3V5CA

Crystal structure of the mutant e234a of galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEAAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant E234A of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 134
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v5cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v5cA01
2QDEA 3MSYA 1JCTA 3VCCA 4M6UA 3TJ4A 1ELSA 3FV9A 4DHGA 2P3ZA 3P93A 1WUFA 3SSZA 2XGZA 1FHUA 1SJCA 2QDDA 2PA6A 4FP1A 2QVHA 3BJSA 4GGHA 3I4KA 1EC7A 3GY1A 3JZUA 1P43A 4IP5A 3RITA 1W6TA 1MNSA 4E4FA 1L8PA 3CK5A 3Q45A 1KD0A 3UCCA 1PDYA 3FYYA 2PPGA 2OPJA 3H12A 7ENLA 3H70A 3IJLA 3I6EA 4IL0A 4FI4A 4ROPA 3CB3A 2CHRA 2QGYA 1BQGA 5FJOA 3ES7A 4A35A 2AKZA 3K1GA 3H8AA 4H1ZA 3BSMA 2NQLA 3JW7A 4EWJA 4GISA 1MRAA 5FJTA 2P88A 3BOXA 4KPLA 3N4FA 2HXUA 1NELA 2P0IA 4HYRA 4A3RA 1EBGA 2AL2A 3FXGA 3R1ZA 2GDQA 1TKKA 3U9IA 4MGGA 3NZGA 2QQ6A 3TOYA 4KWSA 3OZYA 3IJQA 4M0XA 3N6JA 1IYXA 3MKCA 3DEQA 2PU0A 4HPNA 3EKGA 3MQTA 4F4RA 2PGWA 3DFYA 3MWCA 2AL2B 2FYMA 3UJRA 1R6WA 5BOEA 3UJ2A 3CXOA 4A6GA 3V5FA 2ZC8A 3UJSA 3PWIA 4IT1A 3THUA 5ENLA 5BOFA 3DG7A 3SQSA 4GGBA 4KT2A 4JN8A 3FCPA 3MY9A 3DFHA 1P48A 3ENLA 4DWDA 2OZ8A 2GSHA 3JVAA 4E6MA 2OZ3A 2OKTA 4DYEA 3HPFA 4IP4A 3VC6A 4E8GA 4HNCA 1TZZA 4GMEA 3DG3A 5IDZA 4H83A 3R10A 3H7VA 1JDFA 2OZTA 3PFRA 3SN4A 1OEPA 3VA8A 3UGVA 3MZNA 4H2HA 3R11A 2PCEA 2QJMA 3GC2A 3VC5A 3RO6A 5FJRA 4JHMA 4HCHA 3NO1A 1TE6A 3QKEA 4J1OA 2XH7A 3STPA 1R0MA 3FVDA 2PS2A 3SN0A 2ZADA 3QTPA 3IJIA 4K8GA 5EU9A 3ZVHA 4IL2A 4Z17A 2MNRA 3UXKA 2GGJA 1XPYA 1JPMA 2OFJA 2XSXA 3N4EA 4GYPA 4DN1A 2XH0A 2POZA 3TWAA 3CYJA 2OQYA 3RR1A 3VDGA 4G8TA 2DW6A 3SJNA 2ONEA 5FJPA 4J3ZA 3SN1A 1BKHA 3OP2A 4IHCA 3PWGA 3PK7A 3TWBA 3GD6A 2P8BA 3DESA 4ZA0A 1EC8A 4YWSA 3TCSA 4ENLA 3TJIA 4IZGA 3TQPA 2RDXA 3DIPA 3ZLFA 3UXLA 3D46A 3VCNA 1YEYA 4KEMA 2AL1A 3V4BA 2MUCA 1MDRA 3QN3A 2HNEA 3OZMA 4GYPC 4HCLA 2OVLA 3R25A 4MKSA 3OPSA 2HZGA 5J04A 3FJ4A 1SJBA 5FJUA 2DW7A 4JN7A 2GGEA 3T9PA 2QJJA 4GIRA 3T8QA 3QPEA 3OW1A 3VFCA 2PMQA 2PP1A 3P0WA 3T6CA 3ES8A 3N6HA 1RVKA 2HXTA 2QJNA 1WUEA 3IK4A 4Z1YA 3UCDA 3RCYA 2OG9A 3V3WA 4K2SA 3QLDA 1KKOA 1PDZA 2PSNA 3RRAA 3Q4DA 4G7FA 3DGBA 1KCZA 2OQHA 1EC9A 3R0KA 2GL5A 3SBFA 3MUCA 2PODA 2GGGA 2OX4A 1XS2A 4E5TA 3R0UA 3V5CA 2I5QA 3UJFA 3D47A 4HCDA 1F9CA 4DXKA 3KUMA 2PP0A 1SJAA 2PTWA 1ONEA 3ZVIA 3P3BA 3S47A 3OTRA 2PTXA 1E9IA 1ECQA 2PTZA 4MMWA 1FHVA 2XH4A 2OLAA 4E4UA 1SJDA 1EBHA 2AKMA 3TTEA 1JPDX 1MUCA 3NFUA 2P8CA 3GO2A 1NU5A 3NXLA 6ENLA 2PU1A 2PGEA 3UJEA 3TW9A 2XH2A 3B97A 2PTYA 3I6TA 2GGHA 1DTNA 2O56A 3ZLGA 3RGTA 2FKPA 1KKRA 4ZCWA 3CAWA 3DDMA 4GFIA 2GGIA 4HNLA 3ZLHA 4DX3A 3DG6A 2OO6A 4H19A 3U4FA 4HN8A 3EEZA 3T4WA 2PP3A 3CT2A 3S5SA 3DERA 3ZVHB 4X2PA 1MDLA 4K1WA
chains in the Genus database with same CATH superfamily
3VPLA 5HMDA 1GOOA 1A3XA 1H3GA 2IS7A 3CZLA 1FOBA 3AIEA 4CVWA 1AL8A 4EM4A 3P93A 4LUIA 1OK6A 3QOKA 2Y61A 3B8VA 5A5WA 2QDDA 3S2MA 4CNSA 4PTWA 4DZ5A 3BJSA 1EDGA 3HPSA 2X8RA 5AZ0A 2OWWA 2D23A 4DJDA 4S3GA 3LCXA 2Y2WA 1HJWA 1EC7A 1TV7A 4IQDA 4U33A 5HK4A 4I9TA 3U57A 1X8FA 2W4XA 1OC7A 3TYBA 3H2EA 1XGDA 3CK5A 4N4PA 1OK4A 2WWCA 2D3NA 1V3MA 3OG3A 4A29A 1RPXA 3C3NA 2J7EA 1YTDA 2EF9A 1BVNP 2ZUNA 3H2OA 3TEVA 1A4MA 1JEZA 3V5OA 4LT9A 4R7OA 1Q8JA 2F6XA 4MAVA 5I3FA 4M6PA 1EUAA 4O1FA 3WL1A 4HJFA 3EOUA 3H26A 2VR4A 3CZEA 3WMSA 3P81A 3G8RA 2DUAA 4JTUA 1XIBA 4HT3A 4PUUA 4D6GA 1GRTA 4EVZA 4C1KA 2VO5A 1JZ2A 5M3WA 2XN0A 2E9MA 4DZAA 5CCZA 2C1HA 4IMAA 3UERA 5CPSA 2C3CA 3WDPP 4MUPA 3W71A 3LI1A 3LPPA 3QR0A 2NXGA 3DBNA 3T2PA 1IEIA 3EOLA 4G1KA 4N9EA 3TROA 5BCAA 3C4UA 1NFBA 1VENA 5M03A 2GDQA 1C8QA 1SR0A 1FWIC 2A85A 4AZ7A 1T7LA 2CCRA 1KCLA 5CZSA 4IPNB 3SGUA 1ICPA 5I23A 3KCLA 1E71M 2PDFA 1GV4A 2PU0A 4PMVA 4AHOA 1RV8A 2PRLA 4P61A 1GWJA 4F4RA 4Y9AA 4U10A 4UFIA 3W6YA 3VKJA 4X22A 4AXNA 5XINA 4BCEA 4EQRA 5HOSA 3HM7A 1F3PA 2HV5A 3TTYA 2FZ8A 2V6AA 3MMDA 1JXJA 1UMLA 2CKRA 2Q8XA 3PZQA 4NEWA 2PLJA 2VKZG 5CG0A 2B7PA 1K70A 1XYAA 1E5NA 1HJXA 5ABEA 4H8NA 3WH7A 3AIRA 2VELA 3N34A 2OOGA 1K8YA 3W25A 1ADDA 2OXNA 2ZUVA 1V3JA 4ICNA 1D3CA 1YDNA 1F07A 4CNPA 1X7IA 3W00A 3HBLA 1A0EA 3WLSA 4WGHA 3UGVA 5C54A 5L6UA 5JCKA 3B8UA 4LY8A 5CZ0A 1XYBA 3M16A 2X2GA 3GVWA 3IGHX 4ZR8A 5CBBA 1ALDA 1BEUA 1DP0A 4QIUA 1H7OA 1G7VA 3EX4A 3AIVA 1DXLA 4FEZA 2VC9A 3KL3A 4HHPA 4CD7A 4ZOEA 3UXDA 4GC3A 3G1AA 4JFSA 3VGHA 1VS1A 4RL3A 1E56A 5LYRA 3UR8A 3R0DA 1TE1A 5E5CA 3GHTA 5IXEA 2W9MA 1MWOA 4GIYA 3TYAA 1TPEA 4KH2A 3HPZA 3ANYA 3LM3A 4E2VA 1VPXA 4RKAA 2WZEA 4KETA 1W54A 5AYBA 3VZYA 1QUMA 5D2TA 2V3AA 4IGSA 1WB0A 4Z0JA 1NH6A 3W7CA 4I5RA 3KOZA 1YHTA 1JYXA 5DMMA 2P53A 2WM0A 3HV9A 1W56A 2J66A 4K7VA 5HINA 1JRCA 3TQPA 5AECA 1PVNA 3T2OA 4AZBA 1MW3A 3F2BA 4CNOA 2V3DA 1YIXA 2WHMA 1K77A 1SB3B 1H1YA 2J47A 1OZQA 4LEQA 2A3AA 5U25A 2GSEA 4IX0A 1JF5A 3VIFA 3EGJA 3WFAA 2NLIA 1L2QA 3WUEA 4ERGA 1KLZA 4CEUC 4JIRA 4UTLA 2DT0A 3O6CA 4JN7A 4IPPA 1H0GA 2A2IA 3KRUA 1S1PA 4L4MA 1CIUA 2QCLA 4RZ6A 1E3ZA 1E6ZA 2YXOA 4WQ6A 2C1GA 2OMAA 2VEKA 1G5AA 1QW9A 2BVYA 4HBKA 5DELA 4NL1A 4L61A 2XUCA 1MQPA 1ZUAX 1N55A 2OG9A 1R47A 2BV9A 5EMMA 4K2SA 4YWIA 3R7MA 1TTJA 1JZ3A 1U1JA 1GQLA 5I09A 1E70M 4HTYA 4PGLA 1KXHA 3MUCA 2ZTJA 4HA3A 2W3RA 3GRIA 4OUEA 1FX6A 2GGGA 1F6PA 3S6OA 1JL8A 4QG8A 3V5CA 1AMKA 5M5DA 3RFAA 1MI3A 2J62A 3AMLA 2C16A 3WQPA 1GORA 3W1MA 1G0CA 3KM8A 3TN6A 1OIMA 2NV1A 1QO2A 5U7SA 2DV0A 3UZYA 3E3HA 4DUWA 2O9PA 4FXFA 2OLAA 1AODA 4S1FA 2VDGA 4IIGA 1DXFA 1QXLA 2CWXA 2PDIA 1SJDA 2P50A 4W87A 4EX4A 4PA8A 2AKMA 3M5ZA 4L1WA 2XM1A 1FKXA 2CXEA 3WIJA 1ZCCA 4Q4OA 4XAPA 4ZSUA 1HL2A 2RJGA 3NL5A 5A8PA 1LRQA 1WKEA 2FGZA 1KB3A 2PGEA 4TV5A 1CLVA 1EOMA 2CLMA 2ZZ2A 1C7SA 3WQDA 3HQNA 3LM7A 3NNTA 2H8XA 4XUYA 5I3DA 1WXZA 2HPMA 2WSYA 3FGCB 2WK2A 3H23A 1P0NA 2Z1SA 2FPYA 4NI8A 2E6DA 3AFBA 3B8SA 1UR0A 2D2OA 3W6MA 1A3HA 1FECA 2ZYFA 2EXOA 3K4AA 1XCXA 2PFHA 3WUBA 3W87A 2R8WA 2V5LA 4XX6A 4X2PA 3CBWA 1S3TC 1JOAA 4K37A 4BQ2A 1T3QC 1YW1A 3MV01 4DI9A 4AUBA 1U5VA 3LCFA 4H4XA 3A13A 3HG2A 3FV9A 4JQAA 5HAOA 4HP5A 3ERPA 1E4IA 2EJAA 3POCA 1GRBA 1WUFA 1P0DA 3PZTA 1D8WA 4UQDA 1KCKA 2PRMA 2EPNA 3OG2A 3CU2A 5LKYA 5DCBA 1CXFA 4IP5A 5DFAA 3BPWA 4C6BA 1UP0A 1I1WA 2LLEA 1RUSA 3PJTA 4AAJA 2XJ7A 1U1HA 1ZPTA 1D3GA 3FHQA 4J57A 1M5WA 1XHCA 3N15A 3O3RA 3APYA 1UIPA 1HJSA 2I57A 2FB2A 2YZRA 1EDQA 1S38A 3VNIA 3T1GA 3MI3A 4DWSA 4Z0SA 4I5XA 4QJ4B 1V0LA 3CV1A 3BGJA 1MZRA 3TYCA 2VX5A 4LNYA 4MPKA 2BX7A 3FFSA 5DMLA 4UFLA 4H1ZA 4L1GA 1W1B1 1US2A 3LENA 4EAMA 4FXJA 2ALDA 3GVGA 1GG0A 3AS1A 2WLZA 5KINA 2V30A 4GO8A 2CZDA 4O54A 3PHAA 1EXBA 3NVDA 4JKMA 1D8CA 3ITYA 4MGGA 3W7QA 3WQCA 2AMGA 3AS2A 4LBUA 5EY5A 3RRXA 3PZ9A 4KWSA 1I45A 1XFBA 1L6FA 4MTVA 1WZKA 3CWNA 1WX0A 4CQDA 1M7PA 3UNDA 1IGSA 4UQAA 1ZSXA 4J4KA 2PUZA 4R5EA 1KWGA 3GU9A 4L65A 3UJRA 1ONXA 4NASA 1KLYA 4I6KA 3ZQ9A 1FWTA 1Q5MA 3RNDA 5ENLA 1PIFA 4JS3A 4M19A 1LOLA 3ZJ8A 2FQIA 1R30A 4DO7A 3GU1A 2XIJA 1H2JA 1RK6A 1Q13A 2W62A 5LNVA 4WDUA 1B3XA 5DY2A 3TNBA 4KWOA 4LV4A 3AZRA 3HV8A 4QSHA 1BWLA 1EJTC 5LNRA 4IPJA 3SCVA 3ECQA 2HVMA 3H7VA 2W92A 1TRDA 3B9NA 3L8KA 2NW0A 4A8NA 1LLWA 1MFVA 5DMYA 2IKGA 3TLLA 2WV8A 1NY1A 3CZJA 4QE1A 1V6UA 4GA8A 1HVXA 5FJRA 4J28A 1X39A 4ZQNA 3II1A 4H9ZA 4MZYA 4L6DA 1OCJA 1A5OC 1WXYA 1D7FA 3PTQA 3L23A 4OV9A 1EJWC 1UZDA 2AQWA 1ZX9A 1XPYA 1JPMA 1B3ZA 5A2CA 2QPSA 2TAAA 1WKFA 3AXXA 1RA0A 1IWAA 4J5NA 4DJDC 4CQBA 3EAUA 1NAL1 5I02A 1IE7C 4MNKA 4LTSA 3W83A 3F4VA 4LYKA 4LRTA 4GYJA 2BTMA 1HL8A 2O4QA 2UY4A 4XIAA 4Q8TA 2WCGA 2VEIA 2WMKA 1JD7A 1OADA 3GK0A 3PK7A 2F61A 4V2XA 2QAPA 3RDKA 4JIEA 3W7LA 5FESA 4RDZA 1PCKA 3OJGA 3TYDA 2XZ9A 3N2TA 4Q6JA 1XH2A 1R38A 3I68A 4H4IA 4FNUA 3LMZA 4GQGA 2H90A 2HNEA 1TPH1 1TA3A 4HJWA 4CCZA 1IEVA 1FWJC 1M7OA 5TF0A 1VF8A 4XZHA 1DWHM 3G8EA 2HZGA 5M17A 2R1MA 1PKLA 5E1QA 1UWTA 2YBTA 1Y5XA 4B16A 1VR6A 4W86A 1FFRA 2PP1A 1Z48A 2H8ZA 2EPOA 5CPLA 3WLMA 4WJEA 2JF6A 3EOEA 2FDSA 1C29A 3VM7A 1MZHA 2DDXA 1J18A 4JICA 2ABAA 3VFLA 1GW9A 2CBJA 3W2LA 3CJPA 1W1A1 1KFBA 1J6OA 2RDUA 1DWIM 1N60C 3Q37A 1U1UA 4AF0A 2ZRUA 2R1LA 4MIMA 3DH9A 1P0KA 1YBQB 1TUXA 3UJFA 2VEMA 3UWZA 8TIMA 3CHEA 5HWMA 3UESA 4AD5A 4XKMA 3BW4A 3NJ3A 3WY1A 4DBEA 1JDEA 4NHVA 4XBSA 3ID7A 4UTJA 4S3EA 1DJIA 4NNAA 5F2GA 2IKHA 3ZR4A 2XIOA 1I75A 3R13A 1AW5A 1GGOA 1PKNA 1NQ6A 1TPUA 5FAGA 1W3JA 4TVCA 2F8QA 4R27A 3MS8A 4L9ZA 3VGBA 3TZNA 4NZCA 3IVUA 2NT0A 2C3ZA 4DNMA 4GK8A 3RO8A 3QTGA 1G7UA 2VXNA 5A6TC 2AGKA 5AOUA 5FMHA 1NDYA 3A47A 2ISDA 3KRBA 1JPKA 3CUIA 3WFZA 3REQB 1KQYA 3ZOAA 5C9WA 2J7HA 1M6IA 4N9CA 4IGNA 4ES4A 4H4YA 3UWUA 2PGRA 3NQVA 4KIRA 1WOAA 3C61A 3LK6A 1GOQA 1VZWA 1XUUA 3DK8A 5CAHA 4HIBA 4HQVA 3TC7A 1NHSA 2DSKA 1ELSA 3T0TA 5HWJA 4DHGA 2DIEA 3L66A 5DXXA 4BQ3A 4HOXA 3V0TA 3KHDA 3EB3A 3CUGA 3FJNA 1WV2A 2G3FA 3ALFA 5FF2A 4B3ZA 2BVWA 2VX6A 4LIIA 1SFLA 3M7SA 3U2CA 1ZXIC 2WNNA 2Q09A 3MVIA 5D32A 4DBSA 2VR2A 3WLOA 3RJXA 2PE4A 5G4WA 5IOBA 2OTDA 4JX5A 3C2EA 4S38A 4O57A 3N4AA 3W74A 3S2CA 3GHUA 3Q45A 3WMCA 1H63A 4JTRA 3B05A 5H8PA 1V97A 1GOXA 2TPSA 3CAQA 3BGAA 3HGOA 4MY9A 4IICA 1YE6A 3CYVA 4X60A 3DFQA 4UQCA 4A8LA 5HWNA 5IRPA 7REQB 3TC6A 4FNSA 4D6IA 4A35A 4ZQOA 4LC8A 3FG2P 1BYBA 3P61A 1U22A 4F2BA 5HNNA 1POKA 3GTFA 1EJSC 3MKVA 4GWEA 3BOXA 5HJLA 4NNCA 4CN1A 2WBAA 1AW1A 1MW1A 4D6EA 4HSOA 3W1RA 4IQJA 2Z4GA 3SUTA 2DZXA 3SR6B 1DYSA 3EOOA 1HX0A 1OX4A 4QNEA 4YTSA 4PMNA 2CHNA 3L2MA 4O4WA 3TYZA 1QOXA 3NVYB 3VKBA 3NQ8A 4JTEA 2DP3A 3MO4A 3O6DA 4U3AA 1KFLA 3PPCA 4HA1A 1XWYA 1WCGA 2V38A 3T4CA 3TSMA 1GERA 1MEHA 2WPFA 3KP1A 1IWPA 3H21A 2DZTA 4C91A 3QSTA 1C92A 1ZNNA 2YA2A 4JN6A 1RA5A 2BY0A 3MUZ1 3FN9A 4MLRA 1V6VA 4JN8A 3MZ2A 2WHLA 3DFHA 5K4ZA 3JU2A 2GWGA 2D22A 1VKFA 3O9NA 1F3XA 2IXVA 3AMKA 4RPQA 3EKLA 1YXYA 2EPKX 5CJMA 1TMQA 1H09A 5D03A 3RR4A 1DKWA 4GYKA 1EA9C 5G4HC 2VQUA 4HNCA 1NSJA 3VABA 4GYFA 3GBEA 3UR2A 1NP2A 5A95A 1JDFA 2WMHA 4ORIA 4QXIA 4KCTA 2FDMA 5C9ZA 3UXAA 3OQ8A 1EP1A 2HE8A 2PWEA 4B3KA 1EYEA 1GEHA 3FYOA 3R11A 3NQ6A 3WLIA 1FWEC 4ZOBA 1UWQA 4D71A 3M6DA 3BSHA 4PTDA 4CN4A 1UJPA 3G18A 4HN4A 1XIMA 3VC5A 1IXOA 4TMCA 2IQTA 4MAZA 3VVGA 4RDWA 3WQFA 1P1MA 4EANA 1GXFA 1UYQA 3B03A 2XWDA 1EOKA 1TPFA 2OKOA 3V35A 3G22A 3DYMA 3AXKA 1QNVA 3WQ8A 4O8RA 3ITOA 3M46A 3PSWA 2OCZA 3TTSA 3EX6A 4M6QA 4PCNA 2WM1A 1TV4A 1O1ZA 4WKFA 4AQLA 2YZ5A 3RCNA 5GNZA 3KVLA 5FS6A 4HPXA 3R89A 1UBSA 1GKRA 3RR1A 1I0BA 5DBUA 3E74A 2OJPA 2NLYA 3C0LA 5AHNA 5I5RA 3ZXWA 5HQMA 3PUOA 2BNJA 1LL4A 4IHCA 3BURA 3PWGA 4POCA 3S5NA 1ZJAA 1TCDA 2EHHA 2WBGA 3L4VA 3GD6A 4LVAA 2C3DA 1TQXA 1ZY9A 4TMBA 2RDXA 3ZLFA 3P67A 3OBAA 3IVSA 3A4AA 3B0PA 4QLJA 5HDRA 2HK1A 3BLEA 4GNJA 1AQMA 5AVHA 2AL1A 2W79A 3QN3A 2NQ9A 4GYPC 2FZ9A 3TA6A 3VE7A 1X2HA 3TN3A 2R1NA 1GOMA 3N18A 3WQGA 3IK2A 3WD1A 3L4WA 2X0SA 1K9FA 2Z6IA 4AVNA 1TPB1 3II4A 4PBGA 3VKAA 1GKPA 2V69A 2QJJA 5JRBA 3VE9A 3QPEA 1EX5A 3KE0A 3PUDA 4KQNA 3P5ZA 1ML1A 3AXHA 3P0WA 1ESWA 2CIPA 4BQ4A 1M01A 3W2NA 1WUEA 3KDNA 4YNGA 3M07A 3GG8A 3BZJA 2JIEA 4BR1A 2VZOA 3CAKA 1KGXA 2VC5A 4PMUA 4JOMA 2DIKA 4AVFA 2CPUA 2WZTA 1R7OA 3WEOA 4ORMA 1WYIA 3W23A 4JHZA 1U2YA 3TQ0A 5D38A 1XGEA 2NVCA 2YW3A 1IR2A 2QDHA 1OG6A 1YPFA 3FEMA 1FFVC 2GDUA 2GJXA 1IWBA 4H6KA 1REQB 1FDZA 2J27A 3CQIA 1V08A 1D2KA 2R14A 4J3SA 2R9RA 3HTWA 3ABZA 5D2WA 4DY1A 2PDNA 1XYMA 2PDBA 4IIDA 2BY2A 1RQEA 4NX5A 4MG4A 3RX4A 4PBEA 4CCEA 1QTWA 1VFUA 3PB2A 3GO2A 3M1ZA 2JBMA 3H2MA 3GUGA 6ENLA 3SRFA 1DE6A 3I6TA 3BCJA 4KFPA 2HBVA 4I7WA 1IGWA 5A6KA 2ACUA 1CI1A 4MJZA 1HUVA 5JH1A 2C71A 3ZLGA 3URNA 1US3A 2VRKA 2WNWA 3G6MA 4S2BA 3LBCA 2JGYA 3QOMA 3LGEA 2QVNA 3NQDA 4GFIA 5G1TA 1IEQA 4KWWA 5HPCA 5H2ZA 3MSGA 4UUIA 3CQKA 5CSUA 1SMAA 3U4FA 2GZXA 5CBJA 1E4NA 4DLFA 1Z32X 4KFOA 2UY3A 1EGVA 1YXDA 4U2YA 4CNUA 5AFDA 1QHZA 3TN5A 4F0HA 5TAOA 4F2UA 5L9FA 1IXQA 4JYFA 3L68A 2J7CA 4Q8PA 1SZNA 3BQ5A 4P5UA 1H60A 4HKPA 1DPMA 1H11A 2O7QA 2OX1A 2ZE0A 4HU0A 2BWGA 1CYGA 1EXPA 3W27A 1ZFJA 2PBGA 4V1YA 1ODZA 1IZKA 3GY1A 3JZUA 1OINA 1LL6A 5CSSA 3NPVA 1RR2A 4OBSA 4PH6A 3RITA 4NYYA 3BC9A 5FACA 1MNSA 4GR1A 3JR2A 1H49A 1GJPA 1WKYA 1QRQA 3THCA 3UCCA 3V1PA 1F2JA 5F2IA 1A3WA 2PPGA 1UR3M 3H70A 3E2RA 3O06A 1MO0A 4DBWA 1NHPA 4FNTA 1O95A 2CHRA 4C6LA 2F6UA 1HJUA 3H4XA 1CENA 3EBVA 2IPWA 1LM1A 2A21A 4IFKB 3TDFA 4FA3A 3LXCA 3H8AA 4X0NA 1XG4A 3M64A 1UW9A 4EWJA 4TVWA 5E6ZA 4IXXA 3FYPA 2XG9A 5KVHA 5DEZA 2GUBA 2I5IA 1NELA 4JX6A 4G7EB 3UWWA 4P7OA 1TZ9A 1EX1A 4A3RA 1M68A 4CQAA 1KNWA 4QM1A 1KN0A 3BOFA 4K7YA 4A3UA 3DFNA 1XIGA 1S5WA 1CB7B 3N6JA 1RY0A 3MKCA 4JQ1A 4AF0B 3GFZA 3DJGX 1G69A 2YXGA 4PMDA 3L4ZA 1F05A 1SFSA 3D3AA 3VIJA 3V5FA 3A7AA 4BI6A 3WK3A 4X2RA 3WLQA 1E0UA 1VYSX 4AZIA 1FFUC 3NR0A 3PY2A 1HG3A 3NPUA 1V6XA 2DQWA 3BARA 4GIAA 4Q8QA 3WQOA 2VX7A 1X98A 1TRIA 4NVTA 1RK5A 4QAIA 1KO0A 3V75A 1GYLA 2F38A 2OZ3A 4QITA 1RALA 1PCWA 1XL9A 5A8QA 4QAWA 1J8VA 1LDCA 1RLDA 1UD6A 5D04C 3TR2A 3UG3A 1KM5A 1TWSA 1SZEA 5JCIA 4R34A 3ZWSA 1FWHC 3ITCA 4KW2A 2DZSA 3WJZA 2IPFA 3DECA 3BAIA 1AQHA 4Z08A 3GDBA 3WF1A 2FZDA 4FNRA 3HRDC 1LBMA 1JZ5A 4PCFA 4QE4A 3OGSA 3AO0A 1UUMA 1K6AA 4HCHA 3F4NA 1QNOA 3URAA 4PB3A 5CZJA 3SUSA 1W3HA 4UTWC 2PS2A 4FX6M 1F61A 3G77A 1K3UA 2G41A 4GJJA 5GJPA 5DF0A 1XH1A 4AIUA 3CTLA 1FKWA 4BURA 1S2UA 3MKKA 3FK4A 3TFCA 5FS8A 4QE5A 1XIHA 1XGZA 2YL6A 2ZC1A 3B8TA 4ZMGA 5FL0A 2C18A 4JTSA 4C7FA 1OIFA 3AWOA 2ASHA 3Q58A 4AWEA 3MPGA 4E3TA 2Y7GA 1QI5A 1F5ZA 4O1CA 1VEPA 5CSYA 4PMRA 4B4FA 1MNZA 2QJGA 2QXWA 4YTRA 5JBDA 1BWCA 2F9RA 1V3IA 4FNPA 4H4RA 1YTKA 1TVPA 3T0CA 3W2JA 1WAWA 2CFYA 5KZDA 3W1PA 1M3UA 3RILA 4JTAA 3M0MA 4FLRA 4ENLA 4S3JA 1V7AA 3DIPA 1V8EA 3GXTA 4EPDC 1GJUA 3GG0A 3UXLA 4BEQA 3T7VA 4MB5A 5TR3A 3WENA 3SADA 1HGYA 4N42A 4HNOA 5EGRA 1V6WA 1JUBA 5I6SA 4XSMA 4YL2A 2CBUA 5HANA 4BKNA 2XVKA 3PTMA 1UP2A 4MB3A 4I9MA 2FPTA 2FHFA 2Z2BA 2YBVA 1SJBA 5IFTA 1FH8A 3T9PA 2PZNA 2X8GA 2NUYA 3C0QA 3VFCA 3W7OA 2FVLA 4ERAA 3KBWA 5I77A 1Y5WA 4M7TA 2GQAA 1F6KA 2QJNA 3LOTA 3QH2A 4LQ1A 3MA8A 4GXMA 9RUBA 1OX4B 2HS6A 1OX5A 1VFFA 2C8NA 5I79A 2QZRA 5HMEA 3K8LA 2XWEA 2UY2A 2IW0A 2I7GA 4XZMX 4AB4A 3IIOA 2QR6A 4R7WA 3R0KA 3BAXA 4JFWA 4A2SA 2QUUA 4DBUA 1QI4A 2X30A 5AB3A 1OFBA 1XLHA 3KUMA 4WY0A 3VOFA 2OB3A 3RMEA 2HTMA 4QS5A 4EPKA 1J0KA 3CUZA 3AMGA 4M6VA 3WBWA 1BYDA 1J5SA 4AZ6A 3AM9A 4ADTA 5D09A 1Q1WA 4ONVA 1I2RA 4JTKA 4KWUA 1V0NA 2ZX9A 3RPMA 1YMYA 2QUTA 3S83A 1FCQA 2ZX8A 1HZYA 4PMZA 3EWXA 1V3HA 1G4TA 4CVUA 1Q6DA 3KTCA 1JRPA 4HHLA 3AIBA 3H6OA 3NQ2A 3R43A 3RM9A 4H50A 4HGXA 1OM0A 4KCUA 3QVQA 3LCHA 3NG3A 4B5WA 3VIHA 5HULA 4M52A 4QFUA 1HTIA 4DF2A 2QGHA 3N04A 3CWOX 3GR8A 1WDQA 1H7XA 3EWDA 2H3DA 1JFHA 4C6NA 4RE3A 1JCTA 5CLTA 2PDCA 3L2IA 1H7PA 1UD5A 3ELFA 4A2RA 5FEWA 1GCYA 2YR1A 3PTKA 3KBMA 2JF7A 3B0UX 4X63A 3LG3A 2V81A 4AX6A 4EF8A 4H7CA 1V0KA 3A5FA 2QVHA 2ISSA 2VFHA 4O17A 2RDWA 2GVJA 2CLEA 4GQBA 3WDHA 1Z41A 4ZZ9A 1E0VA 4EQXA 1DWFM 4JR5A 5LHEA 1QWGA 2OEKA 3WD3A 2OLSA 4Y90A 1AG1O 4V1XA 4EAYA 5M2FX 4US5A 2J78A 1VLWA 1PWLA 1TG7A 3VNDA 2ZX7A 6TAAA 1MUMA 1QPNA 5C7VA 4YCPA 5C7HA 4JL1A 4F9DA 1S7MA 2QUVA 3HQPA 4Z2HA 3L12A 4BK9A 4MWAE 5FJOA 3NEVA 1IEXA 3AQUA 2VZSA 1MVYA 1MQQA 5RUBA 2GQ3A 3FA4A 4LA1A 3AZTA 4C6DA 4Y96A 1VBGA 4HU4A 2WHJA 1LOQA 4N9DA 4GHRA 3QV8A 3RAOA 1IT7A 3N4FA 4QS6A 2J4GA 1OFOA 2REQB 1H4PA 3N14A 3QZAA 1R46A 3WO8A 1C9DA 1LBFA 3OVGA 1E51A 3NL6A 3EPMA 4AMAA 4NY2A 1OCBA 4GINA 3LPFA 4OKDA 1YADA 2HROA 3SFWA 4MY8A 1X6NA 3NQCA 1HNYA 5G5GB 4LS2A 2C0AA 1O5RA 3IPWA 4LALA 4HVXA 2CDUA 3XISA 4DM2A 4R7JA 3MUY1 3POHA 5BOEA 3GD3A 3PNZA 1A5LC 1F4HA 3UZXA 3A7UA 4I3GA 4GZJA 3N9KA 4O19A 3EPOA 4I6VA 5HUPA 4BJHA 1QNPA 4O11A 2QF7A 3F2DA 1EYWA 4H6EA 1MO9A 3PS7A 4L4LA 4ZXLA 1LT7A 3LCWA 3C5QA 3AMDA 1VRDA 2WANA 1P0BA 4GVGA 1Y0EA 5BW6A 4DI8A 5AKQA 3KS6A 3G1SA 5D02A 2BHUA 1WXJA 2WOVA 5AYYA 4JNYA 1JNDA 3N19B 3T0AA 1NARA 2ANUA 3VNYA 5B7ZA 4IXHA 2QYGA 5C5YA 1JUEA 2DSVA 3N6QA 2EKGA 3IARA 3G1RA 8RUCA 2DORA 1OJTA 4R88A 2J74A 3T81A 1EKOA 5FD0A 3L5LA 4W93A 2OLHA 5D9PA 3W7DA 1JR1A 7CGTA 3HJZA 5K4XA 4M51A 1J11A 1BSLA 1WYGA 1QW8A 4P7NA 4DJDD 4LC6A 4D2JA 2ZTKA 1IXPA 2HRWA 2ZA2A 3K46A 2BXVA 3S46A 1BQCA 3PPHA 3E02A 4F48A 4WCJA 5CZKA 4UCFA 5FKYA 3UG4A 5A8NA 3CPRA 2QV5A 4L5ZA 5JQ9A 4NNBA 4CUCA 3CV2A 3LV6A 3R12A 3ZSSA 3G3DA 3GKAA 3TQKA 2DSUA 3GRTA 1KGWA 3GYEA 2GOKA 4FF5A 1QATA 4OT7A 3GFXA 4K68A 3SECA 4RK8A 4TQTA 3WBXA 1TTQA 4LCSA 2PEVA 8XIMA 4JL2A 4DJED 1K03A 3RLVA 3BLDA 3BW3A 2C1IA 4WUIA 1DWJM 4NJHA 3BG5A 4GIEA 3MDWA 1QMLA 4K39A 4PUEA 4JTGA 2WPBA 1ZL1A 1EUNA 3IGSA 3ZJKA 4GQ0A 5CQ1A 1JZ6A 3SY5A 4B2DA 3OHIA 3VOCA 5BXSA 3URBA 5KZEA 1DVJA 1PKYA 1FWRA 4KEVA 3OA5A 1CPUA 4CU7A 4UTWA 5FSDC 5G2WA 2YAUA 1G4SA 3T6CA 3K13A 5DRIA 4E2OA 1IZCA 7A3HA 7TIMA 3U3HA 3GDLA 3PNUA 3VOGA 4APNA 4GZIA 1SO5A 2WKGA 3IK4A 3RIKA 3UCDA 3OVPA 4NUWA 1AOGA 2JK2A 4N6FA 2J88A 4CD8A 3PAOA 3Q4DA 1YLVA 1B9BA 1LG1A 1JZ8A 3TMLA 3GW0A 4P7QA 1MEIA 2RUSA 1XS2A 3A3WA 3OVQA 4DNHA 4QTGA 4LS1A 2INZA 1XRTA 4ZQRA 1ONEA 4Q33A 3UVIA 2VQTA 3XINA 3PR2A 2PLKA 4DM1A 1ECQA 5JH2A 3AWNA 1KM4A 1SUXA 1H5VA 1WBJA 4IPLA 4JDYA 3QY7A 4GI8A 4ACZA 4W8AA 1EHNA 4ZO7A 3T0DA 2Y5JA 3EX3A 1JPDX 2BG5A 2DT2A 3TIMA 4F79A 1M65A 1GVEA 4C6EA 4LS0A 2R94A 3BWWA 2CESA 2YB4A 2VZUA 4L6OA 1GVFA 1AH4A 2WSKA 1JI2A 5JBFA 1NWRA 3BSGA 4C6QA 4DO6A 4D72A 1DJQA 3NM1A 5HNTA 1DHPA 2ZFAA 1QAPA 2KZHA 3M5XA 3SDOA 4JY9A 3OLDA 4OWGA 3SRDA 1FVPA 5CGMA 1N2VA 1W8SA 1J01A 2E77A 3RM4A 1W5MA 5AYIA 4FX9A 3SO7A 2XGZA 3FXYA 3THAA 2ZKMX 4UNLA 3EXTA 1BLIA 3I4KA 1BYCA 2MANA 1P43A 1P5BA 2HCVA 3EF6A 3KOYA 2E6YA 4LVFA 4UQBA 2JK6A 3QLLA 4LJ3A 1UA7A 4E4FA 5MF5A 4QEEA 1CT5A 4Z1DA 2ADAA 2Q02A 2XYLA 3OLIA 1LRNA 3PG6A 2DH3A 3VXGA 5I00A 4PUWA 3IC9A 1W1PA 3WL0A 6XIMA 5A94A 1XDIA 1M04A 3QGKC 3I6EA 1B3OA 4TXEA 4AD4A 3PFMA 4FI4A 5K9CA 3QY8A 2BC0A 4QGCA 3CB3A 4D1JA 4GE8A 2KAUC 1EWEA 2E7FA 1XW8A 3A23A 1VPYA 3GZ3A 5KEZA 4GUJA 2GJPA 3IVTA 2VCCA 2YA1A 5EMJA 2V6OA 2ZVIA 4ZVJA 1XH0A 2BZNA 2WNQA 4OECA 4IJBA 2NVKX 3LDVA 2PDUA 1S5NA 3LUTA 2HDJA 2RH9A 2Y85A 5A2BA 3LB0A 3R1ZA 3MB9A 4HNTA 3BDKA 5EBUA 5F4WA 1OC5A 3H24A 4HK7A 3T05A 3ARVA 1R3QA 5AN7A 4UQEA 3A6OA 3O1NA 1IYXA 1XLFA 4GNKB 3G1VA 1K7EA 2YCLB 4PR4A 3L4TA 4IIFA 3VMNA 1V93A 5GNYA 3TJXA 1Q63A 3EDFA 1JRBA 1Q6QA 3UPWA 3K4DA 1ZENA 3W7MA 1M53A 3KDOA 1UA3A 4QX4A 3T78A 1J10A 3VILA 3LSCA 3UVAA 1UROA 2GSHA 3JVAA 2QMJA 5DANA 1LLOA 4JIQA 1JULA 2D0HA 4XUGA 4HTBA 3BE7A 4XVEA 4O15A 2EKCA 2Y8KA 2HQAA 2WC4A 4HMCA 1QOPA 4EIVA 4XO7A 3DG3A 2RAGA 2VEFA 3AIWA 1GPFA 4YTTA 2V8ZA 4HNVA 1DL3A 4FPSA 1Q6CA 2XGIA 4B92A 3SFKA 3NZRA 3AIUA 3W84A 2QJHA 3EWCA 3K4WA 3R07C 3S5OA 3PG8A 4BF5A 1C91A 3PJUA 1VEMA 4M80A 1Q1RA 3GDTA 1X1ZA 4OFCA 4FZIA 3DAQA 5I2UA 2GH5A 1K02A 3LD5A 1VH7A 3OYXA 3MP4A 1YPXA 1T99A 4JTIA 3M43A 5FEPA 1GSNA 3GUWA 1KW1A 2J8TA 3VIPA 2VEGA 3NA8A 3W1XA 3ONCA 4UZSA 1UD4A 4RR4A 2XSXA 4NZ4A 1XF0A 4ZOAA 4IFRA 3VO0A 4RNFA 1W2PA 2Y70A 3STFA 2V3BA 1ONWA 2YDQA 1SFJA 1P0EA 4H9VA 1X6UA 2QPXA 5I7GA 2VENA 4Q7NA 1QDSA 3U8GA 4J3ZA 4H4VA 1XRFA 2YJQA 1ISWA 2CWNA 4AYSA 1NP0A 4U5KA 3RUBL 2D2HA 4NU7A 3NL3A 3TXVA 1B4EA 3NSNA 3ALGA 4AIEA 3LTSA 1L6GA 2FZBA 2G4JA 6PTDA 3TCSA 4PB5A 5CBIA 4MJMA 3ZT6A 5DT7A 3ZYZA 1NDWA 3W1QA 2ZXDA 1E1CB 2ZOXA 4AEEA 1N5WC 4RDYA 4QLLA 5DBTA 2F5ZA 1F8MA 2OU4A 3FSUA 2MUCA 4DJFC 5D37A 5EBKA 2Z24A 3UGRA 4L9XA 3GIYA 1DJXA 4LU0A 3F4CA 1XPGA 6A3HA 1A4LA 3KBVA 5D8ZA 3OB8A 4IMEA 3PZVA 1LORA 1U30A 3MP5A 3VOIA 3R4IA 4GO9A 3AU2A 2DW7A 2ZQ0A 5CH9A 4A8IA 3O16A 2YDSA 2QIIA 2E67A 4A3QA 4XVDA 1WDDA 1WNOA 3ZR6A 3T07A 3N6HA 1KRCC 2AQVA 2XPKA 1AZ2A 2TODA 4Q32A 3RCMA 4Z1AA 6REQA 3NO3A 2RHGA 4L4OA 4QRNA 3GTXA 1JCJA 3V3WA 3VMPA 3BLFA 4LPCA 2PSNA 1DOSA 4NZ1A 2NQZA 3C8NA 1TIWA 2VGIA 1LG2A 4GH1A 5FIPA 3PZUA 3SBFA 4WDWA 4DZIA 3N17A 4YJ5A 2B81A 3AXMA 4PFMA 1F3EA 1GVQA 4AC1X 3M0KA 3NDOA 1GHSA 5DLCA 1TCMA 5A3HA 4TVDA 3ZVIA 3W37A 3W28A 4UTIA 3THQA 1E5JA 4WVXA 1F8IA 3A4XA 3GX9A 1Q6LA 4PODA 4XTDA 2BOEX 3W1UA 5F4SA 4DB7A 4AX7A 4MFDA 2NXHA 4PTXA 4W7WA 1ITXA 1OFDA 3WDJA 3HJEA 1VLIA 3SCTA 4WXYA 1F6YA 2CYGA 2XH2A 3REQA 3UF9A 4H01A 2GGHA 1JPHA 4IJCA 4BF9A 4C7DA 4X61A 4PCSA 3FLUA 4NJGA 1TVLA 3PPGA 3KHJA 4YTQA 3U0HA 1H7WA 3NZPA 3QV7A 4U2ZA 2NT1A 4WOZA 5T26A 3S5SA 1TYPA 1LQ0A 1W3KA 5A6SA 1S1RA 5HJYA 2H9AA 4XBJA 2OZ0A 4PL1A 1RHCA 1I2QA 4FIRA 1FO4A 4P7RA 1B0IA 4EF9A 4J7RA 2TMDA 4GVIA 4Q8VA 3LCLA 4HZ6A 1YDYA 2PURA 5FAJA 3WK2A 2ZRYA 4IUGA 2PA6A 3BZGA 2Z0IA 2J8GA 1PX4A 1G9HA 4DNAA 1K4HA 2TYSA 2QF8A 2BCPA 1BFNA 4LYRA 1OFRA 3QMTA 3WEMA 2PDMA 3MT1A 3G1XA 2F6KA 4I9JA 3M0VA 3DI1A 3SUWA 3Q94A 2FMNA 3MW7A 1ODUA 3KZPA 3TKFA 7REQA 3W02A 2VHLA 4XAFA 4EXBA 3UBPC 3JUGA 4IM4A 4MY1A 1XINA 3BICA 2W61A 2EPLX 3DHFA 4DAFA 1IT8A 1TB3A 2VCBA 4W9TA 1BQGA 3FNDA 4UQ9A 1B54A 5C2XA 2CC0A 2OGJA 3S4TA 1ZALA 4U28A 4UZUA 3B9DA 3W86A 3LXDA 3C2RA 2DZPA 3PJWA 2Z29A 3CXBA 5FJTA 1ICQA 1Q2RA 3A3HA 3PPFA 1F8WA 2OWXA 1RY8A 1NOWA 2DZBA 3G1HA 2XFYA 2A79A 2QW5A 5IBXA 1Q6RA 2P0IA 1RCXB 4TX9A 2AL2A 4DRSA 4KRUA 2WMJA 1XFCA 3CHVA 3OZYA 4JQ2A 4LUTB 3PC0A 4DO4A 5JCLA 4WKAA 3F5KA 1DNCA 5F1VA 4HMDA 3EKGA 1KWKA 3W4RA 2PGWA 5A2AA 5E0CA 4HU3A 2PDLA 5JU6A 3GC5A 3N2OA 3UJ2A 3EXSA 4CD4A 4AH7A 4FXRA 3B9EA 1TPC1 1PZ1A 2YCIX 2QDGA 5C70A 1PX3A 2WP5A 2X1RA 3DC0A 2DIJA 1ME7A 3FCPA 2OWCA 3FEQA 3VOJA 1W5NA 5KZMA 3Q67A 2CLHA 4HMNA 2YL5A 1L6YA 5CPOA 3IGUA 4RJEA 4F0SA 1ISYA 3N73A 4KRZA 1TZZA 4IFOA 1GZGA 2DVTA 3MP3A 2ZRVA 3S0CA 5C6MA 1UD8A 2WZIA 1PSCA 1XLKA 4IP7A 4ZXOA 3HO8A 1TWIA 2XFWA 4H2CA 3E49A 3WJXA 2QJIA 1E9LA 1W3IA 1GYNA 4DPQA 3W75A 1BKSA 4NAEA 4JDBA 1R0MA 2X7VA 4K8GA 1R3WA 5MKGB 1SVDA 4O0ZA 3HGRA 2MNRA 4EMJA 1PEZA 4JTCA 2W66A 3RM8A 1N8FA 4ILSA 4OJYA 4L1XA 4TX6A 1AA1B 1J0IA 4XD3A 4B9ZA 4NZ5A 4ZSTA 1GQIA 2V5JA 1KM0A 4WSKA 3N3TA 5DT5A 2PI6A 4U4MA 3RK8A 2Q8ZA 5CC3A 4JD4A 1NFPA 3DYOA 2QCEA 3TWBA 2J79A 2XSBA 2V5DA 1FXPA 2FMOA 3E2VA 1PZ2A 1R9YA 1SYTA 1QJWA 4DXVA 1FP8A 1XYLA 1YDOA 4JEJA 4C60A 1Q7MA 4P8UA 5KETA 2YVFA 1YEYA 3LSBA 1HL9A 3L7RA 5CC7A 3S5ZA 3N1AA 2CKSA 2ZXAA 1RCOB 3R5EA 1VFOA 2Z1VA 3MUXA 5E9AA 4UR9A 1GQKA 1QK0A 1W2VA 3KXQA 4B5NA 4ZEPA 3PBUA 1UC5A 5J04A 1DE5A 4J2PA 3P82A 3G0SA 1OYAA 2E5DA 3KBSA 1RQBA 1V6YA 3QW3A 1WKDA 1VBHA 3DJJA 1GT8A 3LXAA 2PC4A 5A6BD 4Y2WA 4GC4A 2DZAA 4JY8A 2PF8A 1UBPC 1XM3A 3W1TA 1E6QM 4PZVA 2Z6JA 5A6BA 1BG4A 3OGRA 2XN1A 4EE9A 2YCLA 3ARXA 5EMLA 4AY8A 1FHLA 3GNOA 4TVUA 3NQGA 4YYFA 1WO2A 3NWRA 4E5TA 2OYMA 4A21A 3H2FA 2QS8A 2WXDM 3L65A 1QPKA 4HCDA 3UWYA 4ZTYA 1Q65A 3KX6A 4DO5A 1AJ0A 3ABRA 1YX1A 3GBDA 1UH3A 1ISXA 1XDLA 3HMCA 4N6EA 1VYRA 2FVKA 4W88A 3QGAC 4UFHA 3TYUA 5CGTA 4E4UA 1EBHA 5HUOA 4ATDA 4BS0A 1PO9A 5U1OA 1VP5A 4H4SA 3CM4A 1UMYA 2WW5A 1W31A 4GVFA 2YKKA 3W7GA 3HPXA 2G37A 3CH9A 4AWSA 1VB9A 5C2GA 2B0MA 5F2MA 5GNXA 3QFBA 3GRSA 2G95A 3PJXA 1YNQA 5A8OA 4KEUA 1GRHA 5EPDA 1KKRA 5FEZA 3LMYA 1FCBA 3QV6A 3DDMA 2I1OA 4XK2A 3ZLHA 2BS9A 4N4QA 1E72M 3GNXA 4AFYA 4ADUA 3SI9A 3OZPA 1Q6FA 1DJGA 3GHSA 2NVAA 4Q4QA 1UR8A 2V67A 2BBFA 3MYOA 1B31A 1A53A 3S2NA 1R5YA 2X0YA 2R24A 3BTNA 3JRKA 3AYVA 2D24A 5FL1A 5SWUA 3SSZA 3S1WA 1VBRA 1KTNA 5TBOA 3CEPA 2NUXA 3LY0A 3QHNA 4K3ZA 1KBIA 2WYSA 4H6RA 3D3FA 2Y7EA 4K8HA 4CD6A 3WJYA 2XDFA 4JTQA 3W9ZA 4J9JA 1UJQA 2ZRWA 2WJZA 2PZ0A 3KOFA 3CS2A 3W1NA 4G5DA 2IMRA 5JXQA 3N9SA 4MSSA 4IGMA 1JAEA 4W5UA 3HZ3A 1PDYA 3H12A 1SZGA 1ECEA 4XAZA 1PHQA 1AQ0A 4YN5A 3EOSA 4MKVA 4Q8UA 1VJIA 2EG6A 4BY3A 3CNYA 3SQPA 4ATWA 4LB4A 5AC4A 3T44A 5LHFA 1CX9A 4CCCA 1M1BA 2Z7KA 3B9OA 3Q6JA 1EQPA 5I3KA 2YPIA 1PUDA 4GISA 4PMOA 1MRAA 5C9XA 5IM51 2Z1KA 2ZE3A 2QCHA 1UZHA 3GWQA 4MWAC 3TN4A 4AEOA 3EWBX 4C6CA 4X9YA 1QVBA 3STEA 1S46A 1UD2A 3KZSA 5I07A 1Q6OA 1K6WA 3LEPA 4LSBA 3LHWA 3U9IA 3EMQA 3T40A 2ZZCA 3CLWA 3STCA 4AIOA 2ZZ5A 3AYTA 4UR7A 2QNEA 1H1NA 2Q3RA 3AI0A 3OQEA 1SW0A 3AYRA 3UYCA 1I2NA 2FYMA 5G2HA 1FIQB 1ZLPA 4IJRA 2VWTA 2ZZ1A 1T8XA 3UJSA 1T41A 3DHDA 2GSJA 3LHZA 3PULA 4S39A 3TA9A 3WBAA 3ARZA 1ZHAA 3DG7A 3IUIA 1IT0A 1J0HA 1NWTA 4UBPC 2CHOA 1KRBC 3UWVA 4JCMA 1H5YA 1XIDA 3BG3A 3B4YA 3LTPA 1DJHA 1V03A 5TQLA 3N12A 5TIMA 3V16A 4DYEA 4OVXA 3OGVA 4QJ5B 4TO8A 5DO8A 3WQ5A 2VFGA 4BI7A 4RZ5A 1CXKA 1TA3B 3PFRA 3SN4A 3FDGA 2ZXBA 3NPXA 1JPIA 1RXOB 1YDVA 2DT3A 2BFGA 3FGCA 4CQCA 3SQMA 1NM9A 2I9UA 3LRKA 3NO1A 4KERA 3QKEA 5CC5A 2SFPA 4J1OA 3C56A 1WDPA 3VD7A 2WPCA 2XVPA 1R3VA 1A80A 3PP7A 1S2VA 1B3YA 1B30A 1E0XA 3QTPA 2VFEA 4AU0A 5DX7A 1WOBA 4Z17A 2GJXB 4W89A 5I03A 1DORA 4OBRA 5D2YA 5FF3A 3ARYA 3RYSA 2FH6A 1HT6A 3DKJA 3E2QA 1WPCA 1K8ZA 1JROA 5A8MA 2GR1A 4RNHA 2ONEA 5C0QA 3KVKA 1FWNA 3QQ0A 1TWZA 3CPGA 4J3UA 3TOPA 4EOUA 3OP2A 3RMJA 1YPIA 1OGBA 2OT0A 5D2XA 4AEFA 1GTHA 2ZDSA 2PCQA 3LBOA 4IIHA 1X97A 1ZBWA 2PGFA 1LBLA 1QT1A 1V51A 2J7DA 1OGSA 2WPEA 3LHTA 2EJ1A 2NWRA 4PULA 4IZGA 3NIYA 1D3HA 2Z26A 1QCWA 2IKIA 2W5FA 2A7PA 2FHCA 3K1DA 1ZY8A 4KEMA 1UR2A 1DIOA 1CGXA 4Q6XA 1ZAJA 1E73M 3MJMA 4XD5A 2O7SA 3QSRA 2J8FA 1J9YA 5AY7A 4DJEC 1I4NA 2E68A 3MBFA 3QC3A 1O12A 3V36A 4HA4A 4FLSA 2QKFA 4H7ZA 4N02A 9CGTA 3VGEA 2WMIA 3GTIA 2R6OA 3GXMA 4AD0A 3NZQA 4F3HA 4J27A 4O18A 2DUXA 2BXZA 3TFXA 4ZB0A 2V2CA 1YTEA 4K8EA 1TELA 2ZXQA 1LJYA 2DUZA 4O8AA 1ZAIA 1TPWA 3RPDA 5A69A 3TQVA 3W88A 3ATZA 3M0YA 1UPPA 4DUVA 1DJWA 4AHQA 3A7RA 3DGBA 3E0WA 3LX9A 3S9ZA 1DIKA 2Z1XA 5H6HA 3WLNA 1J79A 1CGUA 4TUFA 2D2GA 3UU0A 1WDSA 4ACYA 1SJAA 1ONFA 3RF9A 2V2HA 3TUUA 1XD0A 2WAGA 1GRFA 3BVJA 4GUHA 1FHVA 2B4GA 1IIHA 1GNXA 4I8YA 2DSWA 3DFOA 2FZMA 4L6HA 3CZGA 2G3IA 1AVAA 1GW1A 1QR7A 1EZWA 4M81A 2D3LA 4M1RA 1AL7A 1JCLA 1H2IA 4FMVA 2F7FA 2WQDA 1GVOA 2V3GA 2J9YA 1EPVA 3CL6A 3MO7A 3GVRA 3EA2A 1UWRA 4GKLA 1UPMB 1C93A 2Y5SA 4D9PA 4AHPA 3DN5A 4DX3A 4YTUA 4PCPA 1GVRA 2HVOA 2OYLA 2GPTA 2DY3A 2VCAA 1J2BA 4DYKA 2GUYA 2HVNA 4BV6A 3WCZA 4D6HA 2ZRZA 3N2CA 3HW2A 4JKLA 2GYIA 4QNWA 1F74A 4FDCB 1C8YA 3SCQA 1GYMA 3M5YA 4WF7A 4E2BA 3FSTA 1B9ZA 3VK5A 1YKWA 4NYUA 4NAFB 1M03A 1MOKA 1DWGM 4CU8A 1I2PA 3KRSA 4UMAA 3NGFA 1EO5A 1Y5VA 3S8HA 4QLKA 4FP1A 2QIWA 4GVHA 2WSQA 2BXYA 3DK9A 2FVMA 3EA1A 4H6QA 3C2OA 3NYDA 3SCRA 4XV0A 4GXWA 5F7UA 1XBYA 5KITA 1ZP3A 1D7YA 3PBYA 3VZXA 2GQ8A 3M0XA 3V1HA 3U2OA 2HE5A 3TW6A 4GPNA 4AZCA 3ITTA 2YCKX 2FGLA 5EBAA 4MADA 1TPDA 2CLKA 1KD0A 1TV8A 2XGBA 4TR9A 3FYYA 2OPJA 5AC7A 4OE7A 1XC4A 1ADOA 2QULA 1JAKA 4MWAD 1MEWA 4O1EA 2CZFA 4PSPA 1FCUA 2EQ9A 4BHYA 4JDRA 4B2DD 4PEEA 4NSBA 4LRSA 3WNKA 1DTUA 3EB2A 1TREA 1HKKA 5AZ1A 2TPRA 2AKZA 5FSEC 3F5LA 2RFGA 2PDYA 2P88A 4UIOA 4ZO9A 3MSRA 4XO6A 5EMKA 2HXUA 1IXNA 4QHRA 1YYAA 3S1UA 3W81A 4H9MA 3QFAA 1MRQA 3EMCA 3VMOA 2IPJA 1R87A 2H9AB 1AJ2A 1E55A 1TKKA 1XDJA 1C9WA 3IIZA 2WWDA 4EXQA 4QROA 4XZLX 1W9UA 3NVTA 4L9YA 1J0ZA 4EP8C 4M0XA 2I17A 3S42A 1DIDA 4R53A 3HN3A 3UG8A 1H0IA 3E96A 3G1YA 4W7UA 5JCMA 4V28A 5DY3A 1FY6A 5C8BB 2B31A 4PYSA 4RZBA 3E0FA 3RNMA 3THUA 1ZS2A 1PHWA 3USZA 3OYZA 1TVNA 2YXXA 3WDIA 2V82A 3KBJA 7TAAA 1SPQA 2HSAA 1XCFA 3D0CA 3WQ6A 2NUWA 3G2GA 1HQTA 1QWKA 1A49A 5AHEA 2OO0A 2YSWA 2GR0A 2IQDA 2VDHA 3CGEA 1E6RA 1RPKA 2V5CA 5I3IA 1OG0A 1JNEA 3HPFA 2HNHA 3RLHA 4EQSA 1RBLA 4HYWA 3KLJA 1A50A 3WN6A 1TX0A 2DZWA 4GD0A 1FDYA 3T42A 1NHQA 1OEPA 4WJ8A 1BWKA 4IG2B 3EZ4A 1HKVA 3SJ3A 4E8DA 3MZNA 3TW7A 5HATA 3WLLA 4MM1A 3MVTA 5ABHA 3CGTA 3KP0A 1UWSA 3HA1A 1UG6A 2BLEA 5D2VA 5JCNA 4M82A 5J5RA 4YU1A 4RXFA 4FR6A 1CZ1A 3ZVHA 3AS3A 3S9YA 4GKTA 4ICCX 3UXKA 5FS7A 1GETA 3N4EA 3NAVA 3WNLA 3WELA 3TK7A 4M56A 3TWAA 4PUMA 1OQFA 4EM3A 1R86A 1SW7A 4Z42C 4C1NB 3SJNA 1TR1A 3OIXA 1SFTA 5BZAA 3MSDA 2NVDA 3MI2A 1RCQA 1KA9F 2PD9A 3DK4A 2VOTA 2OSXA 4JTJA 3MWAA 4H4PA 1W32A 2NXIA 1PV8A 4GNVA 4NRSA 1TWDA 3LERA 1XLLA 3DESA 1R3SA 1LTDA 1MXGA 4RZ4A 1W9BM 1V3KA 4KESA 3AJXA 3M0JA 3TJLA 4JIIX 5U4NA 1OT2A 4MYXA 1ZJBA 4E8CA 5AHIA 2XM2A 4MKSA 2IKJA 4MWAB 2YA0A 3H55A 1G4PA 1Y65A 3PANA 1JCNA 1FWCC 1EO7A 1XSJA 3GKFA 3L9CA 3FW6A 1TIMA 1Z42A 5KVIA 3BL3A 4ML9A 4OU1A 4C90A 3T8QA 2A4AA 4WZHA 4QG9A 3K5XA 4LNCA 4UXDA 1ZRQA 1IZJA 4RUBA 1RVKA 2BY1A 3G0UA 5F1UA 1XX1A 1DXEA 4Q8NA 3QFEA 1RJRA 1JZ4A 4WDTA 3VIKA 1RQHA 1XIFA 3BLLA 3SURA 3QLDA 3BMVA 3HU7A 2ZUSA 1V59A 1ZZMA 2FFIA 2XSAA 1CCWB 3SCPA 4ZQPA 4YYCA 2OQHA 3NVVB 3U2ZA 1QNRA 4GUGA 2OX4A 3QR3A 5MHBA 4W8BA 4G2DA 2VT0A 1AD4A 1BZLA 1GZ1A 3AISA 5ABFB 4ACZB 4M1BA 5EMYA 1M6JA 1VBJA 2PP0A 2PTWA 2VEPA 1EJUC 2X1UA 1EGMA 3OU8A 5IHRA 4W84A 4GCAA 5CKSA 3ICJA 3S47A 4D6FA 2PTXA 3CT7A 4IGHA 4H8UA 2NX9A 3VYLA 3GDKA 1XG3A 5CLWA 1F3WA 1DJNA 1E6PA 1YNPA 3WF0A 3WD2A 3PZMA 2UZ9A 3BV4A 2FHBA 2UBPC 3LXBA 1MUCA 4JEQA 2YDRA 1JJKA 4Z2LA 1N5XA 4RDVA 1KXVA 5D4YA 2BGQA 4XZ9A 1BXCA 5IBXC 3WH6A 1VFTA 2REQA 3CQHA 4ATLA 4UB9A 3W0KA 4GY1A 1CGYA 2FKPA 4DZHA 1XBZA 3SW6A 2BMBA 1VJZA 3FY1A 2DPEA 1KTBA 1R9ZA 5FS9A 1FEBA 3EEZA 1UKOA 3TNOA 4YHGA 3EXRA 3HG4A 4AMCA 3TXZA 1GJWA 1K4GA 3SRKA 1E6XM 1C7TA 1HKMA 1LOSA 3UD6A 4BI5A 1NF0A 5BROA 3CGBA 3M0ZA 4OHQA 4N9BA 5M1TA 1GVIA 1O7AA 1W91A 1IQ8A 3OO2A 3CLMA 2NX1A 1QBBA 2BASA 3BLPX 5A6AA 4FR1A 4Q4MA 2BHZA 3LZ3A 1DJYA 3QHOA 4EPEC 3TVAA 3TTQA 1K7XA 4DJFA 3QW4B 2CNCA 3WUGA 1N8WA 3C8FA 5HMFA 1AUSL 4AC7C 1IF2A 3T55A 2J3NA 2V3EA 4I7UA 3MTWA 4B90A 4DELA 2GWNA 1ZU8A 1H51A 4C5ZA 2JE8A 3W82A 7ENLA 5EFDA 3IJLA 1O68A 1W8GA 2QCCA 3KVJA 3LS9A 2J75A 4Q4RA 1EBDA 3WNPA 2V2DA 5DXYA 2VGFA 2V3FA 3E1F1 2C14A 2VRJA 4IWWA 1QU4A 1NEYA 3WQWA 2CFFA 4US5D 3TU9A 4H7VA 3WJSA 5DQPA 2YIHA 1LWHA 3AALA 3CV6A 2WVVA 3VNLA 3WQVA 3ARUA 4C6MA 4JZ5A 5E70A 1E40A 2Z00A 3LYEA 1CXIA 1AK5A 1W5PA 2V68A 4DQWA 2CZEA 1R3TA 1TJPA 1ZKQA 3GH4A 2BGSA 4YIWA 5LNWA 4MLJA 4LXFA 2WC3A 3VIGA 4A4AA 1RD5A 3MQTA 5HQLA 3HMJG 3S1VA 3ORWA 5AHFA 3GDRA 3LU2A 5BNKA 1GQJA 2DSZA 5HNUA 2NX3A 3PWIA 4GG9A 4ZQMA 3NRZB 3INPA 1NFGA 4WOQA 2EQ8A 5LGZA 3XIMA 3A4JA 1XJBA 3CAVA 1AMYA 1X1NA 3GXIA 2EG8A 3RLGA 4IMCA 1RM6B 1AQFA 4JTHA 1RJQA 3UY7A 1RVGA 3NOYA 4DUOA 5A6LA 1LRTA 4IP4A 6TIMA 2F84A 3DUGA 1EGZA 2FGBA 4AY1A 5LXXA 1Z89A 4F8XA 4NQ1A 2DT1A 2PBOA 1JDCA 5EL1A 3QC0A 2Y7FA 3BCDA 3VKDA 1UUQA 1W1IE 2CLIA 3CASA 2ZUMA 4RCXA 3R2GA 2Z28A 4NX0A 2PWHA 4L80A 4C6PA 4LGXA 3B04A 5EA9A 3N2XA 5CGQA 2WOIA 1BGGA 1ENUA 1L0PA 3SN0A 2VR5A 3IGXA 3ZFHA 2ZADA 5LIXX 1SR9A 5EU9A 4FB7A 3L4UA 3SAZA 5CJ5A 4OIFA 4KPRA 1L8NA 3W2MA 3ABXA 4DN1A 1W9PA 1CB2A 3PZOA 4FO4A 3W01A 4DVOA 1O4UA 2JKEA 3OC4A 3MBDA 3CIWA 1E3XA 3NPWA 4JQ4A 2QUMA 3CHCA 1XLGA 4GBUA 5BWFA 1K1DA 1JCMP 2Y7DA 5CPTA 4C6KA 3RJYA 3EMZA 3NL2A 1XLIA 5LIUX 1O60A 1LQAA 5E93A 3R79A 2DU2A 1GOIA 1BVWA 2W0UA 1XBVA 2JKPA 1OBAA 1NPXA 3D46A 4GZ7A 4H9TA 3QM3A 3E12A 4Z2JA 3Q65A 1US0A 5BXPA 1EF2A 1DQWA 4Z1BA 2CETA 1A5CA 5C2CA 4WSHA 2QCGA 4KEZA 5XIAA 1E1CA 3KOXA 4HZ7A 3NVWB 1TR9A 3GVQA 3NVZB 1P1XA 4GJIA 3FJ4A 5LIYX 3H22A 3PUEA 5BOOA 3L4XA 2JIWA 3WMBA 2G96A 4PMYA 4KGLA 5HXMA 4G7EA 3SR7A 4UTTA 2ZCGA 1JG9A 2HXTA 5GPRA 4UFJA 1IR1A 2PTDA 3TYEA 4UMBA 2O9OA 3A3XA 5EB8A 5GJNA 2QCDB 5K3VA 4LAOA 1H61A 2Z7GA 3GHRA 2NWSA 5AYXA 1LZOA 3AYSA 4PN2A 3LHUA 3F1QA 3WJWA 2A5HA 4B5XA 3AHXA 1N61C 2PWDA 1N8IA 4NAEB 3LHYA 4MHBA 3QYSA 5A6MA 3DYPA 2ZZ3A 3HPAA 3S5YA 3BLIA 1NF7A 1XKJA 1FH9A 2OELA 2PODA 4IPIA 1Z69A 3EPNA 4LF2A 1JDDA 4UWMA 1I1XA 2OOFA 1FWGC 2G8ZA 2OT1A 4OBTA 1E15A 3M5VA 3WF4A 4AIBA 5JVLA 4LUYA 1H6VA 1X96A 4YCOA 3TTEA 2WVTA 3QGVA 1UCWA 2I9EA 1WZMA 2PU1A 8A3HA 3I7RA 1P7TA 4QEHA 2AAQA 3Q2DA 1CXHA 3KTXA 2VFIA 4O1AA 4OOUA 3TC3A 1A0DA 5D9MA 3QEZA 1NOUA 3WEZA 1E6NA 4EQWA 1UD3A 1P6CA 1ONRA 3DI0A 4GI9A 4RE0A 3T8LA 1ISVA 3AAMA 5BWAA 1HP4A 1A5BA 3DERA 3ZVHB 1MDLA 4K1WA 3FAWA 3CHFA 3RHGA 2D20A 4ICMA 2GQ9A 4U3CA 3C2FA 3TJ4A 1K9EA 3A5VA 3PUGA 7XIMA 1GQNA 4DF1A 4H4QA 3GW3A 4I7VA 1EEXA 1OJXA 1F4AA 3EDDA 1Q2SA 2WZHA 1U5JA 2PRHA 3CQJA 3B4UA 3UFYA 1DJZA 4WR3A 2B7NA 3CWHA 2JEPA 1C3FA 1BVZA 2WJFA 4H9UA 1TV5A 1LUCA 4FXSA 3O0FA 1HJVA 2C7FA 5C9RA 2E3TA 3N2BA 3WSUA 5AC8A 3W7RA 1IV8A 1B57A 3O15A 1L8PA 1OT1A 2BGNE 3ARWA 1BPLB 1K9TA 4R9OA 4YVPA 4PUNA 4Y8EA 1Z3NA 3CIXA 1QNQA 3WMLA 3AS0A 1RZMA 3KW3A 3V7PA 3W7NA 2ZVRA 1GG1A 3UY8A 1SO6A 3O7UA 2ICSA 3HGSA 2QGYA 4UTMA 4GACA 4QR6A 3QPZA 3MV11 3OOQA 2EAWA 3E0IA 3LCIA 1UUOA 4OQVA 2PDKA 1FTXA 3O0HA 4QBXA 2PWGA 3EDEA 4JGDA 3WNOA 2P76A 1YQ2A 3S6DA 4CN6A 1R3RA 1OB0A 3CEUA 3NSMA 5REQA 4FOUA 4R3UA 4CEXC 5FF0A 4O0QA 4HYRA 3I10A 4QCEA 2Y8VA 1O1HA 2VD8A 3EAOA 3U5UA 3IIPA 4LYPA 3W7HA 4MPQA 3TOYA 4H4WA 2ZWYA 2VRQA 2WSRA 3SCSA 3HFYA 4LEFA 2E1WA 3IJ8A 1FHDA 4DF0A 3MWCA 2AL2B 4G1NA 3QXBA 4PTMA 4ZB5A 2A3EA 2E9LA 4I8DA 4MUZA 3VAVA 3ZO9A 4Z2IA 4IT1A 3U6WA 1E4MM 2P3EA 4YXGA 1S5MA 1VD6A 3FA3A 3IJ9A 4B5VA 3CUXA 2PDHA 4GGBA 4DYJA 1TJ0A 3NQ7A 3MY9A 2X2YA 3ENLA 3GXDA 3H4GA 2ZUWA 3W07A 5FCZA 1KGUA 4JYEA 2ACSA 1X2GA 1BRLB 3W70A 3VC6A 5LA2A 1Q7QA 3VNKA 5I3GA 3F5JA 4MJ2A 1LYXA 2RDTA 1UC4A 4KCWA 1WP6A 3WH9A 3R10A 3NEHA 3BGGA 4ML4A 2Q3OA 2GJNA 4JFVA 5I3JA 4P2VA 2A6NA 4Q22A 1M7JA 6REQB 2GLKA 1XYZA 4C7GA 3IJ7A 3RO6A 4S3CA 4JTDA 3WZ0E 2P10A 3EKZA 1DQXA 3M7WA 5CJNA 3W24A 2W0HA 3VZZA 3ZJ6A 4GJ1A 1PX8A 2R91A 2FLIA 3AN1A 2XH0A 2BODX 1J96A 3CYJA 1ZBVA 2O9RA 4EPBC 2X99A 2OQYA 1PIGA 3UR7A 4KFNA 4B5SA 3BK0A 3PBWA 3CZKA 1SM9A 5KMYA 3VCRA 3SSJA 3W38A 2VTFA 4JKKA 1LP6A 1UASA 4KMQA 4RNJA 1DIEA 3N29A 4J40A 2QAEA 1RBOB 5D33A 3IRSA 2CEQA 2WVSA 5E0FA 4XZNX 5E9XA 3LRLA 3ABSA 4XD4A 5BXTA 1OD8A 4MYAA 1LWIA 1XLAA 3I3EA 3PG9A 1BTCA 1N63C 3EANA 5ABTA 1FBAA 4ALDA 4DWSB 3V4BA 3PZIA 3TP4A 3L0KA 1E6SM 3IJDA 1S2WA 1DXIA 2G97A 4HCLA 3F7JA 4NT0A 4OUIA 2WSPA 3VINA 3OPSA 3O0KA 2E25A 2WPGA 2J6XA 5JBEA 1B2YA 2GUUA 5FJUA 2JFEX 3DENA 2E8YA 4GH3A 3WLTA 4AD1A 4DXXA 3GNDA 2QLYA 3MANA 3DH7A 3ISIX 4K7ZA 4OTKA 2WVVB 1W5OA 1VAHA 1A5SA 2E6FA 2NQ5A 2WP6A 1LT8A 4ADSA 3EB4A 4NZ3A 4P8WA 3KWXA 5LSMA 4DEFA 2BHYA 2NQHA 1CXLA 3UETA 3RPTA 3UPMA 3EDKA 3RCYA 1G67A 3CQ0A 3A4WA 5KZ6A 4L4PA 1KKOA 1V4YA 3AZSA 1AZ1A 4GXPA 4XBKA 3RLUA 3GXPA 4FLQA 3MCMA 3UP8A 3AICA 1UOKA 3DGRA 3L5AA 1KCZA 4KGJA 5DCDA 3E9AA 1NOFA 2XIQA 2BC1A 3GR4A 3UYIA 3KEHA 3VIIA 2Z25A 3A9IA 4NKCA 1J0YA 2G0WA 4XIMA 2BOGX 1VFMA 2XIMA 5BU9A 1SSDA 2YFNA 3P3BA 4B3LA 3SGGA 3BJTA 1Q6GA 4O1DA 3NXFA 4IMGA 1CLKA 4UTUA 3K30A 3NZ1A 4CQ9A 1QHOA 1SSGA 5AHLA 3ZM8A 3TE9A 4M24A 1E9YB 4YS1A 4C65A 4RE2A 1NU5A 3UZWA 2CLFA 3BG9A 3GAKA 3OVRA 4AXKA 3MCOA 3W29A 2E5AA 3UJEA 3TW9A 1EDTA 2CBIA 2V0TA 2VZVA 3P7YA 3U2EA 1TMHA 3LPGA 3SY8A 3TZFA 4I90A 4XZWA 4HNUA 2YQUA 3MHFA 3JZEA 1KC7A 1BD0A 3LV5A 1A5UA 2D73A 3GH7A 1PWMA 3UR5A 1S2CA 4PRRA 1SZRA 4OOZA 3UA3A 3S2LA 4HN8A 3ABQA 3CMJA 1LCOA 3C52A 1ISZA 3WBYA 4WXZA 5LNSA 2PP3A 4LVGA 2HEJA 5PTDA 4O12A 5F4XA 3UA4A 2QDEA 3MSYA 2IUZA 3LGDA 3MMUA 4JNMA 1TTPA 4M6UA 1L9WA 4TU1A 2NV9A 2HK0A 1OFPA 1UOZA 5T8GA 5HBFA 1FRBA 1VC4A 4LV9A 2QPUA 4HOWA 1Y8BA 4GGHA 4Y9OA 4EWND 4GZEA 3GTNA 1EIXA 1MUWA 1I0DA 2GDVA 1KFCA 4ASTA 3DOPA 5JIPA 4XKYA 3R8GA 1E0TA 1W6TA 3MCNA 4HHMA 4UR8A 3NQBA 1Q4WA 5G1YA 3AU6A 4LF1A 4RLIA 5K2ZA 3WF3A 4M29A 1SU5A 1CGVA 4IL0A 3IACA 3W26A 4DIAA 1HO4A 4H4UA 1FQ0A 1OY0A 2HBXA 4R85A 1XRVA 3BLOA 4LANA 3HB9A 5EMUA 2OR2A 3K1GA 1CWYA 3FVMA 3BSMA 2NQLA 4PE8A 3VKCA 1FWFC 2FTWA 1R2TA 2WMFA 3ANUA 1PS9A 1TX2A 3R6IA 4U5IA 1L2UA 1EB3A 3CTTA 3CMFA 1OZMA 4GUFA 3J7HA 3HOJA 3IAQA 4G9PA 1N82A 3RXZA 4C6FA 3FXGA 5J8LA 1VRXA 3GXFA 2BOFX 2EBNA 1Z7AA 3B3DA 3K2GA 4XZBA 2E8ZA 4JTTA 3ME3A 3IWPA 4S3FA 3IJQA 1OC6A 3PSVA 5TD4A 3KAOA 4GI4A 1TZ7A 1GVSA 4D8ZA 3BCFA 3DX5A 2XIIA 4YVVA 5B80A 4E3VA 2INEA 2FIQA 3PF3A 2RGLA 2VZTA 1YNYA 1W37A 2B7QA 1VIZA 2HMCA 4J3XA 5BOFA 3SQSA 4ECLA 1KXQA 4RV3A 1RLCL 1ZDLA 1G6CA 3RX2A 4NZFA 1MW2A 4E6MA 1BAGA 3UT0A 2Y8UA 5DRCA 2X1SA 1XIJA 3VD9A 4E8GA 4AZCB 3P60A 4JTLA 1O5KA 2ACRA 2C0HA 4UOQA 1UWUA 4H83A 2EQ6A 3LRMA 1RSCA 1GRGA 3O6AA 3C0SA 1XLBA 3URHA 2G5WA 1QO5A 2W6RA 4Y6GA 4B5TA 4HNNA 3ITXA 4GY0A 5BRBA 3LNMA 4MOZA 2PCEA 2RJHA 3GFYA 2EQ7A 4K8DA 2ZUUA 4JIPA 2W27A 4D6DA 3F4WA 4TVYA 3APTA 2WC7A 1OFEA 2XH7A 4DJFD 1GTEA 2O9TA 4Q8OA 2PLCA 4LCRA 4AVOA 6CGTA 4GQRA 5CPNA 1TQJA 1RJPA 3QMRA 3SRHA 1PE1A 1H50A 1T0OA 3CIVA 3AMZA 1J2WA 1TJRA 4HPGA 2VVNA 3WLPA 4ZBCA 1LL7A 1WDRA 3H2AA 3N3MA 3B9JB 1PJ9A 3ONBA 3DXIA 1KQZA 5HR7A 4G8TA 2DW6A 3GB6A 4KKXA 3TCEA 3BMXA 4D8AA 3O07A 2YGYA 4CKQA 2BP1A 4NXKA 2X42A 3ZJ7A 4WIWA 4O16A 2DEPA 3VUPA 1KV5A 4J3VA 4B4HA 1QASA 3SY1A 3OHMB 1V0MA 3DU0A 4PMQA 2C79A 3EWUA 1M7XA 4K38A 1XIIA 3QRHA 1ZMDA 4IF2A 3MUIA 3V0UA 3E6EA 1E9ZB 2A3CA 3IEBA 3LA4A 5C71A 1VCFA 3T2QA 1ZP4A 3RX3A 3SGZA 5AHMA 1TYGA 1S3HA 3WH8A 5HMSA 1KRMA 1ZJHA 1VIWA 4Q7BA 2NQJA 2A3LA 4AZ5A 1V5XA 3CHDA 3QY6A 3K8KA 3QYQA 1SO4A 1PAMA 4DAIA 1ZCOA 3ABOA 3QMSA 3OW1A 2Y1HA 1XISA 4LAMA 2O4MA 2ZX5A 1UZ4A 4LAUA 1XLMA 2CZ5A 4G56A 4FALA 1D9EA 3PM6A 1EF3A 1GZJA 3IIVA 3TX9A 4MB1A 4CLMA 4PEKA 5LXEA 4Q4KA 3BJFA 1AH0A 5BMWA 4PL2A 1VGAA 3FS2A 2QEZA 3IV8A 1F7BA 2E5CA 2DGAA 1NVMA 3IUDA 2GJLA 1OCNA 1TSIA 3S9IA 2VOMA 3S6TA 1OGGA 4AG0A 2I5QA 3D47A 2C15A 1A47A 1O5QA 4REQB 4WRHA 2FJKA 3H7RA 3L67A 2KX9A 3VI2A 4RX0A 2E4TA 3W3OA 2NV2A 1CNVA 3B8WA 2Z2AA 1JYWA 2ZZ0A 1E9IA 4C1NA 4MMWA 2AQOA 1QK2A 1NTHA 1PBGA 4UFKA 2BVTA 1GEUA 2QAFA 4FF7A 4GABA 1S2TA 5G5HB 2Y4SA 1TJ1A 3ZT5A 2OEJA 2PWUA 2HPIA 3B97A 2W63A 1QPQA 3G3MA 3RG6A 2W3ZA 2J7FA 1EL3A 1O6IA 2A6LA 4JBRA 5CPQA 5DMNA 3U5YA 3P8IA 4MJ4A 4EACA 3TMQA 3CAWA 1HXJA 1CECA 3E0LA 2VC7A 1C8VA 4TOQA 1XLEA 2XN2A 1M41A 1B5TA 3ZS4A 2P1FA 4H19A 4DJEA 1XBXA 2C19A 4PRWA 3HQ1A 1FDJA 2TRSA 2WMGA 4MZ8A 4KWVA 2WLYA 1X6LA 4US6A 3VCCA 1DQUA 3H54A 1BWVA 1UH2A 4J35A 4AWTA 1AJZA 3GG7A 2R9ZA 4TIMA 2VMFA 3ZR5A 2AGTA 2OYKA 1XICA 4ZFMA 1W9XA 1W1YA 3BANA 1Q45A 3QF0A 4B15A 1UQZA 1VYPX 3P84A 2ZZBA 3BAJA 3FHAA 4B5UA 3WK0A 5AC5A 2E5BA 2WQPA 2D2JA 3UZJA 3KRZA 1CW2A 3B0XA 2QV4A 2YLLA 4NILA 5BU6A 4RXGA 2J7GA 2QCNA 4RNIA 2GVLA 2HQMA 3G6LA 2WB5A 1CBGA 1J6PA 4P8VA 2RGMA 1HJQA 3NOEA 1BXBA 2HISA 1YXCA 4M8UA 2R82A 2WCSA 1HF6A 3BAWA 1V6TA 3NDZA 4E4PA 2FJUB 4WSJA 2J25A 1W3NA 3EWZA 3TH6A 1HFBA 2PD5A 2D0GA 1FXQA 3AHYA 4S3KA 3W53A 5JUVA 2JEQA 3N25A 3GE7A 2YOCA 3VNZA 4ERIA 5T9CE 2ZBTA 2H6RA 3O6YX 4IMDA 3EWWA 2ZDRA 2Y6ZA 2VX4A 6ALDA 4J3WA 3I65A 1PL9A 4YLWA 4J56A 4WY0F 2V63A 3WNMA 1PB0A 1NJJA 1Q3NA 1H1ZA 1VBUA 1LROA 1UP3A 3PBGA 1VHNA 1WA3A 2QQ6A 4KBXA 3NQFA 4F0KA 3EX2A 1QI3A 1SO3A 1RP9A 3QHMA 3WLHA 4HPNA 5ECVA 1FP9A 1ZBCA 9XIMA 1GEQA 3LN3A 8XIAA 4DUXA 2AAMA 3CZ8A 2XFFA 1ZJIA 2EO7A 3NM3A 2QT3A 1UR4A 3N2MA 2VGGA 3FKKA 3RU6A 1I60A 1XSIA 2WJEA 3KCJA 2HS8A 4NXSA 4UC5A 4LYQA 3GZAA 3PZNA 3VUSA 4WHBA 3EUB3 2FTPA 3AUOA 2OZ8A 2F2KA 3LLFA 1UHVA 2WOQA 2OKTA 3H2CA 4F40A 3UCQA 1K4QA 3COTA 1V79A 4FIQA 4O50A 4UTKA 1CLXA 3ZWTA 4H3DA 4LOCA 2WMIB 3EA3A 1W3LA 1BTMA 2VNCA 4NRRA 3W1AA 2X05A 2OZTA 3GIQA 4C5YA 1G1YA 4PMXA 3ATYA 3B0YA 3IAPA 3P0XA 1HO1A 3KL0A 4F0LA 4JHMA 5K9XA 1XP3A 3MI6A 4ROQA 3FVDA 1J0JA 2FH8A 4JIHA 4IG2A 3SZ8A 2J6VA 1HW6A 1UKPA 2GGJA 1B90A 4A3YA 2OFJA 3BV7A 2EPMX 8CGTA 1EFZA 2PC8A 2POZA 2Z27A 4WK9A 1FWBC 1GONA 1A5KC 2B7OA 4HPJA 1JIBA 3BMWA 3BAKA 2DJLA 4E2DA 4F0RA 3VDCA 3AXIA 2HJPA 1R9XA 1GESA 2XFRA 4XB3A 4XAGA 1YE4A 4O53A 4O52A 1PYMA 3A64A 4EK7A 3M9YA 2WNZA 1XD1A 5E6YA 4GCXA 4FX8A 2BVDA 2ZA1A 3WLRA 2F2HA 3VD4A 2DJXA 1BRLA 1ITQA 2WZMA 3VCNA 2YB1A 3VX1A 3UQNA 1X1OA 1ME8A 2CXGA 2X1TA 3VIOA 2GQWA 4O10A 2PDXA 4IX2A 1GRAA 3JS3A 1XQKA 3LNPA 4LWWA 4K6AA 2X41A 1ZBKA 2DVUA 2P5NA 1KFKA 3MHGA 3VOHA 5KTLA 3U48A 1VCGA 3TAKA 1TPVA 1TYTA 3P5YA 4ZE4A 3M4HA 1XC6A 2XVLA 3ARRA 3D5HA 1T5AA 2WHKA 2PMQA 2E3ZA 1JYNA 1ICSA 3W22A 1JGIA 2DFAA 2PDPA 4XSLA 4PUDA 4S23A 2YW4A 4QG6A 4ZTXA 4PRTA 3G1FA 1VFSA 3LBMA 3WDQA 4G7FA 1BYAA 2R1KA 1ZTVA 3HG3A 4O13A 4W4QA 4AZGA 7PTDA 4NJKA 2BB0A 4IOTA 4C1LA 4UNKA 3IUHA 2GVEA 1F9CA 2CLOA 3OLGA 2ODOA 3DBPA 4F2TA 4CGTA 3T08A 2CU0A 3OTRA 2XIBA 4PUKA 4QQUA 4X3ZA 1T6MA 1MSSA 2PTZA 3E5PA 3TV8A 1WQ5A 4AD2A 4FHAA 4CNTA 2ON3A 5AYZA 3BLKA 4LUJA 1DWAM 2QUNA 1J4EA 1EP2A 4RW5A 1L6SA 3GR7A 1J12A 1KV8A 3SB0A 3MMTA 4MF4A 4MVAA 2Q8LA 1HGWA 2ISFA 2PTYA 2GRTA 2EGZA 3DHUA 3KVMA 3NUKA 1RBAA 1V02A 3ARSA 3LB8A 2WKLA 1TV2A 2VWSA 4BWLA 4FSAA 2VDIA 3A9BA 5LZLA 3D9XA 3QV9A 2GGIA 1STZA 4HNLA 1W1TA 3DG6A 2GK1B 2VVSA 5FJJA 1VQTA 3B40A 3P80A 5B7YA 1X38A 3T4WA 4H04A 1JFXA 4DLMA 3CT2A 4Y9PA 4CD5A 3CO4A 3B9AA 4LVBA 1S2AA 4FOKA 3SCNA 1QHPA 1NHRA 4ZGYA 4N7QA 1D7KA 2QCMA 1CDGA 1SJCA 3G5EA 4GOAA 3ARPA 3MYPA 4F0MA 2PDGA 5AC6A 1FWAC 3B06A 4GI6A 4LUSB 1XRSA 4F9JA 4HA0A 2ABBA 1VPQA 3UXIA 3NURA 2BSLA 1XANA 2X8HA 4AISA 4LB3A 1AFSA 1IHIA 1HKIA 4HSHA 3DC8A 5BMXA 4PFHA 1H7RA 1KM3A 4Y8FA 3BO9A 4HOZA 3MU7A 3R8HA 1ME9A 1S39A 2CLPA 1W9DM 2V9DA 3K8MA 3CV7A 1EEPA 3P8JA 4PTVA 1TO3A 1QNSA 3HQOA 1NQKA 1M9HA 3USBA 1QPRA 3AROA 3KWSA 1BXNA 4NJIA 1E0WA 1H41A 4QCFA 3LQLA 4ZB2A 2OEMA 3A24A 3C0JA 1UKTA 1PIIA 3PVFA 2VUYA 4M7SA 1BF2A 5FJIA 4W5ZA 4OGZA 1BG9A 4KPLA 4XISA 1OF6A 3WX7A 4MNMA 3TAOA 3TLQA 3RU8X 1GOWA 4ZENA 1NDAA 2VGBA 2FB3A 3NTYA 4S3DA 4MNJA 4A3HA 3U7VA 4HZMA 4MDOA 3GSMA 4D8LA 3B8IA 2ISWA 2E0PA 2DH2A 1I2OA 4BZYA 3WD0A 4UNIA 4HYVA 4BEUA 3DEQA 3VGFA 1F3TA 5H91A 3ARQA 3H53A 3HF3A 5E09A 3GNRA 4M5PA 2E09A 1FCVA 2VUNA 5CPMA 1N7KA 4Z1CA 4B9YA 1X8CA 4REQA 1NDVA 5CG7A 4CCDA 5H1WA 2JQXA 1B1YA 3BQ6A 5JIWA 1POJA 2Y63A 3S2JA 2W55A 2PWFA 1EJVC 4WKHA 3VDBA 3EX1A 4BQ5A 1GPWA 3FDKA 5FF4A 2P0OA 3CPUA 3OIHA 5GJMA 1I9CB 1EPXA 2YVJA 1ADSA 2PAJA 4MWAA 1VHCA 1XLCA 4LCQA 2VP8A 2E1DA 4NP7A 3TONA 1UR1A 5HQEA 5A8GA 3I4EA 4JAWA 2W54A 5GRTA 5IDZA 1C90A 3E0VA 2VL4A