3V55A

Human malt1 (334-719) in its ligand free form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
383
structure length
368
Chain Sequence
QPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNKVTANIVFGYATCQAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 368
sequence length 383
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v55A02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v55A01
4QUHA 4I1RA 5JFTA 3R7BA 3R6GA 1RWPA 5IC6A 4DCOA 1QDUA 2XYPA 3K7EA 4QTYA 3D6MA 3P4UA 4D3ZA 2C2KA 3D6FA 4HVAA 4QTXA 4JR0A 3PD1A 2C2ZA 2WDPA 1M72A 4JJEA 4NOKA 3DEIA 4N6GA 1I4EB 1PYOA 3DEHA 1RWWA 3BIJA 5IANA 2CDRA 4QUAA 2H4WA 1PAUA 1SHLA 1RHQA 3GJRA 3QNWA 1RHKA 5IARA 5K20A 1RWXA 1SC4A 2J32A 3GJTA 4NOMA 4IEFB 3V6MA 1RHJA 4EHFA 2QL5A 3S8EA 4EHLA 1I3OA 1F1JA 2HBYA 3R7SA 2QLFA 2QLBA 4PRYA 1I51A 4NBNA 4PS1A 2C1EA 1K88A 3DEJA 3V4LA 2FP3A 2FQQA 4HQRA 3H11B 2H5JA 4FDLA 4NBLA 4JR2A 5H0IA 3E4CA 1QX3A 4AWBA 4LSZA 2HBQA 4D3YA 4JQYA 4ZVUA 5IBRA 4FGUA 4D3XA 4JB8A 2AR9A 1GFWA 4EJFA 3OD5A 1QTNA 4HQ0A 1RE1A 3H1PA 4QU9A 1RHMA 3V3KA 3V4OA 4EHHA 4I1PA 3V55A 2HBRA 4QULA 3IBCA 2CNLA 4QUBA 2CJXA 4N5DA 2CNKA 5IAJA 2HBZA 3PD0A 4FXOA 4N7JA 4JJ7A 1NMEA 2C2MA 5IASA 3H11A 2J31A 3D6HA 3KJQA 4EHDA 1RHUA 4M9RA 4QU0A 1GQFA 2H54A 3EDQA 4NOJA 4QUGA 5IAEA 2H5IA 2J30A 3ITNA 3NS7A 5I9BA 4AWAA 2QL7A 1RWKA 1CVRA 5LUBA 4QUDA 4EHAA 2CNNA 2FUNB 4JQZA 1CP3A 3P45A 5I9TA 4EHNA 5LU8A 4JJ8A 2C2OA 3S70A 2CNOA 2K7ZA 2XYGA 3H13A 3SIPA 5IBPA 2XZTA 3NR2A 1JXQA 4ZVOA 3V6LA 5LU9A 5IBCA 3KJNA 2H48A 1RWMA 4DCJA 3GJQA 4N7MA 4PRZA 1SC1A 1F9EA 2QL9A 5IC4A 1ICEA 3UOAB 1NMQA 2XYHA 2QLJA 4ZVRA 4JR1A 3PCXA 2XZDA 4QUIA 2CJYA 4NBKA 4ZVQA 4ZVTA 2NN3C 1NW9B 4IYRA 3IBFA 1NMSA 4ZVSA 3EDRA 3H0EA 2P2CA 1SC3A 4DCPA 4QUJA 5IABA 3R5JA 4NOLA 1K86A 1IBCA 1RWNA 1KMCA 3R5KA 4QU5A 4N6OA 5IAKA 3R7NA 4QUEA 2H51A 4AW9A 2Y1LA 4EHKA 3UO8B 3DEKA 4PS0A 3KJFA 3R6LA 4QU8A 2J33A 4ZVPA 3SIRA 3GJSA 1I4OA 2H65A 2DKOA 3NKFA 5LUAA 1RHRA 4N6NA 2H4YA 5IAGA 1RWOA 2Y0BA 1SHJA 1RWVA 3RJMA 1BMQA 4FEAA
chains in the Genus database with same CATH superfamily
4K9EL 5F89A 2PYEA 2FZGA 1KAOA 1T04A 4KQJA 1MV8A 3WJ2A 1LK3H 1ZE3H 3KTAB 2J43A 2GCYA 3CHPA 4TL4A 1ZGJA 3SHWA 2C7PA 4GKNA 2G06A 1DKPA 2PN1A 2XGGA 1GNRA 1NBCA 2YWRA 3AL2A 4C2AA 2CL7X 3CX6A 1EWRA 2LT9A 2QORA 3H8JA 1KARA 2IQ9H 2QS9A 1Y07A 5BVHB 2V6BA 4C29A 1KO8A 5CP7B 4NCJA 1CEYA 1MFCH 3DXAA 3KZCA 3WGLA 5CA1B 4RHCA 3HJHA 3RBZA 5HJGA 4B83A 3VWKA 3V7AE 1JFVA 2OBGA 4G9DB 1EZZA 4H4DA 4GC9A 4D6XA 1RJ9B 2QW8A 3SYPA 4W6XB 1O6GA 1WB5A 2Y1VA 1ZIPA 4PSCA 5D1ZD 2LAAA 1XFAA 1SBSH 3LKVA 1BQHA 5HUJA 4AKGA 3BVNB 4ZCLA 1CF9A 1C4OA 4N3CA 2ECQA 2FNBA 2A9BA 3T0EC 2MYNA 3CY6A 1QFUL 4Y6RA 4KQ3H 1GJUA 3ZKSD 1RWMA 5B3SB 3HG4A 1CUHA 2FE1A 1H3FA 1R3IH 1T1WB 3SGJA 4WT7A 1WIPA 2VMCA 5IGXH 1WDMA 5HQ3A 2XTJE 4Q6KA 3WRWA 5I4CA 3FD8A 2G3YA 4AGQA 3S0PA 3TNDA 1ZZEA 3LRSB 3UT5A 1EAYA 1IAKB 4LDEB 2NNAA 4MQEA 2C9MA 2J46A 3OM8A 5HFJA 1Z7GA 2NPIA 1MCPL 32C2B 4L1BA 2I7VA 3K8OE 1PR5A 1XSIA 3K09A 3GRAA 1QYRA 3E7WA 1QX1A 1DBBL 4K7FB 3M5DA 5BV7C 2PTVA 1ZD5A 4NXKA 4LYDA 3G9QA 2BK8A 5ICXA 3MEQA 5C0BE 3WFZA 1JNLH 6REQB 4YDJA 5A62A 1RXCA 4X4KA 4Y6SA 4PRIE 1MPTA 5JCOC 4WTXA 3WHXB 1WFNA 1WHOA 3AS2A 4Y1RB 3QEHB 4L05A 3EGDB 4HQ6A 5A06A 4GW4A 4XDZA 2XXJA 2PYFB 1VPDA 1DO2A 1HYEA 4BP9A 2O5YL 3CCHB 2LW7A 5TE6L 1IFHL 4Q0XH 3BUSA 1WE2A 3G5ZB 5E56A 3LD8C 1OZGA 5BS0A 1RUAH 3LBFA 4ANFA 4MHSA 4QRQB 4RDHA 3GA5A 4TWBA 1X1DA 5JLJA 3N70A 2DY1A 2PR7A 3KPYA 2IAMA 10MHA 1QRUA 2QI9F 2VMFA 4UCFA 3WLQA 3KQNA 2BMJA 3CLKA 4B96A 4KDWA 1V8DA 1L3BA 3ND6A 1X5LA 4QHKJ 4LAQH 4YQFA 3KZVA 1WAAE 5D1ZB 2BFAA 3MOQA 3WQRA 1ZNQO 3R0VA 3ONEA 4BAGA 2ZRQA 3FSAA 1CU1A 5I18L 1AKYA 4HNGA 2CHQA 2GBAA 2JH2A 2PBZA 5DU7A 4XMUA 4D7PA 2X0VA 3GRWH 3HUEA 3EOYG 1FPMA 2OS7A 3QXGA 5I9IA 5BW7C 4HKXB 3ASYA 3WIAA 1OYWA 1MCIA 2GH1A 4PCTA 2D3JA 1MB2A 2EFYA 2ZTUA 5L2JA 4JS0A 5T67A 1CE1H 4LLYA 3SDCA 1E28B 2H18A 2I7TA 3W1WA 1BEYH 1T1IA 4FP8H 2W0SA 4R4JA 4DR5B 1XEFA 4L07A 3EZ6A 2IDKA 2X0NA 1II0A 4A2LA 5T1LD 1ZGCA 3GARA 2TRYA 1JB9A 2CBQA 3WLTA 2IEBA 4FG4A 1A9TA 4PWGA 1VF5C 3ZE1F 4EPVA 2VWPA 4FDLA 3NQIA 4PLCA 4WOJA 1C0IA 4EY7A 4AVIA 2CFSA 3NBQA 1M1YB 4IIBA 3T3MB 3K9QO 35C8L 1EUUA 4JJ7A 1PFGA 1TUIA 4D74A 1U93B 1EP1B 2NOAA 2FW1A 3VMFA 3ZVRA 4ALMA 2ZWPA 3V7NA 2EH7L 3D4CA 2KWIA 4R8VA 4BKPA 1C2TA 2V0GA 3ZV5A 4IK6A 5HRCA 1M6UA 2W71A 4C9BA 5T3ZH 3PDCA 4N5ED 5GIRB 1EE2A 3QYFA 4TV8B 1G19A 1JF5A 1QHXA 2YFHA 2EC5A 2OJZL 4AROA 3HP1A 1ORWA 5DGHA 1ZANL 2JDIA 1TVEA 4JOBA 4P2OC 4PXSA 1P44A 3EGOA 4FFLA 3J81k 3AS1A 4HJRA 1MIMH 2R8YA 3WE7A 2B37A 5AD0A 1UCBL 5KOJA 4V0KA 4OX9B 2OO5C 3MIIA 4L7VA 3ZWXA 1XCTB 5ALIA 3HI1B 4GIOA 4GNKB 1JVSA 3PXLA 1R4NB 1N8OE 4MYCA 2NZYA 1GMIA 1A7NH 1O75A 2JZNA 2HYDA 5FO0A 3H1BA 2IW1A 2VTEA 2IIPA 3C8KA 2WTRB 3DX7B 1WRBA 1FB5A 5KHOC 4TLAA 2ZSEA 1LI5A 3INNA 2GM5A 4IL5A 3TIIA 4TUYF 3PWUA 4ABWA 3A5VA 3IMFA 1BEUB 3C1UA 4BNYA 2ZSWB 1HH4A 3RABA 5GZOD 4TXMA 5AW2A 5T1LB 2I8LA 3FGNA 3POCA 3HE6B 4MA8H 5IG7A 3KR3H 4R3SA 4F56A 1OROA 1ZLSL 4AYID 1XZQA 3L6UA 3ESCA 4OLUL 3LAFA 3FZQA 3AI2A 1R17A 4OI8A 2JQMA 5DFWH 3ZS8A 1XR8A 3RVPA 5IFHL 2KQMA 5G53C 4BLPA 3RY4A 4PMFA 3WUWG 5GVSA 4O4JB 3JV6A 4DERA 3RQSA 2ED6A 1YHNA 3INUH 3MREB 3AETA 5AVQB 2TRHA 2PR9A 3F58H 4Q1CA 2PX3A 1H5BC 3A1FA 4B9EA 1DC6A 3LY9A 1BMFD 1IIBA 1OGJA 4MGIR 1SLUA 2QRHA 5TEVA 2IV8A 4ZOQI 4HZLA 3T0BA 4XCXA 5DJCA 2C2ZA 1ORDA 4D4GA 4G2AA 1NQ5A 4JLUA 5BSMA 3WNKA 1Q0YH 1BJTA 1GT6A 2ZF8A 4NO0B 4YGYA 2RAMA 2E27H 2I07A 1CY4A 4MKMA 4D9QE 5EDXA 4U0QB 1N0WA 3FTFA 3VHQA 5C5DA 1N1EA 4DM4A 3CBKB 4X7FC 3MLTB 1I4WA 1NLUA 1M1NB 4QDTA 2Q1UA 2CO7A 3UMYA 2WIDA 3NTCH 3F6SA 4WZAA 1UAYA 4GSLA 5LGHL 1ZHNA 1Y1KE 3MNZB 2WZPA 4GRIA 4TSAL 4FEYA 3DOFA 3IVCA 4LHUD 3D7MA 5DRZA 3T71A 4D0BA 4FW8A 4HRVA 1YUKB 3N2LA 1TK9A 2PZAA 3L3BA 1HWWA 1TO4A 1R7RA 1ZOLA 4PR5B 2V4MA 2VQ4A 2B7BA 2KI5A 4NATA 1XSOA 4E68A 3WHIA 4JJ5B 4HSGA 5LGKA 4UIKL 4JY7A 5HJ7A 1C4KA 5F7KC 2AK1L 4QX6A 2PUWA 2AVFA 2HV9A 3N0VA 4S3MA 4I5BA 2Q4BA 3JQCA 4YRTA 3R0ZA 3UWKA 4MB1A 4D8PA 4YRRA 1ADCA 4GW3A 1DO6A 1EFHA 1E0DA 2PJRA 2PAFA 4D4HA 5FWQA 1F48A 2AG1A 4XPBL 4AYFA 1YEDA 3DJZA 4XIYA 4QRTA 1KB5A 4ZHQF 3QEGH 3HB1A 2FPGB 4G72B 3QNZB 5CVJA 5G0TA 3W1VA 1VFBA 3JYOA 4A3SA 5TK2A 1PZSA 4ESVA 4RFVA 5ALRA 2IWHA 4KRNA 3V4VB 3BVVA 1ESNA 1Y81A 4XPIB 4LFBB 3GZNB 3DLPX 3L1EA 2QR3A 3LZFL 1MREH 1EH9A 5CNHA 1KZ9A 4JP8A 5K01A 5CDHA 4NXSA 1IY1A 3NUKA 1NBYB 5IF0A 1Q9OA 5EWJB 1VCNA 4QYOB 1WV0A 1F8TL 1CZOA 3NCXA 1F2QA 4R3NA 1RLBA 1A9OA 5CPBA 1V16B 4OHRA 2R5WA 1A6AB 1TI7A 3R5XA 4AN0A 5FYLD 4IJ3B 2WE8A 1JJ7A 4KOEC 1U58A 3FUFA 4Z3HA 3EJYD 3IX7A 2PTTB 2WYZA 4JC8A 3TL6A 1BBDL 4HEPA 5M7QA 3OZ9H 4ZVNA 4MQTB 4LW8A 5FECA 5KSBF 2MCFA 3TVDA 4Z0HO 4P2CG 2FJHA 2VJMB 4MD5A 1ZA2A 1QTPA 5IJDC 1ZVJA 4TLMB 3RHZA 1UK6A 2KLHA 3GLRA 3DGGA 4ZYXA 4OZHE 1S7SB 3N6XA 2AABL 4ZOBA 2YYSA 1IEWA 2B3TA 2W2PA 1U8YA 3ZDXF 1IAMA 4Y19D 1ETHA 1L5YA 1CRWG 3VOAA 2QVXX 1TTCA 1WP9A 3IPCA 2OAP1 4WA7A 4LY6A 3TSCA 3FTVA 5DD6A 3FQNA 2DIJA 2YGOA 3UBXG 3DROA 4DRXB 3H5IA 3MV8A 4A6DA 1V1MA 1HFEL 2OO3A 3JQ7A 2ASEA 2DSTA 1ZSDA 4ON9A 5I6KA 4GU5A 2AQKA 4WW0A 1Z7BA 1F5WA 4L5JA 4IDEA 3QVMA 2O8NA 2P67A 2JB6A 3PD7A 1ZINA 2O8CA 3QX9A 4BNWA 5GS0D 2BY3A 1S9YB 4S2SB 4Y2DA 1IY2A 1H9AA 2NNWB 3JR3A 4Y0GA 1KACB 3DVFA 2OMNA 3EYSH 2QRGA 4TRRA 5AVYA 5C4IA 2DI9A 1M7DA 1MG5A 3IS0X 3MGKA 4TZTA 2ADYA 1E4KC 3L93A 3ORRA 4PYHA 3WLLA 3N42B 3EEBA 5AVZB 1S7GA 3NAMA 1TG8A 1N6RA 3EXIB 3QQDA 4LSQL 4HU2A 3MXVH 1USVA 3ETCA 4LRNH 1DAHA 1S7TB 2LU4A 1FNSA 3R4CA 4I7EA 4DSZA 2VXCA 5DGDA 3ZIMA 3CZCA 3LY8A 1WVIA 1FFAA 2J5LC 2O9JA 4KAFA 4OM7A 5I6NA 3J7AC 3BXEA 2ZT7A 1HC1A 4ONGL 3L7MA 1OWPA 2PUFA 4BNHA 1BM7A 2VNCA 4FFZL 2Q7DA 3IUMA 2BBOA 2VJYA 3PP3H 4PJHB 3GA7A 3I2CH 2ZUEA 3C4VA 5DDIP 1X1TA 1VCHA 2PCLA 1E6EA 4HLEA 5C2BH 1SH7A 1KZYA 4WKPA 1E4WH 2IG2L 1LX6A 4P3DB 3EXEA 1AV6A 5ILTL 1GA4A 4J0DA 5BWOA 1NL3A 2OGSA 3HR5B 4UOW0 2AQTA 3JWNC 3HMQA 4MS1A 2WYOA 4W8GA 1PLKA 2FZCA 5LKAA 3KPQB 2W9DL 2NW2B 4N2AA 5B1KA 5AXDA 3ZBTA 2YGQA 1U8AA 3DD1A 1V7MH 4FHJA 3E03A 1MWAL 5MDHA 2W9EL 2ST1A 3D3NA 3IEMA 2MWMA 3NFRA 3WGQA 2PJDA 1SXQA 5GZNA 4XNBA 2BMVA 4GUDA 2NDFA 4DHLA 5DUBA 1W1WA 2FTKE 1RBYA 3UV6A 4KDEA 4NYJR 1QBLL 4PQEA 3HJTA 5I1HH 1YVUA 2FOLA 4ZQHA 5DBHX 5KJFA 3GJFK 1O87A 3UTTE 5DLDA 3OPYI 5TR9A 5ALMA 2HU2A 2A0YA 4OIIH 4LP8A 1R9GA 5AVRA 4POUB 5GRJH 4GG6B 3ELDA 4NYLB 5CDTA 1SXBA 4TNVF 1QHOA 3CH4B 1B4DA 1GCUA 3W9BA 2J6EA 1DTSA 1VRCA 1YO4A 5MEPB 1SQFA 5CLJA 1C3XA 5AM3A 3AB0B 4X8LA 3OC5A 1LILA 3UEZA 1ST3A 1H8SA 2RBGA 5J1AB 2XQBH 3GI9H 4FMCF 2P5PA 3UQYS 1V47A 4AG4L 1DANT 1JPGA 3IUBA 4OXRA 5A3RA 4LOKA 1SXJD 3V0IA 1UJ5A 1YB5A 1CVLA 4Q39A 2MWCA 1WBXB 3G04B 5EC8A 1M2VA 2B34A 4YLQT 2PUJA 3L8DA 4BK5A 2QUZA 4DYDA 5DHXB 1TLLA 2IS2A 3LUFA 2O54A 1KXTB 1KK0A 3CZQA 4P4TA 4ZV4A 3CMOL 3DX9A 2GX6A 2Q8AL 3WZMA 1M71B 3RVRA 4DKFL 4KGXA 4P4GA 2W2LA 1G43A 3OQPA 4E1AA 1JHAA 2I3AA 5JNUA 3BD7A 2H26B 5DLMH 1IE5A 3ZYCA 1AHWC 1A1SA 5TE4H 3VDAA 4ZXFA 2N7SA 1WFOA 2UVPB 2VZOA 4L3CA 3TEJA 5HHQA 1CJYA 3NIGB 5EP1A 4QO1B 1XIWB 2NY4B 3KO8A 3TR6A 4ORZC 2C2YA 1IBRA 4R7TA 3TTXA 1DBPA 5ENWB 4JFQA 3BW9A 2A92A 1FK8A 3O93A 4K3GA 4KVNH 4ZICA 1KIUB 3P0GB 3H17A 2HMYB 1FZOA 1BM3H 2VDLH 1JMVA 4HZUB 1QRAA 3OQ6A 3AU0A 3H97A 2A99A 2H8PA 2YV5A 5GINE 5IK2D 5C53B 3VCLB 1CIJA 4MJLA 3TIXB 2PIAA 4RISL 1CFJA 3DUSB 1ATIA 4KO4S 2PR4H 4HIXL 3EBHA 1P19A 5JO5B 1JHKL 2QSQA 2JIXD 5F0JB 3O7MA 4D0RA 2A5DA 3G6DL 4X6CE 4QWWA 3LP8A 1SNRA 3E82A 1CQIB 4UV4H 3ROOB 1L6ZA 1UZAA 2PS1A 2WKLA 2V7QA 3SZ6A 2ZPTX 5L3QB 2VPXA 4ZMBA 4FKHA 3T65A 1DFIA 1X7XB 3LEYH 3Q9NA 5J4KA 3V5DA 1S7WB 4HNSA 5DGTA 5IV2A 2NU7A 2G71A 2J1XA 1JG6A 4CKBA 3IGAA 4UEKA 1BG1A 2W9LA 1JBQA 5D51S 4ODUB 4AEHL 5I1GH 1PUIA 2R7MA 2IZOA 4QAQA 1JFQH 1NBEA 3M6WA 1M2HA 4PTZA 4BCCA 3IRVA 2BSRA 2RJOA 3VHRA 4H59A 5J5EA 5BV0A 1PVVA 3P9SA 3R09A 5F3BB 1KC5L 1HYSC 5EHZA 5TF0A 3ELUA 5F7EH 2Q2OA 1EXVA 3EF7A 1V43A 2B2CA 2EQAA 5BVGA 3OLWA 1JGUH 4HIHB 1XXHB 3N0AA 5CBPB 3PQ4A 2VB5A 3QU7A 3ZJYA 2RG1A 4YDZA 2RB4A 4IOKA 4CM4A 2DY2A 4U8HA 4G43A 2BDTA 1KDYA 4HWBA 2FSDA 2WWXA 2NLJB 2RCSH 5IK3A 2AJVH 3IIIA 3IP7A 3WJ1A 1PG2A 5EOVA 1MFDL 1LWOA 1R5JA 3I8XA 5D6OA 4CN6A 1F8XA 4QBHA 3M6FA 3ZIUA 4HEQA 2WYTA 4YJKA 4R4FL 3KPRE 4A6YL 2W70A 5IESL 2WTBA 4JBHA 1DQJB 2FW8A 3CX4A 5I6DA 3V8RA 3QE0A 5DK0B 1T1YB 1DCTA 3FO2B 2KW5A 1XZEA 2BMKA 4G5XA 3PNSA 4ELKB 3AREA 1B6UA 3SYQA 1N5AA 1XG5A 4JZJB 1GGEA 1ZGHA 4PBWD 1CBVL 4ACAA 3SSGA 1BVZA 4F7MA 2DECA 1XEWX 1DLHA 3P97A 2X7LA 5EXDA 3N53A 1ESDA 4U9HS 3IGLA 2R2EB 3U17A 5I71C 2XXMB 1ZSYA 2FFAA 4BGEA 4FL4B 3FWNA 1A69A 1ND6A 3Q2IA 4AOFA 4YJFB 4GT1A 1XMEB 5KVFL 2IPTH 3MPOA 3FPKA 4MA7H 2R8EA 4BMZA 4CVWA 3C74A 4DEXA 1W75A 4DMCA 4FONA 4JEHA 3X1MA 4H7EA 3MVSA 3ESAA 5E70A 3QPBA 721PA 4PJ9C 4JE4B 2PUCA 3UMBA 4LJKA 4ZIRA 1A3LH 4H16A 2J5WA 1XBRA 4RH3A 3N41F 3AADB 5LIRA 3FWHA 2Q8NA 4IFBA 3LQ1A 4ZRMA 1PS3A 2K70A 1Y9JA 1NBZA 3HS8A 5DV9A 1N70A 2WQ8A 1FDWA 3ECBB 2I7XA 1LTQA 3ZRSA 3VO0A 1KH2A 1VPEA 2Y0PA 3WN5C 1RI1A 4JANB 3BHBB 2VZUA 4GSRA 3MRDB 3NZUA 1NBMD 3P69A 1YHYA 5JR1L 1FFEA 4M36A 4N5LA 3DDFA 3SOBH 2WFZA 3NYQA 1QO3B 4CG1A 2GEDA 2OULB 1EJ6A 4LRIC 5C0CA 1A5TA 1L5RA 2AWOA 1TA0A 1QAWA 5E2UH 2JAWA 1SUFA 2PEYA 3VZBA 2O5XL 4RZKA 2VXTL 3L0YA 2YSSB 1V7NL 3QXDB 2DHRA 4H7PA 2APWA 2O1SA 2D1FA 1T2DA 1F6AA 4Z3DA 2P1ZA 4QBFA 1G94A 1MZZA 5CGYC 3GBPA 4JVLA 4AZ3B 3AY2A 3SFZA 3MGCA 1CYEA 1U99A 3D0OA 2OAAA 3ILXA 3GO1H 5DWPA 4OUUB 5ITVA 5CLQA 4BWFB 3I9V1 1VHLA 1K75A 2W5UA 1Q6ZA 3E2MA 4EI9A 1JG7A 3U7AA 1N0UA 1N8NA 3OJCA 5ESQB 3HMWH 2VBGA 4BFRA 4RIHA 2QVYX 2F55A 1YDGA 2EIEA 4AJLA 2YKGA 2CKMA 3NJIA 1NBQA 4W93A 4C4RA 4LIPD 4RGMC 1H85A 2I6XA 2P5YA 4WTZG 1T3ZA 5AG8A 4PNZA 1ZSHA 1ICTA 1A22B 1RUKL 2QSUA 3VXQA 4C5CA 5HGBB 3T0XA 2B5WA 3PGVA 4PSUA 4NBXB 4EITA 2QQ5A 2JQAA 4OJYA 5FH9A 3AOEC 2VG8A 1S3RA 1X80B 5LHDA 5F2NA 4Z3IA 1JEDA 2ZAOA 4FI8A 1KZQA 2WKOF 1BDYA 1QRRA 3GMLA 4I3GA 3GPLA 3BSZA 3Q2WA 1UJMA 3KG5A 4KR0A 4Q9IA 1W8NA 1D9KA 4PLOB 4Z0XB 3CVVA 1M76A 3MRJB 3A4VA 1JT2A 2AR0A 3R6DA 2OMZB 4R26L 1PLGL 2GPSA 4OF3A 1R34A 5HDQL 5E8JA 3BCHA 3WHPA 5EUCA 1OXYA 1HHHB 4LF9B 1GAFH 1N0IA 4AT1A 1V8FA 3RSGA 2HZHA 1XGPA 5KOHA 2C61A 3H6AA 1KBKA 5FOSA 1DBRA 4UJ3A 4ACBA 3TFQA 5D4HA 4PH8A 4JYCA 5L6YL 5DF0A 4M7LT 2Z35A 1FP2A 3T5DA 2DM4A 4ESKA 1ZVSA 1CZ8L 5E9WA 2WB4A 4AKSA 4C6TA 3ZGOA 5ERWA 2H2HA 4U4BA 4HAWA 4FI6A 2AKAB 5CW1A 3WO4B 1FL5B 5LBVA 3ZKXB 4MQ6A 2HCJB 4KKXB 1N2SA 1FWXA 3SE6A 4JQOA 4CV0A 3D31A 2J3LA 5MFZA 2E49A 4KP7A 2UUDK 2VITB 4ZVPA 4FQQB 3ZDAA 1NMBL 4IHQA 4LVOB 2BC4B 2V5YA 9MHTA 5F9JB 2D31B 1MF7A 3BGVA 1KRHA 4JG1H 4K9QA 2IPLA 1KDZA 4X24A 1LF0A 1KCBA 4EYKA 4PJDE 2GDZA 3RYHA 3ZE2E 3VI3E 3KH4A 4PZPA 1IVLA 1HIML 4JHWH 3PNKA 4XW2A 5JS1A 3ER8A 4H1LH 3N7TA 3N39C 3KALA 2C2GA 4MINA 5IVXA 1KJVA 4BQPA 4C88A 5A6MA 1JEOA 1QPZA 3TM6A 4ETWA 4C0XA 3AQXA 2ZIGA 3OEEA 3WY4A 3ULVD 4Q3OA 2XXAB 1EEZB 1TKRA 1YR8A 3TVYA 3EZJB 3JV5A 5AUMA 3ROLA 2P27A 2CHVA 2FWMX 2QRZA 2Z3WA 3GB7B 3KFXA 4P2QA 4B5EA 1FSZA 5B5SA 2YMQA 4UHHA 3K6OA 1ETA1 4PRIB 4YX9A 4YQXH 4G8IB 1RIVH 1XHEA 5KVDH 1MDAA 5JYDA 2E9JA 2AEMA 3E8UH 2ICEB 4KAQL 3MNVA 2FYYA 3HDVA 3TFKC 3RGVD 4WZBB 1P2DA 2IA5A 1K8DA 4ZMLA 4NDMB 1RKUA 1NXSA 2TRSB 4B40A 1W1UA 1OGAD 4W9EC 1T8TA 5CA0F 3INYA 2J88H 5JSQA 4DV0B 1VJ1A 4IIJF 3KJFA 2CD0A 1MAVA 1I8IB 3CVHL 2Q3CA 2PWPA 2Z08A 1V45E 2FEEL 5GSVB 1G1KA 3CH8A 3AHIA 2VZVA 4LCUA 2I5YL 1QW9A 3RRJA 1W16A 5E1AA 3TQQA 1VZ3A 3ENVA 1CRQA 4ZTOH 4RBPH 1IOVA 2WBXA 3ZTYA 3FM9A 5EIOA 3H2YA 2NADA 5ICCA 1TQ2A 1K4MA 1NYRA 2XI4A 3W7BA 1NUFA 4AUUA 2GEQA 2HMSA 4NULA 1MOZA 2ISSD 3MOIA 3UTQB 5EP3A 1ZT4B 5FBVB 2MIIA 1RZVA 2Y7NA 3OHXB 3U3RA 2NYAA 1U30A 4FULA 1YOBA 3AF6A 5F0MB 3D3WA 1LRKA 1EXGA 2M1ZA 1JWSA 5E0QA 3KV1A 4BRZA 1C8LA 3AMVA 1GZHC 4JKOA 2E4AA 3GLEA 3RIYA 2HT6A 3UO1H 2J4WH 3UJTH 3HM9A 3TVMA 4NQEE 2QNIA 4IKIA 2B4KA 1ONNA 2FPIA 4QVGA 2ZB8A 5IT9A 2OHGA 3C6EA 1OOAA 3WIIH 1YVRA 4BNUA 4JPVL 3HDHA 2Z8WC 4IDDA 2JLWA 3SC2A 2ESVD 3LY5A 3ABIA 3FOAA 3Q8KA 4OD3H 4UM8B 3BAEH 3F7OA 4KMTH 2Z92A 4F5CA 1GPJA 3LUCA 1I7RA 3IC5A 1AIFB 2PQ2A 5KVEL 1T5BA 3RGVB 4NARA 4DP8X 3QA3A 4YJHB 1CUEA 5EJ8A 5JW3H 3QZOA 2MTAA 4HF5L 4P3KA 1FRZA 4ZQEA 1A6VL 1G21A 2W43A 1CEEA 3U0TB 2YEZB 1K3IA 1OZFA 3G6AB 4QI3A 1YZYA 1NHGA 4UHEA 1CX9B 1Y3HA 3DV6A 1QF6A 4WLFA 3IFNH 1MPXA 2JHGA 4MCAA 1LD9B 4MKRA 2BKLA 3AERA 3HDTA 2VDPB 4R51A 1TENA 3R76A 2YAOA 5HYJE 2ED7A 4IIQC 4IDQA 2QRJA 4AWBA 1RUQH 1I85A 4IM7A 5FUOH 3BZFB 3WC4A 5EH1A 4ZCTA 3FRHA 7MDHA 2VUTA 4K8RD 4EJ6A 1GGCH 3KSRA 1C7TA 2CMRL 1CRZA 3LSYA 3UAYA 2H0EA 1H8NA 1MAML 3PQ6A 3GRUA 4YL9A 2NQTA 3S40A 5FTKA 4Q9LA 3DL7A 4GPAA 1Z07A 4LIQE 4HX9A 3FBQA 1P4BL 2WCPA 1NFKA 3TIEB 2XACC 4NUGL 3E53A 4WRLA 3SXUA 2XFGB 2JGDA 4XWGA 1UMDB 3MG9A 2N75A 5ECJE 1TJIH 4YVUA 3ZKQD 4WO4D 1U8NB 1QNIA 4GVLA 2VHTA 5HIKA 3OOYA 3HMXL 3IDGA 4TLBA 4OXQA 3W05A 5AVVA 3T0EE 2F1OA 2NV2B 1KZ7B 4NAJA 5A2FA 1KLUB 4S04A 4B34A 4WO0A 3SCMD 3VSEA 1U2GA 2R25B 4CC4A 4A9AA 5JXEC 2NZ9D 2ZJ2A 4MZ3A 1MNAA 1OIXA 4PGJA 2YUTA 2NW3B 3UGTA 1SRDA 2VP2A 5JYCA 4WNAB 3PF2A 2KI6A 4GPZA 3WIOA 4MUJA 4OLWH 3RLIA 5E8DH 2ITDA 4H0CA 4JZNB 3RPEA 1SKMA 2N7AA 4L37A 4IFIA 3AIIA 4UV7H 4R0VA 1RUPH 4LKCA 3G0OA 1G8KA 4QRRA 2LTQB 4BVBA 1A3QA 3DJFA 5CXPA 1T9DA 2AEPL 1AH1A 1BKSB 1FRQA 3U39A 1NDGA 4KMOA 2NXYB 4YHZL 4G6FB 1EX7A 3BT2H 4NNPL 3L5XL 1HFJA 1LE9B 4PPYA 3UACA 7PAZA 3OMNB 2X9WA 5CDSA 2HSIA 1MDTA 5DO9A 3WX0A 1U2DA 5GGVH 2W07A 2VTVA 2Q0ZX 2R7EB 3OPYA 1JWAB 4NO3B 3O1IC 1B3BA 2H1PL 2C4WA 4G2NA 2X70A 2F54A 4XO4A 1P2TA 3Q41A 1GADO 4ALNA 3SDAC 5FKPA 3H2HA 2BGRA 3DC2A 1DIBA 4ZV7A 5IDVA 3RIGA 3QRGL 3MFFB 3IKJA 1NSNL 3Q85A 1ZIOA 4MKXA 1AQDA 4GKVA 1N7IA 2CUMA 3PFGA 4G8FB 2YXLA 3OQNA 4ROTA 3QWRA 1T20A 3FYDA 4IAOA 5H4GA 1SVSA 1P9MA 1VCOA 4BWYA 3VXPB 2UAGA 3CN4A 2P9QA 4PG2C 2WDPA 4JFUA 3AL3A 4R2MA 3P77A 4OF7A 3I9PA 2XWJB 4EECA 4G0UA 3SGDI 3S1LA 3AKYA 1NQOA 3Q1EA 3ETBF 5GIPE 3QH4A 2F9FA 3GMNB 2AV7A 3DVIA 4ELDA 4ZHQA 3O9WD 3TDNA 1K8IB 3ONNA 4NCIA 1JGEB 1TCUA 4B6RA 3FYCA 4CSSA 4NC2B 1KSGA 5T6MA 1OAYL 3TAUA 1Q1PA 3R0JA 3OC0A 3HYRA 1OAJA 3B36A 1RHUA 3KEDA 2MPVA 5CGQB 3K0CA 5ELIA 4ER5A 1HMPA 1MO5A 4C7VA 1NBVL 2WR8A 1ICIA 4QRDA 2C7QA 4DVJA 4UT9A 1NATA 4Z99A 1V9LA 4LASH 3OZLA 1ZOSA 4QXMA 2C3XA 4RWHA 3FCYA 4KUGA 2RCYA 2IU6A 1MVFA 1YJDC 2I69A 5E3IA 3BH8B 1OHHD 5D2NC 4X6BB 3OKEB 5F88A 5MFPA 5KSBA 4Y1TA 1UBKS 2XV6B 1TCBA 1H5NA 5K51A 2OV2A 1GOTA 1B42A 5EUKA 1CUUA 3ZCQA 1K6QL 1WO8A 4P5MA 1TE2A 5LLIC 4YNYA 4QRBA 3P4UA 4JN6B 5I0VA 3IF1B 4ITRC 1CK4A 4BQQA 5TS3A 2DMCA 1H9DA 5DZVA 1RTTA 4IRXA 5K9OA 2XG5B 2LU7A 3CRZA 1D7CA 2XRMA 3U0PA 1KY7A 2AMUA 1C80A 4DBLC 2CMFA 3A6CL 2F53A 4DNFA 2D8KA 3BZWA 1CE8B 3GSNA 1TZCA 4M54A 4L9LB 1DZ0A 5TQ0L 4FZEL 5AAWA 4NBLA 1TJHL 4Z3JA 3U9WA 3RBVA 4JJ4A 3LOPA 2WXIA 1JH8A 4N2FA 2XA8L 5E23A 2AQPA 4LLQA 2POQX 2G7ZA 3MJGX 5LA6A 2E7LC 4ACPA 1ONSA 1QP8A 2IT1A 4IGBB 3MK31 3ZDWA 2QOEA 2XB2A 1HL3A 2DGDA 1OGPA 1NEPA 4FXKA 3OCVA 3VYWA 3QYMA 3OX2A 4GQAA 3QHZL 2QD5A 2DPGA 1EVIA 5DNUA 3F3YA 5DYFA 3W5UA 2OBMA 4A5OA 2JLUA 1SXPA 4PCYA 5I9QB 4GBXD 5DUPH 4ENPA 3K8QA 2ERXA 1R0WA 2YOCA 4Z95L 1BG6A 2EBUA 4J3JA 3O8DA 4DESA 1OP3K 2K6WA 1H69A 4M7ZC 1V6CA 1OCWH 3MXWH 1LJ8A 4G5QA 1BVLB 2ORBH 3K2BA 4L8CB 3RJMA 4I3RH 1XA4A 4LLMA 5DZAA 5GGYA 5HJ5A 5HHMD 4OFPA 4TWAA 2L0XA 2H59A 3KSDO 1EO5A 1XNGA 1WT5A 2OW6A 3A4DA 1B0GB 5BQDA 3LUPA 3E9QA 5FGRA 1FGVL 5I9SA 1QGZA 1P0IA 5I1AA 5CB0A 4J2QA 5EZPA 4XIFA 3S2EA 3S3TA 4CKQA 4F6LA 1G5QA 4MCJA 3O9VA 1IQWH 3GJYA 2H6PB 1IEAA 3AR2A 3DOSB 4M4RB 2FHSA 4O5OA 2IYUA 3SKOA 3VW3H 3WL3A 5IS2A 1NCCH 3P9LB 5JVDB 4ZT5A 4ACTA 4LBWA 4G3YL 3LVQE 4WK2B 2X1HA 1EFRD 4PGBB 3L7OA 5KNBA 5I4KA 1H3VA 4YBLC 1A7AA 3PL6B 1YTUA 1OB1B 2P41A 1UFOA 1UOLA 5K6RA 3L01A 3S97C 2ZGVA 4BRJA 2CLLB 2HKHH 3KVYA 3MA7A 1CL7I 3EASA 1LHZA 4FN0A 2GN8A 1J07A 5D7LD 2IEYA 3JATB 1UXWA 1ISFA 4ZPXA 1YAIA 2YUVA 3L7EA 2GJ6A 5A9TA 4HXAL 1RZUA 4KRFA 2P4HX 4J8RB 2CSPA 3MXOA 2ZULA 4WY8A 1PO7A 4JFFA 1E9FA 2FPMA 2HG5A 2MCG1 2GI4A 3G85A 4IHKA 2OQJB 3GLUA 3NO4A 4HNAB 3Q3VA 3BAFA 3GMMB 3UEQA 1JG3A 5E5LA 3S2IA 4DUGA 4HWZB 1PZ2A 7TAAA 3PA8A 4PJBE 3ZTNH 3KQLA 1SG0A 2WBWB 3FUUA 3IAM1 3T08A 2BMWA 2QPDB 1KOGA 4GBXB 2EGHA 1A8PA 3FLMA 3CDYA 2REQA 3P8ZA 4BEJA 1VJGA 4WFGD 1JDJA 5F1NA 4I48B 4TM8A 1TJ5A 4WUKH 3A11A 2IBSA 2YWZA 1U8XX 4BRVA 4CKVX 2J0VA 5HHMB 1OASA 5F7AA 1USQA 4YYZA 2BDNH 3DMMA 3AVYA 2EXYD 3UXFA 2ZT9C 1H94A 1SEBB 2L3BA 2PL5A 4MDFA 1YU9A 1KGCD 1KT2A 4JT2A 5H68A 4YT4A 1XZHA 1RU9L 3W56A 1TZ8A 1AI1L 3IXTB 1WMEA 3ZU2A 3LZRA 1JG1A 3GGJA 4V33A 4XQEA 4NE2A 1G9MH 4N0MA 4IRUB 4PJ6A 2DBRA 1L7BA 5FLUA 4AV4A 5JH7A 1E5VA 3OGCA 5C7YA 4A7QA 3T4XA 1Y9AA 3GBEA 3QC5X 4DLWA 4A7GF 2VSMB 1GMEA 3AUVA 3L5WB 4I3FA 3E2HC 2YBDA 1AG6A 2VDQL 3AUSA 1JU3A 2ECFA 1A04A 4WOPA 3HADA 4KNUA 1KYIA 2OCKA 4E5KA 5LIPA 5AVTA 1BHJA 1HINH 2GS9A 1XZ0A 3BJMA 2Q41A 1VLQA 5D7LB 4D79A 5IOPA 4C4ZA 4FD2A 1JHLL 4YAGA 5MI0B 2Y0BA 4IGFA 4Z4FA 4TX1A 4ER0A 1EB8A 2WILA 4V0SA 3B6KA 5T5NG 3HJEA 2IEZA 1EJ2A 4Q7JB 4F1ZA 3CBGA 1UIRA 4DXDA 4PJCF 2YXMA 1QI3A 4EF6A 5J1SC 4WNSA 3RGGA 2GA8A 1MCRA 3EY9A 2Z56A 1YMMB 3EAQA 4JOSA 3F12B 1J97A 1KBBA 1L1RA 3K0BA 4RD2A 5F1OA 3BPLB 4K2UH 5F7NC 3VZCA 1YPZA 5EIHA 1NG9A 3KVDD 3OETA 2A0LC 3LN5B 3PUXA 1XR3A 3FB8B 4PB0H 5DCCA 1LO3H 2YLKA 1KEZA 3QUMH 3OZWA 1FZKA 1AHKA 4R3WA 3WIHA 3P9MA 3D6UA 4JN1H 1E9DA 2NU8B 5E2VH 4HUVB 4B09A 3GLIE 4DCCA 4DA9A 2ZJOA 2PTHA 3DJYA 1RULH 1V39A 4C0WA 4JFEE 3O03A 5MN4A 4Y4HC 4OAWA 2E3VA 1Q77A 1R0ZA 2Q5CA 4AYEC 2A7QA 5D6CA 3JT0A 7GPBA 3Q8AA 4GO8A 3HUJB 4FOOA 3HBPA 2XC8A 4S1DC 3H3PL 3V95A 1GXSB 2NTNA 2AAAA 5IAKA 1B2YA 2F3SA 4DRZA 2WFAA 2VHJA 1GJRA 3VBCA 1AY0A 1ODJA 3VFGL 1EJ0A 1BVKA 1JTOA 1TUEA 3AR7A 3UJ8A 2C2KA 3V9FA 3FWYA 5E4TA 1SUWA 5EBLA 5IN5A 4HAGA 1YZKA 3GT4A 4DV6B 2AX4A 2BGNA 2CA4A 1WMDA 4X6DA 4NQSB 4ZXBC 1ZEMA 4Y2OA 4PRAB 5A0FA 4M8QB 5L8JB 2B20A 4UQOA 4GP4B 2UY7A 4KXNA 2V7UA 2RR3A 2DM7A 5TSDA 1RURH 2GN6A 2H00A 5HS4A 4OM0L 3TN7A 2Q6VA 5AOVA 2B5VA 5ESVB 4ZGGA 2OTWB 2OG1A 1BMZA 2X2EA 3SF0A 4Z3EA 5JI2E 2D4AA 2BHRA 2VT2A 1W36C 2Y1GA 2R8SL 2OHOA 4PV8A 1J2UA 3CKLA 1D5BB 1DIAA 5JATA 1H6EA 4ZZ2A 4ENZA 1E94E 2NR6D 2BLNA 5IQLA 3RWFA 4DSTA 4N0UA 3AGVA 4X0KA 1WFUA 1BNCA 3JWNE 1MVLA 2O2JA 5J6SA 1KAEA 2F7SA 4LISA 1FL9A 2VLJD 4LOFA 5K3AA 3IFLH 3JQFC 1MFMA 3RS2A 3VKHA 2WV9A 3QDJD 5IEBA 4HDKA 4JA2A 4WY7H 4PINA 4JREC 1ECGA 1XZ8A 4PAOA 1VHQA 3H1GA 2ZUCA 5IABA 4ENED 5C0NC 1IBCA 2P91A 3WJLC 4I9WE 1WMFA 1KJ3H 4RXTA 2X1WL 1OC4A 1SYVA 4HEA1 4FADA 4N8CH 3A1SA 1WC7B 4YX2H 5F7JA 4NZTL 3VXUE 3VKWA 4GQPH 2QYTA 1GCFA 1OCOB 3DW3X 1JJIA 3QZWB 5D2CA 3EC1A 3WJJA 5FW7A 4D3ZA 2I65A 4YUVA 3RKDC 3POHA 3QYCA 3ECCA 1N9GA 2QPTA 2FJPA 2FYVA 2IMNA 3ARGA 3DDNA 3LNGA 3RGHA 2I1VB 1RAIA 2BSEA 5TPWH 4B60A 4CQNA 2Q6KA 4NM8L 5SWSA 3UK1A 1GLNA 2G2RA 4BDSA 5DEFB 2QKIB 1PZBA 3QNYB 2WIGA 4RTOA 1UPXA 1STOA 5AK6A 1GS6X 3WL9B 1Y1UA 1RLIA 1YC7A 3FUMA 1ECYA 1Z8FA 3RTQD 1OV6A 3GCXA 2OR3A 4GMXA 3ZWKA 5KANI 4XB6B 4BZ2H 1UH5A 1G7HA 3II1A 1CE6A 2HJLA 5CK4A 1RS0A 5IM7A 3PYXA 2R00C 1LXMA 3KYNB 3GEEA 3V9AA 2PVSA 3QDGB 4J3OC 2ADJB 1K7EB 2UZIL 1MVOA 1BVUA 3QHAA 4PSKA 4E0RB 2XQYK 2ZG3A 3CKYA 2E6QA 3ROFA 3EFDL 2O8VA 5IHXA 1Y7PA 2KLTA 2ZEJA 4LLUA 1P1KA 4NRXA 3GSOB 3D3EA 2JRCA 2CJYA 4C4AA 3HLAB 5KQLA 3VR4H 2P62A 4LHEA 2GN2A 2F1JA 5ER6A 3S4SB 5K0CA 2VLJB 2W7TA 4EF4A 1GPDG 4U1MB 1Z8HA 3BLKA 3G5TA 4NXNB 2AJ3B 5CIWA 1UM5H 3E9ZA 1F3JB 1NEUA 4MIEA 1JIQA 1ULBA 1AAJA 4I9FA 2EKSA 2OTUA 2BFVH 1BAPA 3MRRA 2GCEA 4L72A 4D9LL 5KSPA 3TLAA 2IJGX 2YKLL 4U1JA 4CM3A 5SWZD 2Z6AA 1RYNA 3FHOA 1U0LA 4QCIA 4BTLA 1U9ZA 2FGWL 2FMKA 3CC5B 4GP5B 4F57L 1HHIB 3GO4A 2JKLA 4NIMA 4IVPA 5CEZH 3P4NB 5CZVL 2BEWA 2UZXB 4WI0A 2KL6A 3FPHA 4LTDA 2WKOA 1EBFA 3PU6A 4PRHA 5BVPL 4C4XA 2FZ3B 4AYGA 3SYNA 4F2GA 3H11B 4AJKA 2WZBA 7PCYA 3IU3B 2Y7LA 1MG3C 1G8YA 3E80A 1NN3A 1IXRC 2V1UA 4OI4A 4OU3A 1O6BA 4XVCA 1HM5A 4PF1A 5JPMC 5JNVA 3RRXA 2YQ2A 3GHEH 4G5YA 1ZHBB 4N0PA 2P24B 2LR0A 2E21A 1K4DB 1IBGH 3QC6X 1M05B 4PCKA 5MEOA 1GQFA 5C8JB 2Y67A 2QADC 4F8EA 2JS7A 4N8DA 5IVDA 4J2XA 2C9RA 4Q56A 5EO1B 1SYSA 3CWZA 3ZCRA 1QH0A 4FQ7A 3ILQD 4LXHA 5FUQA 2AFRA 4MPJA 2JFWA 5IC4A 3EJWA 2ZSDA 3SQRA 3TV8A 1N5YL 3QJFB 5A6IA 2GFQA 2FDRA 5JQGB 1AHMA 2JBAA 2FZ4A 5CCHE 1EA7A 4L1DA 2PCPA 1ZPUA 2AQQA 1QQ5A 3AONB 2JD1A 1N8TA 1UWGH 4UOZA 4OFZA 1GJIA 1U42A 4ZO4A 1FLRH 2R29L 2RMNA 1BMTA 3NU1A 3H19A 1JR3A 1A5FL 3BKCH 1XTUA 4Z9BA 1EFAA 1OLUB 5I7HA 4X7TA 3TF7C 3DGEC 2FAUA 5G5DA 3GXTA 2QMHA 4OQPA 5JIMA 4JIGA 3ZIDA 1MQ9A 2VDVE 1N4XH 4XB2A 1IGMH 2CC2A 1R4XA 3HZHA 3PPEA 4NMHA 1N67A 1LK0A 2AFIE 1C9KA 3PDUA 1QBAA 4M1QA 3DKPA 2B1OA 3SE8L 4G80A 4HYEA 4X90A 4TKUA 2RK3A 2XKAA 3B60A 4R8LA 3L54A 2O23A 1QWUA 3S98A 3IKLA 1SY6L 1QTIA 3GRGA 3E8VA 3HDQA 1VL0A 5GJCA 3LCMA 2GAIA 1MLDA 3NP9A 3VFMA 3ZHVA 1FF9A 3LPNA 3QJGA 1N18A 3Q2OA 2O2YA 2HT1A 3PGCB 1FW8A 4X6FA 3CH6A 1D4OA 1U2TA 4FHBD 2XKUA 5SX5K 5BXFA 1FS5A 2VJOA 2UXGA 3D2UD 3IOMA 3F85A 4B0MB 3L0CA 4U3XA 5AXCA 3FTGB 2DD8L 3R5SA 1PJQA 3ZGZA 4OKDA 1MI5A 4LE8A 4YXHL 1UWXK 4L0QA 1F90L 4IBQA 5I7UA 5CWSA 4AICA 3HA2A 3HHRB 4BB5A 2VUYA 5EOCJ 4Y98A 2GN9A 5CA0A 5KSUB 3RVXD 1P4LB 2G7MC 2DIAA 4FEAA 3MT0A 3WB0A 4ZALA 1O08A 4NJ9H 4KYIB 2AR7A 4B31A 4Y67A 2AH5A 3KLBA 4L7QA 3O2VH 4HS8H 1YT5A 43CAA 4XP6L 3U3KA 1KJ2A 4NN7C 2MSNA 2HFEA 3K1AB 4X5PA 4G07A 3WEMA 1Z0JA 2Z04A 3FUTA 4BNTA 3NHWA 1TQ8A 4LC0A 1XLTA 4KQ6A 2GZAA 3GBMH 5ADOH 5GQSA 3ZHUA 2K5UA 4XFKA 1FDIA 1QYCA 1NV8A 4PSDA 5IUSA 3WV0A 1RCYA 3B7GA 3EBPA 3AXLA 3BMVA 1AUXA 1HAUA 1P4IL 1E90A 3GLGB 1LX7A 4AW4A 5WRFA 3WXMA 2BFEA 2AZAA 4IKKA 1VI6A 4JRLA 2ZQYA 3SE0A 5KB3A 5TDPB 4G0OA 3HB3C 2X0DA 5HYSG 2PUHA 3WNQA 3D33A 4AF6A 3GUTA 3FTDA 4MRNA 5BUPA 5I74B 1UXIA 1EGJA 4WW2A 4Q9CA 2NUAA 3SSAA 1R5IA 4MROA 3NP7A 4C0BA 3OAZH 2DQCL 1J90A 1SBYA 3UAWA 2QQNH 3O75A 4FMDB 3EIWA 1C9JA 1M8JA 1VG0B 2V45A 3FCTB 4FCVA 5LZ9A 5IEKA 4LXTA 4NQEB 2BVUA 1KIAA 1UADA 3D2UB 3ILVA 2CLFB 5KC8A 5C1PA 4IKPA 4DG5A 3BJIC 1BZOA 1IZZA 3KTOA 4P7JA 4ER3A 4J1NA 1NMCC 2IV9A 4HAZA 1PIGA 4QYIA 4AVHA 1DBSA 3S5UA 3ZYOA 2KHAA 1GFZA 4EG4A 1ED3A 4W70A 1KO5A 3Q06A 2VATA 1F2VA 2R7LA 3KVQA 3TC9A 3FT2A 4K71B 3V4PA 2VSKB 5SV3A 5JW5A 3PNYA 3ZE8A 1CY1A 5FWXB 3MLPA 1LTKA 3K8KA 3UZVB 4YUEL 1Z68A 4TVOA 2YY5A 3PRYA 1JU4A 2O2IA 1U3FA 4ZXPA 4BNJA 1P1ZB 3ZWQA 1M6VB 1SPXA 4G9FD 1JV5B 4NY1A 1NTDA 4LEOA 2JJTA 1DQML 4UBMA 3FN3A 2VUKA 3SMVA 4TSFD 4JL6A 4IU3A 1XJWA 1CU4L 3QG1A 5LP1A 1Y1DA 5IB2B 3V7MA 4IZOA 4IRZL 5HYJB 4JFRA 3NAQA 4EZKA 2WD9A 1PSZA 4FDUA 1R0AL 4YGXB 5I7VA 4ATWA 5BSHA 2ZXEA 3G5UA 4OJTA 5F73A 3WV4A 3DLHA 4KJPD 4M5ZH 3L49A 4OXKA 3C7AA 2D2EA 2BSDA 4XLLA 2PMDA 2BGGA 4XTRD 2AV1A 3TPZA 1KXQA 3ZWMA 1L9MA 5IVXF 2FPRA 4ZZIA 4M1TA 3RX5A 4F12A 2XLLA 1URPA 2IOFK 3F7VA 3PIQA 3B2VL 5K9KA 5AOJA 2UV3A 2VNKA 3CLWA 3I4CA 4LHZA 2W2OA 5KG9A 1TXKA 1WSBA 2XTSA 2HT2C 3H05A 2PF6A 3MLUL 2MSDB 3C08L 3TA3A 2VRCA 3F6JA 3U4GA 3L7AA 3RWGA 1RKBA 3RTAA 5HI4D 5FUBA 4WNYA 5IWCA 2ZJYA 4ETMA 3BUDA 2WYUA 4M1CD 5BOSA 3QKWA 1MN4A 2HO4A 4ALAL 1UJ3A 3QEOA 3GUVA 1NAMB 4FUTA 2FE4A 3ZZLA 5JNYB 3IXAB 2X23A 4K9PA 4MICA 2TAAA 4IOFC 1V8ZA 3BFKA 3V6OC 4FLRA 5FXCH 4N7JA 2K2QB 3DMPA 4OQEA 1JEQB 4M1DH 3HZ3A 1TEXA 5JS6A 3MM4A 2DBYA 5A3IC 4DFIA 3IMUA 4IHJB 5JPNC 1EFQA 1S5IH 1TTTA 2IK8A 1R5OA 3GPSA 4G9FB 2YFKA 4KX3A 3D3QA 2FQWA 3F01A 2D59A 4HC1A 1XFPA 4XZUA 1TETL 3SKMB 4ZYKA 2BM3A 5K4AA 3FONB 1GGFA 3GG9A 4XH2B 1MG0A 4TUJB 4A10A 4UPEA 1TZIA 3LZ6A 1G6RB 2QGZA 3NCYS 2EILB 4M1EA 5HGDA 2OZLA 1HNXB 2VPYA 3W81A 1AS0A 1S1CA 3A0UA 3EXHA 4OHZA 3HE6D 1IY8A 2NDGA 4WSOA 1FYTE 1VADA 1KLGB 2OA0A 3EPPA 4BFWA 1R9NA 2I33A 5DQJB 4LEXH 3OTIA 3O4OB 3CFUA 3R9IA 2SEBA 4U1LA 1T3FB 2QTAA 3HE7A 2FWAA 2GLUA 1UFUA 2JGEA 4BFOA 4RPCA 3H5OA 4F8NA 2IDMA 3HC3H 4Y5YA 4B9IA 4E13A 3FZUC 5KWIA 4E42B 2YHIA 4AE0A 3IDNB 2F8IA 2SCUB 5EMYA 4HQKA 4DWVA 3K7UA 3C5JA 2OSWA 5DBIA 4QJ5A 4GI2A 1US8A 3C4JA 3WWYA 2NT0A 2W11A 4QU9A 1OAAA 4IDNA 5D2LF 2GASA 4G6ZA 4FXOA 4Q6WA 1FQWA 3ERCA 4TUOA 3L41A 3F46A 1MQ8A 5FM5O 1N5OX 5J47A 4I4IA 3KMDA 2QRNA 3L0DA 1CXLA 3SO3B 1NDUA 2RSLA 3T6VA 4JM4H 4ZDWA 5J4YA 4QJ3A 1XQYA 4NO0D 3TF4A 5CAYB 2I7CA 4UAOC 3AZQA 1UACH 1RYBA 4XYLA 4IZHA 1XT6A 2XKNB 4J43A 4C2TA 3W04A 2VZ9A 4RVOA 1L1FA 1S5HA 3DXXA 4EGJA 3VQLA 4BC0A 1KQPA 2RGEA 3D85B 5DTEA 2Y72A 4D2IA 3RS4A 3FI0A 4FDAA 4YRDA 1H0RA 4XVOA 1JFFB 1QO0A 5ICGA 1DBKL 4N0DA 4WWPA 3V2HA 5DMKB 3QWBA 5HY9B 1D9ZA 4L8SA 1A6PA 2FVNA 3RI5K 4AYDC 2FSSA 2VMJA 4JY4A 1SU4A 4JYBA 4XO3A 2H4WA 5JAHA 4RVNA 1JAEA 5JARA 3VG9B 3H42B 4MFHA 4ZAKC 3C3YA 2OM6A 2C4UA 2ODWA 1A4BA 5E8EB 1OBVA 5HA5A 2WQZA 2Y5TA 3LKSB 3U1VA 4M61B 2HX8A 1J06A 4O2CB 3MJ4A 4ZT4A 2PWYA 2OMYA 5A5DA 1U63A 3BOSA 5L4LA 2W80C 4ENSA 3W90A 1MVUA 4N8VB 5T33H 5BMFL 1Q20A 3GEPA 1Z3RA 3RIFF 3B2DC 1DKQA 4R5TA 3AR8A 4MYWB 1PEDA 2QM8A 1EHIA 1LEGA 2ITCA 3X11A 3AG6A 3Q1SH 1M7BA 1T2EA 5AW7A 1T35A 2Z2YA 2A74A 2OX5B 1MA3A 2AZUA 2HJRA 3VD7A 4FNGA 3U19A 4RIFA 3OB8A 5IQ7L 4AI7A 3UICA 4MP3A 4GYWA 1N8ZA 2Y2TA 2IHNA 3SNKA 1RZGB 3B43A 3E0GA 1ZA3B 5CHNA 5CP3A 5DP2A 5J9PA 5A2QA 2Q2VA 4F33B 3ZHTA 4WAFA 1NCBH 4F1SA 4OQZA 3F2IA 4LOUD 3S27A 1ACLA 4G7VH 4QAWA 5FB8B 5J6HA 2P4EA 3CW9A 2L7QA 3ZE0F 1M7HA 1XA0A 2Q7NA 5B4TA 2OK0H 3CN7A 2ZXCA 5BQOA 3CM0A 1NGQL 3IPXA 2IWEA 2M26A 3OQVA 4L5FL 3VA6A 1SKAA 3REVB 1RE0A 1GTRA 3CLVA 4CADB 3SKYA 2CKBH 3GYGA 3TZCA 4OFQA 3X3GH 4BE9A 2MSCB 1TQCB 2NX5D 3OMIB 3VFWA 1E65A 5E00A 5E5MB 4GL4A 5JRDS 3T7EA 1DJYA 2BRQA 5G0WA 3H9GA 5HHPB 3KLKA 2Q99A 1FL6A 2LHAA 1OI3A 3DZGA 2LCFA 3VU9B 1M3SA 3GLQA 5BO0D 1BGVA 4B8WA 4EI6B 4WH0A 4ZDHA 5AZEH 2YARA 1DVSA 4ZBJA 1XVTA 1SLXA 1G4UR 1H5BB 4XE5A 4B3CA 1DQDH 1ZW1A 1XI2A 2XIDA 3MN8A 5GSRB 5DTFB 3FH8A 2Q6IA 3IIMA 1MF2L 4YRKA 4A6EA 3KOXA 4GAAA 1BQ3A 3GK8L 3FTUA 5EZ6B 2CRYA 3KXFE 1LVGA 3VO1A 4MMXA 5BYKA 2AITA 3JX9A 4A0QA 1E9VA 4YRPA 3M2TA 4NHCH 2JI9A 3RS9A 2GEBA 1ADGA 1R1DA 3K9FC 1KI6A 1LO4H 2PQ0A 1E92A 5FOBB 1GM5A 4YMUA 2ZJSL 5HGGS 2MFNA 1Q5PA 3VXSE 1N3IA 3C8ZA 3WRXC 1Z9PA 1I1OA 4H13C 5FO7B 3ZXIA 1PBYA 2JJSA 3KWXA 1V26A 1FPTH 5BPHA 2PX2A 5FWYB 1DSFL 1RERA 3SIKA 3WXBA 5BR8B 1X4XA 4UBJA 2JAOA 4RA9B 5KS9E 1T9GS 4HWOA 4KKNA 4RETB 5EGSA 1HZHL 3HCVB 1EG2A 3B9KC 2R0KL 3ZHDA 2BZ1A 2DYKA 4Y1AA 2QVMA 3G5MA 4GAYA 3QXAA 1S3GA 3KQVA 1KB9K 1KTDA 2FJUB 4PJBB 1E5TA 2EE3A 2P8PA 4IMIB 5KVGH 5EWLA 2EERA 3OLQA 5ITWA 1GN8A 4X5QA 2ATCA 1P5UA 3V0FA 3CSPA 3E4CA 2AOUB 3HYCA 4MX7B 3L7FB 3ASUA 7ADHA 3A06A 5L4IA 4XH9B 3KEHA 3CGTA 3W1EA 4RSVA 2NX5B 1RI2A 1QGDA 3TV3L 3DUHA 2PO6A 3D39E 5IB4B 4LQFL 1TJXA 3I61A 2PO5A 3MINA 4JQVA 1AGPA 2WICA 4YJGA 3CLUC 4M60A 3I83A 1QO7A 1VC2A 1C08B 3WEBA 1A7PH 3BDAA 3LP5A 2RA1A 3F7QA 2FWNA 1G7JB 2ZONA 3N28A 1DN0A 1Z7EA 4ODVL 3S81A 4OFDA 1A7OL 4A7GA 1N6IA 2OGWA 5B38A 5JRJA 3SGKC 5LQJA 1YQTA 5T3XL 3WFHA 2NAFA 2CRZA 1L5HB 3RLSA 2GR9A 3B1YA 1FP4B 2WAXA 3RSLA 1ZV5A 1NCDL 4K9EC 3HMKA 1E27B 4LC9A 5FAKA 1Z15A 1QNFA 4FGJA 1YRYE 2H4FA 2RHGB 1YKFA 4S0TD 3ZHOA 1KF0A 3CLSD 2H11A 2EIBA 5D2NE 5LA6F 1R46A 5JW4R 3WCYA 1XH3A 2NO9A 4FBLA 4NBYB 2IELA 7REQB 1GUYA 1JNNH 5HDRA 2QLFA 5BUQA 4FWBA 2WIIA 3TJHC 4GP8B 1DU4A 4PJCA 4O4IF 3L1HA 4DVBA 1CICA 3T15A 5TFSL 5KBMA 4F2EA 3SKVA 3K5PA 1M0TA 3VKUA 3SQBA 1NCAH 4O5LL 4MUBA 1CJUC 1RD6A 3U7YL 4QRIA 1JN6B 3FPXA 1W72B 4ESOA 4DBLE 4J3TA 1KDOA 2CDEA 3THRA 2IHZA 2NMVA 3CSDA 5J4MA 2GRJA 3N7UA 4RVSA 2YEQA 3C14C 2X4LA 3AEKA 1KXVC 3VR0A 1R9JA 5SY4A 3LIZA 1PWEA 1QLFB 5CXXA 3Q01A 1YB4A 2H2IA 1A98A 1HZZA 4ZMQA 2Q21A 1PGRB 3MV7A 7ABPA 3MC1A 3KYCB 2ZOKB 5IBPA 2Y92A 3TAXA 4OHYA 5GZ1A 3R19A 5C0DA 2Q7XA 2RQEA 3APNA 4NECA 1SXAA 4BQSA 5H4HA 3IDIA 4BVHA 2AJUH 1DBJL 3VFOA 2XZQL 1AB5A 3HJBA 3KM0A 2GB4A 4QBKA 4IBUA 3HCOA 3DOIA 1HNGA 2NWQA 2XUFA 3N2EA 4CU7A 1KBWA 1S9WB 1QLRB 1Y8RA 3JU3A 1YEGL 3IV6A 2RACA 4UT6A 1C5DB 1ZN2A 4RIGA 1Y7VA 3P0HA 4L2IA 3SEZA 2Y7SA 4XP9H 4OCSH 4UULA 3B6IA 3TI7A 3ANMA 4PLJC 1NVAA 1XIWD 2NY4D 2VJPA 4EKGA 2Z3VA 3Q9SA 3TRFA 4WY2A 1OSPH 1MENA 4PLFA 1MELA 1KJYA 3T5WA 4XP4H 2ZRCA 4KI5C 5AYQA 4MK4A 4DCQB 4HW6A 5IMLB 3V2GA 5K9JH 1P2FA 2B3DA 5HI3D 5JZVA 1ID2A 3DX4A 3I6LE 4LBYA 4X95A 3VH8G 2LU3A 4FNSA 1KTBA 1PD1A 4M98A 4M0KA 3LV3A 4M7RA 1MX1A 2FWOB 3O2QB 2R48A 4AEIH 3RUHA 5FW6A 2Q1TA 2WZAA 4NPYB 4HP8A 4BFYA 3SVZA 2A5GA 3FB4A 5DD5H 4UANA 2EE6A 2VZTA 3V8BA 3BVDB 4XN4A 4LCCA 4HUJA 2IJ0C 1RPTA 2P3SA 2ZP0T 3HO1A 2EJBA 3THWA 1XB3A 3SYRA 3JV4B 5K9QG 2HWKA 1D6SA 1N2XA 2ZRLA 2ZOUA 4D9BA 2P80A 1KCRL 2MQGA 4JUDX 2C7RA 4L9DA 1JEYB 4U2ZA 2XGOA 2I25N 4C4BA 2NY7L 1U3HC 3SFTA 1ZISA 3B8EA 1P2CB 4H3KB 4DZ8B 1XRRA 3F6PA 3HBLA 3JAKA 5AI0A 1EM8A 5C3MA 1JXOA 4RA6B 3MGTB 4Q2ZA 1NVUQ 2R3SA 3TR0A 2VDNB 4NP4H 5BV1A 1AQLA 1M7IA 3CEJA 3TO2B 5BRZA 5AI9A 4NJMA 3QFRA 5DRWA 4FQHB 1XB8A 1W52X 4PPTA 4CU2A 3TIDA 3VXUB 2WU1A 4RF3A 1VMKA 3DXYA 3FH0A 1MY7A 5JH7F 1MOEA 4YFDB 5H4YA 3RT1A 2ZIUB 4Q37A 5L0QC 3LEVH 3LPMA 5LP6A 2MHAB 2HLFD 4XMVA 2I4MA 3A9CA 4IWXA 1FYXA 5EZSA 5DYWA 3CPSA 4WMLA 4P4KC 4YWJA 2EXWD 3RZCB 3TPUA 2B3IA 1XCMA 4LJLA 2Q3AA 1H2HA 2OVFA 5B39A 3NRJA 3SKXA 4YK4B 5JNLA 2Z6QA 3RA7H 1YR3A 2PRZA 4EN3A 5KYWA 2ZM5A 4HXGA 4UU8A 1E2QA 3EZGA 1HK7A 1VFNA 4PRNB 4B3MB 4M7KH 4P57B 1NWHA 3BERA 3IVKA 1U0SY 2QVLA 3VC1A 4C0KA 3B1TA 1D5IH 2IF2A 3CW2A 5I48A 4XNYH 3J80A 1AMYA 2H63A 1A14H 2VTDA 4QDUA 2O7VA 5E4JA 1H2YA 3L5JA 1J0AA 4CNQA 3HUUA 1OARL 3DETD 4QUEA 2BFWA 2C4FU 4EA9A 3OM3B 1V1JA 1SLWA 4HISA 2HA1A 4B6JA 1YBAA 1UT2A 2P26A 5FYKU 3B2UC 4TULL 4JFDE 5GS1C 4TLDA 1YPZF 1QHYA 4UCQA 1OTUC 2CR6A 2E82A 3CLTC 3G9VA 1LDEA 2ZWVA 1L4FA 2EDRA 4XO8A 1T9GR 1U28C 5A7GA 3A4EA 1DRWA 4G56A 5C4MA 1E5DA 3WSQH 1WVZA 2D7MA 1QYGL 1PYOA 2X38A 2HT3C 4JB9H 3WRYC 1KN2H 3R8BB 3PNQA 2Z2KA 1ONBA 3PJFA 4FXTA 3JASB 4R83A 5TJHA 3ZU4A 1AKEA 2WKRA 3V5NA 2QY6A 1U1IA 5JMOA 5LAXB 3WI9A 3T4YB 2Q2LA 4HYYA 1KB5H 3RTBA 1JXFA 4DOHB 1YUHB 5KSWB 1OJ7A 2VPWA 3KOMA 2YGPA 4R0LB 2W5PA 3NTQA 4GWKA 2XOEA 3AUKA 3SD7A 5DO2C 2I0FA 2XOTA 2C5GA 2FR8A 2W2QA 4NUQA 3C2SA 5AW0B 4NNYA 3KDAA 2PWBA 2Q27A 3NOIA 4JNCA 4PJFE 4LGYA 3PQYD 2ZB7A 1UD8A 3PLYA 5F3FA 1OX6A 1K6EA 1PL7A 4GQ9L 1CR2A 4BINA 2C4MA 1IM5A 3UTPE 4KYUA 1GYAA 3M6UA 2FCRA 1BGWA 3AF2A 3OX8B 1Q19A 5KTRA 3KDMB 4Z18A 4EVNB 4AJJA 3WGVA 1J9QA 3LVFO 1YQDA 3BMWA 3HR4A 4X6DF 4PX9A 4U8GA 1FE8L 2EDFA 4M9OA 2QJTA 5D1XB 1OE2A 2YQ3A 3N0TA 1P9RA 5JYEA 3BN9D 1LLDA 2QG4A 2QB5A 2G17A 1TZHB 3W9EB 3HB4X 4WQOA 2G82A 3E3OA 4KU4A 3GFQA 4OMDA 1Y5NA 2N47A 3AI7A 3IUEA 4L9RA 3D6FA 1I32A 1TVHB 4JXKA 3B83A 5GJTH 3EIQA 4FTDA 2P7HA 5B21A 5LAPA 2FGZA 2QP4A 1NJ8A 5LJLA 4EHIA 5KOVC 2UXCB 4OD1H 4B81A 2YS6A 2VKXA 4OFIA 1G5IA 4PFEA 1VKXB 4CF5A 4YC2C 1SBTA 2CRMA 1U2YA 3GCGA 2OXHB 3JAMA 2CQVA 3TO4D 2XKSA 4KBYA 2I2CA 3QHFH 4YECA 4QPNA 3HHEA 2OMUA 1YFKA 2YBRA 4DJAA 1BZ9B 1G3IA 3NI2A 4EKNB 4KNQA 3KYOB 1KTLB 1X7GA 2WJHA 2CLRA 1DADA 2AFIB 1D7DA 5JHDA 3AUYA 3D3KA 4UJ5A 4UZFA 1T4KA 1N77A 5AK3A 1Y6GA 3P11H 1R0LA 2Z8SA 1HC7A 1NNEA 2C2OA 2WCSA 1AG0A 4MUFA 2A59A 3OPUA 5E4FA 3HFMH 3MJ9A 3OPZH 2V5TA 4NENA 5BCAA 3PQYB 1P39A 5F1SA 3DM5A 3IBOA 5HDOA 4OQ4A 4BRUA 3OM9A 1XNRB 2GFIA 2ILLA 3PGJA 4I55B 4WJ5A 3ZDYF 1CY8A 2ZTSA 4JRXA 4C76A 3FMVA 4PW3A 3NT0A 3S34L 1FNSH 1Z4MA 3WE6B 5EOTA 4JE0A 4QJ4B 1N9PA 4BASA 4XC3H 3PWLA 2GHZA 1WX1A 3A05A 4W6YB 4FJ2A 4CLOA 2P9EA 5IROD 2F9BT 4RK6A 4ND8A 1U6AL 4ISBA 4DEPC 3I72A 4JBNA 2IDQA 4PLVA 1G1OA 3ASNB 1LO0H 3A6BL 3I3DA 5D93B 4X54A 3IEXA 4X20B 4LSSH 4KXDA 4ND3A 1P8JA 3T04D 2XDYA 2P9YA 1TADA 1KJWA 3S37X 2IDSA 3BIBX 1N2RB 2OQIA 1NGYA 2GMWA 121PA 1DDIA 3UYPB 1TZJA 2D1RA 4M3JA 4HLJA 2XYVA 3CPLA 3KJ6H 3UH8A 2WBJA 1ZG3A 2HBZA 5EIBC 1HJBC 4ENQA 5DZPA 5B57C 2DQ4A 1P91A 4RX4A 4XNQB 2GFHA 2H1WA 3TO4B 4OAOA 4O1MA 4FG6D 2XTJD 1SOAA 4EPXA 5KCZA 1QCDA 2M8XA 5A05A 3QQ3A 2G08A 1LDYA 5EJ5A 1JDZA 5HHXH 4X61A 3AZUA 3AKCA 4G5AA 4DCJA 4HBGA 3BVXA 4JPIA 3KQTA 1HHGB 4OZFG 1ZD6A 5AKIA 3O3AA 4G4SP 3OX3A 4PQYA 3CV3A 3RVWD 3IAS1 4OH7A 4F8TA 3UA4A 1PIFA 4TTJA 3UWDA 2C9ZA 5JECA 1MRSA 2LVCA 1GPWB 4LQDA 3F04A 4MVJF 1OLZA 3S96B 1XMJA 3PIIA 2LOEA 3OY2A 2VEDA 3OEHA 3BMQA 2MSEB 4MI3A 5HP5A 3KQQA 3L4SO 3DI2B 3D3VA 1R6VA 4NWUL 2IY9A 5KNDA 4E3ZA 1XGUA 2FSEB 4C5BA 1IAOA 1ADBA 4RZCB 3CB2A 4PRID 4D0GA 5C9JA 1KIPB 3PD1A 3CHOA 2HYMA 4ZAFA 2W6CX 3RWHB 3RNKA 4DLZA 3F6CA 4MUYA 2J6EH 4K23H 4PLYA 3LQ2A 4RXMA 2VHXA 4NQVA 4GVPA 3R3UA 3BIAX 2YVKA 2Z31D 2AEQH 5CKAA 5D84A 2DERA 2BOCB 3H54A 2EFEB 2Z7WA 3DDCA 4XIJA 1VHTA 2J4DA 2HD4A 2VT3A 4S11A 4JY5H 2BFCB 3QQ4A 3Q12A 4X5WB 1DQSA 3MRVA 4XCCL 3X1XA 5AVXB 3IJSB 2XNAB 1ETUA 2DPXA 1F86A 2JA1A 4LVNC 3HO8A 3LX5A 1KMIY 1I1AB 4D56A 5AKGA 2F8OA 1QKZL 3EO1B 3ATFA 4FN5A 2CJWB 2VR9A 2I67A 3P9CA 1QC5A 4MCZB 5HD8D 3UMCA 2CNWA 3KLHC 3AM8C 4DMRA 5CS7A 1B7GO 4PUBL 3REQB 3QS3A 4MDJB 1HLPA 3NJXA 3C5ZA 3FN0L 2EEBA 3JV7A 3OCWA 2DWDA 2RG7A 4X8JA 4KQKA 1Z4QA 1MXFA 1GKLA 2QN9A 1JR4A 1SNYA 3I3OA 3ML8A 2QQLH 5TGTA 2WD7B 1VE6A 2XTJB 3ENQA 2JF1A 3KQSA 4JO3L 2W6OA 2DLFL 1WWCA 5IB1A 1X1EA 3EFHA 1SVMA 4ODWB 1V05A 4KK6D 3GMPB 4GX2A 1MDFA 2J9FB 1TYDE 2XNJA 4XLTA 5THKA 1EBPA 4U1NA 3E6HA 2ZREA 1JDAA 3SXJA 1UWFA 2GSGB 5B53A 3OAYH 3W9DA 2VIRA 3GZOA 1GRRA 4KSYA 3NQKA 3D0QA 3ATAA 3PWJA 5JUWA 5C0BB 2WJJA 3Q98A 5FLXA 2V6GA 3CQ9A 2G1AA 2YGVA 4PG8A 2V3FA 3RRFA 5FK9A 5EVCA 2CRIA 4GLBA 5A0VA 1H0DA 3AY6A 2WIKA 2A14A 2QSYA 3TUIC 5CJPA 5K5EA 1QLJA 4MW6A 5AK0A 3TLBA 2NUTB 4DJEC 3G2JA 4YHNB 2Z31B 1EGHA 4NP6A 3BH9B 3KHOA 3ZWAA 4JFPB 1ISGA 2V8OA 3R3HA 2Y6SC 3HVNA 4F58H 4OMCA 4A2GA 2J08A 2IYYA 2QTZA 3NCCB 4NMMA 1EQAA 1E4YA 3RAJA 1PT7A 4I3SL 2WPDA 2X4OA 4ORGA 3DIFB 4B50A 1MHCB 1CPUA 3L0IB 1JS1X 1CUYA 1B0ZA 4EAAA 4A73A 4XBGB 1H9BA 1NZJA 2GEKA 3RY6A 2PUBA 4YHYB 5C0GB 2BMEA 3A1NA 4LSVL 3UMFA 2BH9A 3QLEA 2D0PB 1IJEA 2K7QA 1M2JA 3DOHA 5CX4A 3KDPB 1BZEA 5EORH 4K9KA 3DRQA 1J33A 3JZYA 1RHRA 3TW8A 3E35A 3KZNA 4C7OA 3HI4A 2OMTA 3T95A 3EGCA 1IBYA 1L3CA 3WY9A 3M9XA 3T9WA 3FF7A 1MXDA 2PZEA 1FRNA 5IB3B 2YOFA 2GJ9A 1RP8A 1MX3A 2JAXA 4MHOA 3QULA 3UBMA 4UUOA 2FWLB 1EXNA 4LCEA 4FNLL 3S8YA 2P43B 5L53A 2C1ZA 2P9RA 7AT1A 1YQUA 4KWHA 3SR0A 1F0KA 2QUIA 4I87A 3O6FA 4GRLA 4WW2F 4NDNE 4M8LA 4TYNA 3FMOB 3WYBA 4AXWB 3PP4L 4AQAA 1UANA 2HSJA 3IPYA 3MXTA 4NEQA 2C5DC 4WXYB 2BVPA 3DO7A 4F84A 1OH5A 2MOVA 5D2LA 3OOSA 3IP3A 1LWJA 3EG9A 4JDEB 3NPMA 3MA9L 1Z0DA 1HN1A 3K3PA 1OW0C 5CLFA 5JSZA 1GZVA 4LB8A 4YHHB 4APQD 4DA8A 3AFNA 4MIYA 1VZHA 4A2EA 1V11A 1UF9A 4HBZA 3V7WA 2RDMA 4YP1A 3NH7H 4H60A 4LSRH 2XJ9A 3PUUA 3AJ7A 4HETA 1PYDA 2AKRB 1ULVA 4E5YA 4A5SA 3A1DA 1TTGA 1PBTA 5LBUA 1NOAA 4H2DA 4TTVA 2QLTA 3U82B 1WQ1R 4BLTA 3UYRH 4ARUA 3V48A 2LGJA 3SCZA 4FB5A 3AFGA 3T8XB 1M2KA 2GNAA 4JFAA 1QE5A 4B2IA 1F6LL 4M1WA 2GPYA 4L8WB 4WV1A 1HZJA 3MOAH 2OXIA 5DK4A 4ZI2A 4OT1H 5K93A 2NXYD 3A6HA 3EO0A 3ORSA 1SG9A 4G6FD 4D9QD 5E99L 2XYPA 3O21A 1Z13A 3GSWA 3KWTA 2DYSB 2BONA 3HKCA 2QA5A 1Y4DE 1QZUA 1S9XA 5A0TA 4MVJI 4KU1A 3SDBA 4N26A 1DVFB 4P4UA 1IGFL 4QHMB 1B1AA 4P3WA 3T7RA 2X4UA 2R8ZA 2XX3A 4XN5A 5DHUA 2QAGC 1SDDB 5HOQA 4HEME 4OZIF 3KEOA 1M33A 4ZVVA 4ZOLF 1T5SA 1G9NH 4L74A 4EJSC 4DA4A 1IZKA 3S2UA 1NJFA 5TB5A 4FS8A 2XFXB 5E4YA 4P2BA 1FU8A 1T91A 3TBSB 1LL1A 2C3OA 1PQZB 5JZ7C 1CDOA 2GARA 4E5XB 1SG6A 1KO1A 5D00A 2CL6X 2BM0A 1ETJA 4CMIB 1AGDA 3D9AH 3NHSA 1IC1A 4MRMB 1G8PA 2X3UA 1Y18A 4BWWA 3N5CA 2NV0A 1AY1L 4X4ME 1A3CA 4BMOB 2ZBUA 1LF5A 1MJJB 2VP4A 2X7XA 4KPYA 4OHFA 3SJVA 4NERA 4Q66C 3CPJB 3RC9A 3VUFA 1YB1A 2P9ZA 3FQTA 1F2TA 5FPQA 5GGUB 4FFBB 3U7RA 5GS3A 4COOA 4HIJB 1QRNA 5D7IE 4HPHA 3BQUD 2L42A 2BUBA 2QLYA 4APQB 4UNRA 1KYAA 4Z9XA 3MBXH 2OZ4A 1PYWA 3T3DA 2RBEA 4XNDA 1OAXH 2OP1A 3DDSA 1DO8A 1IZJA 1W85B 4TRNA 4QDJA 3G08A 5DK6A 1YI8A 4GMSL 3KU1A 4RL4A 5L6MB 4KGLA 2I8AA 3ELAT 2BMDA 2CJUL 2DWEA 1YZVA 2P5WE 2FT6A 5TDNA 1YJCA 2KERA 2OL3A 4GGPA 4C06A 3CCBA 2RK6A 4BM7A 1LO2L 1FVFA 5BNTA 3DEAA 4B32A 1FYEA 5C31A 3RC1A 4JI7B 1YACA 5I5EA 1QYXA 4JLRA 3U7FB 1CDIA 1E6MA 3H4TA 4YLYA 2NQ3A 1DQYA 5IWLC 5L7WA 4OKIA 3BSZH 5SWQA 3IL2A 3KPOB 2PGJA 4Q9RL 1R8XA 3GEBA 3HTXA 3WS6A 3OPMA 1E5YA 2O6DA 3BWXA 3PXJA 2IWRA 2X2PA 1U9YA 3R0MA 5JNRA 2XN2A 3U3ZA 2DE0X 5B8CA 3AGQA 2Y9MB 5EZQA 2PCYA 4FQXC 1UZ6F 1JDCA 4DAEA 3V6OE 3QG7L 2XG4A 1T0PB 2R1XA 4Z7QF 4XPHL 4NZRH 4OD2A 2ZIVB 3VYNA 3DDOA 1A8HA 3R4VA 4N22A 2IC2A 5ACZA 3RVQA 1OGYA 3KXFB 2ZX5A 1U3JA 3BP7B 2BLFA 2Y0CA 4MS8C 4G6AC 4WU5A 2QRVA 3NKFA 5E08H 5E4EC 4P93A 1RZRA 2Q3FA 2O5VA 1Q0XL 3EJZC 4DP9X 2GYSA 3C5CA 3PHIA 3UZUA 5CBKA 1DYZA 4DSYA 4QTYA 3QUSA 5LGJA 3LQMA 4OGWA 4IGBD 1PY4A 2G80A 43C9A 3BQUB 3BRWD 1Z4LA 3KLAB 3S37H 4RX1A 4QHNB 2ZCJA 4E32A 2CUHA 5LMNB 5TMBA 3VA7A 4NMWA 3NA4A 4DY4A 3DC0A 4F2DA 4J3VA 4QSHA 4FSHA 2GJPA 3PR3A 2KDGA 3IIKA 4U4IA 1ZUNA 4JHLA 3QR0A 1ST2A 4FGWA 4OL9A 2A67A 2IHJA 2GCOB 3W3ZB 4AP9A 4BE7B 1GGYA 3BGWA 1U0GA 3K94A 4IH9A 1LPAB 1NWPA 1B8UA 3JWJA 2GI0A 3AVVA 3AKZA 1SUJA 2J21A 1VB3A 5CSZB 2GXAA 5KQMA 3GRYA 2J1YA 2HK6A 3KJZA 1KCVH 4FJYA 4RZ2A 3DPIA 1ZRUA 1DQKA 2A30A 1O0CA 1WHSB 4P4RB 3L3OB 4WWHA 3W6OA 3C60B 1WXQA 5HHVL 2WF5A 2GTPA 4YP0A 6ADHA 1SHZA 1CLZL 2DPKA 3QORA 3FOZA 1E30A 2AFHA 5DSCA 3KOYA 3T77B 2X0KA 2F8SA 4MCNA 1AMNA 1IPHA 3MRBA 5IHUL 3VXTB 2V5VA 2GB2A 3EOBA 1FS4A 1RYYA 5MGBA 2A9CA 2E75C 1QCCA 5EO9A 4YAWA 5FT9A 5CMAB 4XB7A 5CB4A 4YRFA 5J2UB 5BZZA 4ENUA 3NVAA 4OZHB 2OE2A 3S2YA 4L8BB 4P2RA 1O94A 2A1UB 5GJBA 2Q6WB 4DQXA 1LVEA 3KKEA 1VSBA 3PL6D 5LOVB 4BKUA 3LH8A 4TKVB 3AVTA 3UTOA 4H0NA 3QWIA 4IMLB 3H5TA 4NN6C 3UGUA 1M67A 1S6YA 3L3GB 4TWRA 5B6IA 4BD4A 1AS6A 3KYBA 1M53A 3FUWA 3TVTA 3TZQA 3NZ8A 3NOOA 4F85A 4HQOA 4KXBA 2VYRE 4TN9A 3AJRA 2D8MA 4C59B 4F8QA 4U3JA 2M9MA 3UCFA 4QFBA 3HAEG 2EWVA 1SBBA 2HAEA 4KUEA 4O4IA 3T3GA 4UE3S 3PJSB 3O8BA 4CBZA 2GEUA 3LYLA 3IQZA 4AQZA 2EADA 3KH3A 4O2RA 1DUYA 3IDFA 3T7TA 1RYHA 2CDBA 5BRJA 1BS1A 2I03A 5FV4A 4XM1A 4UU9B 2XUAA 3GS7A 3FU7A 1T0UA 3NP3A 5LDSA 1JEJA 4YDNA 2YZKA 1NY5A 3O92A 5CH3A 3UTTD 1XMIA 1VGEL 3EKCA 1Y63A 4BQEA 1B2WL 3OA0A 4H25A 4TPKA 4Q1BA 5FBRB 3U3DA 2PFSA 3ULUD 5K3OA 3G5XB 2UXDB 2H7XA 4MCMA 3LPCA 2QV2A 2DS4A 4DTGH 5CD3A 2ATAA 1N5DA 4ZCQA 4KAJA 5EJEA 4WIAA 3MRXA 4UU0A 4UQCA 2N1TE 1QONA 4FKEA 2H65A 4ZKEA 3U7EB 2JLAA 2JLQA 2PW1B 3AVUA 5I19H 1EYZA 1HPLA 4MCYA 1XUOA 1IC4L 2IE8A 1IUKA 4X60A 1OZTG 2FATH 3VSTA 4JPKL 3CLHA 2WOBA 4AL8H 1MFNA 5ESRA 4I6JA 2FB9A 1JLLB 4OLVL 2HTLD 3DZDA 4LLDB 4MR9A 1YC8A 1YQVH 3O2WH 2VDRL 3PHSA 2VJDA 3D07A 4MI6A 2PE5A 3CFCH 2R6DA 4PS1A 1MCHA 1N6QL 5FYQA 3B1WA 4ONFH 2VZ0A 3FQWB 3BICA 3GD7A 3HLKA 2B2NA 1JNJA 1FGNL 4DARA 2JCWA 3MCZA 3A3PA 2AXGB 4NFHA 3DZKA 4ER6A 5KX5B 5EUOF 3TX6A 4QHKI 3U3XA 4YOKA 5HBBA 5HW0A 4LL4A 2QX9A 5HQTA 3DV4A 3SE9H 4D8YA 4WWID 5HZHA 2C2WA 2WFLA 2Q9UA 5LNGA 1DT5A 5ALEA 5F9OH 1G7PB 1IVTA 3QNMA 3N1FC 3LECA 1VE7A 2D3WA 3LT1A 2PBRA 2A38A 2ENQA 4XVSH 1FVXA 2D2VA 1YMMD 2J2ZA 4PJ7F 3GOQA 2W6PA 3AU1B 3ZZNA 3HN5A 2I32A 4G4IA 3UTTB 5IDXA 4R9UC 3BMNB 1K2DB 3ZXSA 2YNMC 3U2QA 5DRXA 1A9BB 1T5XA 3U9PH 3F3SA 5ITZA 4XWGH 3BEWA 3V42A 4YCSA 1SOQA 4HNHA 3JTMA 4X6YA 3DQQA 4F9LC 1P69B 5E8RA 1DANU 1G7IB 1ZXBA 5CX1B 2WY3B 1ZM9A 2R1TB 4QLBA 1Z32X 4Q21A 2A5LA 5J3HD 1B4LA