3V55A

Human malt1 (334-719) in its ligand free form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
383
structure length
368
Chain Sequence
QPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNKVTANIVFGYATCQAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 106
structure length 368
sequence length 383
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v55A02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v55A01
4FEAA 4NBNA 4NBKA 5IASA 2QLJA 1QDUA 3NS7A 4PRYA 3D6FA 2CNNA 4LSZA 4ZVUA 4ZVTA 3RJMA 3SIRA 5IBCA 2NN3C 4N6NA 1RWOA 3DEIA 3KJQA 1RWPA 1GFWA 2XZTA 1RWMA 1SHLA 4QUJA 1QX3A 4D3YA 2FQQA 3P45A 4PS0A 2C1EA 2Y1LA 4QUHA 1KMCA 3P4UA 2CNLA 4EJFA 3R6LA 4QU0A 2XZDA 5IAGA 2H4YA 5I9TA 3QNWA 1CP3A 1PAUA 2QLFA 1RHMA 1SC4A 2H65A 1NMQA 1I4OA 4QUBA 1RWWA 2WDPA 5IC6A 5IC4A 4IYRA 4AWAA 3NR2A 4JB8A 3E4CA 4D3ZA 3H11A 2Y0BA 1CVRA 4QTYA 4QUIA 1K86A 3H13A 3V4LA 2C2KA 2XYGA 4JJ8A 4QU5A 3SIPA 1SHJA 2H5JA 3OD5A 1M72A 1JXQA 2FP3A 4HQ0A 4PS1A 1RHQA 2J30A 2HBQA 2HBRA 3H11B 1RWXA 2HBYA 4QUGA 2XYHA 4QTXA 2J32A 2QL9A 4FGUA 1I3OA 4QUAA 3R5KA 5IAEA 1NW9B 3S8EA 2K7ZA 4JR2A 4JQYA 4N7JA 4ZVRA 3NKFA 2CJYA 2CNKA 2XYPA 3R6GA 2CJXA 4JJEA 2C2ZA 4EHNA 1PYOA 2J33A 3R7NA 5I9BA 3V55A 4PRZA 2J31A 4JJ7A 4QUEA 2CNOA 5LUAA 4I1RA 1IBCA 3V4OA 1RE1A 1I4EB 2H5IA 4QULA 4N6GA 3ITNA 4ZVPA 2H51A 4AW9A 4ZVQA 3R5JA 4ZVOA 4IEFB 1K88A 1RHJA 1RWKA 3IBCA 1GQFA 3V3KA 4N5DA 5LUBA 3V6MA 3H1PA 4EHDA 5IANA 3BIJA 4DCPA 4ZVSA 1RWVA 4EHHA 2HBZA 4DCJA 4EHFA 5IABA 3KJNA 4DCOA 5IBPA 5LU9A 3PD0A 4QU8A 2H4WA 3DEJA 5IBRA 3GJTA 2FUNB 3D6MA 3UO8B 2AR9A 3DEHA 4HVAA 5H0IA 4D3XA 3GJRA 4M9RA 4NOMA 1I51A 1NMEA 4NBLA 3EDRA 1F1JA 1RHKA 1RHRA 4QU9A 4HQRA 3DEKA 1RWNA 3R7SA 5JFTA 5LU8A 4I1PA 3GJQA 3IBFA 1QTNA 1SC1A 5IARA 1SC3A 1NMSA 2H54A 3S70A 5IAJA 2P2CA 3D6HA 1ICEA 4JQZA 4NOLA 5K20A 2QL7A 4N7MA 2QLBA 3KJFA 4N6OA 4NOKA 1RHUA 5IAKA 1BMQA 4EHAA 3GJSA 2CDRA 4AWBA 4FDLA 3H0EA 2C2OA 3PD1A 4EHLA 3PCXA 4FXOA 4NOJA 2QL5A 4QUDA 4JR0A 4JR1A 3V6LA 2H48A 3UOAB 2DKOA 1F9EA 3R7BA 2C2MA 3EDQA 4EHKA 3K7EA
chains in the Genus database with same CATH superfamily
4JUDX 4AZUA 2HAZA 1RP8A 3Q43A 3NHJA 3EF7A 4WV1A 2WOOA 1N0UA 2DRUA 1U28C 2NX5B 2ASVA 4D2IA 2HLFD 1N33B 1GGFA 1XZWA 3OMNB 3PGDB 2WSIA 3UK0A 4KZDL 2H2SD 2CHFA 1IDOA 3SYQA 2X5OA 1SM3L 3N42F 3JT2A 3BZBA 4E7OA 1OBOA 2RGGA 3BAWA 3H8JA 1XRLA 5FR3A 3KOMA 3MT0A 1QP4A 1TEYA 2FB9A 4RPCA 3KJ6H 2EP5A 1MB3A 2HREA 1MIHA 4TWBA 1EIBA 4P2AA 2WQSA 2XYRA 3CQFA 4LCEA 4FERA 1KTJA 4D7BA 4Q9RL 4YHYB 2NCEA 5DUML 3SE8L 1MFCH 2I7OA 2CMRH 1UQRA 1D6MA 3KKZA 3IKCB 3F3YA 3B48A 4QAJA 2D7OA 4DKAA 2A86A 2IT1A 1D0SA 4YXLH 4A2PA 2AXGB 1MH1A 4NEQA 3M81A 1N0LA 2IEGA 1F42A 3O6FB 4G67A 5CHEA 3VJRA 3CUPA 3IIJA 3GAAA 1MC8A 2H1HA 1QKIA 1H8OA 3FT2A 4K9SA 1D1SA 4N01A 2G08A 4MW6A 3OHPA 2CCWA 3E7DA 5BW8A 2PYED 3LD9A 2XWJI 1PQUA 5D9SB 5DUBB 1QH8A 2IL1A 2O2XA 1J48A 2QZQA 2WB7A 1I1YB 4K4KA 4DA4A 2HADA 5JROA 4D3SA 2W6JA 3EA0A 1TTFA 2JGDA 1NCHA 32C2B 3CNKA 1IGTA 5I0ZA 1SUDA 4PBSA 4NKIH 2VPTA 3EXJA 1GL7A 5T3XH 3PDGA 4JDPA 3GIVB 3EOBB 4JRLA 4DSYA 4EVIA 4U3SB 1W6WA 3FAZA 2F8LA 3CNQS 1W36D 4LZLA 1FQKA 2R8SH 2XX0A 5D7LE 3G0CA 1XFDA 4G5QA 1VYTA 3VACA 4W6YB 5KJ1A 1T5WB 1J0IA 1TT7A 2CJUH 4Q6IC 2BRUA 25C8H 3HNVL 2DKNA 2EX0A 2FLBT 4A7TA 3A6KA 5DEGA 1WDLA 2I55A 1JSLA 1JHMA 2G4VA 3LUCA 2Y7NA 5AAWC 3Q05A 4JM2C 3MBIA 3MRVA 1QQTA 2PPFA 3JQAA 3MK31 3WO0A 5MHSD 4G82A 3FWYA 5K4AA 1W0VA 5KBLA 2XG5A 4H6XA 2A0UA 2HSZA 2LPMA 2OBLA 3UAJC 15C8H 3MJ6A 1DIOB 5I8OH 2C77A 3DPBB 1Y9ZA 3NEJA 2BY2A 3WLFA 4AY2A 4PC3A 3CLFL 5DBIA 3HXMA 5GS1A 1I94B 1CBVH 1AHNA 4M1TA 2IPTL 3AJRA 4PGCB 4R5MA 2BR3A 5FLVA 1CULC 5BN1A 1I7RA 4S1WA 3BGVA 1X1EA 2HVBA 4I8IA 3RTGA 3QCVL 2GXUA 4PRIB 5IB3B 1KBGH 3FA2A 4F1ZA 3N42B 3WLBA 2CB9A 4P46B 1TFPA 2R1TB 3HBMA 1W88A 3MMNA 3C6MA 2NMSA 1EBUA 4EK9A 5FKAB 3HR5A 2BDNH 4WD3A 4MO9A 5I6LA 4D8YA 4Z4HA 1KEGH 2DFVA 5FW6A 3MNVB 1VYVA 2DPMA 3TEFA 1I7TA 3CJRA 2AOTB 3V1KA 4JANB 3E9DA 5J4YA 4Z77A 6FABL 5DMXA 4GI6A 2VOJA 2Z93A 3OETA 4FCWA 4OA8A 2R1WA 5L4NA 3NTUA 4UTXA 3LDAA 2ERJB 2A73B 1IQDB 4XAKD 4Q0MA 4TQIA 4X6EB 1CJBA 1KDOA 3K2UL 4XVJL 3H8WA 4OF6A 3D85D 4IUYA 4X6BA 4Y16A 1LSSA 1PS8A 2EQ5A 4W6QA 1ZEMA 3I85A 3UBHA 2WA1A 3OBAA 2XOKD 4N0UA 3HPLB 1G20B 1NBQA 2ARJB 1UOOA 3WL4A 4UAOC 4BDVB 3D2CA 2QN8A 2XB4A 1MREH 2GZSA 4NKOB 2AZAA 4UYQA 4LE1A 3O3BB 5DV9A 4IXNA 3ZKAA 3DEYX 4XEHA 4E88A 5FR2A 4YROA 2IXQB 5A16B 3SGEH 4MVCA 2YPLA 3M83A 1N7HA 1NGPH 1SXPA 2C9UA 4YAQA 2GJPA 4GFXA 2FQGA 1YA6A 4HQQH 4PR5B 2XRFA 4BZ1L 2MYPA 3TXAA 1E99A 1H15B 3T9FA 2W59A 4AWXA 2KHZA 4QPPA 3AYZB 1IY8A 3H4VA 3KTOA 3M88A 2VLKD 4BQOA 2B15A 4JG9A 4CHTA 3CEMA 4QRAA 3VMNA 1OXKB 5FYLH 5L8KB 2EIZB 4Y4HC 1G8AA 1LX6A 3QU4A 2RE8A 2EC8A 3QZUA 5C0EB 2V9CA 2OK0L 1PJ8A 1A7OL 1MVYA 4OD1H 2R66A 4D9RE 1PTJA 1Y9DA 4DNXA 2X6RA 4PJFE 1V6SA 3P0IA 2FUEA 2HNBA 3KPMA 1HSAA 1L7BA 2WWMD 2P80A 4B9IA 4YSPA 4MRMA 3CH1B 5GVSA 2QX6A 1GTJ1 5L3SA 2EFCB 1N36B 4LGCA 1TJNA 3HZHA 4M7LL 2BCGY 5CIYA 4UTOA 5DCWA 2V8BA 3C1AA 4FA8A 1MCDA 4N8VB 5I74C 4CF4A 3X17A 3TOPA 3W1WA 3AB0C 1LDNA 2QTBA 4LP8A 5F1YA 5A0TA 4DBVO 2W48A 2APWA 1GRCA 1J1UA 3KPRB 2O2SA 4X7DC 2IAMB 4ZJ9A 3IMBA 1KWGA 1X1CA 4BK5A 4M4RA 1ET5A 1XTPA 3C6LD 5AW4B 3MF4A 3MLWL 3K8MA 4AP5A 1G1KA 3IETA 4B6PA 5HI5D 1NDMB 5EUOE 1QD0A 5LDUA 1BQLH 2H00A 3TW6A 1DVZA 3TPFA 4K94L 3FO1A 1F4XL 3WFIA 2UX7A 3T8XB 3PICA 1FFHA 1Z3RA 2VTDA 2EHJA 3BHBB 3SDDD 2OV3A 2X5NA 5ADVA 3TLBA 4AZWA 4UI2A 4FNQA 4NLLA 1ACYL 1RWOA 3WL8A 5HDWA 3UPAA 1Z33A 2G9VA 3EXHB 5DI8B 4RD4A 3PGFH 3MFYA 4S10A 1CB0A 3H8NA 1G0DA 4LN1A 2NNAB 1SM3H 2WM8A 1G5RA 4HDIB 2GKGA 4DUZB 4EZMA 1Q16A 4GS7C 4FYIA 3IVKB 1UJ3C 1EDZA 5I9LA 3UENA 4KFTA 2A77H 1KP3A 3QEUA 1D5XA 1JAHA 4QDGA 1WK0A 1L0YA 3C1OA 1JHOA 4KQ6A 5D00A 2O52A 1QRTA 4UE3S 3EEIA 2C1OB 1VADA 4MA3A 3IMRA 3JZYA 3AVQA 2D7TH 2J09A 4XBGA 5SZJA 1RW4A 2IYZA 4WENB 3Q2CA 2OSBA 3RG2A 1WFJA 2I80A 1KI7A 3DMGA 3FETA 1H0DB 2NO6A 3ND7A 2RGWA 4G5AA 2AOUA 4HB0A 1L7XA 4D41A 1U65A 3R77A 3FSAA 3TO2A 4JP2A 5M5BA 1T13A 3HP1A 2BFCB 3SEPA 4AMWA 5FKPB 2BEVB 3SCMA 2ATXA 2FWAA 3SQOH 3KOYA 5G1NA 1EVJA 2FQ1A 4A2DA 1HHIA 2C9ZA 4PRLA 3O6LL 3GSOB 5D55A 4L50A 5FAAA 1HE8A 4Y2HA 3T2NH 3N5CA 3T0VA 1RZFH 3E9MA 1H9AA 1PIFA 2Y5TA 5IFKA 5IWCA 3WLEA 4AH2B 2AN9A 1ZXKA 1SJHA 4EO7A 1CX9B 3WE6A 1JBEA 3TDNA 2NVUB 5B7PA 3T1QA 3VNUA 4JPKH 4CM1A 2O23A 1OC4A 3HS9A 2R7AA 1URLA 3RB8A 1OYVA 4RTJA 4YK4C 1OIXA 5CLHA 3KSZO 4XJXA 2ORYA 4EFNA 1ZH8A 3K46A 4TTIA 2XUHA 1ZMRA 2HX8A 4K6FA 2H1WA 3QEQE 2IEAA 3GDOA 1JQLB 4GT1A 4R7VA 2Q7OE 5CLJA 2O8EA 4Y5YB 2YN2A 2C34A 2GIXA 5BVGB 1YDWA 4PJCF 4NZTL 2FE4A 5BV7B 2AF2A 4FMBB 5EMLA 5E1DA 1QHHB 3ZDXB 1M8FA 3AWEA 1K8YB 1NJ1A 2XTMA 4I4TB 2DPXA 1EAPB 1A9OA 1UJBA 4X0KB 4RQBA 3S2CA 2Z4RA 2H3EA 3GFQA 1DTWA 1UWXK 2WIIA 2XKNB 3TEUA 2GLUA 2FATH 5I0VA 5JS2A 4P58A 4ZMLA 3C70A 1IJ9A 2FIKB 1D3CA 1F38A 1L4UA 2CCVA 3ZO9A 3L3JB 1JXJA 1LDGA 4DN3H 3K5WA 3GUFA 1IC4H 3R8QA 5GONA 2EE9A 1Y5NA 3EY9A 4LZWA 3HS0A 4R1MA 2FQEA 3VH4A 4GX2A 4ERXA 2E7CA 3RJQB 3DX8B 2PKRA 4N2BA 2BVPB 1KYUA 3AP1A 1KJ3H 4XM0A 4NAQA 1N6UA 2OI9B 1SYVB 1U3VA 4MLIA 2NW2B 4PLOB 3VW3L 4ENVA 2OFQA 4PJIA 1M2OB 4N5IX 4LJRA 2PRJA 4FEYA 4R16A 3MD0A 5J1TB 1CE1H 4B85A 3M7OA 3KUXA 2A0XA 1E1YA 3WXMA 1EX9A 3WX0A 2WV9A 3I9JA 5MI0C 4DY6A 1VRCA 4P48A 1J39A 1AC0A 2WKOA 3KAKA 3O4JA 5DB4A 4K2HA 5CEEA 3TNFA 3URMA 4K7PL 3K0SA 2JLCA 4B3XA 2C9XA 5AW5B 2RJ3A 1SIOA 3ZLJA 3TIIA 4CRWB 3NP3A 3QIWC 3T2OA 5FDYA 2I33A 4RIIA 5FM8A 2QRLA 1P1ZB 2XTJA 3NHWA 2UXBB 3WJLC 5AFSA 3HW7A 4UQ2A 4UZEA 4ENPA 5HDQH 2ZUBA 3X2EA 2A0LC 4BWWA 5K3DA 1ZMYA 3D0LA 2VXUH 3MRTA 4GECA 4U3XA 1E30A 3ZV7A 4L9SA 5E1HB 3LKZA 2PDAA 5CDUA 1UK7A 4HAGA 2CL0X 2VDUE 4DP1X 5DJ2A 2BLFA 2GAJA 5IJAA 2DIJA 1E1QA 1V48A 1J5EB 2CNBA 5JIDA 2V33A 3SLRA 4M9QA 3UQYS 1MB9A 3K31A 4N6RA 3Q13A 1USKA 2K9UA 4LGRB 4JZYA 1FGNL 4EY4A 3KQPA 5FEUA 1XGUA 4MVWA 1LDMA 5E1AA 2IE8A 3WWCA 4G42A 4KRGA 4ATWA 2WQ6A 5L0QC 3HKBA 1JAZA 2Z56A 3TBCA 4QJ3A 1OWPA 3FTFA 5K0CA 5DMKB 3DZJA 3GJSA 4JPWL 4ZTBA 1KLUA 2CO2A 5KVEE 1ECGA 3TX2A 3L06A 5IKMA 3ARDA 4LY6A 4KO9A 1NF9A 2GHZA 2BNQE 3IBTA 4UTAA 1OARL 2VDQL 2FX8L 1DVRA 4HN4B 1X42A 3TLGB 2DR3A 2DDQH 1HHKB 3AESB 3V34A 4M0PA 1UD8A 1M34A 1UMKA 3R3XA 2EDYA 3U0TA 2VCHA 2PMWB 1MGOA 1V71A 1FPMA 3ROKA 2QSVA 3SC3A 1RS0A 3N74A 1KYOK 1YEWA 3JUZA 3COWA 5CT6A 3DS8A 2RIPA 2BCJQ 5DEZA 5JYDA 1HKLL 2I1LA 1M9NA 3AXTA 4GSQA 3I1JA 1P9RA 1YE8A 3N50A 4BZ2H 2EF0A 3TQTA 5GS2H 1P3Y1 4OGWA 1HSZA 1W0JA 1TU2A 2Q45A 4PJXF 4LEXH 4ZUSB 1H22A 4OIIH 1R4NB 3K70C 2P48B 4LBYA 4W4NA 2E9JA 4HEPA 5A2AA 1Z4OA 3KDPA 3MA9L 1T5IA 4ZMYA 1ULZA 5FL3A 3TFWA 3W9BA 1I1NA 2FWMX 2HPZA 3B2VL 4HQLA 4ZPJA 1D2HA 2ZCKL 3UJHA 5CCGE 4CEIB 2K5UA 2HYIC 4BZYA 1V7NH 4I18A 3WTXA 2H9AA 4UB0H 1ADFA 2ZKWA 5DQDL 5IT2L 2K87A 1FFGA 5JU6A 4CEHB 4JJFA 2I2DA 4WZBE 3QWRA 4RK0A 2ZPKL 4PLWA 4LRWA 5FIEA 1Y9EA 3FMOB 1IPHA 4MEJA 1D5BA 4M7KH 4PY7B 1Y3CE 3CMGA 1B8UA 2ZUWA 1H3UA 3FB4A 4XXDB 4G6ML 1BOYA 2PPEA 2ZOSA 4ID9A 1G43A 5HJEA 3SI7A 3OM9A 2TRYA 2P5SA 4C4XA 3SQBB 2PXYB 2N56A 4H17A 1IEQA 4K94C 5DNYB 3HUJE 4GBXA 4XGRA 1QBLL 3WU1A 1XTIA 2O0JA 4IXDA 4NAVA 3HWWA 3FPFA 5IESH 2N4IA 2BBTA 1UR5A 4G9FE 1M67A 4JLNA 3Q15C 4UBJA 5IFAL 3POHA 4P23A 3MPOA 5TE6L 4B81A 3F6RA 2OCKA 3BF8A 3FUXA 2DLEA 4L95C 3RX9A 3Q8EA 1K8DB 1SR8A 3CKKA 1W2WB 4UTRA 2PWYA 2VLJB 3UEQA 3PXAA 4L3CB 3DUFB 2PPCA 1A7RH 3U9TA 4QYSA 2B6NA 1UKZA 1O7VA 3VJ6A 2XA8L 2VG8A 2GM3A 1O96B 5ALLA 2GAOA 5AW3A 1Y6GA 5K0FA 1DKPA 1Z25A 5DJ6B 1FVEA 1DDOA 1R5OA 4KBPA 2O8DA 3ZXIA 1TITA 3HN7A 2FPPA 1PFGA 2QUJA 1YNTA 4L3FA 3MV01 3MLXH 5JO5A 3GLIE 1J8SA 1VZ2A 4NBTA 2EEBA 2VZ0A 1UIMA 5ICXB 1CUEA 2OGWA 4JR0A 4DKEH 3G6AB 3GRBA 3MRHB 2BHNA 3E35A 2Q2EB 3T38A 3PFQA 2FWLB 4FS3A 3ZRCC 4OSUL 4PRYA 3GLFE 3SQXA 1JYWA 4WU7B 4E30A 4X95A 4JL5A 2IFFH 1U4NA 3FYSA 1X1DA 5G4OA 1PZBA 2WF7A 1ONSA 4RAQA 3GSRA 3SZMA 4H8UA 3HPQA 3K0CA 1ZRNA 3AR6A 4X7EC 5ESAA 2ZTLA 4MW1A 3C3DA 3F1KA 3FOFC 43C9A 3SIKA 2QSJA 5CTJA 2CDAA 1MO4A 3IXQA 2IV9A 1INEH 3S34L 3U0PB 4L4VB 3VXTA 1RE0A 4G2AA 1E3FA 1RIIA 3FUDA 3O1JC 1TF4A 3QUYC 3AGWA 2V6BA 2QV7A 3DYOA 3ORSA 1IGYB 3OSVA 3MO1B 2BH0A 4TLSA 4TXNA 1Z9MA 3MRPB 3SYRA 2BFFB 1O97C 5I48A 2I4NA 4XVHA 1NCCL 5CG2A 4EJ0A 3Q5OA 5L4MA 1E9AA 2PUTA 3L4KA 3UBGA 4YQEA 2PWGA 4KITB 3NHZA 2KZWA 4CC1A 4EHFA 4MV8A 3ZDYB 1SBQA 2C4XA 2BSRB 5J1SC 5ALEA 3WN5C 1YVUA 1A77A 3UGEA 1GJUA 1LEIB 3T08A 3IQDB 1NEZB 1ZM9A 1NSYA 3UTCA 5D71H 5IUKC 3BTOA 3SE7A 2JGAA 2XV0A 1YU9A 2JXMB 4R7XA 4FK8A 5L4IA 5E1IA 5EKUA 4A0HA 3IDGB 4IDBA 4J94A 3DBOB 2Y1KA 4Z77B 1ULHA 3QXHA 2AK3A 4FX5A 3N85L 4DV6B 4JHZA 4K26A 3QXWA 4FCCA 3S4SB 2G9NA 3RVWD 1BX1A 3MNWA 5CDSA 3RZWA 4PFEA 1XCBA 5CVVA 3KUKA 3AVYA 3ZHXA 4X92A 3RS8A 2XA1A 2XV6B 2EIJB 4HFWA 3MQFA 3IE0A 2FPGA 5IFLA 1UWFA 1L3WA 4FZEH 4IJ3C 2A94A 4E41A 4B8WA 1XR9B 5F1NB 3UBXG 1ZLXA 4JE4B 2C2KA 1T1WA 1U58A 1SCAA 1OK0A 1LWNA 3RI5F 4KI5D 3MJFA 2C7PA 3DO7A 1YPZB 2QA5A 2EERA 1O7JA 3QVMA 2XTZA 2GY7B 2C0PA 5E7IA 3AR2A 2XDWA 3HDYA 1XPJA 3RM3A 3M5DA 4HGWB 4JO1L 2XB6A 2SBTA 4KXXA 1CDJA 4XPFH 4JOQA 1IVTA 3HYCA 1N3BA 2PE5A 3CDCA 4U7DA 2CV0A 4QGTA 1TL7C 5KOJA 1E2BA 5L53A 3MKGA 4KJQC 5ADUS 1IAII 3FKUS 4DNQA 3BEVA 3R74A 4NYMR 4AYFA 5HBBA 4Q7KA 2VYVD 3ZIDA 3CLWA 1PQZA 4LWQA 3FMVA 5L7XL 1FDLH 2O19A 4JFEE 1ZEAH 3Q2IA 4PJ7B 5F2OA 2WUCH 1GHFL 3ECWA 5DVPA 5HHNB 4NYJR 2EDMA 1DAGA 3KPLA 2GPWA 4F27A 4GZ5A 5G5DA 4LCYB 4DLZA 1GTRA 1PT6A 2IHUA 1WD7A 3MBEB 2XUKA 2OKMA 1S3SA 5JDIA 3FU0A 3NCCB 1HXYA 4R5TA 1G7HA 4RX4A 3D07A 4ANXA 3JD3A 3HC0B 3WFBL 4PZ9A 3HEAA 1IEAB 2IOFA 2WINI 4YVUA 3DUUA 4NO2B 2Z9CA 3L7MA 3HOGA 1F48A 1V7QA 1SJVA 4U1GC 1H6DA 1CYXA 1KB9K 2AV7B 4E94A 1MQAA 3PBKA 4L6CA 1QG6A 3LEVL 1DUYA 4A6YA 4HA1A 3K09A 5IJKC 4UIMB 5A5GA 4RH0A 4CKYA 4HU8A 3L4ZA 5TEVA 4JUSA 3UHFA 2VLJA 3AEUA 4ENWA 4CG2A 5ADHA 2C3WA 4V1DA 1XDBA 1X1QA 4K6HA 2GTIA 1A2YA 2RR3A 1YNKH 5HDBB 4QODA 3U40A 4V3CA 1N2CB 3A37A 3K2EA 1E79D 3EYUH 3BO8A 1SO8A 3PREA 1ZRSA 4CQMD 2C31A 3VXQA 4K9EL 2NZ9D 4AZ3A 4MXWH 1JF8A 3ELYA 5JANA 5GM2A 2IDMA 3QWBA 1G63A 4S1NA 3JWOC 1ZI9A 2FNBA 4DPCX 3RJTA 4BKLB 3CZMA 1TC2A 4KE8A 4L4RA 5I8OL 4KJPC 2ZBGA 4AIRA 2LV4A 1VADB 5HYQB 5FTJA 3LVTA 1OVGA 4D9RD 3X11A 3PIRA 5GGVH 4KX5A 1OROA 5ARCA 1I7UA 1WAAE 3SEQA 2PZJA 4HKTA 3OE1A 3GSRB 4BNYA 3ACBA 3Q6GL 1ETZA 2ATVA 1E94E 3C6LB 5IZCC 4QASA 3FR8A 3JWEA 3RDJA 1YI0A 4NO0A 2HMTA 3NJ8A 2WY2D 2A6JA 3ESBA 4NMXB 4BSWA 3WD5H 3MOQA 3JVDA 4L78A 3KYNB 1CWVA 1GU1A 3EJTA 1N0WA 2P9YA 3G8YA 1CZRA 4FTVD 4ICIA 3DJ9A 4AO6A 3KQOA 3D0OA 3ERXA 2PCPA 3ZCXA 1WE2A 5EJEA 4AYMC 5I17A 4BLRA 4LSVL 1S7TB 2MNWA 1E3DA 2AG5A 4MKIA 4WZAB 1PYWB 3BP5B 3GLGA 1WCIB 3WFHB 1L4YA 5AVUB 1QRUA 1S8OA 2R9HD 4DP7X 4XGNA 3B2UD 4OFWA 3DMMC 1PSKL 2J8UB 4HKXB 4R9HA 2QM0A 2FPUA 3GPBA 1NPJA 5M94B 4E5XB 2W81C 2HUHA 2Q8BH 1Z4IA 1KFAL 1YA8A 2AOVA 4N54A 2A6DA 4EXPX 4IJQA 3O8CA 8ATCA 4WTWA 4UTCA 5IMOB 5GS0C 1U5CA 1DCLA 2BFEA 4JCWA 4NWIA 5C0DB 3BMCA 5B3SB 1XF3A 4JZNA 5DQJB 4KK8D 5F3BA 4OKSA 1BMQA 5IZCA 2LCQA 2WIAA 3MOAH 2PTVA 4PONA 3FTGB 5HHQB 3G7TA 3LX6A 4LGPB 4JM0A 3DV2A 2AQTA 2YPVA 4PHCA 4HPYL 3RNQB 1NFKA 1XHEA 1Z37A 4B33A 3B1WA 3DZ8A 1UUSA 4I8XA 2HH0L 1G66A 1VHQA 2JGKA 1R74A 3TS1A 2FX7H 4LLYB 3IO5A 1XBTA 5DK3A 1N8OE 2C7RA 2Y3IA 3RYHB 2CKNA 1PLLA 2Y9MB 4YJFB 5KBDA 4AEEA 2RMNA 2W6OA 1L7MA 2PR7A 4LXTA 3G9QA 3CMCO 4Y89A 3PKZA 4RD0A 5EQJB 1PCXA 1GGTA 2C04A 4O2AA 1NBVL 4HUWB 4IOMA 4O4YH 2RJOA 4NONA 5EU3B 3FB6A 4RSVA 4J28A 4MV3A 2AV1B 3B13B 5JHHB 4GRLA 4NQCB 3REFA 1A97A 2QP3A 2VSXA 1AQDA 1PU0A 1QBLH 4OCLC 1IXSB 1M3IA 2V3EA 4EA8A 1GNRA 4RK5A 3FPEA 1EEZB 2Q6IA 2OS7A 1GNQA 1EV2E 1F0NA 5GGVL 5EE0A 1W48A 3PHOA 3Q88A 4MVJH 1KGIA 4G4GA 1CXZA 5CD5C 1M1XB 2L69A 5IBPA 2ODWA 2NY6B 4N3NA 4XVQA 1KEPA 1JGUH 4U1NB 4WW1A 2BGIA 1L8OA 4QRTA 5A16A 2WWKO 4O58H 4MUMA 5AXAA 4C2TA 5JTUA 2QNIA 2OO3A 1MCFA 4PJ7A 1QPPA 3O4OC 3SBOA 4M1CC 4CMMB 3SEFA 1RJYB 1QGYA 3O0RH 1S9VA 5IK2A 2NAPA 1T35A 4BNKA 2EW1A 1OCRB 4U7MA 2G63A 1RK0B 4NM8H 2YOFA 5H1YA 3P9PA 3H2YA 3RQ3A 3QQ9D 4X8CA 4CBZA 4RY0A 2FKNA 3DUWA 5J1AB 4KJXA 1XKQA 1TQSA 1KGDA 4MR8A 2OZ4A 3GJEA 4QDXA 4NBVA 4DFDA 3S48A 2PBFA 1CB4A 4XO5A 4GMSL 4QRQA 3KAAA 4TV8B 1FRFS 3QSGA 1BNCA 3T41A 1CF1A 2Y06H 4IDGA 1E5XA 5I7RA 1P2BA 3H16A 4GUCA 3KPMB 1JDVA 2JATA 2ILLA 3FDXA 3ZY2A 4AF6A 3MTJA 1CTMA 3O2NA 5JBNA 5DD0H 4AKPA 4ZMOA 4WJLA 1PGRB 2TMKA 3SFZA 3UBXB 2ADYA 3OFVA 5C35A 1WTCA 4RBNA 5E5LA 4IDFA 4KRXA 2VL5B 1C9KA 3RZCB 1BDBA 1Z62A 1U99A 5F33A 3FCEA 2Q0SA 2EGUA 1ML3A 5C0CB 4MS3A 3WSQH 2AJTA 1O75A 5KVDE 4F9PA 1E3WB 2IUTA 2XE4A 3V7AG 5HKAA 1ZD6A 2WXGA 1NPYA 4JLUA 4CR8A 3MRRB 3KPSE 1WIWA 3FBWA 4V0OA 4JM2A 2DLIA 2V45A 4ODHL 2A7XA 1KXTB 4EI5C 1M34B 3COVA 3FLMA 4PWJA 2R8RA 4K2AA 3GJRA 5D2LA 3QDMA 2ZSUA 4PM4A 2ZWMA 1BFKA 3TQRA 1Q1ZA 5HGJA 2DY2A 4H7KA 4L0ZA 5JHDB 5CX4A 1ZGLA 1EB9A 3SPGA 1RUQH 4DHWA 4PEEA 4PLKD 3DR5A 4CZ2A 5A4AA 4EGCB 1GADO 2ZZUT 2Y1YA 4BRVA 5L2JA 3LLCA 3VU9A 2JFOA 2VUUA 2KM1A 1FW8A 4OREX 4X1YB 4HYTA 4N65A 4CM9D 1B4LA 1OA1A 4MZDA 1UBLS 1C1XA 4JO1H 4EKDA 2TSAA 4MJLA 1PKQE 1GGYA 1MDBA 5PAZA 5JHBA 4L74A 4RMRA 4J03A 1C4WA 2DMBA 5CRIA 1CVRA 4GQPH 1DQNA 3THYB 4JJGA 1H65A 4JODA 3BAKA 2COKA 5AKIA 3ZHLA 5DYWA 3PFWO 2ES4A 3SIXA 5AW9A 1KJVA 4EI5A 1N5YH 5DJ8A 3LJ3A 2PL3A 3WNOA 3TH5A 2YPVL 1L5GB 1FPTH 3CB2A 3FNGA 3PG5A 4BASA 4DREA 3SGEI 3WTYA 1YFKA 1NNI1 5BW4A 2GD6A 3ECBA 1YQWA 2J8ZA 4LP5A 4KMSA 4XPTL 3U26A 1A2OA 5HZMA 3SO3B 2D00A 4LL1A 2FJPA 3IAM1 3ZU4A 3UAGA 3JQOB 1P6AB 1BDHA 1UC5B 3BQUC 2ZSBA 5LBTA 1GPDG 4IG4A 1OTXA 1BHQ1 4NZ8A 1R6BX 1GGBH 3AUYA 5LAXB 3O4HA 4DLNA 4DCCA 4F9TA 5IT0A 2ZRQA 5ITBH 1JPSL 3IQIX 4U1HB 1BJTA 4I9WE 3EJYD 2J46A 2I9PA 3ADDA 1T6BY 5F1PA 2YWCA 3WWZA 1DUZA 3UHOA 1WD8A 2WXHA 2ZKMX 3EOAA 4CU7A 1ZW1A 5LPNA 2CWWA 1A1SA 1W6UA 2WILA 1NCUA 3F3KA 5TPZA 1QP8A 3SGDH 3RFXA 2YOGA 3CNHA 2Q5EA 4V1CA 3WHLA 2FDXA 4QDUA 5GS1C 3H6HA 5TDNA 4JB3A 3ZHVA 5TE6H 4YGVB 4XMUA 1XU7A 2ITDA 4G5FA 3QHZH 1D1QA 5LZ7A 3OFND 3CF6R 3IMEA 3FXIC 4J49A 2RK3A 2C3YA 1FYHB 4XB2A 4PTLA 3VC3A 2VYND 3FT2B 5EO0A 2GK3A 4BLPA 3VVMA 1E2WA 1FDTA 1HE4A 3V7NA 2WIIB 3G7NA 2TMDA 2X4OB 2E48A 3TYFA 1YMUA 2CJXA 1NAML 2P75A 1WNFA 3D3VA 2OKGA 1S4QA 3E82A 4HRAA 5I8EB 1J56A 4H4EA 4PGBA 5EHFA 4Q6KA 3A1NA 1ZA6A 3FOCA 3VI3F 1YQVH 1WF3A 4KW7A 2HWZH 4XVSL 1KO7A 2JIBA 2JGDB 4BVEA 5IM7A 2Y67A 2O7SA 1I13A 1Q1JL 4UT9L 3ABRB 4HF5H 1AZNA 1JK9A 5M04A 2HD4A 2KI6A 1PHRA 5E9DB 1RHKA 3ML1A 1KXJA 5I47A 3ENWA 1NBIA 1RYEA 2W60A 2R68A 4TKMA 3QXTA 3L8ZA 2B1QA 2ZE0A 3QVXA 4NQSA 5D1XA 4ANVA 2X5KO 2WMNB 2MSCB 5D2LF 4D92A 1WGVA 5AD0B 1IIKA 1I3RB 3AB7A 4NMMA 2IEPA 3AHJA 1UZAA 3MD9A 5F0MB 1FFNB 3WWPA 2F2TA 1A6PA 1YOVA 2XWCA 1JDBB 4DZRA 1LVHA 2NY0D 5T1KD 1LSJA 2QBWA 2XN9B 3PNKA 5CA1F 4NYIR 3P3UA 2CD0A 2HMUA 2HWYA 4NMHA 3SSAA 5ITWA 5JEDA 5L95A 1QIIA 3USES 1EIZA 3FKSA 1E4OA 1SVMA 4DMKA 2O06A 3PFBA 4PIVA 4WCFB 1F41A 4K3EL 4QU5A 4IG9A 5A2FA 4B09A 3Q0TA 2JFUA 4OFVA 3JWDL 4RFSB 3A14A 1NEPA 4X2UA 4PAWA 1I24A 5LZ9A 2WVAA 3BIAX 3X1GA 1ISHA 1PVHA 4DQOH 4OP3A 4GF5A 1DEEB 4OD2B 2CLOB 3BMQA 4KX8A 4GI1A 2BNUA 2B4AA 3ND5A 5DX0A 3IE9A 1UBKS 4YXWA 4IL5A 1GPAA 2ETVA 1LO2L 2LGNA 1PTJC 1JJBA 5LUBA 4PMEA 4M7JH 3V6BR 3QXAA 1O6VA 1NQ5A 2VZOA 3BZWA 3VXMD 1JUFA 4K3HA 4MW9A 5IB4A 3BQUA 3O2QB 1UJ5A 2FW1A 3D7MA 1OE3A 1Z2AA 4IIGA 5TGDA 1VENA 2QYHA 1UKCA 1L3CA 4ZI2A 2CNWA 1M3SA 3EEYA 5BVHB 3IPRA 3WB9A 2WHPA 1O94A 1XRSB 2DQTH 4HIJA 4J8RA 3I9PA 4F92B 1F4PA 5ITBL 5JOEA 1HXMB 2LVBA 3D85B 2IG2L 5DA4A 2VH1A 4Y9GA 1SBCA 1U31A 3H4IA 2OYKA 1T20A 3ZBQA 4TTDC 2C57A 5GGSB 1WDWB 5I76B 1P7ZA 2F3UA 4JMLA 4DWVA 3HZRA 2EDJA 2HA0A 4ESEA 4AYID 1ZIYA 1LQTA 3B56A 4XRGA 4ZV9A 5I9TA 2QT1A 1WHSA 1VKXA 4UQBA 4RF2A 2Z08A 2NO1A 4DB2A 2EF1A 2ZJ7A 4B3GA 4MUAA 4BZ2L 3H7BB 1L4LA 1QGAA 5AJUA 4XWGH 4HWPA 4P5RA 4LJAA 2R6JA 1T3ZA 2V4MA 4G5ZH 1EHLL 4KH9A 2QRNA 1U2YA 2A74A 3ME0A 4OF0A 4ZVRA 2VEDA 3KL3A 5HF9A 3ZT5A 4RS3A 2ODPA 4IMJB 4FFVC 4ZS7H 3CGGA 4MS1A 3ESAA 2A9NL 1QMGA 2AJDA 3ZGNA 3FPYA 1MP0A 3F3SA 2I4OA 2WTRB 2X2PA 4O9HL 4UE6A 3K4QA 4ZSOE 4HMCA 4PY2A 4ER5A 5ICEA 3L7FA 4B5EA 3VOAA 2QMKA 1ZJJA 1K4DB 1EXMA 2HX7A 1C7ZA 1QZ3A 1RM5A 3IGAA 5C0GB 1Q11A 3BK7A 1OQOA 4OUDA 2GVDC 5BUSA 4E6PA 1Q9WB 1OLXB 1NOIA 1GFZA 2KB0A 3L07A 4NQDD 2D4FA 2Y1GA 3B60A 5TRTA 3O3DB 1LEKA 4J43A 2HU7A 3HJAA 4P93A 1Q9LB 4M48H 1Y9AA 3LQ2A 1FNCA 1RACA 4UD6A 3LC2O 5CUSL 4DQXA 3N1FC 2RAFA 4LRQA 2VJMB 3ZUPA 1DL7H 4U6VH 2H3HA 1R8YA 3DHVA 4LJ9A 3TVDA 3JASA 2Y0CA 2NUAA 2PFSA 2QZJA 1X7DA 4BRSA 1G8MA 3PQYA 2WKLA 1F14A 4A03A 4EPSA 3G8BA 2QN3A 3CZKA 3L2LA 4KN6A 3ZMRA 4BKPA 2MINB 3HUFA 2NTEA 3HHPA 1HL9A 4TSRA 4AZ3B 5DWUH 3C5SB 3SPHA 5EULV 5HDQL 1R16A 3MFFB 4TLTA 4JVMA 3FQUB 5T4HA 1A4KB 1G21A 1DUVG 1WDKA 4QOFA 5DHXB 5JTWA 2VYNA 1G9MH 2XVXA 1KULA 3CVCA 5BR4A 3V4UH 3BSHA 4GFTB 1P6UA 3QU9A 1VDGA 5B7FA 1O0SA 3EISA 4DCSA 1M5UA 3P9CA 2O2DA 5KJ7E 5KUKA 3GEDA 1XVVA 2XFXA 5IOPB 1SXHA 4HT1H 1W1WA 2WFZA 3AU8A 4E08A 1N6PA 4KQ4L 2N7AA 1T1EA 1HTYA 3QXXA 5T8KA 3O8BA 5CUQA 3NM4A 2OTWB 3AF5A 3VD3A 5J6GA 4BWGA 1PLBA 1OAKH 3HTXA 3Q6FA 5CT5A 4U9HS 3IE1A 3WN5B 3PUCA 2R8XA 3ZDEA 1JEQB 3O3AA 4QDOA 3S2IA 3TECE 3DJZA 2IOOA 2YXLA 4R3UC 4E3WA 5DMIL 4X71A 3K2IA 1D4AA 4BUJA 1OFTA 2O6EA 5FWYB 5TDOB 1SUFA 1EJ6A 2IA5A 1OI7A 2R15A 1QRDA 2AOUB 1YR7A 2Z31C 4FQXB 4C76A 5JBQA 3SBXA 4TROA 3A22A 4YPGA 3IAPA 4XB8A 3C39A 2NTFB 4R98A 2IF0A 2ZICA 2EDRA 3RVPA 3L2NA 4LA4A 1NUUA 3FYTA 5AW4A 4G56A 4JKIA 2D2EA 3ZPXA 3T65A 2R97A 4PU0A 1UANA 3M1YA 4OHWA 3H4FA 4CRPA 1NDMA 4M8SA 1W8OA 4Z3TA 3NFRA 2CJUL 3T4AA 1IEXA 3QVJA 4ZOLF 3L45A 1SKMA 1L7AA 3PGJA 1DJWA 1V3TA 5JS8A 3NUZA 3PE6A 5HI3D 4XVUC 5AM5A 3ASNB 4IM8A 3C3BA 3ZKXC 4EKIA 3RARA 2PNDA 5J2TA 5D4JA 5D86A 4EZKA 2BTOA 4AF8A 1U0EA 3O5AA 1YJ8A 2C9CA 4PJIE 5IW1B 1OH7A 1ZT7A 2AEIT 3G2HA 3L4WA 3EF1A 4K28A 5DIFA 3S36X 1W6LA 5JCJD 4R81A 2H2PD 2O6DA 5DWVA 4C0BA 1TR7A 4N9OB 4ZT1A 4O08A 5T7BA 4OFYD 5EOVA 1QANA 4WI5A 1JHDA 4MA7H 2CLHB 4QRUA 4KO5A 3DRQA 3ZZ1A 2UZ1B 3EGOA 4LGVA 2V2TA 2BGKA 3DKVA 4OMCA 5K8CA 4CKQA 1OHHA 5AM2A 3BP7A 4OMDA 5E08H 3FSGA 5F7EH 4RIEA 1QYCA 1UD3A 5J5AA 1YY8B 4PRPE 5AIBA 4IQGA 3OIUA 2IF7A 5F89B 4JBHA 3DETC 3GGWA 2CE6A 3TTUA 4UMGA 4G6JL 2RGAA 2X3BA 4B9ZA 1Z0JA 2D1SA 2G60L 2EICA 1V8PA 1AM4D 4ZZ3A 3S8GB 2D1FA 2L4OA 4AJOA 1NCIA 4AGPA 2GQHA 1E7YA 4IAOA 5I8CB 3PSAA 3E6HA 5C2BH 4QAMB 4FQIH 4NZJA 3HDHA 3UTPE 4YY3B 2ZXDA 5HHXH 1YK0A 4LSMA 3MUHL 1F5NA 2DF8A 1MEXL 3D2BA 4UTAL 2A6KA 3A2KA 3O9WA 4XQEA 2YXBA 3VKWA 3CINA 3AQ4A 3RL1B 4K9QA 1KFBB 4ZDJA 1KXZA 2J0UA 2J6WA 4R0VA 4UUPA 5A0VA 5EVJA 4CPDA 3A2LA 2DH6A 4QRQB 3BC1A 1UQTA 1T5SA 4BNXA 3O8DA 1B88A 3S7ZA 1EFXD 4DIDA 2VTVA 5NLLA 4XC3L 3NXKA 5CFPA 2JCCF 4INZA 3OSUA 3JVVA 4YMSA 4JDEB 2Y07L 2RGRA 4RAVA 1I9IH 1NMCB 4M62H 5DJYB 4QHUB 2J9ZB 1OFGA 4JREC 5C8DA 3NQIA 2IH5A 3OF3A 4H7PA 3HI1B 3E8UL 1CSEE 5DC4B 5DN6D 2IGFH 4M83A 5C8JA 3QO1A 3IPBA 3HSKA 5DYYA 5JOFB 2HMYB 5KQSA 1GGVA 3U4AA 1GGHA 4LPSA 3T6VA 1XAJA 1D7OA 5LP1A 2BMEA 1SC4A 2W2NA 1NI5A 3HB0A 3IH5A 2E82A 2CNZA 1GN8A 1KYTA 1YKGA 1A7OH 1KI3A 1I6LA 2E0IA 4NZRH 3R6TA 3BKCH 2YDYA 2J1YA 3C6LC 2WLMA 1TM3E 1OVZA 5C3MA 2EBUA 1RRPA 1CF2O 3BWBA 3PQ4A 1ZK3A 3JWGA 3ZX5A 1UXMA 4ELMA 4AQZA 4JPIB 4UJ5A 1OGAB 1OE2A 5CURA 3T3ME 1DBKL 2PQMA 1IUZA 4JL8A 1YNOA 1HE7A 1PZMA 2XQ0A 2WFLB 5IH7A 1GW0A 4YLCA 2OV1A 3WTVA 5CKGA 4F8JA 1R5WB 1G1OA 3EDEA 1ZCRA 2Z83A 4QARA 2WJZB 4ECNA 5L51A 2YYAA 4OCNC 3LKOB 5IHUH 5H35A 2YMTA 3F00A 5AVRA 5AQEA 3X3FL 1M1UA 2AQ1A 5DEFB 2VMCA 4CKEA 3IOMA 4OU5A 2AAAA 2QAIA 2HGSA 3ETEA 1RT9A 2X1VA 3VD4A 3P9SA 2X9WA 1T4CA 4Q21A 4UM7A 4HWZB 1A5TA 4HDRB 3UGQA 3EH2A 4PSKA 1PR4A 2PCXA 2OFPA 4OX9B 1D6EA 4DVBA 1S8FA 2P7TA 3MRJB 2LTQC 3NHFA 5DLYA 3G02A 3BHIA 4GP7A 1PZ3A 43CAB 4QICA 5CFAA 3HFMH 3CRNA 3IIEA 2WVGA 4Y9TA 9ABPA 3OI7A 3U4EA 4N47A 2AW3A 4U7JA 1AP2A 3HDTA 1T29A 3LZLA 1XDUA 3IP7A 4JM4L 1JG2A 3AM5A 2R8YA 4NCHA 4TYNA 5D6DC 1TUBB 4KZPA 4C56A 3QUMH 1LBTA 2H3KA 1IIRA 2ZI9A 4ISCA 4WESA 3A1CA 4CIAA 2QJRA 1WC7B 4B4WA 3GCXA 1MY7A 1I7TB 3N59A 3GNSA 3SHOA 2AK1L 1Y9JA 5F1OA 3VWJC 3BJRA 5BRPA 2I91A 1QNZL 1ULBA 3ZDXF 4K23L 3TGLA 1RWVA 3RILA 1GQSA 4MB0A 4OXRA 1TJHH 1J24A 3RHZA 4NFCA 3T61A 2F8SA 5ALCH 1CB7A 3GTVA 2QRJA 1OP9A 4HLDA 3KQTA 3EQ6A 3ANSA 1PNQA 3TBVA 4JLPA 4OKNA 3MLYL 1ZISA 2X5XA 4IRZH 1QFWH 4U00A 3CFJB 1MH5B 1P4BH 2NQ8A 2EKPA 4PXSA 1GVHA 4WMLA 3KPVA 4L9LB 8AT1A 1F9EA 3ZWAA 1RC0A 4OJKA 3UMGA 5CD1A 4WZZA 1NCAL 3ZIMA 5AYUL 1JG3A 4R41A 3SIRA 2CHNA 2A9BA 3KDPB 3LDHA 5TXGA 1JZ7A 2Q2OA 1CR9L 2ZBPA 3TN0B 5GGSY 1ZS9A 4JFFE 3F5SA 1WS7A 1IKFL 4CQMB 4BQCA 4CT4B 3VG0L 4V38A 2RKOA 2J7LA 3DDSA 1E4JA 4DP2X 1XX6A 3PC4A 1CY7A 3WSVA 4YSAA 2X8JB 2VKXA 3PABA 3HUJA 4F96A 3OIVA 1YDEA 4UMDA 2WK2A 3IFNL 3SVLA 1JFHA 4QX6A 3HUJF 3T0IA 4W1SA 3QRGL 5FYKE 3X1KA 5HE9A 1MY5A 2O5NA 1PW3A 1XZJA 4X94A 2X4NB 4ITVA 4N8VA 3HG7A 2IEYA 2VUYA 2PZLA 4I4TF 4PHGA 1RVFH 4C14A 5JO9A 4C6TB 4LLDB 4LCWA 4D9GA 3VFOB 2ONKA 4BJ6A 2XSZD 3EUFA 3IRVA 3RA7H 4OGZA 4U6TA 4ZUVB 5LU8A 2J88L 1ZL2A 4PAMA 4XVTL 5A3JA 5AQ1A 3MXOA 3W3ZB 3NN8B 3A05A 5KBNC 1GU0A 2FR4B 3GZTB 4MJIB 1SXJB 4PYQA 4XOEA 3MWKA 4PCUA 3E8SA 3Q98A 1UM4H 1T66C 4B5LA 1Y7PA 1PR5A 1ZM2A 1K8DA 3GH1A 4MYHA 3N1PC 1M9SA 2X9NA 4URXR 2X3UA 3VYUB 4IU2A 3IOBA 3RJ5A 2OO5A 4V3BA 3AR3A 5HYSB 2FPWA 2AJXH 4U3JA 5K05A 1OCOB 1UASA 1Z68A 2H2IA 5AI6A 5LQKA 4TRNA 2VF2A 3QHFL 3V6OA 1FP1D 2DQUH 3F7MA 3AMVA 4ZW3A 3K5HA 1E0DA 1OO2A 1OTSD 3DYMA 2ZWAA 4YDQA 1Y6RA 4UHBA 5GRYA 4TZTA 2GRUA 2YIDA 2NYZA 2FSGA 1XH3B 1PY0A 1J0JA 1PNDA 4FQIL 1WA1X 5F9MA 1TO4A 2P2SA 5IVPA 1FIGL 2CDFA 4IGIA 3W5SA 1HHHA 2OMEA 4CLOB 4P81A 4QOKA 4WK2B 3GAZA 3TQCA 3PFGA 3G5UA 1ZJ5A 1PW7A 1CRLA 2PX6A 5EOTB 4NE7A 3ZE6A 4NN5C 2AC7A 3ZE0F 2B5WA 4WWKA 2SKDA 4Y2OB 4KRFA 3A6CH 5KJFA 2HCTA 3W06A 2NY0B 1P5RA 1XF5B 1E3LA 1Y1SA 2WQZA 4Y5VA 3QPBA 1Q5PA 3HE3A 2VH5L 4FDTA 2NPLX 3GPLA 5LOVA 5JNYA 1W0YT 4WI6A 3BD6A 5DYNA 1BWPA 4HWZA 1HT1E 3DAPA 3Q12A 4HDRA 5TGZA 1DFHA 4URFA 1OU0A 3AVPA 4MI6A 5DKFA 2G30A 1WH0A 2GOYA 2P2LA 3FOAA 1A3CA 4LZOA 1NTRA 4N0EA 1G9NL 3FFWA 2EDQA 1TYDE 1PBTA 4CJ0A 1OI4A 3LW7A 3Q9NA 4X54A 2G71A 4PR3A 3BVDB 4NFSA 3RSGA 1YEGL 3UDWC 1O5IA 1O89A 3LOQA 1XNGA 3C5XA 2G5UA 1IRXA 2H65A 3ILEA 4XPZA 1LE9A 4QZVA 2C3GA 4IV0A 3NX4A 4AY4A 4Z54A 5SZKB 1U11A 3NJMA 1Y6FA 2WP3O 1U0TA 4HSGA 4C4TA 3RWDA 1KJVB 1FVCB 2Y1DA 4E11A 4NJMA 3ULUF 1UKBA 1DSFL 3O3DA 3CXRA 3MBED 4FD3A 2ZJ2A 4JELA 4NUQA 1XXLA 4L5BA 4URHA 3DNKA 4G9BA 1AD0B 1H1LA 4C03A 1RRFA 2Y76A 4Y0VA 3QIWA 5A05A 1YZZA 1KMGA 1ZHBA 1N19A 5TTRA 1UZ6E 1Q95A 3C60C 1XUOA 3DHJA 1II8A 2XWTB 4YAGA 3UG4A 4IZHA 4O2CB 5KNCA 4APQC 3O4LA 3RFZC 3LMJL 1YYML 2ZIAA 5EEXA 4OZGA 1JGTA 4PI0A 2A0KA 2MWCA 3JWJA 4X7TA 2X1OA 1QIFA 2EEPA 3L82B 1H8SA 4K6KA 3GXFA 4KI5F 1UPBA 1U8UA 3RUIA 3P9QA 3VH3A 1PWEA 5SWZB 4JI6B 1FFYA 1BD3A 1XAUA 2PU5A 1HT0A 4KHTH 1VL5A 5FGSA 2BN4A 5JS6A 1DBKH 1CGWA 4X1IA 3D7RA 1BMFD 2ADFA 3EMDA 3HVNA 1BXXA 2ZYWX 3OMWA 4OFBA 2ZS9A 3MCKB 4DTCA 2FPSA 1KJ8A 2B1RA 2VXOA 2CXNA 2VSFA 3SN6A 4JUBA 1U8OA 5EZOH 5E0KB 1PAZA 1TKWA 4NO0D 4ZT3A 4KK8C 3ATBA 2QUIA 2P1DA 3SIWA 3W7AA 4PE5B 3RTCA 4PCAA 4PP2B 2OTUB 4WACA 3LPCA 1FGVL 1IOWA 1MG3C 4I1YA 3I6YA 4I55A 4LKCA 4OLYL 2JGRA 4BKLA 4ZUWA 3QKSB 1AH1A 2FGJA 4EI2A 5HPMB 4JBXA 1NU8A 4MGIR 2EBFX 3MA7A 1HWYA 1PJWA 1V05A 2N42A 3AZOA 2IAMD 2YQ2A 3QVAA 2O0LA 5SICE 4HIEB 4OATA 2EKJA 1PLGH 3ZXAC 1D5CA 3MLVH 4G1CA 1KIPA 4I4WB 2XWEA 2FGZA 2FR8C 2W60B 5KYGA 4FR5A 3PR2B 1T0NA 5FWXA 4ETIA 4F91B 3KJIA 4I50A 1YN7B 4XPAL 4R1OA 1L6PA 2WHVA 2YY5A 5JPNA 3DROA 2W11A 5EIBC 1JYXA 2BY1A 4ETYA 3BAEL 5JXHA 3U39A 3TO4A 1R37A 1RJEA 4M7PA 4UC0A 1T6ZA 3VW3H 4M8NE 4G3YL 4FSXA 3GMLA 4IHJF 1VBKA 4P2RE 3WOHA 1SEPA 4YLYA 4IRXA 5DMYA 3K9QO 2QN6A 3IJSB 1A4XA 4PM1A 3K0CC 3OAAD 1TEXA 1BVLB 4M3JA 2OMTB 1YZKA 5E8NA 1NCCH 3PP8A 5KYWA 2OCJA 4EF4A 1A9EA 3LCUA 2GGSA 2FATL 1PT9A 3NOXA 2JRLA 4WF7A 4G5ZL 3I75B 2JHFA 2PUGA 3NFSH 1UP6A 2XECA 4DDKA 3FPXA 1X86B 1JU9A 1NOAA 1ZMTA 5DZLA 2CLCX 4QFBA 3E9UA 3FUFA 1AT1A 3TVMD 3DNPA 4DCVA 2X19A 2PMKA 5CB4B 4FLMA 4QXVA 1WXWA 2QYOA 4OV5A 2BSTB 3DMNA 5EOTA 5TS2A 3CT4A 3LSOA 1N5KA 2VDPB 2I76A 4E0RA 5FHQA 1X5LA 3OIWA 4IEFA 4MZ2A 1EGJA 1U0FA 2B98A 3P4MB 5IXYA 2C82A 3RWFA 2JQMA 1VHJA 3FCXA 4A6DA 2FEEI 4QQNA 4NQCD 4H59A 2J9YB 4XP4H 1S5PA 4RWEA 4KPUA 3QUKA 3I5UA 1D03A 4M00A 1U6AH 5JBIA 2EJWA 4YMGA 1HOXA 2WAQA 2PYFA 4A6YL 1M6WA 5H4HA 1H0KA 1NVTA 2H0FA 1Z0AA 1U2EA 4RHEA 3QUXB 5G3YA 4ZAXA 5SZIA 3SY6A 1AUXA 3RTAA 3IPLA 3SZRA 4MKFA 4EZEA 3IT2A 1NCBH 2JC3A 4ZCLA 4Y1RA 4RMGA 4QHMA 3HQ4O 2OMXB 1C7RA 1PRYA 3TR5A 2VCOA 4HEPG 2HI0A 1ZNZA 1RQGA 1Q0HA 1LPNA 2EZ9A 1YIOA 1UKEA 2JFYA 2R2EB 5F96L 4KY1L 3FB8B 4A2MA 4F2EA 1N7GA 2C9AA 1VDZA 4MGHA 4UAVA 3STTA 3RKDC 4I5BB 4W81A 5TPWL 1Q0ZA 3ZC3A 2XEDA 4RGND 3L6DA 4MGZR 5DYOB 2X9ZA 3UJBA 3LKNA 2BOLA 1Y1PA 3VG9C 1CQJB 4APXB 4LCWD 5C31A 1L3NA 4WOPA 4RF5A 2EOAA 1K4KA 4S04A 2VP6A 4BFOA 1QONA 4L3CA 3IKKA 3PEVA 1OHZA 5HD8D 5GADl 1AXEA 5D84A 1P31A 4HVCA 4U6HB 2ODIA 1Z5UA 3DBXA 1NWOA 3NCYP 4F9LC 4DZBB 5EOCJ 2XDAA 1FUEA 5MHTA 5B21A 1YEGH 1CJCA 5IBUB 4HPWA 3I9V6 4NDAA 2YK1H 1UFOA 3LBIA 3UH1A 5CILH 5F70A 3GO1H 1RFDH 5DHMC 4DSAA 1EXUA 4MVJP 4CM9A 1NXSA 1YNTB 1FYDA 1Z4KA 1OKKD 4RHUA 4JFFD 5EJAA 4CGYA 4ER7A 3KTAB 5TQ0A 2DYPD 1V16A 1A1MB 4PZYA 4CF6A 1J20A 3B3QA 1T4WA 3JQCA 4CDMA 2F74B 3JAWB 4CCYA 3JSAA 1QR2A 4HADA 1DFBL 4FOPA 5EYPA 4Q6WA 2BGJA 2K7PA 2PS1A 3OLEA 3OLCX 3CU7A 3HCEA 5F9JB 4MUJA 1O77A 4J0DA 5DWUL 1DJLA 4AUEA 2JJ2D 1TENA 1GU7A 3FMGA 3MFQA 2FE1A 4N5LA 3KALA 2RHCA 1ZCAA 1WBYA 2F1JA 3QEQB 5IVXB 4BIIA 4ISVB 1US8A 1QRSA 2ERYA 1HC7A 1GL9B 3ILQC 3OQ1A 3QQ9C 3K1ZA 3H3PH 4M1GL 4JPVL 5D5HA 3EW3B 4YDHB 3CLSC 4XNXH 5J7CC 2IZ0A 1KB5L 3COYA 4LDLB 3SG0A 5CYGA 1GQRA 1JXKA 3A3KA 4G80A 3MR9A 1O6SA 4P3OA 4WFGE 1VJRA 2LFEA 3DDGA 1H4VB 4R2LA 1EDDA 2VDLL 4QYIA 4UQ2B 4I13B 1ECZA 4IKLA 4FPXA 3P4LA 1WV7T 5KBYA 5F9DC 2D3WA 4HH8A 4ATTA 1G6RA 4UILH 2ICEC 2W92A 4J4PC 3HABA 4YP5A 2H1OA 1NUQA 3WAJA 3ER6A 4EUFA 1Z4QA 2C20A 4KPYA 4GEJA 3QQ4A 5KVDH 2AJZA 4ZEWA 1OAYL 2CV1A 4XMLL 2VN6A 4H2AA 4ZCQA 4YCLA 1I10A 4JG5A 5E8NB 4F3NA 4WI2A 1P2SA 2OBYA 1MREL 4IRZL 2V74B 3CNNA 3H7IA 5EE1A 4NPYA 3QORD 1V4VA 2FX5A 3INYA 3L0BA 1G6HA 2V03A 4GOKA 2HV9A 4L0CA 4QNPF 1CFMA 3SDAA 4YL4A 3QR2A 3QI9A 2X8AA 1SD2A 3DF7A 1NVVR 3AT9A 1M7GA 1T2XA 3KLAB 3HR5B 3WYCA 4QTXA 4KI0A 3HG3A 4RGNC 2DQKA 2GCIA 1JI2A 3EFHA 2PQ0A 4O02B 3P19A 3FLAA 2RACA 3PWPA 5AOVA 2FEEL 2JE8A 5CZVH 2AE2A 3GJ0A 3G8DA 1GZDA 4PWEA 2ERCA 2R85A 1X7YA 3SJCA 4QO1B 4NSNA 2WYZA 3VU0A 4RL4A 1A3RH 2YRPA 3A9CA 2QKSA 721PA 3U37A 4U2YA 3TN0A 1QLHA 4TLUA 1QAWA 4JIGA 5ENDA 3H7LA 3R5TA 1O0BA 1URZA 5KOJB 4NYLA 5AKKA 1V8FA 1CPUA 3WFBH 1ND5A 3RRYA 5B4MD 4HLZG 5KVSA 2YJ6A 5K99A 3Q1KA 1STOA 4XVRA 13PKA 1NGPL 4LDAA 4L8BB 4Q1DA 2DYKA 5EAIA 4F3CA 2D2IA 1MW1A 3O4RA 1OT2A 2P9FA 4P4TA 4B0MM 4Y7OC 4RESA 2XUDA 1AD9B 3U4GA 4C3OB 5KHLB 3AWDA 3AQYA 3J7TA 4AEHL 2WQRA 4G5HA 1UBEA 4LS3A 3FOMA 3ED1A 1YMQA 4DWOA 2UWEA 4S1OA 3G9TA 3DBRB 3VE0A 4H4DA 1JFSA 4PTUA 1QSFE 1YB4A 2PBLA 2QTFA 4ELMF 5B7NA 4OGFA 3QIUD 3IFLL 3CVHA 4TQHA 3RK1A 4D79A 4BFWA 3KQYA 3C98A 1P5HA 3DVAB 4CQLA 4M1OA 3NWEA 1BCSA 1L7NA 4N8SA 4RD2A 2IOYA 1HCVA 5TF1L 4BKSC 3KPNA 5D1XB 3C43A 1JVSA 2OV6A 5KOHB 3OMZA 1ACJA 3CN7A 3UROR 1UXIA 5E4EC 4FNPA 4ZN6A 1JZ2A 2H4EA 1EVZA 3TVMC 4FJ1A 2HLHA 2OJZH 1USQA 2AKRA 3K1YA 1JPGA 7ADHA 3UK6A 3SHQA 1P72A 3GRKA 3FUVA 2HFKA 2DBQA 4NKIL 1B3IA 4IV5A 6CHYA 3LY6A 2J6HA 4XVOA 1YFZA 4O4IB 1JWMA 1EUDA 3K3PA 3DTVA 1UMCA 2G72A 4U2CA 5FPPA 1DEXA 4DY4A 3VTKA 3L7YA 2QLNA 4EMBA 4H8VA 2ADGA 2QVZX 4P2CG 2R0WH 1XRNA 1C12A 4QU9A 1G7IB 2VXVH 4QTZA 3N6RA 5FUMA 1ETJA 3BDYL 1DT3A 5LDSA 3G5TA 4KUHA 4IIUA 2ZJAA 2CIIA 4NEGA 2QAGC 3GA0A 4G8GA 2M98A 3VYOA 3ZE9A 4H4NA 1ISSA 3S2FA 4W7IA 3IKTA 1AE1A 1F3LA 3RWIB 3CK0L 1YB7A 1N5AA 2VH5H 2JZCA 3L3GB 2NY4B 4HSAC 1VCMA 1BZ9B 5E8DH 4LEIA 2CNNA 2DWTA 4MRAA 3WLKX 2UZXA 3ZIYA 4B9EA 1TM4E 5SYMA 4M87A 4JKKA 4L05A 2H3NA 1LEGA 4H1WA 4II3A 5F93C 5FL7A 3LC0A 3IMTA 3P9YA 2LTQB 4ZCRA 1GTVA 1GP2A 5A5EA 3CO0S 1PY4A 3LVFO 4WZBA 2YPKB 1S5HA 1JF1B 2FH8A 5E8PA 3KPOB 2XU9A 2EWWA 5CZXD 1XBRA 1SMAA 1ODJA 1P74A 1SCBA 1OGAA 2WJ7A 4CIXA 2QPDB 4FQJL 3K0KA 1TDQA 4HSCX 4PJGA 3T6ZA 4C54A 5TE9A 4BLOA 2WWFA 2YY6A 2ISDA 1TTRA 4JG0L 3IBCA 1ONOA 4DPKA 2XT6A 3SY8A 3K72A 3WS6A 4GG6F 4YACA 4L3ED 4A6YH 3SYPA 3VQTA 3ECAA 3WJAA 1SXCA 3A67L 1C1DA 3T54A 2Q3BA 1WTAA 3DWEX 5FA3B 3OJFA 3E7FA 5FT9A 4X7RA 4FJ6A 1G84A 3HR4A 5I0YA 4BXOB 3I9GL 3U7WH 1RHRA 2AZ4A 3WQRA 1MFZA 1QTNA 2PR4L 4Y19B 2O72A 1OLUB 1JHTA 1Z28A 1USZA 5E99L 5ELMA 2IFFL 4UJ3A 3PTLA 3O6KL 2Z0UA 4OBRA 4Y5XB 3PWKA 2FQFA 3VXRB 1A9QA 1UPAA 3GPDG 4KTYA 3R7LA 3S28A 1KIRB 5HHQA 4RDBA 1WWBX 2ZUDA 5CD5D 1XT5A 3GDWA 4KMTH 5K9ZA 1SOUA 3N2IA 2PUWA 3W8DA 1V3VA 4NQVB 1UXLA 1MLCA 4IS6B 1MO5A 3AKEA 1SOSA 4JBIA 3RK4A 3L8EA 5IWAB 2R84A 2P1ZA 2UYLA 4CDGC 1F7UA 4L8SA 2BUCA 1J5OH 3TYXA 3EGSB 4AQYB 4PUBH 4GG6E 1FRQA 2CIKA 3D9AH 4FLSA 3OD5A 4DP0X 5D96C 1SGWA 2VUKA 4K3JL 1UURA 1W52X 3NOQA 2XA8H 1OAZL 1YGPA 3C4JA 1K6EA 1T04B 3USZA 3VNBA 1GPUA 2ZOLA 5EHIA 3C5VA 4NUMA 1H5NA 1V1MA 3LT4A 4QHTA 1Z9PA 4Q3EA 4UBDD 5LQRA 4WFHD 4GR4A 5EXEA 4H7IA 2DMRA 2JI7A 5K93A 4E5MA 4H77A 2WO2B 2BIOA 3WL7A 3UN1A 2RARA 1R5IB 4MMXA 3DEJA 1BD2D 4R4FH 4GIBA 4R96B 3EDRA 5DGQA 3MAJA 1MOEA 4LV8B 3CFJA 3PUUA 2NTYC 3T06B 5CJJA 1UIRA 5EC2B 4N0DA 4LXGA 1SBSL 2EXYC 2REXB 3KLQA 3VDCA 4ICWA 1A4UA 1QTIA 1DVXA 1AQHA 2RHBA 4ZT5A 3CH4B 5B7GA 1CLCA 4G8JA 3RODA 3MV7B 5JQ6L 4GRLD 2FSPA 4ZVTA 3MUJA 5T5NG 3HBGA 3ZR6A 5D1QC 3ZE0B 4YRAA 1CDGA 3V1NA 3CEJA 4YWGL 4FG4A 2BP8B 4TGLA 4U05A 1DEAA 4EG0A 4CW1A 3W8NA 1U8YA 3NR2A 4W5QA 3O3EA 2Y1XA 4LNRA 4AN4A 2PS3A 3MRNB 2FEKA 3EA5A 1MJ8H 2I65A 4UAJA 1SUWA 2O4UX 1VPVA 4PLKC 2P4EA 3D1MC 2B59A 1HZHH 2GYYA 4Z6KA 3ROFA 3OD1A 3JYQA 2R1UA 1B1CA 3WB1A 3L5HA 4WEUD 4Z1OA 4Y9RA 4BFFA 3CF4A 1HFUA 3LA8A 2XXMB 4FYQA 2JIZD 3HYLA 2MJWA 1MCHA 1UWEL 1C0IA 1HL3A 4DGIL 3U5ZB 4MD0B 3Q3HA 1GLNA 4YGXB 2QVCA 1QU2A 1C8LA 5D6NA 1G3QA 3ZJAA 1BWQA 3AWIA 1CRWG 5IQNA 4C6RA 3PYXA 1A6ZA 4LGSB 5KTKA 4PZAA 1E4WH 2P44B 5FNVB 1TUIA 4FJYA 1UVQA 4ODTL 3QIBA 3I9AA 3DD5A 2R56H 3LH5A 2NYUA 2G0KA 5A9RA 3NAAH 4EDWL 4JL6A 4YZWA 2NXZB 3D3NA 2F53E 5DMKA 1DQLL 3GRWA 1OCEA 2ILVA 3TV3L 3OT1B 4GSLA 1OI2A 2VK2A 5JDIC 1A2YB 1W0KA 3CEAA 5ISMA 3IAS6 4NQZA 4Q01A 5I4IA 3OXSB 4CGUB 4L8FA 4L8SC 1XQXA 1LVEA 1D9ZA 1ZK1A 4L4TD 2E4ZA 3JZFA 3UTTA 3NPSC 1NAKL 1S7RB 4ODXB 2PGJA 3LDFA 4HGOA 2DTDA 4UHJA 5KOIA 1JF6A 1K7XB 3OEED 4D8TA 2BISA 3SDZA 3MINB 1ISFA 3Q85A 5D4IA 2AYYA 2FKAA 2VDOL 3L4YA 3O3AB 3IVXA 1S7WB 4CN9A 2CVQA 1ASQA 2LU4A 1E7SA 1SIBE 1FP6A 1EFKA 2Z7YA 1TZCA 3RVVC 4P0QB 2IRWA 3WGHA 3PQ5A 3NASA 2QTTA 5EI5A 5B1EA 3RVVD 4WFKA 2PWAA 5E9WA 5G3ZA 3OB8A 2FW9A 1DRKA 1GCUA 2R5NA 4NDMB 1Q1GA 3GEHA 1SWWA 5B58C 2A9AA 3C75A 4OVVA 2FVNA 1WITA 1R17A 1Z7EA 1AJ7L 3BC9A 3UO1L 1ISIA 3Q48A 3UZQB 2P1YA 3MLTA 4J7CA 4JHWL 4QOIA 4GKVA 4E9SA 4INPA 1MFBL 3NCXA 3LVQE 5AICA 2YWFA 4LLQA 4A2HA 3REOA 4MD4A 4EITA 4H2DA 1PK7A 1GPOH 2LIVA 1E77A 3QBVA 5LWQA 2IDSA 4OXNA 4Z1MA 1U63A 2GJ6E 2H4FA 4UAOB 2BKUA 4W93A 1WXEA 3MWEA 1KBWA 3NSXA 3LRPA 2QYSA 3I6SA 3PNPA 1YPZF 4WNSA 2C1XA 7FABH 4INAA 4IZOA 5CDHA 4YCNA 1T8TA 3VFNA 3UPUA 2PBRA 3HVJA 2BTQB 5AHXA 3ZD7A 1FHNA 1JXGA 4YBHA 3RL1A 1USVA 1KJ3L 1T3GA 1KB3A 3TF5A 3DX3A 4POZC 3K05A 3CCHA 2A9DA 3D31A 2DICA 1AIPA 2P8PB 4ZW7A 4BMZA 2EG5A 2R9VA 3FSZA 2QSCH 3PXDA 4L73A 3BH9B 4O1MA 1MZPA 5EWLA 2MCAA 3JVUA 1L4EA 1K1EA 4JITA 3R3VA 3VFSB 1IM3A 3PSHA 4MDFA 3WMRA 4D9LL 5BO1L 1S5IH 3NALA 4C55A 4WV1C 3L08A 4U6YA 1J97A 2RGNA 3GMIA 2F1RA 1PNOA 2R48A 3RKSA 1T0MB 3D2TA 5D1ZC 5EUQB 4B0PA 4ZJYA 1Y6JA 3N0XA 1T7VA 3FT4A 3E2PA 3ZYZA 4Q3OA 1EYZA 2W38A 1V16B 1M7DB 2V7NB 1N59A 5BXQC 4PGBB 4XD7A 1LTKA 3TFKD 2F43A 2O50A 3ELWA 3FIUA 1VGEL 1OWWA 1KNXA 4J1QA 1UB6B 2H47C 3TCXA 1U7XA 1QZUA 5AVSB 4HY3A 1JH8A 4EAEA 1BYOA 1PVVA 3EDFA 3RUGF 1OLSA 3IP1A 3A28A 2JH9A 5C7ZA 1YEFH 3HA3A 4UU7A 5BORA 2QPUA 2QB5A 1W44A 4HVBA 4XKJA 4F1WA 5E08L 1B6TA 4CN6A 3JQAD 2VHEA 1NWPA 2A9OA 2V7XA 3SDCD 2BELA 4F33A 4EHKA 4U2GA 5DQ9B 4U5QA 4UHCA 3UAYA 3BWXA 2VCEA 3E9NA 821PA 5T1DH 4YVFA 4XBMA 1QO9A 3HZKB 1B16A 2OO5C 5T64A 3GXBA 3O6MH 3H5WA 2EAEA 5IR1B 1JWLA 5HQJA 4LFHG 5AENA 4MA1C 1BKYA 4FXGA 2NW3A 5LQAA 1NMAL 4FXKB 3JSSA 5EP3A 1UAAA 2PO6B 3LWNA 4G4JA 2GPSA 5DCYA 3EXHC 1IEWA 1P53A 4PP2A 3ROQA 3APCA 2A9ML 4FQQA 1DDHA 1B23P 3V52L 1DIBA 4CMMA 1E3IA 4RTRA 3DVRX 1VJ0A 3U3XA 2B9BA 5EBMB 3WDIA 2AVDA 3L7EA 4KOBA 3WFCL 3I9LA 3QLUC 3SM9A 3G5AA 3HRZA 1NFDE 1I4DD 3N2NA 5H16A 4HD5A 1M6UA 5T3ZL 4TYQA 1LD9B 1RDFA 4RTQA 1YCHA 3EDOA 2PKQP 3Q0IA 5G41A 1RLWA 2VC2L 3INUL 1PWZA 5A3QA 1FORH 2NYKA 4LFCB 2REQB 3ZQUA 4DQDA 4OJQA 1OJ7A 4CKCA 3HVDA 2Z43A 2AD1A 4J90A 4I2XE 1V5WA 4ACAA 3RU8H 2AR9A 3ZRFC 3L1OH 2UYQA 2UZIR 4KIUA 1V11B 4U6XB 3LDGA 1DT5A 35C8L 4NQDA 3OZBA 4FTWA 1OAKL 2O5YL 1X7QA 3ETBJ 1ZD3A 3C5ZD 4QHKI 1DDTA 2FZ4A 3UJTL 5F76A 1E7VA 3QYPA 3T8XA 3UWSA 1IPFA 1OSZA 2REBA 4BO4A 3RVKA 2CHUA 1ZJAA 2Q1SA 4U7FA 2BVEA 4UM8B 1H3XA 4BEIA 5C8ZA 2E56A 4PTTA 5AVVB 4HV8A 1Y34E 1CG9A 2YJQA 3L5XH 2OHVA 3DAOA 4D4HA 2I7VA 2ZF9A 4HUQB 5LQBL 3X1FA 1Y6MR 4LOFA 5I2IB 5E94B 1TZHA 1E1DA 1Z3IX 4RKRA 2FPGB 4X6DF 4LF4B 4NRYA 1G5QA 1KY2A 2Y77A 3BAXA 2YH2A 3RUCA 4MDIB 3BUDA 2R1YA 4YK4B 3TT3H 3QEBZ 2GZDA 5EEYA 4GWKA 3GJFK 1HKUA 4KRMB 1EO8L 1H2YA 4YUXA 3PLAE 4BQQA 4B7UA 3WADA 5F7XA 1BHJA 4LCCC 5LD2B 1DG9A 2NNWB 3GRYA 2CGEA 3WHXB 4G0XA 1YDHA 1GOTA 4MNHB 2UUDK 3RVBA 2Z9DA 4IEFB 4P4UA 4M1DH 4AQDA 5FF6B 3E53A 3BUPA 5D8JH 4ZREA 4O4JF 5FFFA 5LXTB 4DCTA 4ENQA 3QFFA 1NA8A 3UMBA 3OG6B 2WTRA 2I34A 1ZGZA 4II7A 5BZXA 3HR8A 3WGJA 1XR8B 4DIFA 1RXVA 3I3OA 2AXFB 4GX5A 1A02N 1KSRA 2E8YA 3PUWA 1HE8B 1HLPA 3GGGA 2YMXH 3FTSA 4IS3A 5CW2A 3BIKA 5GTDA 4NZFA 4OGXL 1YZTA 4PFKA 4G7VL 5FTLA 2L42A 5HDOA 1Y4ZA 4F46A 1YMVA 2XT1B 3WKBA 3QUXA 3OZ9H 5IULC 4ZDHA 1J18A 1FLVA 2BRRH 1MW0A 5DUPH 4J1TC 3ZCTA 1ACXA 1TQ6A 4WNQA 5FPHA 4F72A 4LYEA 2AZXA 5L4SA 3FCTA 1YMHB 3ENEA 3LQZB 1GRWA 1XR3A 4BPBA 2QQNL 3GVCA 3U1BA 3HC2A 4GINA 3VO0A 1BN7A 1JS1X 5FTMA 1JWMB 1EUDB 1PJBA 4N8DA 1NMQA 5CP7B 4U1KB 1K5WA 5MI0B 3ULVF 3ARGB 2GHRA 3OU2A 2NXCA 5DTFB 1ORWA 4OQXA 3PCYA 1N4XH 4RD6A 1MFEH 4AULA 3V5KB 1EMDA 4BTEA 4DLVA 2I2CA 5CA0A 2DIAA 5I1AA 4L72A 1RU9H 3R6GA 3LKNB 2NZWA 1W8DA 3L3DB 3LBHA 1ADWA 5B39G 1TU3A 3DH0A 1EUCA 2R44A 4ONFL 3ILSA 1LWHA 2D8KA 1Y18B 1LZKA 4R6WA 3CZCA 3ZD6A 3L5XL 4DZBA 4UT7L 2HFJA 4PJ9B 1M0WA 2RKWA 2DMCA 1N70A 1DP4A 3JYOA 2VW7A 3FJYA 2OMZA 4FOSA 1TJGH 1V25A 4ARCA 3D2UD 2RHOA 4PXYA 2AC4A 4WBSA 4H5SB 4NT6B 4ZI3A 4LZJA 4J0FA 3FC8A 1VEPA 3AVEA 4TQEH 1D2PA 4CMIB 5BUCA 3HCVA 3M1BA 4U4IA 1PWHA 3HBJA 5IUJC 2Y99A 2MHCA 5E5MB 1CE6A 1ZJBA 3F6SA 4AIIA 2O5YH 1THTA 4MTLA 1UB5A 4UANA 4H26B 4PJGB 2VZEA 2W00A 3D39B 4OYHA 3ZSTA 2REOA 1U9YA 4E36A 3SOBH 4Q3CA 2WTPA 2OC4A 4LLMB 1P4LB 1ZDMA 3QUBA 3N58A 3IDNB 3GEIA 4ZGGA 1T9ZA 4IJVA 3UMNA 3C6LA 3E7WA 2WB2A 1B2YA 4YAKA 3GRWH 4FZRA 2YMOA 1DLIA 1KF9B 1E40A 4HHGA 3TQFA 4N0UE 3O8QA 4HZAA 2C9QA 4UE2A 4ZTPH 5IQ7L 2AJ3B 3PEFA 4GI7A 1QUNA 3S0JA 4J0EA 2PH5A 5EHQA 3IFOB 3UC5A 4MCMA 5BOZG 2N1MA 3LBAA 1SZPA 3W39A 4OEHA 1NGQH 1IBFA 3AT1A 4C78A 1PYWA 2VQ4A 3BP5A 3GLGB 4PYMA 1G6RH 4PNZA 3WFHA 1EK6A 3TVYA 4CYMA 3KKEA 1PFVA 4G8CA 3CPEA 1BG1A 2ADFL 4R7NB 5EEZA 1MJGA 4ZD3L 3M2TA 3CNEA 3WGVA 5B30A 3TKAA 1ZLUH 4EGQA 5HQ3A 4FTVE 5KAPA 1HS6A 1JHLH 2WSLA 1AQNA 4S3MA 2P5EE 7ABPA 3QJVB 5JIKA 5JRJA 4ZMQA 1NOLA 4BQ8A 4MA5A 4LL9A 3M6MD 4EY5A 3NSFA 1QR6A 4TN9A 4NVRA 1FIUA 3FTZA 1ASPA 1RZVA 3A6BH 4GG1A 3NYKA 3T2NL 4LXXA 5LQDA 3O0RL 3H6KA 2V2WB 2EP7A 2QM3A 1NIEA 1R0ZA 3EGIA 2GRJA 5J57B 3CR3C 3JWNE 3UPCA 1HH6A 4QXRA 1DO6A 2A30A 2GPAA 1MFDH 5CPFA 1FE8L 4XX0A 1YR6A 1RI5A 4X6BB 4Y16B 2B7BA 2WXJA 2WN2A 1H8HD 2QW0X 1ZV9A 4E68A 2W94A 3V2HA 2HQOA 1OYOA 4PQFA 4F8NA 1Y5IA 5H59A 1NV8A 1JPFB 1UHVA 2B8OT 1JWSB 4RY9A 4LLUB 3RS7A 4JJ8A 5E4OA 4D6YA 1U1IA 3O26A 5EZQA 5GZOC 3D5EA 4MARA 1L4BA 4RMWA 3R5KA 4RVUA 1XXHB 3PX7A 3D85A 4DNPA 2QQ0A 1KA9H 4MWCA 2CY0A 5CGYD 2WIKA 4X6DB 1Y0BA 3UV7A 3QHZL 1BEXA 3UAOA 1FVHA 4XJTA 4YCJA 3Q5TA 1OHHD 2WBWB 3MWDB 4MQBA 4E5YA 1NY6A 2QY6A 4LO9A 3H2JA 3NJGA 1BWWA 4PO1A 5H82A 4EO5A 2Q2WA 2DPLA 1KVRA 1X7TA 5D7NA 1J4AA 3GROA 1S02A 4U1NA 4E51A 1GCIA 4ZEOA 4EA6A 5TEWA 3W9EB 3V8PA 4B9FA 1UJ3A 2CB0A 2R8OA 4LVOA 5CBKA 5EBWA 5E00A 3CHPA 3IERA 1YULA 3DX9B 3UOGA 2GR9A 2VP2A 1BVNT 3L5IA 1W85B 4P2QE 4URWR 4DVJA 3ZVNA 1ISJA 4CT5A 3QKSA 3GVPA 3JXAA 2XNKA 4GSRA 3G85A 3LQ4A 3LZQA 4RX4D 4JXJA 3G9XA 3ZHCA 4OA5A 4HK4A 1A5FL 3ARZA 4HXAL 4L4TE 3JWHA 1WG3A 3VRLF 5CP3H 4I85A 4X5XB 1QGUA 1ZUNA 1PF7E 3R40A 1XD2B 3KPRA 5ESVB 1WPGA 4BP3A 2VZVA 2J3MA 4FOOA 4I9UA 1HLFA 5L40A 4RXMA 1Y4DE 3QJFA 3N8GA 1UVQB 1Z5GA 4N8EA 4TXLA 5CYFA 4I88A 1UAYA 5ISZE 5GIOE 3P0FA 5ALYA 1H0SA 2C03A 2CHVA 1QI5A 4FS8A 3P3SA 5I1KH 5SWZA 3T5AA 4RD1A 4NX2A 4XX5A 3KBFA 1FJGB 5FI3A 3IKCA 5DMGC 1FX0A 1T1JA 2CMFA 4IGFA 3R06B 4KHTL 4F0JA 3IP8A 2WU4A 3UERA 1XPRA 3D6NB 4WEBH 3L79A 4X9BA 1CR2A 3SJBA 5HKOA 3PHLA 1C80A 1W16A 4ELKA 1W581 1OTSC 2OVFA 3VD2A 2K6ZA 4LQFH 4GR5A 1GR0A 3ZQ4A 2B2XH 1FSPA 1CQPA 2HTEA 1D0IA 3ARBD 3TSWA 2DLTA 2VHUA 4J75A 2JFGA 2X6AA 3RR2A 4JVPA 2YUWA 1CDHA 2X53A 3EBLA 2WQAA 1LP9F 4I6JA 1N5AB 1VF5C 3TBHA 1P3JA 2Q9BA 1UBFA 1OM3L 3I9IA 2IALA 2VAJA 2R69H 4IO0A 4P57A 3DFIA 2G28A 5KNBD 4HJRA 3F7VA 1TCUA 3MLYH 3P9MB 2G8LA 3RAFC 3CRRA 2X3YA 4YH1A 3P45A 1EBBA 4DGWC 2H4YA 1JFLA 1LK0A 4CV2A 4ZODA 4X6FA 4NWTL 1F13A 4HX5A 3RI3A 1DXOA 4GSUA 5DD6A 1HY3A 4Y2GA 4BWVA 4TTSA 4ZOLA 3UBXI 3WUWB 4YP1A 4WUUD 4GOLD 3DTDA 3IAGC 4JT9A 3MQ2A 3DTXB 2JCWA 4N2IA 1OZGA 1BAWA 2YXFA 3AG6A 4M6NL 2YWYA 3QTLA 3C87A 4W5OA 3D4CA 5FBVB 4EVQA 4IDHA 3I30X 4AW7A 4DW8A 2M2DA 4N26A 5GGQL 1FH2A 5KQLA 2W98A 4EQ6B 2K70A 1AGRA 2HPVA 4FFYH 3RTQD 1WWWX 5A2CA 4NHCH 3GMTA 3RWOA 3DPBA 3EUUA 1E7RA 2XXFA 1D6JA 4RIGA 4EYQA 2I6GA 3O0TA 2B4YA 5BSMA 1UA6H 4WFHE 1RHHA 1LJ8A 5FWQA 4KVAA 5T4FA 1C8BA 3IDGA 1UODA 4JI3B 3CSBA 3U7YL 1AKPA 5T1LD 2WAOA 5J47A 1I3UA 4EI6B 3BYYA 3PXXA 1C5BL 5DYOA 4PRIA 1OP3K 1XRMA 1XQ4A 1MJ7L 4AYBA 1IV8A 3P0RA 3KB8A 4APXA 3GLVA 1DOHA 5IJWA 3X3FH 4LNUB 3SLGA 3NFYA 1KYFA 3ONEA 2OP1A 5JZMA 3HCBA 1ZDQA 3PL1A 2IPLA 1W9HA 1BXRB 4F3FB 3SYTA 2JAHA 2ZUYA 5HGDB 5IV2B 2I69A 3TJZA 4E5KA 2MOKA 4BNWA 4YDJB 3PAZA 4J4PD 1NYLA 3QX9A 3ZLTA 3TG8A 2FGKA 2CO7B 3FSVA 4D0BA 3EAQA 3EUWA 1DQQA 5BRZE 2WXMA 4MRPA 4F4JA 3PTZA 2P6MA 3DYVA 3KZ1E 4H8WL 4TN1A 3VR2D 3WNBA 4JJOA 2BUBA 4BTLA 5JQGB 2ZG1A 4PJ5A 2JLVA 1J1OH 2CJWB 5JYMA 1EFTA 4L4TA 2WBLC 3HGMA 4EIUA 3HUJB 2BZDA 3LPPA 4P5KA 4WQMA 3M07A 3L9XA 3X2QB 1QLRB 3STVA 2XVLA 2IPUK 1FFRA 1TZ8A 1BCRA 3BUSA 4UV7L 5H8DA 2J3JA 2RAUA 3KXFE 1JKXA 2PZFA 3VXME 1ZN2A 3PPXA 3Q3EA 1RJDA 3GH3A 4HWOA 4F38A 1DCTA 3AKYA 2L18A 4H6WA 4N3TA 4NBZB 1Q1QA 3AVWA 1XNRB 3AH8A 3HM9A 2FIRT 1XQ1A 4EB0A 1YJAA 4PANA 4KMRA 5EC1B 3MMPA 2C97A 4HHAB 3FH7A 4FHCA 4D4KA 4UNQA 5LNK6 2E0PA 4TKWA 1R5BA 2P6OA 4YXWD 4MQFB 4GVLA 3MBEA 1SCNE 3HCDA 3L3OA 5EA0H 2AJ8A 3NS7A 2DFDA 4M03A