOA 2OCPA 4XVCA 5I1HH 2AJDA 1XGPA 3G9TA 1Z34A 6REQB 4PRPB 3O93A 2F18A 4ZAKA 3VX4A 1KBKA 1H3NA 1IC5L 2PA0A 4NAUA 5CFAA 3PWLB 2PUTA 4X0KB 5I8OH 3GFFA 2OBYA 4N6OA 1KIPB 5EJFA 2X41A 4L4VB 3HO6A 2YJNA 4TLDA 1Y6KR 5G4OA 4CMMA 1II4E 3MBEC 2QTRA 5KHAA 2GBAA 4PG4A 5LBIA 4BO4A 5WRFA 2ZTSA 5HYQB 1RJCA 3O11A 2BE7A 3LF2A 4UIMB 3L0OA 3C6QA 1TDJA 2SNIE 4U1IA 2MCPH 4XBMA 2A0LC 3YASA 5AI0A 5DDHA 4A8JA 4MB5A 2DLTA 1TQCB 4MKTA 1HNGA 1XGPB 5AVWA 4E22A 3VWKB 2F8LA 3RVWC 4QD3A 2ADFA 5M34A 5FCUL 1RXUA 4PRID 4MW7A 3VMFA 3TVMD 2OG1A 1ISMA 2J1YA 3HBJA 4G9DA 2ZU0C 1IBZA 3J80A 1K1EA 2XMDA 5EBWA 2IEYA 1G38A 4P99A 1W93A 3GMMA 5CLFA 2XQJA 4NZNA 3HRZB 2J0UA 3O26A 3QJOA 3FDXA 4JELA 3AUUA 2A0XA 2DMKA 3WJMA 3VR5D 2REQB 2I7XA 1FSZA 5HY9A 4UAUA 3STZA 1SEPA 4ZMXA 4RWYL 4KDVA 3TXXA 3T08A 5AKIA 3SR4A 1QQ7A 2XAUA 3Q6NA 5LPNA 3ADBA 1I4FB 2O5NA 1DTSA 4QUAA 1SVBA 3O92A 4Z0HO 2H3XC 5CJBA 1SLWA 2NNCA 3HVIA 5ILGA 4KQ3H 2R69H 3LZNA 5IDXA 3Q0IA 1R9MA 4CMGA 1BXVA 5JXHA 2CB9A 4FD3A 4RDBA 3P30L 4MQUA 1WAMA 5DBHX 4C0SA 5ICGA 2AG5A 2BEVA 3B1FA 1U8QB 4XCXA 1X86B 2ZQ5A 2BP8B 3N8DA 1ROWA 3QUXC 2H4XA 2PWZA 3LAWA 2QDXA 4EHNA 1ZLXA 3JYPA 1EZVY 4XOBA 2EXYC 5K1VA 5LKRA 4XOEA 2D74A 1AXSB 3L4WA 4O02L 3E2HC 4ODTL 1AGDA 1T6WA 1T3TA 3S3PA 1A4CA 4B3EA 1QYRA 2A9FA 3VJLA 2R6HA 2E7LC 2Z95A 2V9UA 3WY2A 3R1IA 1GC1L 1EMTL 3AY2A 1XDTT 1OYOA 1ZWLA 3CX3A 2R1TA 3KKEA 2JVIA 1XEDA 2YYSA 4R4FH 3OZFA 5CDUA 3VSVA 5EH1A 1CQJB 4AQEB 3F3YA 3G23A 1RP8A 2GCYB 4MAUL 1BA3A 3L7OA 4AVYA 1Z2DA 5C9KA 1W6UA 4FLRA 3TYGL 2HJ9A 3DHYA 1SYSA 2BRQA 2AJUH 3WQHA 1JCVA 2IVFA 5F7AA 3UC5A 3FT0A 3P9XA 5AQ1A 2LTAA 1IG3A 1A6WL 2Z1MA 3U2QA 2AX3A 4EE2A 1EB9A 1X7ZA 1SK9A 4KQKA 5L3SB 1NUGA 1GPJA 4J3OC 1Y7PA 1IEBB 4L7VA 1X1QA 3L8EA 5IFAH 5E38A 2FFBA 5T1KA 4LEOB 1V35A 1BEZA 4H0HB 3U31A 1LLAA 1RHHB 1CD1B 4LV6A 2O7VA 3KQKA 4L8WB 3LYLA 2GTWA 2VLBA 1K3ZA 4I4NA 1AVAA 2I4RA 1MRNA 1OXSC 1L8XA 1AA9A 4PEVA 3BPNC 2ZF8A 5CXSA 5DP1A 4MV1A 3ZWYA 4ZX3A 5HXMA 5FA3B 1ZLVH 4S1RL 3FLMA 2VJMB 4FFZH 5JHMA 2EC8A 4JFFE 2WJYA 2VR7A 1VLHA 3S28A 2X6CA 3QWAA 1RXIA 4MX8A 5ALTA 1LTKA 4O5LH 2OP1A 3D2CA 4YRLA 1JS1X 3LAFA 3E3QE 3QQ9D 1FTSA 5BVPL 4E9TA 2OSXA 2X9QA 4MKMA 5K01A 3NOIA 4DEVA 2H7VA 1NMSA 5C0DB 1CC3A 3PAUA 3UPAA 1AI1L 4CVUA 3L8MA 2ZOWA 1J2EA 1RAHA 5DXJA 4HFWA 2AJUL 3W81A 3QFJE 4O1MA 1KEKA 3UBFA 5FP0A 5AVTB 4UW9A 3MRMA 3BHNA 3DTVD 3T2QA 1PDWA 3QHTC 4YWGL 4ODHL 3MUUA 1SY7A 4AJHA 1REQA 4MVWA 4RY2A 1FAKT 4MH0R 1LJLA 5JQGA 2IZ5A 1MENA 4CCYB 4XXDA 2CQVA 3SYNA 5LUAA 3S3DB 2P42B 3ADPA 3CR8A 2A7XA 3PJDA 3TZVD 4KAJA 2Q3LA 2AQQA 4JLRA 3A6EA 2IWRA 1OP3K 4Z0XB 3TIDA 3OZRA 4BU0A 4IYKA 2UUDH 3EFDL 1QMPA 3AQDA 3BZBA 3FT2A 2ORYA 4GRWE 3TRIA 4CJXA 1FPMA 3IMUA 3L6EA 1ADCA 1AGNA 1M1NB 1TTBA 4GZ5A 3UUGA 4NRZB 2V7HA 4JPQA 3QCUH 1XKTA 5ALDA 5ALCL 4Q34A 2YZ8A 4HXBL 4WOPA 3HG1E 4DLAA 1WLYA 1I1FA 4B9JA 3KSDO 5FFOA 2X7JA 2HDWA 2JJ8A 3GRFA 1T0MA 1KGDA 4OQTA 4RCVA 4R96B 2ED8A 3V9FA 1E2LA 4MYUA 5E6SA 5ECGA 1B6RA 4QELA 1NMCC 1Q0LA 2Z92B 4Y6GB 5AZ2H 1HLPA 1N6VA 2ZRMA 5PAZA 4IIQA 4GMXA 2Q5HA 1DIOB 4L9LB 4KL8S 4DETA 2HGSA 5CWSA 3Q01A 2J6BA 1YBMA 4N8CL 1EWKA 1GOHA 2AHOA 3WYFA 2CZGA 3BLPX 3HU5A 5HHMD 5LGJA 2OL3H 9GPBA 2XVKA 2VH5H 3EARA 4PG2A 4E68A 3K3QA 5GIRA 4JHWL 2PGAA 4NBYB 3W2DH 3IQFA 3ZLUA 1WCQA 1TLMA 4M0MA 2Q99A 4RD3A 4XCCL 3FNHA 3MPOA 4ODHH 4IGKA 5DTMA 4JDZB 3KAKA 4BGLA 4AJ9A 3CLVA 1MTOA 2Z2KA 5C0ND 3ETDA 4AQAB 4I1PA 1U0NA 4H27A 4XI5C 1MFAL 3W6OA 1IZ8A 2Y4SA 1AQKL 1CUHA 2I87A 4RFSA 5AVZB 3ORJA 5E4EC 4DWVA 4EHAA 2BM8A 1QNFA 4CQNA 3DJYA 2CEKA 2MYNA 4KJPC 4FHBD 4MLPA 4W4TA 2OC4A 4LY6A 1E3IA 2ZKMX 1QK5A 2XUWA 1ZUWA 4WKOA 3AOGA 2YNMD 4U1NA 3ENWA 1CJCA 3EBOA 3V0WH 2YFOA 3FVQA 4U1GB 4JEHA 2CLOB 4AVKA 1E9AA 1SOKA 4HC4A 3ZI4A 2G2PA 2NZYA 2W8BA 4LMQE 3I5XA 3QSYA 1QFUH 4N8VB 2EJCA 3KTAB 1HO3A 4PW9A 3RRMA 5EE0A 3PHOA 1TD1A 4YO0B 5IEHA 1G7HA 1XF3A 4PHXA 4HUKB 2FZEA 1NANH 3V0EA 3IOCA 4KY1L 3T8YA 2Q7YA 2COKA 1MCIA 5KVGE 1JQ3A 4OHMA 1XWWA 5E24E 3QFTA 2X40A 3AO0B 1QK4A 3V79C 2PS9A 4IOFC 5JOFA 3A6ZA 5TE6H 4M7WA 5AD1A 3CVCA 3MMEA 4DUGA 5E1BA 2PKQO 3K70D 4M9CA 1I1OA 1SJVA 3T3MF 3HSYA 4JL1A 5GS0L 4HMCA 4U1HB 3FIJA 1YEKL 4Q9BA 4ADGA 5JIQA 1CDZA 2NV6A 4RHCA 2A2QT 3QKSB 1NQBA 4MS4A 3EW3B 3PHOB 4YUZA 2C5GA 3ZGNA 5G0WA 1MZPA 4G0UA 1J5XA 2V97A 4BNJA 2ZI6A 4RBPH 5AOVA 2WVTA 1A1OB 4NATA 4LSMA 1F6AB 2I80A 4PYLA 1H2ZA 1RR6A 3L3DA 3T0EC 3VMNA 3L9BA 5IMMA 1BIIB 5B1EA 2PVPA 2OESA 5JW6A 5JYBA 2AB0A 4ZVRA 1U8PA 2LU7A 2LCFA 3C6EA 1U21A 1AURA 4M7LT 3DUUA 5JPMA 4OB6A 1RFLA 3PUYA 5K1ZA 5H9VA 1FG9C 2AANA 1QOZA 1QPXA 1FO0H 3OSKA 2WINI 2EKLA 2I4LA 3PQ8A 1KIMA 1IJ9A 5FXCH 3IQEA 3QNXA 1B0GA 1HQ4B 4LRSB 3DO7B 1KS2A 3NTVA 3NBYC 5IARA 5KSPA 2FSHA 4MMYB 4IJVA 4OXXA 4KJZA 1LL1A 5EC1A 3WKML 3MWEB 5I30H 5FAXA 3EIWA 1Z17A 4W81A 1EUQA 4DVBA 1Q6ZA 3A9UA 3V7FA 3CLWA 4GW1A 4ZT2A 3JPYA 1FXWF 1ECFA 3LLCA 2YZ1A 2JFNA 3KPWA 3UH8A 5KVEE 4X8MA 3KZMA 4KH2A 1KB9J 1E42A 3IBOA 4J91A 2NTNA 2PZFA 4DUPA 3GEMA 1R6DA 5IS2A 1G7PA 4ZMTA 4ODXA 3UMFA 5GSRB 4R7GA 2WTRA 4XC3H 2GAAA 4F1SA 2CDCA 3CLKA 2W2LD 4A2QA 3M1IA 4HMEA 3RFCA 1QRSA 1J9SA 4DP6X 2FPUA 1X1CA 5L2KD 4RK6A 2FW1A 5JHBA 1PNDA 2PAAA 2MIIA 4JZJB 4PM1A 3VSUA 1B4JH 5CBKA 1Z4NA 1Z06A 1P1ZB 1Z6XA 4UUJB 1G6RB 1QFMA 3V4VL 4GBJA 4UOW0 1KY6A 1U2GC 4BB6A 3OQIB 2OSLB 5E8JA 2HF9A 2DJUA 1PUIA 2IOQA 2NXWA 5ESRA 1L7IH 3VI3A 1KXVC 1DEXA 1H94A 3IAS6 3M07A 1IHDA 3D3NA 4WI8A 2B82A 5CTJA 5GSRA 3PPSA 2XYCA 4LYHA 5LQKA 1ZKAA 2FHSA 3C6LA 3DR3A 4DK6A 1Y3CE 3VFRB 4Q15A 2I2AA 1F97A 4OI1A 1N9PA 1YBFA 3OMWA 1GU1A 2YWCA 3X11A 5LDSA 2VNIA 3O3AB 5F7DA 2XMRA 3FJTA 2QSTA 4PPGA 2QD5A 2DQKA 2BOBA 2P68A 3NMUF 2J12B 3BFQG 3JYLA 1P53A 4PAGA 1T22B 5KKNB 2YMXL 4W5RA 2I2WA 2GZHA 3LWNA 2D1RA 4BX9A 1X1SA 2Q3FA 1IM2A 4DGIL 2HU2A 1A6TB 5I6NA 2WQAA 5EMLA 4RZ2A 4FQ1L 4GFDA 1GLNA 1BQHA 3L1JA 1UXLA 4B6JA 4X5XA 3AUVA 1GCIA 2ZRQA 1K92A 1ZHKB 4DN3H 3O7WA 2VN6A 3TBCA 3CSFA 1FYFA 4JK3A 2LNDA 1UHVA 5AW9A 4E12A 3IKCB 2NU9B 1FC2D 4J3UA 1KJJA 3WLIA 1PKQA 5HHPB 2C5DC 3ELDA 5CIPH 1WWBX 1HSBB 4BNKA 1Q12A 4PWJA 5JOPE 1BKSB 2EKPA 4JUIA 1YDPB 2APFA 1C3XA 1SFDA 4PJXB 4NQDB 4J94A 1P9OA 4KU4A 1TE2A 1ACZA 1XVSA 4ZZ2A 4PXSA 3TBWA 1BQHB 1JF6A 4NPCA 5D1QA 4XBEH 2E56A 2HVKB 4DCCA 3NM6B 5MENA 1XSOA 1RFDL 1NUTA 3WGUA 2ESVE 4QTTB 4PQXA 4M38A 2GARA 4PAWA 1WAAF 1DQVA 3WSVA 4KAFA 3D12B 5FTKA 5DWDA 1Q7GA 1E69A 1WWKA 1Z6QA 3P71T 1EAPA 4PJ5A 3HG0A 4MBOA 1AKTA 3BK1A 1WXEA 4Q39A 1NCCH 4DMKA 1Z82A 3F3HA 2OILA 2Z31C 4KKZA 3KZ8A 4L9AA 3OHXB 1SOMA 1T1IA 4X7MA 4Z4GA 4UTBA 1BFVL 3KZKA 4Q16A 4ID9A 2GBCA 4KVGA 4YONB 3DJRA 1G6HA 3DBXB 2QADB 2VDRB 2CK2A 1Y7LA 4XP4H 4ASUD 3WGUB 1XMJA 4FQ1H 3WHLA 4AXBA 3LZFL 4DOHE 4WAFA 4D4GA 1BJMA 3D7KA 3DM9B 2VDLB 3ZWBA 4CLRB 3FCAA 5KTPA 2BUBA 1I6MA 4JFPB 1FP4A 3FCXA 1JKJB 4PGBA 3UWPA 1ZFNA 3ZBPA 1XH2A 3QX9A 1YEHL 3PEVA 1OXXK 3K2UH 5DJ2B 3BPSA 3LX5A 4B27A 4BX3A 1CS6A 2FVXA 2VAXA 2WWWA 3BKXA 3RU9A 2RCSL 1N5LA 1QBAA 2X2HA 2R86A 5FKPB 2Q41A 5EUCA 3A2NA 3LVQE 4BA8A 2UYGA 1TNMA 2PNDA 3OOEA 2QRZA 4N0DA 4D7PA 3GEFA 5FO7B 3AG3B 4H3SA 2QVFB 3KETA 5G1PA 2J0VA 3AXIA 1RPAA 3ELBA 1E90A 5LDHA 1P5HA 3FULA 4ZSOE 2Q27A 5C0NC 5AKLA 1O9HA 4HLQB 1YZQA 5JXIA 4ESHA 3ZEIA 3P2OA 4MQTB 3F96A 1MRCH 2CHGA 4XMPH 4ARAA 3PP4H 3LY9A 2AK1H 3IQXA 4WZBB 1S8DB 3GRVA 3W5CA 1TQTA 1KZ4A 2QAJA 4LDOB 2VR6A 1O58A 1SLXA 4HYYA 3AF5A 3CH1A 4RGOH 4WFFD 4LC0A 3F65A 4P49A 2OZ4H 1OE3A 4I48A 2A78A 5ACZA 4D9RD 1RY7B 1YR2A 1TQVA 3TVDA 3NZ8B 1OXMA 4IHJF 3SDXB 1T2EA 4NZRH 1KB5B 4MO2A 4J1TC 1FYTA 3HMXA 3U0WH 4YDJB 4LC1A 5CP7A 3IJHB 4HD5A 5CYFA 4BNIA 5E94B 2ZXQA 5P8WA 1LGYA 4WIQA 1AK9A 1XCQA 1J4AA 4FGWA 2BGWA 1BFOA 3UJJL 1SVKA 4PPYA 1HE5A 1NZDA 2PWYA 4Z95H 2MCFA 5I4KA 4OGYL 1G5FA 2WIJA 3BGVA 1P2CA 1KI9A 2Y1AA 4KO7A 3RVUC 5I76A 1P2UA 2H2AA 2YQ2A 4KJQC 4DCPA 2K8QA 3C15C 1AK1A 5C7IO 4RRPM 4GT1A 1CFTA 4X93A 1ASPA 3OAYH 4X90A 5EZLB 1W85A 2O7NA 3WYCA 5DD6A 2PKDA 1H6CA 4YCBA 1FDTA 2O5EA 3FCCA 1GOFA 2EDYA 1IILE 4GX1A 4HD9A 3G0DA 2WYZA 2QT9A 3OLXA 3QJQB 5BRZA 1XYGA 3ILQD 5LWHA 3PV7A 4MA8L 1AZTA 2E7HA 1TVBA 1BJTA 3AS1A 2UZYA 3I74A 5GJBA 1C8QA 3C4VA 1VEMA 2C99A 2WFLB 3NC4A 4WGGA 1N8SA 4RMRA 5HGGS 2ZF9A 2XX3A 2Z2YA 3ACCA 1XJCA 4FS8A 2ZRBA 5F51A 2HHCA 2EIBA 2X0RA 4TUYB 7PAZA 2X5OA 5IZ7A 5IFHL 2AI3A 8PAZA 1PX2A 5CGMA 1MJJB 4MI1A 4IH1A 4GXVL 4HIXH 1A4BA 5TT0A 2J6IA 3U9SA 1BGVA 3KLHD 3ML8A 4GHWA 3EDQA 1LSUA 1TKRA 3SD5A 4BLPA 3KD2A 4RKEA 1A6VH 3JQAD 3F83A 4KHXL 3GFOA 2WOJA 2QZ5A 2OW6A 3HS0B 3R3WA 2ATKB 4O58H 5CFZA 1FZJA 2N9UA 2H0QA 1SVOA 4ZYZA 4H7VA 4C5CA 3D4OA 1DQDH 4UUBA 2LVCA 4PZ9A 5J1AB 3GMNB 3PUJA 1BVKB 1L9SA 4NKMB 1SZPA 3EA0A 2J1WA 2VK8A 2OC9A 4HDRA 4PN6A 4CI9A 3GB9A 5DE3A 4EHLA 2PWGA 4LOUC 5EHXA 1FPTL 4GWKA 5DZ9A 2X1XR 1ATIA 2YFNA 5ESQA 5I1EL 3V4RA 5G0SA 4CRWB 3ILSA 3IVXA 3A1DA 4YMSA 5J9FA 1AO3A 2IXBA 4EEKA 3TBKA 5KWEA 4NQDE 4OGFA 3OJXA 1C0IA 2NVUA 3AAZB 4O5AA 5ILTL 4FKBA 2C2MA 4OW6A 1BN6A 2Z1NA 4LFBB 1D5ZA 3CX5K 3T0BA 4J3SA 2WM9B 3PNLA 2B94A 4APQB 3E9QA 1AQKH 2I7CA 3EGOA 4N2HA 5ACMA 1CUEA 1XPUA 1HTYA 4LSVH 3W2GA 5BRZD 3OZ9L 3PRHA 5ALIA 2AS0A 1JHTB 3ZWVA 3FQTA 3KPNA 2WTNA 3SC2A 5I6LA 3K0FB 1O9WA 2DE0X 1NCCL 2IAND 4J7XA 3ZCRA 5EU3A 4IRSA 721PA 5E1OA 4OA8A 5KJRH 1TEZA 4YP0A 4PJDA 1GYCA 2C3MA 1IWOA 4H7KA 4TWAA 1ORVA 4HB0A 4BKTC 4Q1FA 2HA0A 1IGFL 3Q85A 2GFQA 1DVQA 5HSGA 2WMPA 3BK2A 4UV7H 4Y19D 4RHEA 1MDBA 2IYOA 3AT1A 3C6LC 1YUHA 2IP4A 3FG9A 4J7CA 4TWJA 3G68A 4OI9A 1J1ZA 4OH1A 4CEHA 4N3TA 2PS0A 5FCSH 3NXKA 3RUCA 5KZCD 2VHWA 4JXKA 2HPOA 4WTXA 5ILOA 4K7PL 3B5TA 1H8NA 4XCYB 5HHOE 4C03A 4KXCA 3ROEA 4L4TB 3MWFA 1TVDA 1WUYA 3ZZNA 1KN4H 4L5FL 5EBMA 1FP7A 1A8PA 4CEIB 1KZ7B 3QENA 2DFVA 3R06B 1K6EA 3LD8C 5D1ZD 4RQBA 2QLFA 2QMKA 1XGQA 2XWJB 3PNMA 1TCBA 3G8BA 4LJ9A 5E00B 4NPHA 2A9QA 4A5OA 3M6IA 1Z18A 3NOQA 2KPNA 3LV3B 4M61B 3B9DA 2DTMH 1MCRA 4G63A 3UW1A 3MMNA 3NJFA 3K0WA 4UTBL 4RO0A 4BLRA 4PJ7B 2YHSA 4UQPA 5FOTA 4OKVA 4CCYA 3BD6A 2ZUVA 4DM3A 3IPRA 1WMDA 1XUOA 1P1CA 3FQ1A 4A55A 2JH8A 4GR5A 4BNFA 2B3TA 1A2YA 1WCBA 5JNSA 2HU8A 1DOZA 5CT6A 2EDOA 2QDKA 1VJGA 5DBEX 4P5PA 1T91A 4K2UL 5DHFA 1N3NB 1G5QA 3IIEA 2OZLA 5J5AA 1G2QA 4KX8A 4BDVB 3CIAA 5LWYH 3PK0A 1PJZA 3IE4A 3TDMA 3H0TA 1SUAA 4CVZB 1HCZA 3BGDA 1Z08A 3IDOA 4P2RD 5BO0D 2EE9A 3GCGA 2HPAA 4PVDA 3EGDA 1CICA 4DBLE 4P2BA 2BNQA 3Q6GH 3B5IA 4EI5A 4NESA 3BKWA 4F3YA 2BHLA 3GRYA 1X1RA 2YFHA 2KQMA 1ZH4A 2C31A 1CXFA 3I2FA 2ZRPA 1VMAA 3X1MA 3C2AL 1SEQL 4L0CA 4BNNA 2ZCKL 3G85A 4ZQHA 3MPUA 5IWAB 1J07A 1KB9K 3MERA 3MJVA 3IUPA 3VH1A 4DNLA 3VFOA 4ZI2A 3M33A 5JZBA 1FFPA 3H5VA 2FH5B 1KEGL 3ZT5A 2WAXA 4RRPA 4KFSA 2O6DA 5DO2C 1JG2A 5IDQA 1S3KL 3E84A 4M0EA 2Z5FA 3TNNA 2P3OA 2MR5A 2WG2A 2F7PA 5B2ZA 5IVXE 3V6ZA 2J1LA 2ZI9A 2QIOA 1EGQA 2E75C 3D4PA 5AB2A 3NOOA 4YGVB 3QUHA 3QIUB 3OEHA 4Z3KA 2P0YA 3TNMB 2R4TA 4XGNA 3RJ9A 4E5PA 4LY0A 4HAXA 1BEEA 1D1PA 5I5EA 4AIEA 3O0LA 3UTQA 1EWVA 1Y1RA 3QF4B 1Q0XL 1FL6A 4KKAD 4DW2L 3IJEB 3DYBA 3AF4A 1V8OA 1TCRB 3SZKC 1GCUA 1Y6MR 4NQZA 4OGXH 2O2DA 3HDQA 5BYJA 2QRPA 4P8RA 4UBMA 5KBDA 3HYLA 1WCIA 5HK8A 3AVOA 4MSWA 3SGDH 1DDHA 2MCG1 1O5IA 1IUPA 3EOZA 3LD9A 4P2OC 4DNPA 4LJ4A 2RONA 3ALXA 4U1MA 3ZDYE 4B76A 1MEEA 4BZ1H 3QR0A 4S2EA 1E66A 1VI6A 3ASOB 3KQTA 3O5AA 1FVXA 2C5HA 2EWWA 2YMMA 3CF2A 4YR7A 4S04A 2Z8ZA 2OMBA 1K75A 1OH8A 3H9GA 1L5HB 4IUBS 2EP5A 1FO0L 2BSTB 1P18A 2VJDA 2GCEA 2KYRA 2HC9A 3FR7A 4LTNA 1ABBA 3OQHA 3LXCA 4TYQA 3BEVB 2OMKA 2IYWA 4Y1AE 2NOYA 4XRRA 3P9RA 3B53X 2WJ3A 2F43A 5ADPH 1WIPA 4HQFA 5FECB 4BRUA 3GZKA 4CLEA 1EVTC 3H55A 2BUCA 3GRZA 2C7OA 2R2GA 1X5HA 4QASA 5JLJA 2CNNA 1INLA 1YN7B 1SXJA 3UUWA 3BB4A 2OQRA 4ITVA 2CDFA 3FFCD 3PHJA 1CF9A 2H18A 5GOZA 2WWTA 3CZQA 2OWDA 3B2UC 4TYMA 1FBIH 2ICCA 1DJWA 2IV7A 2FECI 1UT9A 2VXYA 1CFSB 3L77A 3QP9A 3QWHA 2PMWB 1GZDA 5L9AA 5CN2A 4K9EL 2ZG1A 4KKLD 3X13A 4BGUA 5B5SA 1WXFA 1DUIA 1BVLB 1J2RA 3CVVA 4J6RL 4YSUA 3F5WB 4QWWA 3CSSA 5FPPA 2I99A 4HZ1A 2CK3D 2YZMA 1JLKA 4Q9RL 4NJMA 1PYDA 4UMVA 3U1SH 3ME0B 1SVIA 2I8LA 1H8EA 4BSWB 4PIMA 1X5KA 4N2NA 2HT3C 4KFZC 1JV2B 1HHKA 5J5EA 2DTSA 1AXTL 2WNHA 1MRSA 4RTKA 3ZR5A 4DEWA 3TT3H 1PL7A 3RUIA 4NIKB 2G9UA 3APCA 2VLLB 2ZX8A 3V7AG 4Z1OA 1LS1A 2FR8C 2W2LA 2FW6A 1ZJAA 3ZDWA 3WKBA 3HN6A 3VYUB 2WSMA 4UDNA 3H85A 2OT3B 4IILA 1ETJA 3T41A 1ULUA 3C7AA 2D0OB 4V0RA 3NSJA 3U0TA 1P1BA 3HWRA 2QVGA 3OPXA 4MYDA 2Y2VA 1XH0A 2OLKA 1X7HA 2F1IA 3D3VA 2GETA 3HYNA 2D9QB 3LQQA 4N5MA 4KPYA 3VB9A 3VMPA 4AGMA 3RC3A 3TPUB 5L8LB 1KAEA 3HYSA 1NAKH 3ASNB 1P1VA 4JGMA 1G2IA 1C16B 3QVGA 4Q3EA 3JAWA 4QRUB 3QJFB 2V7HB 2ODEA 3AJEA 5B6IA 3GI1A 4E5XB 1UH3A 4GS7C 3ETBF 1SWWA 1SHUX 2CF5A 1V3MA 3T3ME 3BWAB 2IYYA 3PRYA 4I1IA 2FB9A 3FNGA 1U8IA 5C0GA 2WD8A 3DEKA 1C08A 2PNJA 4TX1A 4XPAH 4GZLA 4M93C 4HLZH 3WQRA 3D3VB 5I1HL 1TIPA 4FJ0A 1YT5A 2ZR0A 1U2CA 3TM5A 4Y2DD 5DTEA 5AYTA 2FEOA 2WZBA 2REBA 1PGQA 4DB2A 1LO3H 2AJZB 4ND6A 4UQLA 3AGVA 4KKRA 4WO4D 4X62B 2Q1TA 1MQ9A 1SHZA 1QJ4A 1E4KA 2P41A 3WYEA 1VXOA 1E4EB 3SQBB 4AJ4A 4N2LA 3QEGL 2G80A 2WWKO 4DP2X 1ORQA 1IHUA 2I6FA 3KAQA 3LCCA 4K8RH 2I4TA 1X94A 3EIEA 3SKMB 5CDHA 4YL4A 3O4LA 3ZNOA 2R00A 3RS3A 3AG5A 1N75A 2IBGA 5IU6A 5IWLC 4OZIA 1KZHA 4CF7A 4B53A 5KNDA 2BN4A 1HNZB 1XLVA 4ZVNA 4FU0A 2V6FA 1E4YA 1FFRA 1NMYA 5KWSA 4FIDA 3IE9A 4HGZA 1ZPDA 3OTQA 43C9A 4KAAA 3UTZB 2XYHA 3U61B 5KYVA 1D2MA 1UWGL 4K3HA 3SQBA 3W9EA 1T89A 4GSKA 3KX2A 1D2OA 1I3GL 1N2SA 4FJZA 5IEJA 2D0GA 3FCUB 5F9MA 4QOKE 4E11A 3PFUA 1QTSA 1Z4IA 4CKXA 4OZIE 4JVOA 3U60B 4QF1A 5EPEA 5D71H 2CJTA 1VQ1A 1WKBA 3FSEA 1PZ5B 3PENA 5EO1A 4AZ0A 3A4IA 1ZESA 5D51S 1A6ZA 4UT9A 4HKXA 4JR0A 2ROYA 5KYUB 3UK2A 5B2FA 3WLEA 3VSDA 3OFKA 1MJFA 1OWOA 2XW6A 4HW6A 5FNVA 3BMXA 4UAGA 5AIAA 4ISVA 3HNVL 5JOPD 3RX8A 1FSSA 3PHIA 5K8LA 5JTUA 1BZ9B 4FFPA 1RZRA 1OBCA 2NRDA 3BMQA 4NNPL 2XFXB 2CFTA 4Y4HB 2BRRL 4F7MA 3WIHH 4N9WA 1E6CA 3GEPA 4J0DA 3E1ZA 2GIMA 2X4IA 4JN2B 1TTCA 4K8RD 3MMEB 2W6OA 3UA4A 4BOYA 4EABA 4X41A 3GDGA 2A9NH 5LMNB 2V7VA 1JHPA 4MNQD 2DLHA 4RTOA 4Y7DA 4RPHA 4ZDJA 3GEIA 3F85A 3A1VA 4TMWA 3ESNA 3BWDD 4LVNC 1VBNA 2FGJA 1APBA 5AJZA 5FBRB 2JKIS 3BWUC 1ZIPA 2EYQA 2QX7A 3BLBA 1RHFA 4K9NA 1UENA 4GO1A 4NFYA 5EDXA 3TQFA 1CNFA 5KJ6A 4WZAE 1ETHA 4NKOA 1AKWA 1IBYA 5T3UA 5BZDA 3BB1A 3EHBB 1CL7H 1ZEAH 2G67A 1U04A 5FHAH 4BE5A 1T4KB 1UDWA 3A6LA 3OIDA 3RQSA 4DY4A 4M98A 3SKUD 4MVXA 3INNA 4YUXA 4ODIA 2XZCL 1KAHA 1NI4A 3U7QA 4B95C 3SBXA 2AQKA 3LHFA 5GZNC 1FUNA 4LQCA 5DTFA 4QQ8A 2ZR7A 3G6AB 1H1LA 3DXAB 3I3EA 4OXIA 2DYPA 1JGEB 2QJOA 3HNTL 5EXXA 4LPTA 1V16B 1GKLA 2YRXA 3CUYA 2JMRA 1HSZA 3HCNA 3DTNA 1AUXA 3BUQA 3U3DA 4LNAA 4MS6A 4AY6A 4UBDC 4BNTA 2FEAA 4PB9L 4A7SA 4FL4C 2SICE 1EK0A 4CJ1A 1HC7A 1WPGA 3B6EA 3STHA 5F88A 3OKAA 5J13C 4LVUA 3DYMA 5J4LA 1K72A 2G60L 4HCRL 4GH5A 4F4UA 1DXQA 3CFTA 5IZCC 3ZHNA 3BXNB 1YRBA 4BFYA 3DZKA 4CM1A 4IXWA 4M3KB 1Z5LA 3GNLA 1HHGB 3QJHB 2XZDA 3TX4A 4ASUA 5EJ7A 1UK9A 4L4RA 4GRMA 1AE6H 4B33A 1YCFA 3SQMA 4LVHC 2GAZB 4IBSA 1RZVA 2R69A 2AZMA 1KARA 5A9SB 2Q3XA 3ITNA 4Q9CA 3DE7X 2Q2EB 2VUHB 4BQOA 4YDLB 2H4EA 1JRHH 4CMBA 4FYIA 2VT0A 2FPIB 4DP4X 1PVHA 4URHA 2DJ4A 1IO4C 4Z7IA 1PW5A 2XWRA 2YBRB 3RL2A 3W6UA 2HO4A 5CLHA 4MAYD 3E18A 1Z39A 1AXIB 1GGIH 4X2UA 1AZCA 1ONSA 4E9QA 4GLRI 3CAFA 1ZJ5A 1QAOA 2QZZA 2F74A 2NZWA 3KQHA 5HHMB 3FSOA 1EQAA 2C7RA 5AVSA 1BD2B 2CDEA 4C6TA 3QUZA 4AMXA 3N7AA 3TEUA 2BKEA 2XUKA 3M6LA 5DO8A 4NCIA 3RTQC 3FWKA 3P9CA 1H2AS 4XDHA 3IP8A 2B9BA 2WHRA 5SV2A 1O3YA 1SUWA 4QLRA 1XCWA 2JCCF 3N44F 4A63A 5CB4B 5EEZA 1IH8A 4F5YA 5BSEA 3I52A 4GP6A 3O3NB 5F7MC 3WADA 4CEJB 4HJRA 1KIAA 3HR5B 3UG6A 2FQWA 2NT3A 4G5SA 4HWRA 1D6NA 4M0DA 3WMEA 2C3HA 3VGBA 1HH9B 4KK6D 1B1AA 4Q4LA 4DLRA 1W72B 1BD2A 1MG3C 4JSYA 3K8ZA 2YWYA 1MJGA 4INPA 4RTLA 4XYMA 2I25N 2PPAA 3OEYA 3NJ4A 2DHCA 4Y9EA 4MW6A 1FRGH 3LW7A 3H8SA 3OZVA 4RENA 2F5AL 1SQ5A 1RI5A 5IM5A 2ZNWA 5K0SA 2R68A 5FW6A 3VGAC 1TVEA 1R24B 4H26A 4Z7QB 3E9RA 4F3CA 3B9BA 1BX2B 1Y37A 3N2KB 4A1RA 3TBTB 5HMMA 1D3CA 1ULSA 5FA4A 4WD3A 2WV3A 3VDNB 1JAXA 1USVA 4FNMA 4KN6A 3RS5A 1EIWA 2Y7OA 5DHDA 4FHDA 3W0WB 4LDNA 3LX9A 4P53A 4IU3B 2HKAA 5INDA 2X13A 1YEJL 4NDMB 4TXMA 5IVKA 2WICA 1PBYA 1T6BX 3IN2A 3MB5A 3V42A 5JORA 3OXSB 1E0SA 1ZGZA 4XNQA 1ZA6B 1I53A 4X6FA 2BY2A 1FEZA 4EG4A 2H1XA 4LGCA 1LXCA 3VMOA 4LSGA 4P4KD 1O94A 3M1BB 3KM1A 3R0QA 4IIHA 4OLEA 1VBFA 3DVGB 4G25A 4JM2A 3SEZA 4MPRA 4MPDA 4YAUA 2BTEA 2V7WA 3SPHA 1A1MA 2G4LA 2WYTA 4ZPTA 2IELA 2FYVA 1N68A 5KJ4A 1UDXA 3H9EO 5K0LA 1QE3A 4RQTA 5JY1A 2I78A 1Z16A 1KKMA 4N7RA 1E8XA 5DPMA 2VZUA 3NN8A 4PPTA 1J0CA 4F38A 2RH9B 3RTEA 3BDYH 4FULA 5ITFB 1K6XA 1VPEA 3U4CA 5CBEA 2NNXA 2PYEA 4F8TA 3Q9NA 1W6WA 2DD8L 2P6RA 4FPXA 3SZ3A 1ZCJA 2FPGA 4S1VA 2DQCH 1EERB 4BN0A 4LF3A 3CKYA 2DEXX 3DTDA 3NRCA 2BI8A 4YJKA 3F1KA 4R16A 4HAGA 2J0SA 3BPCA 4GPIB 4BFIA 3DYOA 1MC1A 1GGMA 4OGZA 1IOWA 4EG3A 5IROC 4BZ2A 1IFRA 4ILEA 2Z08A 1KEML 1E5BA 4WCFB 1TFUA 1F11A 3CVUA 3TFOA 1GJWA 1YFZA 2XR1A 1JK8B 1FIGH 3JVFC 4YPJA 4P2GA 1JB1A 1AY0A 4DN6A 4DPCX 4PBWD 2OECA 3JD1A 5DM60 4EMTA 5FYJD 3SHOA 3ZKWB 2VZ8A 4FQQA 4OZFA 4RGND 5H37G 3EJJX 4D9GA 4G8GA 5CZVH 2A2ZA 4G0OA 5BV7H 2GSIB 2QYHA 4N0FB 4WADA 1HLDA 3NEXA 3OZEA 4F04A 1HXYA 4GI5A 3DZIA 4KH9A 3DMMC 4CDHA 4EMZA 4ONHB 4GNKB 2ZITA 2N3JA 5JYEA 3M2PA 1G8YA 2OAP1 3R0NA 3QZMA 4XE5B 1MLCA 4CADA 2P6PA 3JYNA 2J5LC 1VLJA 5DLML 3ROXA 7REQA 4HWKA 2ONJA 1X7WA 1MW9X 4H3VA 4NCBA 4NBXB 4XP9L 1GVIA 5BV7A 1ZKMA 5EHZA 3HNSL 4N9GA 3CRZA 2XTJD 5FOBB 4BVBA 2PO5A 3EIFA 4ZI3A 1W49A 5HDBB 2AQTA 2CJXA 1KJ2H 2A3NA 3BXGA 4EY5A 4BQ9A 3JPWA 4JB9H 1S9VB 3G6JB 4QU5A 3UWSA 5FYJU 2BFGA 1NGZB 3C7DB 4HB4A 2GJRA 4J2QA 1QR1A 1KH3A 3E7WA 1PT6A 1CXZA 2MOGA 1IC6A 1Z2AA 1EA7A 1CEYA 4PREB 4WHDA 2B2XA 3UZVB 3E05A 5ISZB 1OFHA 4RV5A 1E28B 1OAQH 3SICE 5DGDA 2G83A 1BQUA 1VHWA 4OPMA 1HT3A 1T7XA 3X1KA 4GW3A 3RAJA 5LBSH 4HWOA 4ZCSA 4CM8B 2F64A 4EBQH 5FULA 4XHQA 2E4WA 4X6LA 1LS6A 4I9XA 3DEZA 3NANA 4ZSOA 1RJLB 3X1NA 5AB0A 2B7DT 5KKCA 1IAKA 4NERA 3BGMB 4M02A 3GXPA 1VJRA 5CMAB 1KKUA 4XJTA 1DHRA 1ENPA 2O2XA 4D97A 4Y88A 1OHZA 3PQ3A 3P4LA 4PFSA 1KDYA 4L0YA 4X20B 3UPRA 3DVAB 4P0PB 2ZXGA 2XTAA 3WIOA 2XXAB 4B73A 2CLZB 3APNA 3WFHA 3GELA 4YRRA 3RAJH 1V3UA 5CSGA 2ZJ5A 5DRWB 5G4MA 4HHEA 5F70A 3N91A 4B3HA 4MR8A 4U2KA 4BXSV 4KG7A 4K6FA 4C58B 1AR1D 5FWNA 4S1QH 3FPJA 2DMBA 1N2GA 2A86A 3V6BR 4R2JA 2JNZA 5C6TH 1L9KA 2PCXA 1OB5A 4GAJL 5D3ZA 4RKRA 4N0QA 5KANI 3PQ4A 2WXMA 4A2DA 3VTKA 1ACCA 2VISB 3CHOA 3SDDB 1M0EA 3DOFA 3H11A 2ZUDA 1KXQA 1WTLA 2WXIA 5TPWB 3CXHJ 4LF4B 2ED6A 4L1BA 1N32B 1JHVA 1GOTA 3W7BA 3HUJF 1QAWA 5TPWL 3B3FA 3E8SA 1F9EA 5K09A 3RH0A 1I3VA 1L4IA 3QUBA 2YL2A 2NU7A 2NYVA 3TNMA 3JZDA 3T0WA 3M6VA 3DB2A 1EP3B 4TWBA 3LRXA 4WOKA 1RVDA 1QSGA 1OH6A 4N18A 1V3TA 1PCXA 1ONNA 4YSPA 2X4TB 4U39A 3H54A 5IFKA 3HHMA 1N6QH 4YRCA 3HBPA 1C0KA 4HKJB 5GGRB 4HB3A 4MINA 3KDMA 2VH2A 3EB9A 1A50B 4MNGB 1EJ0A 3ZHKA 4QDTA 2O6LA 1B0AA 5AZEL 5F5LA 2FY8A 1MF2L 1B0PA 5DW0A 2G06A 4ZFGL 3I9NA 2OBNA 2BNRD 4A36A 2B3DA 3ZTEA 4LBEA 4WKBA 3AR6A 1NZFA 2J9ZB 3OF2A 4U9HS 3E81A 1PQWA 1DO2A 4HIPA 3W4IA 3WO1A 2AOUB 4OLVH 4H17A 1WR8A 1UKCA 1KETA 4JVNA 4UXJA 5GGRA 4RL4A 5FB8A 2R8EA 5AG8A 1HXMA 1V43A 2HJLA 5CJJA 3LVTA 2Y2YA 2ODNA 3CLUD 1IAOA 2YPKB 4AM0B 4QDUA 2EZ0C 3VX0A 4RIRB 4Y4KD 4LEBA 1R3IH 3K5WA 4N2CA 3O1HB 1DG3A 1PF7E 1BBDL 4F6RA 2R0ZL 2J8UB 3BRCA 3FA2A 4RFVA 1FC1A 3SJ7A 2VQDA 1T2QL 3CJJA 3MV9A 4ZI5A 4N0CC 3WFBL 4FE3A 1JBKA 2WP3T 2GFBA 5L4SA 1CIDA 1T1ZB 2YN4A 4TZTA 5HHTA 4YRMA 4BLUA 4A37A 3T7KA 4GS7B 3GLSA 2OA0A 4X5RA 3PR3A 3R23A 2PW2B 3O9WC 1OAKL 1GTFA 3D5TA 4G2NA 3AWEA 2E6KA 4BZ2H 3T0XA 4BEVA 2AI2A 4NZRL 4PXAA 4R4ND 1LO0H 3FOMB 4E94A 3E3AA 1T2AA 2VMCA 4KE8A 5BN5A 3NUKA 1RPQA 3O7MA 4DQOL 4C0AC 3TBYA 2QTCA 1J6UA 3QEOA 5EZ5A 4AH2A 1ZSVA 1Q72L 4NZPA 3TC9A 1HINH 1T4DA 3B9EA 4UE2A 5JZ9A 3PGXA 3KJFA 5JTTA 4KKCD 4OHOA 3DURB 5AVYB 3D8SA 4KO8A 5JMPA 1I3LA 3RV4A 2P30A 3MO1B 3DOHA 4B31A 2BJML 2V3VA 4XA8A 4TL7A 3OC5A 2DY1A 3OFJA 1NA8A 1OX4B 4XMPL 1PWZA 2QN8A 3C24A 3I8OA 3BULA 4EAQA 2FOLA 1BZDA 4WV1C 2XLBA 3ZDZB 2FQFA 1E4XI 1WUNT 3FT1A 1VTKA 5C7OO 3S5LG 3O74A 3P5SA 2BGMA 5KTMA 3GBEA 1WLHA 1E9VA 3DULA 2ENJA 4WQOA 3HNSH 3JSXA 1I9CA 1TB4A 2RARA 5CHNA 4W1SA 3IDXL 2V6IA 2DPMA 1YJDH 4P5KA 3ZJ5A 3KJ4C 4FHKA 5MN4A 1IXRC 5LOVA 2Q3DA 2PV7A 4PJBF 3QWIA 2ORBH 1NIFA 1AQ6A 1XGKA 2WNSA 2H85A 2P62A 1WQ3A 1DBQA 4JVLA 4YFYA 2R8PA 4YAFA 3STXA 3KEQA 3HBZA 1EUDB 1PFCA 1JPGA 4QTHB 5HJGA 1Q1ZA 4Q1BA 4XKJA 1U80A 1N0LB 2Q5FA 3E58A 1BXGB 1NVAA 3HABA 4YHML 4HNHA 3S5ZA 2ZIDA 3FZEA 1RK1B 1KYZA 4K3VA 2F53B 3QYFA 4U7TB 1YQ9A 2A67A 3IJRA 2J48A 2Z5LA 5HBBA 4WI5A 5DNYB 4WKNA 2MNWA 1IPFA 4HXAH 1Z6ZA 2PUCA 2QVXX 1BJ1H 1HE8B 4PQEA 1T3FA 2B8TA 3D2LA 2WVVB 2N3ZA 4KZKA 4L6CA 3SZOA 4QRQA 3O8RA 1HH6B 3RANA 1QZNA 1YYLH 4BTLA 2XN9E 1K86A 1YUBA 4K6GA 2NTSP 3JS5A 5HHNA 1IK6A 1NP3A 5KS2A 3PV6B 1QZUA 1R3DA 4LHYA 3ZU4A 4Q0XH 1FQKA 3IKKA 1BXGA 4L8VA 4R2IA 1N3YA 4PRIB 4W93A 1MFNA 2EYSB 4AGOA 5DRXB 1KC5L 4IIQB 2WIDA 2AE1A 4X6CE 2E4VA 1IAVA 3PNBA 4XQEA 4YQZA 5AAPA 3S7GA 3V52L 2XB2A 1KENH 1JT9A 3GHEL 5DK6A 1QS0B 2VBFA 1F18A 1HE8A 1S5HA 2X3AA 5HJ5A 4P5MA 4HVBA 3ISWA 5C0IA 1NU8A 4CC1A 5K1NA 3ZRCC 3ARBC 1K7SN 3SKJL 4JKLA 1V2GA 2BMWA 2PUGA 4NBWA 4N0YH 1ZEJA 4B2IA 2UZPA 1Z9LA 4DREA 4RAVA 1JZ4A 5IBTH 2FEMA 1JI3A 4WHTB 1XIWB 1LEKA 1U02A 4XN2A 4GW5B 3WBKA 1LO0L 1P2FA 2RGNC 1UINA 1YEDB 4CDMA 1KB5L 4WCYL 1SRDA 3E7XA 4LSVL 3HPLA 4DUWA 3ZDXF 4P31A 4ZS6D 1KWGA 2Q3EA 3S34L 5IKCB 5A1TA 4KLAA 1Z0ZA 4QEKA 3WTXA 4CW1B 2XT6A 2YXWA 1AE1A 1E5QA 3O2SB 3PUKA 2W71A 5AM5A 5IC5A 1XE3A 1IZJA 2Q5LA 1U8CB 5HS4A 3AT8A 5B64A 1YBHA 2HDOA 3SE6A 3CBJB 3SJVA 1PG7W 1B8VA 1IWBB 3IGLA 2Z7ZA 1I10A 3KQOA 4DLZA 5AVXB 1L9QA 2Q7YB 2Y5TA 5J8OA 4H0CA 1KR5A 4LGMA 3FYDA 3AOEA 4G0MA 3TSYA 1H6FA 1VF5C 1QMUA 1OE0A 5JW4Q 4EUSA 3QDMA 1Z6GA 1Z9OA 3LVFO 3UPCA 4CW1A 4PJ8A 3ICPA 1CN4A 3KKOA 3PNVA 1TEVA 1LO2H 3O6FC 4XNUH 4YDKH 1CJBA 5FL7A 2OSLA 3WWEA 5DT1L 4PJ8C 2AJSL 3FO2A 2FX7L 2Z4QA 3OXRA 3CFDB 1WG3A 2G9VA 4IQHA 1OOEA 4JI6B 4BZQA 1G0NA 5H94B 1FRQA 4F3TA 3JWOC 1W0KA 3DD5A 4LY9A 1XGRB 2DBYA 2GCOA 1KFEB 1R5JA 4HXEB 4OI0A 4NUGH 4AJPA 3DEYX 2X2FA 3ZEAA 1JVLA 2WN3A 4MQLA 4NDNE 4Y9FA 3KJQA 3B6SB 3LIZL 3SHTA 4HPYL 3QPQC 2CHNA 1PY4A 1TJXA 2EL9A 4KUZL 1WX1A 4Z4FA 1NN0A 1KZGB 5HRUA 1II8A 3JV7A 4OV5A 3OKFA 1RPKA 2XGSA 4ARUA 3NI2A 4I1NB 1PDKB 4IJ6A 2Y7NA 2P24A 2VHYA 5IASA 2VCOA 2QVKA 1CYEA 3AHCA 2FJUA 4XIJA 5K3CA 5JSZA 2OTWB 1L3IA 3GP8A 1OC4A 2YS4A 4LESA 1RWBA 2QUHA 1C9DB 1YY9D 4G26A 4KXZI 1MIOB 2ZKXA 4TT3D 4XH2B 2A1TS 5EUQB 4FLFA 3PJEA 3MNZA 1E77A 3TZQA 1OB2A 3C3PA 2VLIA 1ESDA 4N20A 1QHIA 1EFVB 4L9SA 2RKWA 2VAMA 3THYA 2GFIA 3KYOA 1PLJA 4TZ0A 1JN0A 5AI6A 4Q03A 4DLBA 5J6GB 2QROA 1E9RA 4AECA 1NVDA 1MPTA 5DM2A 4IRJC 3QNUA 5BVGB 4NRYA 1PU2A 1C2TA 3LC7O 4U63A 4FE9A 2XGOA 2J4FA 4DJ5X 1XQYA 3RL1A 1YSOA 3FF7A 1HL9A 4MX7B 1DZBA 3IHKA 2ZX9A 4LFAB 4L5FE 3VA6A 3RVXC 5MENB 5A4IS 4JY6B 1WRBA 4YDRA 1QH8B 4IMKA 2K6YA 3U7YH 4QTIL 5IGXL 5EU6B 4KQ1A 1S8FA 2TYSB 2ZIXA 3TIIA 3CRW1 3QDGB 2E1PA 4P33A 3MLTA 4D9HA 4XOCA 2J25A 2PL5A 4LHSA 2QHXA 1E2FA 2OMNA 1DIHA 3EX7C 1Q7CA 4LGRB 2LOEA 1EFXA 2VHCA 5IAAA 1SXPA 1DEAA 2C9ZA 1MFCL 5T6MA 3QUXB 1TO1E 2F53E 5FM5O 4L1KA 3V8PA 3OGOE 2BR3A 3HAEH 2D13A 2IPKB 1UT6A 2V9TA 2ZRGA 1SD5A 1PYWA 3A3OA 2VMEA 5DVOA 2KM1A 2WZAA 3HCAA 5FA4B 2ZREA 3ZLQC 3INYA 1Z0FA 3RWHB 3WVNA 1Q83A 5DV9A 4QEGA 3QEHA 4DEXA 2H26B 1F6WA 2NZ2A 4KROB 1T5IA 4FNGA 4QBKA 4FFMA 4TSFA 4MD5A 1FRNA 4MYRA 2WIAA 1ETB1 3BH6A 3OE7D 5F72S 2FUEA 4XP6L 2IBZY 4ZXBC 2VYCA 2XN0A 3BCUA 1DQRA 1PS9A 3DIFA 1LBHA 4JS0A 3QIBB 4UJ5A 4XP9H 1P0PA 1QHHB 5KC9A 5E08L 3VUAA 3E2IA 2Y2TA 1NLBH 4YAKA 3BVVA 1XSJA 3CUSA 3DGDA 5AQEA 4F7MB 3OEWA 2EBWA 2W11A 4Y67A 3Q1SL 3DROB 5LBUA 4FYKA 4NQQA 4ZCTA 2D3VA 3PUCA 3CC5B 1TTPB 3KBBA 4DJAA 2FGWH 5T7BA 1UA3A 1ND0B 1P6WA 3HAEB 1G1KA 4F5WA 4ZW7A 3KPQB 3K96A 1CZOA 5DNEA 3UKOA 1CBUA 1E4VA 2X38A 4JUTA 1DVUA 1UH2A 2AMJA 2IQAB 2NV2B 2H0PA 3ARED 1DBPA 3NH6A 5BN3B 3T0FA 1M8PA 4FQIL 3WNZA 1QFWL 1IC7L 5D7IF 1UBHS 3ER8A 3AACA 4F4JA 1NFRA 4EUEA 1LC3A 1N3LA 4P2RB 3O6LH 4B6ZA 2CBGA 2YEZA 2Z5VA 4JPKL 2QAGB 4XPIA 2C9BA 2WZCA 3ULKA 5HGHB 3P11L 5B3AA 2R6DA 3ESAA 2YD2A 3DHVA 4DIOA 4PLVA 4BO8A 2OI9C 4FHFA 3FUHA 4YDVA 3N41F 3IKLA 3S2YA 5DJ0B 2FSFA 4G8GB 4ZKDA 4K9EC 3VXOB 1WC7B 2DR0A 4L5IA 4N2KA 2VDRL 1XLTC 4XO3A 1AIPA 1DCEA 4BINA 3DV6B 4IVNA 1UB5B 3S1LA 3EXEA 4C8XA 2BAGA 4Y5XA 3HE7A 3UIYA 2ODWA 2AXEA 4CM4B 1DNPA 1OX6A 2DTDA 5DFWH 3ZHSA 4D8WA 2A9PA 3QI2A 4QRPB 1INQB 3S44A 3LNDA 1IMHC 3QIWC 4XPAL 1X7WB 1JF1B 4NQCE 5DIFA 5I6OA 2F54A 2DP4E 1S89A 3IVMA 5TH2B 2OHGA 1TQSA 1VP3A 2EP7A 2XTNA 4UTNA 1PS3A 1QU3A 5D7JD 2JGLA 5I7SA 3I3OA 4X5WA 1E64A 3MKGA 1WUIS 1ZMXA 1KO1A 1U8OB 1T36A 3R8FA 3FONA 2E82A 1K2DA 4NZYA 1X9RA 4KJXA 3MVSA 3D6JA 2C4UA 4R9HA 3RWIA 1JAEA 3KBHE 2AX4A 1BM3L 1KYQA 2MOVA 3DO3A 1CERA 3BSSA 5E8NA 1F14A 2ZTUA 2V2WB 4AUUA 4QRTB 1N6LA 3MT8A 1OARH 5FA6A 1SUSA 4QXGH 3GGOA 1OKEA 3TP4A 3SLKA 4MB2A 4ELDA 3VSEA 3FSWA 4X4MA 3IQWA 5KG9B 3NBXX 5EEXA 2BP0B 5DUML 3UEZA 4CODB 1SUDA 5KTEL 3CN0A 1M6EX 2F7OA 1L1EA 4E2WA 4DV6B 1RUQL 2B83A 1S7VB 2NU8A 3LFHA 4HJIA 1U2RA 3E9CA 3LD8B 3I6KA 3LX6A 1NLDL 4JYPA 4LFHG 3ICWA 1BG9A 1WYJA 1VPOH 4LBYA 2QW0X 3F6IA 3PGMA 1XRNA 4ZREA 1NPJA 4ES9A 2D62A 3IEMA 3ID6C 3IFOB 1AKUA 2ZW9A 4COKA 2OD9A 3DUSB 3HB7A 1KYFA 1NUHA 1B3JA 3ARFA 3C6LB 4XNXL 3BTVA 5E9AA 1Z5PA 1NWPA 3FI9A 1FNSH 2QGFA 4Y2RA 4DM7A 1E1CB 2GGSA