3V5CA

Crystal structure of the mutant e234a of galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
b'SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEAAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
molecule tags Lyase
source organism Paenibacillus sp.
publication title Crystal structure of the mutant E234A of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
total genus 134
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v5cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v5cA01
3T8QA 3SJNA 2RDXA 3H7VA 2AL2A 2GSHA 2OPJA 2PSNA 2GDQA 4HN8A 3HPFA 3BJSA 2PP3A 2OO6A 1KCZA 3QPEA 3JW7A 4E4FA 3TJIA 4E5TA 3N4EA 3PWIA 2GGGA 1JPDX 3UJEA 3JZUA 4YWSA 2P8CA 2OZTA 3UCCA 2GGHA 4G7FA 5ENLA 4J3ZA 3THUA 4JHMA 3H8AA 3FV9A 3MZNA 5BOFA 3MSYA 5J04A 1EBHA 2PA6A 4JN7A 3MY9A 2PGEA 3UJSA 1TE6A 3CAWA 1RVKA 1JCTA 2AL1A 3B97A 1OEPA 4HYRA 3U9IA 4IT1A 3VCNA 4A6GA 3K1GA 2PTZA 1ONEA 5FJUA 3DEQA 3UXLA 3ES7A 2I5QA 2ZADA 4GGBA 4E6MA 4MMWA 3RR1A 3MQTA 3MUCA 1XS2A 3OPSA 1ELSA 3GC2A 4H2HA 1F9CA 3TTEA 1NU5A 3TQPA 2HNEA 3DFYA 1YEYA 2XH2A 3NZGA 2DW6A 3TCSA 3FCPA 2QDEA 3ZLGA 3DESA 4FP1A 3BOXA 4Z1YA 3ZVIA 2HXUA 3MKCA 2PTWA 3PWGA 2GGIA 3CXOA 2QJJA 3R10A 3IJIA 3UGVA 4KPLA 1JPMA 1E9IA 4FI4A 1EBGA 4A3RA 3CB3A 4GMEA 3QN3A 4MKSA 3FJ4A 4K8GA 3TJ4A 1KD0A 3S47A 3U4FA 3ES8A 3ENLA 1MDRA 3OW1A 4DX3A 1NELA 3QKEA 1L8PA 4HCLA 4KWSA 2OQYA 3OZYA 5FJRA 3EEZA 1XPYA 2HZGA 2O56A 3V3WA 3SSZA 3P93A 3TOYA 3SN1A 3TW9A 2OFJA 4IZGA 4GGHA 2PGWA 1FHVA 5FJPA 3GY1A 3I6TA 3Q45A 3SQSA 3R25A 3NXLA 3GO2A 3KUMA 3TWAA 1ECQA 1KKRA 2OZ3A 1MNSA 3FYYA 4HNLA 3VCCA 3D47A 2OG9A 2PMQA 3N6HA 3N4FA 4H19A 4G8TA 4ROPA 4ZA0A 3EKGA 5EU9A 3Q4DA 3T6CA 3QLDA 3OTRA 4K1WA 2P3ZA 3V4BA 3VC6A 1IYXA 2GGJA 2P0IA 3V5FA 3DDMA 3OP2A 4GIRA 3D46A 2POZA 1SJDA 4IP4A 1FHUA 3RRAA 2PPGA 2FYMA 3VDGA 4DWDA 2QDDA 1MDLA 5FJTA 1WUEA 4IL2A 2DW7A 4HCDA 3I6EA 2PU0A 3S5SA 2PS2A 3DG7A 4IP5A 2OLAA 3DGBA 4E8GA 4IL0A 3VC5A 4A35A 3BSMA 4ZCWA 4EWJA 3PK7A 4ENLA 3RGTA 3RCYA 2OVLA 2QQ6A 3OZMA 3JVAA 3PFRA 2ONEA 3IK4A 3IJLA 4HPNA 2OKTA 1W6TA 1BQGA 1EC8A 2FKPA 3ZLHA 3GD6A 3DG3A 1EC7A 2PP1A 3CT2A 1P48A 1SJAA 4DXKA 2CHRA 4DN1A 4H83A 3R0UA 2GL5A 1JDFA 2OZ8A 3NO1A 3R11A 3P0WA 4IHCA 4KT2A 2MUCA 6ENLA 2AKZA 3VA8A 3R0KA 3MWCA 4HCHA 3UJRA 3UXKA 4M0XA 2AL2B 3P3BA 2OX4A 2NQLA 1MUCA 1P43A 1EC9A 3QTPA 3CK5A 4GFIA 5FJOA 3UJ2A 2PCEA 1SJBA 4JN8A 3SBFA 5BOEA 3DG6A 1TZZA 2PP0A 1R0MA 4F4RA 1R6WA 4GYPA 4Z17A 3R1ZA 2QVHA 3IJQA 3H70A 4DYEA 4GISA 2MNRA 4M6UA 2P8BA 2ZC8A 3RO6A 2AKMA 3CYJA 1PDZA 3RITA 4HNCA 1MRAA 3ZVHB 2P88A 2XSXA 3ZLFA 3I4KA 3SN0A 3VFCA 2XH4A 3T9PA 2PTXA 3H12A 2QJNA 4MGGA 2HXTA 3DIPA 3STPA 2XH7A 5IDZA 3DERA 4X2PA 1TKKA 2PODA 3FXGA 3FVDA 4E4UA 4K2SA 1SJCA 1BKHA 3UJFA 4DHGA 4GYPC 1PDYA 2QJMA 4J1OA 3N6JA 3TWBA 2GGEA 2XH0A 1DTNA 2PTYA 1WUFA 3V5CA 2OQHA 2QGYA 3DFHA 3NFUA 3UCDA 7ENLA 3T4WA 4KEMA 4H1ZA 2PU1A 3ZVHA 2XGZA 3SN4A 1KKOA
chains in the Genus database with same CATH superfamily
4XAYA 1Q6DA 3FJNA 1GVRA 4LBRA 4W8BA 2ESCA 1VRXA 2VZTA 3TW7A 1DJHA 3ITGA 6TAAA 1AZ1A 3W27A 4OVXA 2Y88A 5A6AA 5G1TA 1BLIA 1T8QA 2FB2A 2CXGA 3L66A 4AUBA 4PH6A 4LYRA 3N4EA 3CQJA 3GXTA 1QHPA 1CZ1A 1SO5A 3AN1A 1CX9A 3MJMA 4HU0A 2VEGA 2NUWA 1TUXA 2WO5A 1US0A 3UYCA 3CUJA 5GJMA 4WXYA 2HPIA 3UCCA 3OGSA 4G7FA 4AIEA 1FTXA 4HSOA 3Q37A 4GC4A 4H7VA 2PA6A 1H6VA 3M4HA 3SIMA 4FMVA 4HA3A 2VURA 1TE6A 1EJTC 3WUFA 8TIMA 1ISXA 2WMHA 3MMTA 1MXGA 4XD3A 4A6GA 2X40A 2D2JA 3MU7A 1NF7A 1PB0A 2O9OA 5KZ6A 1YYAA 3XIMA 1Z41A 1GKPA 5C2XA 5HXMA 1I2RA 1VIZA 5KINA 3WEOA 3MUZ1 3AC0A 1F9CA 2W62A 3KL3A 1KFJA 4GE8A 2QKFA 4IMAA 1XH2A 3VNKA 5DRCA 1IWPA 3TCSA 1G1YA 3WJSA 2OYKA 4CVWA 1CGYA 5CGTA 1PYFA 1UG6A 4E0CA 1QU4A 2CITA 3COTA 4AWTA 3QV6A 4U3CA 2E9BA 5G1YA 3WLMA 3PWGA 4TIMA 3ICJA 1HJXA 3KFTA 3R10A 2NVDA 3IJIA 3NIYA 3PZ9A 3G3MA 1I6NA 3M0LA 2ISVA 4LB4A 1JRBA 1JGIA 4HZ7A 1LQ0A 3CGEA 3DBNA 3GQYA 3MUXA 2ALRA 4PSPA 1KFEA 1YQ2A 2I7GA 3HJZA 3HPSA 2O7QA 1UD5A 3LY0A 4GO8A 4MNLA 3K5XA 5D2YA 3HQ1A 5FJRA 3EEZA 5DBUA 1WYIA 4LS0A 5GNYA 1M7XA 5D2TA 3HPXA 1QI4A 3SZ8A 2NX1A 2PGWA 3C2EA 3BSHA 4JTQA 1WP6A 1X6UA 1EO7A 1PAMA 4QDPA 3TA9A 1FQ0A 1SFLA 3KUMA 3AQUA 1TREA 3L12A 4QEEA 4AZ5A 1RH9A 1FECA 1HT6A 3T40A 1GQJA 1HJQA 2DY3A 3LCHA 3UERA 3T7VA 4HNTA 2FB3A 1Q6GA 5C9ZA 3IIOA 3LRMA 3EWYA 2BHUA 5F4WA 1JD7A 3PF3A 4IMEA 2HTMA 3ORWA 3QLDA 4BF9A 2X8GA 3WDRA 3SFWA 1G7VA 1UQZA 2I9UA 3FJ6A 4C6OA 4PUKA 1YQZA 2GUUA 3V5FA 1WBJA 4J28A 1PBGA 4GIRA 2OO0A 2VGIA 4RZBA 3VGHA 3WFZA 3FHQA 2G97A 3DJGX 2DZTA 3MVIA 1WUEA 3WUGA 2QUMA 3W1AA 1ZPTA 1OCBA 1Q7QA 1WOAA 3GDTA 3O7UA 2GWGA 2OLAA 1FCUA 2A21A 1X2GA 2V67A 5C7HA 2ZFAA 1D8WA 3GX9A 1SVDA 4GJ1A 2CHOA 1QOXA 4YCOA 3AS3A 5I6SA 1TA3A 1GPFA 4MYAA 2WNZA 3PUGA 3CNYA 1U1UA 1ZU8A 4Y7EA 1EC8A 1JROA 1ONXA 2HMCA 3GHSA 4QSHA 4GVIA 1JPIA 2NVKX 5K9XA 5HQLA 5AHMA 1HX0A 4J3SA 4PUJA 4DQWA 1XHGA 2H9AA 4C6PA 4JQAA 1EUAA 3LERA 3RM4A 3MCMA 1ENUA 1MWOA 4BQ5A 2WKLA 2QCLA 3MWCA 3L7RA 1ONWA 4JIHA 1RZMA 4X0VA 4D8LA 3W7EA 4AYSA 3A64A 3MJYA 3HU7A 1HXJA 3RN6A 4HHMA 2JGYA 1F05A 4ZR8A 3UJ2A 3F2DA 4EF8A 3WF0A 3OHIA 9RUBA 4RZ5A 2PDQA 2J79A 2J3NA 1DL3A 1I2QA 4AWSA 1N61C 1UPPA 2FTPA 1EQCA 2GR3A 3UPMA 1XDIA 2PP0A 4AD4A 1YRRA 1TPH1 2ATMA 5EBUA 3VD5A 1S2UA 1JULA 5D30A 2B7OA 1ITCA 3VGGA 3NJ3A 3HMCA 1GVYA 2P88A 3SGZA 2JQXA 3OVQA 3VIIA 4DELA 1RPXA 3ZLFA 2XIMA 1GVEA 2AQWA 3UXAA 1Y5VA 2WMKA 5KEZA 1UBSA 2PTXA 4RKAA 3QVQA 1PKYA 5BMXA 1HKMA 1TZ7A 2XISA 3VUSA 4N6EA 4O1CA 3T2QA 3QQ1A 1K70A 3VKAA 4OQVA 3LDVA 3CXBA 1HL2A 2PDMA 4W7WA 3S6DA 1EO5A 1FWNA 5G5HB 4GD0A 4M51A 4Q8PA 2QCDA 1KXVA 4PRWA 2XVGA 4HP5A 1QI2A 4H6EA 4GCAA 2VDHA 1E6SM 3WQPA 3QTGA 3E74A 3NTYA 5CPQA 4LW7A 1KWGA 1V97A 1A0CA 3CJPA 2PBGA 3QGVA 1GEHA 4GZIA 2PC4A 3UWVA 3TQ0A 3NNTA 2O9TA 1KXQA 3KLLA 3G1VA 4HVXA 3NDYA 3GTHA 1NFPA 3RLVA 1KNWA 2NWRA 3SJNA 1HFBA 2G4FA 1HQTA 3F5JA 3R6IA 4P8UA 4PTDA 1BTCA 3AXIA 5BXPA 4NF7A 4YYFA 1H50A 1NFGA 4XB3A 2OPJA 1J2WA 5F7UA 3ARWA 4Z2HA 3FG2P 4LIIA 1O6IA 2I56A 1PS9A 4LA1A 3FN9A 1QDSA 1S39A 3S4TA 2XDFA 3S1VA 3KCJA 2V3FA 4KPRA 2EQ7A 2VR4A 5HNUA 3VDCA 1VJSA 1H7OA 2QUUA 2GVEA 1LWIA 4CU7A 3VTRA 4UTWA 2PRLA 1NJJA 2Y8VA 4H41A 1J96A 1R86A 4E8DA 2XIOA 2YCLA 3FV9A 2A3BA 4LY8A 3DX5A 1E55A 4O16A 5J04A 5C54A 2YGYA 3RF9A 1KXHA 4PMQA 1GYLA 3T07A 1OC5A 2AL1A 1OEPA 5MF5A 3UZ5A 4J9JA 2GJPA 3F2BA 1ZJHA 1W1ZA 4JIIX 2I5QA 3CHDA 2QR6A 1XUUA 2NX3A 3S1UA 1IXQA 4NHVA 2Z0IA 2TYSA 4JCMA 4E38A 4MVAA 3TMLA 3OPSA 4O52A 1VFOA 3WLQA 2XFRA 4Q4PA 1DPMA 4NYYA 1BYAA 4YN5A 2PF0A 3FYOA 4AVOA 3ZVIA 3H2AA 3GNNA 1Y65A 4KIEA 2WZHA 2VZUA 5GRTA 3OU8A 3K4DA 4DB7A 3W2KA 1PXGA 2OWWA 4BCEA 2QEZA 3BG5A 5AN7A 2R1KA 1JZ5A 2X1SA 2NXGA 2FQIA 2A7PA 1XIJA 4ZTYA 4WVXA 3NUKA 3S47A 4UFHA 3DYMA 2ODOA 3GG0A 4KETA 4C5YA 3KOXA 2VZVA 3MP4A 1H7PA 3C52A 4GKLA 5K9DA 3AIBA 2NVAA 4LOCA 2EG7A 2ISDA 2Q09A 4WHBA 3M5XA 4KCUA 3R8HA 3LN3A 2HZGA 3HFYA 3PZVA 4M3PA 4HYVA 4U5KA 1F4AA 2XU2A 2A85A 3V35A 1FXPA 3WH9A 3GY1A 5M3WA 4KKXA 3SRHA 1PYMA 1RQEA 2ZOXA 1S5MA 1OABA 3AJ7A 3F4DA 3A4AA 3M9YA 5A2AA 3FYYA 1F74A 3D47A 4M7TA 2OG9A 4X9YA 2QCCA 3WG6A 3REQA 3OJGA 2A3CA 4CCEA 4Z08A 2CWNA 1EEXA 4BQ2A 2J8TA 1H60A 2GSEA 1GG1A 2IS7A 4XD5A 1ZUAX 3H7RA 4NKCA 3L5LA 3VABA 3M64A 1XIEA 1YKWA 3W7PA 3IJ8A 1IYXA 4JDYA 5HQEA 1ZDLA 1R3WA 4PMNA 2YX0A 1G4EA 1Y0EA 1AJ0A 4S3CA 5A94A 2BP1A 2TMDA 3CV7A 2A5HA 5BOOA 1DBTA 1SJDA 4IIBA 3MHGA 2DQXA 5DLCA 1VHCA 4XSMA 3ERPA 5FJTA 5EKYA 3PNZA 4PZVA 5FF3A 3NM3A 4O19A 4WK9A 1LCOA 1K7FA 4MY8A 4GYJA 5I07A 4E2BA 1UR1A 3WLIA 2Z6IA 4H4UA 4Z1BA 3NVVB 2FFCA 3KL0A 4D9PA 5ABGA 1H63A 2ALDA 5LNRA 3BW2A 3W72A 4GVHA 4UTKA 1W6TA 2V3GA 3NQAA 1K9TA 1LWHA 3SM0A 4KFPA 4DUXA 3GD6A 2F38A 1LLOA 3MP3A 3KDOA 4RW5A 2G41A 1D8CA 3QMTA 1TX0A 1FWTA 2DJXA 3CBWA 3L4TA 4AD3A 4FIQA 1QWKA 3P8JA 4KIRA 3BGJA 4EQSA 3VXGA 5FA5A 3W1MA 1SYTA 4H9MA 2NQJA 2XWEA 3VD7A 2A3LA 3WLJA 3WMBA 4KT2A 3GG1A 2NQ9A 4TU1A 5IFTA 5I7GA 3VA8A 1GONA 1KM4A 3FAWA 3NQEA 4OOUA 1EC9A 1F61A 4NG3A 3TP4A 1X39A 3BAYA 2OYMA 2Z2AA 1KR1A 1TPUA 3WUBA 3VZYA 2DJLA 3SCRA 1QHOA 3W7CA 2ASHA 2YBUA 4DLMA 1IF2A 3W01A 2XWDA 2JF7A 3TQKA 3USBA 3HG2A 2H8ZA 4NU7A 2ZZ2A 3NURA 5LNWA 2UY4A 4YVXA 2C15A 2Y5SA 5DMMA 3P80A 1DIKA 3AZSA 4IISA 1JZ3A 3EF6A 1E43A 1H51A 3KX6A 3EWCA 5LYRA 4DBWA 3RPTA 4JX5A 3LB0A 3QR1A 4HNCA 2WOWA 4K3ZA 4Z1DA 1UA7A 3I7SA 1GSNA 4L4MA 2VOTA 2XH4A 3NS1B 1TZ9A 1A3HA 1NP2A 4MADA 4H6KA 4Z0JA 4JTUA 3GVWA 3B9DA 4GACA 1YX1A 1XLLA 1YXCA 1UROA 1JRPA 2J7FA 4IQLA 4HKPA 4JFVA 3SDOA 2QZRA 4DHGA 1R7AA 4REQA 3BLIA 4GYPC 2QJMA 1CI1A 3SW6A 5G5GB 2CESA 1DTNA 3C8FA 2ABAA 1WUFA 3YPIA 5C9UA 4NXKA 1KBBA 4WEVX 4C91A 1PIGA 3CO8A 3OOQA 1BXCA 2B81A 4PEEA 3UWYA 1ZFJA 2JGQA 4EF9A 1GPWA 5D2XA 5D03A 2XGZA 4XTDA 1V0KA 2B7QA 1A5SA 4WOZA 2NQ5A 5TAOA 5CGMA 1JYNA 4GUIA 5HOSA 2AL2A 1FWSA 1RAKA 3FOKA 1VFMA 4BQ3A 5JCLA 2PDUA 4IMGA 5HQMA 2EPNA 4E3VA 4XD4A 4IJRA 2QT3A 3B0UX 4FXJA 3SCVA 3BXWA 1KCZA 1ZBVA 1KTCA 3KTSA 3PFMA 3ANYA 3SSJA 3L5AA 4CU6A 2DZUA 3WBWA 2XN0A 3NEVA 1UASA 1IGWA 2ZZ1A 4LUJA 1VIWA 4YU1A 2AAQA 3IRDA 1FWIC 4V28A 3KVKA 5G4EA 3SADA 1YPFA 2A2IA 4EQWA 4Z0SA 4KWWA 3SECA 1BWLA 3EOEA 4XV0A 3MZNA 1NWRA 3B8VA 2BLEA 2D2HA 3PBGA 3W6LA 4DUVA 1TMQA 4Y6GA 1XRTA 3NOYA 5FJJA 1VFFA 4HJWA 4XX6A 4IT1A 1NOUA 5K2ZA 1AQFA 3UXLA 4AAJA 2RDWA 1OJXA 3E2RA 4PCPA 1AH0A 1GW9A 4O0QA 4WIWA 1XS2A 1PJ9A 1K9DA 4ZE4A 1TMHA 2IKGA 1M41A 2UBPC 1ZKQA 1XLGA 2OELA 2HV5A 3DFYA 2WJDA 1QFEA 4DWSC 5CPTA 1Y8BA 1WKFA 3W1LA 4GNKB 4H9UA 3DZ1A 4I9MA 4Y8FA 3WH7A 4J40A 3MP5A 5U25A 1MSSA 2D23A 3DFQA 4O0ZA 3UGVA 2YVJA 1JPMA 3CL7A 1WZMA 4FI4A 2LLEA 3E9AA 2FPTA 2IMRA 1O68A 3BZJA 4UIOA 4CNOA 4PL2A 4AXNA 4H9ZA 5E6ZA 3ETRB 3NRZB 3TJ4A 4BV6A 4P61A 2Z6JA 4DX3A 1V6VA 8RUCA 2XJ7A 2Z28A 3E0FA 5IXEA 4S3DA 4M6QA 1PEZA 1ICPA 4KWSA 3N9SA 1F6KA 2GJXB 4ASTA 1Z42A 5G4WA 3KAOA 4MKVA 2ZXBA 1Q2SA 3CC1A 3LPPA 4NT0A 4RX0A 1GOWA 4IPJA 4YNGA 3BE7A 1OC7A 3C2FA 3ALGA 3TR9A 2GDUA 3B03A 1EYEA 5A8MA 2DSKA 2HVNA 4GQGA 2YLAA 1A5AA 2H3DA 3M46A 3NVWB 1XKJA 3B9EA 1BWVA 1TV8A 2EG6A 3O0FA 4YLWA 1TJRA 1K8YA 1W0MA 3VKDA 1JOAA 3LEPA 3GHTA 3PSVA 3VZXA 1XF0A 3GIYA 1AQMA 3ZFHA 3OVRA 6REQA 1JCNA 1RBOB 3NQ2A 4HJFA 5LGXA 1JNDA 3AXKA 2DT0A 4AFYA 4UTTC 4C6FA 4H6QA 3ZYZA 4MNMA 1HIZA 3H53A 2W66A 5PTDA 3W76A 2D69A 1TVPA 3RRAA 1FWFC 1H1ZA 2ABBA 2NT0A 4KESA 4F40A 4IL2A 1US2A 1BD0A 3B8TA 2YZ5A 3TVAA 4NEVA 4KWVA 2HCVA 2D3NA 2O0TA 3AXXA 4AHQA 3ZO9A 1QUMA 4AZHA 1ZP4A 1V6YA 4EOUA 1YADA 2FDSA 4TV6A 5HAOA 4ES4A 1PHQA 4LTSA 4PFMA 2X99A 3N1AA 4TVCA 3PFRA 3WK2A 1GJPA 3EOLA 3MHFA 5HJXA 1H7WA 4GQ0A 3CPUA 5RUBA 1A4MA 1CWYA 2WPEA 2BX7A 1LT8A 1LUCB 4NI8A 3ZMRA 2A6NA 4FXRA 3WX7A 4YVVA 1CECA 1HL9A 3GTIA 3D5HA 4WXZA 4KEUA 5F4XA 1Q8AA 3W28A 4E2OA 3WDPP 4XZHA 1JYWA 1T40A 1OG0A 4ZFCA 3U5YA 3VIFA 1WDWA 2F84A 4FX6M 1QW8A 4A3YA 1YIXA 5I5RA 1AMKA 4E2VA 5JH1A 1AH4A 1DE5A 3UJRA 1I45A 2Z1KA 4EAMA 1X38A 3W86A 5GVJA 4YWOA 1S1RA 3ZT7A 1MYRA 3MZ2A 1ISVA 4N9CA 4NILA 3L4UA 5LNSA 2C1HA 1JFXA 1MUMA 1B4EA 2W91A 3S6OA 3VGEA 4GJJA 2BXVA 1X7IA 1DIDA 2CLPA 4AW7A 1JVNA 1KFKA 1QO5A 1W1YA 4CEUC 1SO4A 6PTDA 1CCWB 1BF2A 1VH7A 4H4SA 3P5YA 1R6WA 2ZZ5A 3AHXA 2INFA 1JPKA 4HK7A 3ZJ7A 3IJQA 1S2AA 1S2TA 2ZX8A 2BFGA 3MI3A 3WQ5A 3AM9A 4JQ9A 2HRWA 1AQHA 3RO6A 4ERAA 2J88A 1UH2A 3PG8A 4A8NA 2XN1A 1FWJC 3PSWA 4MLRA 1LQAA 1QJWA 1CEOA 3W23A 4R9OA 4NJKA 2DFAA 4TX9A 4WY0F 1O66A 3THDA 3UZYA 1K1DA 4BY3A 3GTFA 3QHMA 2EG8A 1VZWA 3AAMA 3M7SA 1V4YA 4RCXA 4LYKA 1DWHM 3SCUA 1TE1A 2YA1A 4H4ZA 2NSOA 3E0WA 2PDYA 2Y8KA 3IUDA 3O15A 3WD2A 4C6QA 3W26A 4DVOA 4KW2A 5FSDC 2YL5A 3W7JA 2V0TA 1JUBA 4NZ5A 4QDMA 4NIRA 3LOTA 1L6SA 3V7PA 1PHWA 4OHQA 3W22A 2UWFA 2FMNA 2EQ9A 2WBGA 3SN4A 3BLPX 5BW6A 4U31A 3QY6A 1YBQB 3QKZA 4I8DA 3H7VA 2J47A 1T96A 2ZTJA 1NQKA 3APTA 1GVIA 3VIJA 5A6MA 2PRHA 1Q45A 3IRSA 4Q3MA 4JL1A 3BV7A 3P67A 2FFIA 4ZB5A 2HNHA 2VRQA 4O1BA 3ARYA 4HMNA 1XV8A 1OZQA 2H6RA 3B05A 3UJEA 3SY1A 4YWIA 3F2CA 2PWDA 4F9JA 3UFYA 5LSMA 1K03A 4NJGA 1FP8A 4AC7C 4ZTXA 4XAFA 3AIWA 4EQXA 3LHWA 4B9ZA 4JNZA 2WNQA 2PDCA 4H6RA 4WX2A 1DXLA 2VTFA 4JNYA 2JFEX 1UKQA 5LHEA 3KP0A 3W6YA 5M03A 1W8SA 1BF6A 3EXSA 2QMKA 3I68A 3QYQA 4FB7A 1QPRA 2VP8A 3OZPA 4YTRA 2YLLA 2CETA 3I4EA 1FEAA 2EPLX 3CMFA 3NVTA 1M65A 3W2NA 4FSAA 3NZGA 9XIAA 4NYUA 1IWAA 4B9YA 2QAFA 3P81A 2HVOA 4H4PA 1Z69A 1VCFA 2NVCA 2NUXA 1G67A 1T99A 1M3UA 3V16A 2D0HA 1F7BA 1KRBC 4MB1A 3RMEA 3NVYB 3AUOA 4W88A 4L9XA 3PZUA 4N42A 3N11A 4BS0A 3A9IA 1KBIA 4JKMA 1GQIA 1TIWA 1WB0A 5HINA 2VWSA 2W55A 5HBFA 3AWNA 4D6EA 2NXHA 2WLZA 5CAKA 2YCEA 1SPQA 3AROA 1WYGA 3AMZA 4B15A 3WDJA 1L6GA 2CLMA 3HGOA 2DT1A 2NQHA 3G5EA 3LCXA 1ITQA 2WCAA 3LPOA 1EJSC 3M5YA 3CEPA 3ZT6A 3GBDA 3DHPA 3BZGA 2XHYA 4WGXA 3QFAA 1EP3A 1CXLA 2GR0A 4S3AA 3VCCA 2CLHA 4TVDA 3KVJA 2P50A 3A7RA 3TFXA 4H19A 1J5SA 5M17A 3WLKX 3M0IA 3CZKA 4AVFA 1UP2A 2XM1A 3R0DA 1KGXA 2BVWA 3IEBA 3VE9A 3LNMA 5HMSA 3G1HA 3WEMA 3G22A 4DI8A 4XO7A 3NG3A 3N04A 3VMPA 3RYSA 1GWJA 3EANA 4LAMA 3D46A 3KTXA 2POZA 3AMLA 2EBNA 1PZ3A 1VFTA 2VR5A 4N4QA 3W2LA 2QDDA 1GT8A 1GREA 4WSHA 2DGAA 3NQGA 4GCXA 1TQJA 3CL6A 3W88A 3URHA 3GWQA 3PHAA 4AB4A 4MPKA 1KCKA 3RILA 3SCSA 4C90A 3FY1A 4F0MA 2RH9A 2Y8UA 2Z25A 3GZ3A 3BSMA 3CHCA 2CCRA 3RPDA 3SCWA 1R3QA 3W87A 3MHUA 5I3FA 3RGTA 4DO4A 4N9EA 2RHGA 1H09A 3TONA 5FESA 5U1OA 1KA9F 1S2CA 1SMAA 2GPTA 5HMEA 3LTYA 4H9VA 1GVSA 3TROA 1DJZA 2DSVA 1J0KA 4HA0A 4K7YA 1QVBA 4JQ1A 2NWSA 1JL8A 2QPUA 2PP1A 1NVMA 2PE4A 1HJSA 2YDSA 4QNWA 3IIZA 1MEWA 1H5VA 2XM2A 5G2WA 2PDXA 3TTYA 2X8HA 2GL5A 5D8ZA 3EB4A 4ZQPA 3H23A 1E4MM 2MANA 1XIBA 1K4QA 3DKLA 4I7VA 4HCHA 5T26A 3BWWA 1P43A 1FDYA 4UXDA 1W1VA 5CQ1A 3DAQA 3BJFA 1ZAJA 3QOKA 4K39A 1V93A 3UW6A 2V5CA 4JTAA 5DANA 3I10A 1IT8A 2NSXA 3CLWA 1XGEA 2VC9A 3NZ1A 4HMDA 2W54A 1E70M 3LMYA 2BDQA 2JEQA 1CGTA 2PCEA 1XLBA 1CTNA 1KXTA 1GZGA 5E93A 4PODA 1HNYA 1ZCOA 3V18A 2BOGX 4UOZA 3O9NA 1OT1A 2YCIX 2JKEA 3PTDA 2RDUA 1GQKA 1S5TA 1XDLA 1TWIA 4DYEA 5CSYA 2DZWA 3WF2A 4O15A 1XH1A 3PJUA 2XPKA 3WD1A 2WPBA 3VNIA 1TSIA 2GYIA 3A3WA 5C6MA 1J0JA 3Q67A 4BKNA 1SR0A 1JPHA 1PWMA 4D71A 1GETA 4HNVA 3TFCA 1N5XA 3GUWA 2CYGA 1RSCA 1N62C 5I3JA 3EOUA 1DP0A 4MY9A 4WY0A 3GK0A 1RLDA 1W32A 2BZNA 4GQQA 1TKKA 1HZYA 1XIIA 3O16A 5D09A 1GRAA 2QUVA 2BY0A 2J6XA 1HO1A 4O17A 5EYWA 1BKHA 1V8EA 3UJFA 4YTTA 5E70A 3TN5A 5CXPA 4NNAA 4R9XA 3WH8A 1UZDA 1S3HA 3WF4A 4NZJA 1N5WC 2GR2A 5TR3A 4Q7NA 3DFHA 1K77A 1JYXA 4AEEA 4AF0B 3P8IA 5DT7A 5D32A 3HA1A 1B54A 1K8XA 3HF3A 5F2MA 3PN8A 4JNMA 3W7RA 5CSSA 3BDKA 1E1FA 1FOBA 3LA4A 1AQ0A 3A47A 3ONCA 2C6QA 4DI9A 1DYSA 2GSHA 2YA0A 3MO4A 1E4LA 4AD2A 4BK9A 4YJ5A 5CLWA 2EPHA 5I09A 2PP3A 2VX6A 2E5AA 2W9MA 4J2MA 3FAXA 5DX7A 2CPUA 1J9YA 4BF7A 1FFQA 3OVPA 4UC5A 1S3TC 3FFSA 3E0IA 4I5UA 4LAKA 5I06A 2VX7A 3W2UA 1MMFA 3T05A 1BVNP 4G7EB 4KRUA 3K8LA 1EXPA 4I5XA 5ENLA 4J3ZA 1ISZA 3ABOA 1HG3A 3W7KA 3GAYA 3PULA 4J4KA 2Y6ZA 1LORA 5IHRA 1XIDA 1XLIA 4GWEA 4LY4A 3HJEA 2NUYA 3H21A 3TTOA 1R85A 1XISA 5BZAA 3IV8A 1DV7A 1ADSA 1PTAA 1OCJA 1W17A 1I2PA 3CV6A 3MQTA 3BQ5A 4FLSA 5CPOA 2XFFA 4XQ6A 3E96A 5DO8A 1X7FA 4EMIA 1RPKA 4U2ZA 5E1QA 1K9FA 1EWEA 3V36A 2TAAA 1KM2A 4P7LA 3VGDA 4IWWA 4AZCA 2PTWA 4FEZA 1FFRA 3N2BA 1UA3A 2C1IA 3TU9A 4U33A 4RE2A 4DNMA 1LG2A 3V0UA 1UWUA 2G96A 3L0KA 1E9YB 4LWWA 4UFKA 1N60C 1ZHAA 1Q5MA 4L80A 3H6OA 3E49A 1TTPA 3ATZA 2CNCA 2WHMA 2VR2A 4MM1A 3WNKA 5K9CA 1Q1WA 4FLOA 4EP8C 2YZRA 1TQXA 2BVDA 1KM1A 1MW3A 4QTGA 3OEXA 1H7XA 3MBDA 3CV2A 4RDZA 4TX8A 1X1NA 3SN1A 2OFJA 1EDGA 3IGXA 3KVMA 3N9KA 5CJMA 4IIEA 1B30A 4JGDA 4LSBA 1OZMA 5IBXA 1KTBA 4FPSA 2DSUA 3W84A 2V8ZA 1PX3A 1VP5A 3R25A 3THQA 5AYZA 3OA5A 1KB3A 1CGXA 3T0CA 3VM7A 1QI0A 3DHDA 3B4UA 2Z2BA 2C91A 4K1GA 5A95A 1CNVA 3N6HA 1P0KA 1KO0A 2F2HA 4IQEA 2ZIDA 2YSWA 1N8WA 3RM9A 1UW9A 1BEUA 5HWJA 3WLPA 4KCWA 3CS2A 1J18A 1KR0A 1S5NA 5CG0A 2EQ6A 1O5QA 4ZQCA 3FX4A 4XKYB 2DZBA 5DN1A 1OJTA 2A3EA 5LIKX 2Z7GA 1ZMDA 3BARA 3OP2A 3R89A 5J5DA 4D8ZA 4XBSA 5AYIA 1RVGA 1VDVA 1VEMA 3W24A 4DWDA 1U5HA 3A22A 3ITXA 3N9RA 4IUOA 2E6FA 4HQVA 4LNCA 1L6WA 4X61A 2PU0A 4L1GA 1W2VA 2ZUTA 3QH2A 2F9RA 3TX9A 2QCDB 5D9OA 3K2GA 4CQ8A 2VELA 2OEKA 4PMRA 1E9ZB 3W00A 4OV9A 3IIPA 4AY7A 2GQWA 3P0XA 3U2CA 1MW2A 3QPYA 1OY0A 5LA1A 2GVYA 4BEUA 1VBGA 3DFTA 3TKFA 2ZX5A 2Y0FA 4PYSA 3VOHA 3GFYA 5DXYA 3NQBA 3NQ8A 3UG5A 1MW0A 1QI3A 3TXZA 1TUFA 4P7RA 1QPKA 1ITUA 2VHLA 1YMYA 5BROA 3OIXA 1UOKA 2ZTKA 3V1HA 4H83A 4HU8A 1VFSA 2DORA 3L4WA 1F3XA 1AK5A 3HZ3A 1HUVA 3WK3A 1LOQA 5F2IA 2BSLA 3TLQA 3UU0A 1GGOA 1JD9A 1EZ2A 2QCNA 2EKCA 4CVUA 1E15A 1PIIA 2PGFA 3WKZA 3MCNA 4IM4A 1B5TA 1DQUA 3RNMA 2D22A 2PD5A 4TO8A 3ZR6A 3VMOA 4JFTA 3HB9A 1EJRC 1FFUC 1XYMA 4DM1A 4FNUA 4DEFA 1E5NA 3FA5A 4KCVA 1V79A 3A3HA 3NWRA 4LVGA 5D37A 4HK5A 1XWYA 4L1XA 4CEXC 5CCZA 2CWXA 5DELA 4AIOA 1IR1A 4XO6A 4JTHA 5A2BA 2P8BA 1IWBA 3NQ6A 3AICA 3B3DA 3J7HA 3HQPA 4MJ4A 2VZSA 2WANA 3GNDA 5K4XA 2QAEA 4A29A 1Z9AA 3STEA 3ECQA 1FWCC 2XH7A 1SUXA 1FKXA 3C6CA 2FZBA 3G0XA 4X2PA 3C2VA 2XZ9A 1TA3B 4PUUA 2PODA 1QK2A 4LF2A 3CZGA 2FPVA 4K2SA 1SJCA 3BG3A 3U7BA 3N12A 4D6GA 2IQDA 1OYBA 3LQGA 3QQ0A 1RM6B 1A5NC 3C2RA 2OQHA 3LMZA 5BRPA 3M5VA 7ENLA 1IZKA 4DNAA 4IOTA 4M6PA 3QV9A 5BXSA 3WF3A 4JIQA 1GORA 3WBEA 2V69A 2I17A 2ZRWA 4XUYA 3GTNA 1PWLA 2RAGA 1VEPA 1XUZA 4HU3A 1P0BA 3W7GA 4UCGA 3IGUA 5KITA 3W37A 4DUWA 4KBXA 1NAL1 4W7UA 3LLXA 3GRSA 1S2VA 1A49A 1X8FA 3QPEA 1EHNA 3TJIA 1C7TA 2EAWA 4WCJA 3WF1A 1R3SA 3HN3A 1LYXA 3RJYA 3U3HA 3CMJA 1GESA 3KRBA 2A1YA 1Q6RA 3H4WA 1ZJBA 4JHMA 2JEPA 2XIJA 3WQGA 4AMAA 2SFPA 1EOKA 1SSDA 3GXDA 1EPXA 2ZVRA 5I78A 1IE7C 2JKPA 1KFLA 1XLDA 2J9YA 2CFYA 1EQPA 2EQ8A 1TWSA 1GG0A 5FJUA 4XD6A 2OGYA 1L2UA 5XIAA 3TNOA 1RHCA 2WWDA 4Z1AA 5B7ZA 3JS3A 2JE8A 2NV9A 2Q6ZA 4ATLA 2PDBA 2YXGA 3MDUA 1F3PA 4H4QA 1C92A 1QPOA 1XLMA 1FCBA 1JUEA 3FCPA 1N55A 3EPMA 1QCWA 4X22A 3F5LA 2DPEA 4AQLA 1P6CA 3OBKA 1VS1A 2O55A 3MKCA 3LHTA 1FVPA 1TV5A 4ZSTA 3IS4A 1ZS2A 1UKPA 2DV0A 3KM8A 4V1XA 4KEVA 4YMZA 3SJ3A 2QULA 4ZO9A 2E5DA 4LUSB 4H01A 1Z3NA 4EACA 2H90A 3G1RA 4MNKA 4LNYA 2BGNE 2F2KA 4KERA 3U6WA 3CHFA 3R13A 1EGZA 2WAGA 3NA8A 4B5XA 4UFJA 1F73A 1OFOA 3KP1A 4GY1A 5FL1A 1E51A 3CB8A 1L8PA 2F6XA 2R24A 4H2CA 1ZAIA 1R9YA 3OZYA 1XPYA 3HIJA 3V3WA 4NX5A 2KAUC 3SSZA 1KBLA 1W9PA 4HNOA 4ZGYA 3P62A 3PZOA 2VYOA 2BXYA 2PDLA 1V02A 3KOWA 1OF6A 2W6RA 4R7OA 2D1ZA 3F4NA 8CGTA 2VGFA 3I3BA 3CAQA 2AOSA 4ALDA 1XANA 3GDRA 3URBA 2CW6A 4NP7A 1F2JA 1RA0A 4B16A 1B3ZA 4LS1A 2GJNA 1WPCA 5CKSA 1B3WA 3FA3A 2Y7FA 5A6TC 4CD4A 4P5UA 3T8LA 3IUIA 1XIGA 4ZA0A 3T6CA 2VX4A 1FHDA 1REQA 1D3GA 3GLCA 1W1IE 3TJXA 4Z42C 2WSYA 2O9RA 2CZ5A 4UQEA 3BICA 3DFNA 4AIBA 1VRDA 2E77A 2Z1BA 4IP4A 3E5BA 1ZGDA 5HA7A 2VQTA 1YPXA 1AJZA 4I90A 2GSJA 4PC8A 3N19B 2BY3A 2FGZA 3DH9A 5EGRA 1ZBCA 3N73A 4QEHA 2QCHA 4FZIA 1J8VA 2EXOA 4IL0A 5TNVA 3O6CA 1BHGA 4O4VA 1MW1A 1TX2A 3IVUA 4ZCWA 2IQTA 3V5OA 4UZSA 3GG7A 2F7FA 3TXVA 3CQ0A 2OU4A 3ABRA 1X98A 4JIEA 1Q6EA 1IEIA 3HPAA 4QS6A 4Y9AA 2RUSA 2C19A 2IPWA 1EH9A 1F8WA 1UD6A 4X60A 1UD3A 4E4PA 3LG3A 3LXBA 3VKCA 4D6DA 3BO9A 4ZL1A 3BGGA 2BWGA 1Q66A 1PTDA 4MIMA 2VEKA 3W74A 1IXNA 5AC6A 4UQBA 1CYGA 3EA1A 2YOCA 3G6LA 2WW5A 4GX8A 3NXFA 4J57A 3ABZA 3IUHA 5FEZA 1UMYA 3SUTA 4JXCA 2YB1A 3A13A 3UXKA 1BG9A 1A80A 1V59A 1LOLA 3AHYA 1V3IA 1TRIA 5GPRA 1OIFA 2X50A 3EWZA 4XAPA 4K36A 5GQBA 4GABA 4UNLA 3QTPA 2WJFA 4FHAA 4GO9A 2ZRYA 3PUOA 3MSGA 4JTJA 1VF8A 4ADWA 1R3YA 2J77A 3UXIA 3ANVA 2ZA1A 1XFCA 1IZCA 1SJBA 4RL3A 3QF0A 3OYXA 1T0OA 3BLLA 1WV2A 5BMWA 5K3VA 3H2EA 3ZXWA 1QTWA 5BCAA 1KLYA 2HSAA 4QBXA 4LANA 4AXKA 2PWFA 5TIMA 2HE5A 5D05A 1PZ0A 3W1UA 1A3WA 1CGVA 4W87A 2I5GA 4GISA 4R5EA 5JXQA 2BODX 4CN6A 3C2YA 4QJ1A 2NX9A 2VL4A 4FOJA 3NPUA 2EJ1A 3HGJA 3NO5A 4Q4MA 3CL8A 1R2SA 3CWHA 4REQB 4YVPA 5I2UA 4X2RA 3EX3A 3UGRA 1STZA 3ITLA 4PULA 3FXGA 3W25A 5T9BG 1AFSA 2YB4A 3WK0A 3W82A 4PA8A 4ZO8A 2KX9A 1CBGA 5XINA 2G3IA 2R1PA 5FAJA 5E0FA 3CIXA 2P10A 3FHAA 5IHSA 1J2BA 4KEMA 1D7KA 3K8KA 3GXMA 5JIPA 4OBRA 3SR6B 1ZBKA 1O95A 4L64A 4LVDA 3KOZA 4JTTA 3TW6A 3EB2A 4QNEA 4ICCX 5HUPA 3BQ6A 4RXGA 3CUIA 2BVYA 3H54A 5CPLA 4MWAB 1NHSA 5FJIA 2Y24A 3LZ3A 3LBCA 1LQ2A 4WKHA 4S3FA 5BWFA 3VOFA 4HGXA 3JW7A 4MJZA 4DJDA 1XLAA 2REQA 3VPLA 1H62A 1TCMA 1IHIA 1JPDX 4OJYA 4M82A 3L21A 4QIUA 2JK6A 3VU2A 5CJ5A 3RO8A 2V5DA 2XFYA 5JCMA 3BLOA 1U33A 3B8SA 3VD3A 4L4PA 4TTGA 1CXKA 3SQMA 2BOFX 4CNSA 4ZXOA 2I16A 5BWAA 2GFTA 2CZVA 3A24A 3CAWA 3LI1A 3ZSSA 4PMOA 3H22A 4WSKA 3WQOA 3K1GA 1NTHA 1XRFA 2P5NA 4MTVA 4QCFA 1AVAA 1OGBA 1FX6A 4AX6A 1GOIA 5EPDA 1KQZA 4G2DA 3GDLA 3B8DA 4HZ8A 3CTTA 3N34A 3IANA 4EKJA 5CZTA 2WOQA 1W9VA 3GU2A 1I1XA 3B9OA 1Z6KA 4FALA 3SAZA 5M1TA 2CLOA 1G94A 4ORIA 1YNPA 3ALFA 3B8WA 4H8HA 1KV5A 1Q2RA 4P8VA 1DWFM 3GR7A 5EFFA 3VNMA 1KFBA 4GI4A 1UZ4A 3I3EA 3VOGA 3D6NA 4FNRA 4JY9A 2E9LA 3AI0A 4GMEA 4QR6A 3N25A 4CGTA 1AG1O 1RJPA 1KWKA 4EPEC 5ECUA 5KSWA 3UZJA 3OW1A 5FEXA 3W07A 3G2GA 3LGGA 4Q8VA 3AXMA 1OX4A 4HCLA 1TJPA 4LS2A 3WQVA 5M5DA 3TYUA 3VGFA 2OQYA 2G5WA 3MUY1 1UR9A 2GVGA 2G3JA 3TW9A 4IJCA 4UZUA 3IGSA 2OX1A 1SZGA 4FNTA 3NR0A 1FWHC 2V82A 1WKYA 3TWAA 1OSEA 1E6XM 4Q8TA 5CG7A 1OX4B 3T4CA 1P1MA 3G1XA 1TWDA 4QDWA 3DGRA 4YYCA 1MQQA 5D2WA 2CERA 3PJWA 1XYAA 1K8ZA 2CBIA 1LDCA 4JHOA 1U1JA 4A22A 1CGWA 1ZXIC 4IMCA 3N3TA 4F0SA 3WBYA 3IV3A 1O12A 3UG3A 3W6MA 4AD5A 1PZ1A 8A3HA 3CM4A 4M7SA 5D02A 4MOZA 1VC4A 5A6BD 1LG1A 4C6MA 1V77A 1P5BA 1KCXA 1EEPA 4NQ1A 3LM3A 1VFHA 3AMDA 1JZ8A 2DZPA 4A2SA 4QHRA 2R6OA 2VZOA 2X1RA 2FYMA 3KTCA 1QRQA 4GOAA 1IEWA 2PZNA 1V3MA 1XLFA 1HP5A 3F4CA 3S5ZA 3CZLA 1QOPA 3NSMA 2Y1HA 1ME9A 3U2OA 1V6UA 1H49A 3S5SA 1JXJA 5G2HA 5DT5A 3ELFA 4PCFA 4B4FA 3VC5A 4GBUA 1GOQA 4CCDA 3VYLA 2X41A 4N0RA 2QHAA 2OVLA 2RJGA 3S5NA 4GXPA 1MNZA 2QIWA 4BHYA 4UMAA 2C3ZA 3IK4A 4Q8WA 3MANA 4W86A 1LF1A 4ZB0A 4FX7A 3GIQA 3IJ7A 1A5LC 3NQCA 2V2DA 1B31A 1GHRA 2G95A 4KF1A 1XI3A 2F6UA 3M6YA 2W79A 4JKKA 2ZKMX 4Q4SA 4L4LA 3E2QA 4GY0A 3DGHA 3QY7A 3D3AA 1S2WA 4J3WA 4PMZA 4TVYA 2A7NA 1HO4A 1Z7AA 3TV8A 1VFUA 1DTUA 4RW3A 4W7VA 3HV9A 1ZTVA 1BWCA 4F48A 3BW4A 5C5YA 2V81A 4N9DA 1B2YA 1XBXA 3LHZA 3UZXA 4BR1A 3RX4A 4MWAA 2ZZ3A 3CUXA 1LBLA 3PWAA 1XL9A 3TSBA 2YCLB 1WDQA 2V3DA 1QNRA 3KXQA 1A5MC 3LX9A 1NP0A 1VQTA 2GK1B 3WNNA 4DF0A 3CAVA 4HHLA 4BI6A 2OSXA 4Y9NA 2DVXA 4R53A 2BY2A 1CT5A 4QLKA 2CIPA 4C6JA 3EA3A 4C65A 1O5RA 3PM6A 4W85A 5I77A 1UR3M 3N18A 5GNZA 3VDAA 3URQA 1IT7A 4M1RA 1PCKA 1CLXA 3ATYA 4EQRA 3G8EA 2WHKA 4N6FA 4Z17A 3A21A 2VEFA 2GQAA 2TRSA 3R8GA 2QVHA 2I57A 4LF1A 2XGIA 1YW1A 1WDDA 3BAJA 1AH3A 8XIAA 2NLIA 1HF6A 4M6UA 4MFDA 3JZEA 3PPGA 4XK2A 2FH8A 1VYRA 3RITA 1TTIA 2VFIA 4R88A 2E1DA 3N29A 4M56A 4PTMA 1LPFA 2WNNA 3WMCA 4GQBA 1M6JA 4LAOA 3PP7A 1H0IA 4EPKA 3W7NA 1GJUA 4B5TA 4LYQA 3AS2A 4IFOA 5H2ZA 1UR0A 4JY8A 5C7VA 3GC4A 4CQAA 3DERA 3C8NA 3M41A 1TJ2A 2WPCA 4ZQRA 2E8ZA 3L67A 2TODA 4UNIA 3OLIA 3NDZA 3FDKA 3QV7A 4F0RA 4KCTA 4DUOA 1KCLA 4TXEA 2OXNA 2QMJA 3VOJA 5JCNA 4ZENA 2QGYA 3A3XA 3ITVA 1QATA 3HPZA 4P7OA 3PC0A 2YQUA 1GXFA 4KFNA 4ACZA 3NZPA 1QHZA 2NW0A 5H8UA 4UOJA 1TV2A 4C5ZA 4LC8A 2E7FA 1UKSA 3S0CA 3UD6A 4UCFA 4GUGA 3S3GA 3H26A 3AXHA 3TYDA 3LV5A 1Y7VA 4HN8A 2Q8LA 1BXNA 3HPFA 3T09A 2UY5A 3VVGA 2I9EA 1CB2A 2JKAA 4JOMA 3R2GA 1KV8A 3PBWA 1DE6A 2YPIA 1OM0A 1DKWA 1P4CA 3KDNA 5HNTA 1PUDA 4YTQA 2GGGA 4ROQA 4L9ZA 4P7NA 1F6YA 1SB3B 4C6EA 1DJNA 3JZUA 4PN2A 3WQ4A 2YDAA 3DC8A 1XRSA 4PUWA 4S3KA 7ODCA 1WKDA 1K9EA 2QPXA 4WQ6A 2WJZA 1XSJA 3HG4A 2PGEA 1J12A 1OFRA 4RV8A 1RVKA 3POCA 4HYRA 4YL2A 2IKHA 3GC5A 4K7ZA 3W70A 1XG3A 3DENA 1ONEA 3ES7A 1WE5A 1JEZA 4QJ5B 1E3ZA 4JTLA 3OZOA 1AL8A 3HRDC 4OV4A 1HJVA 3M0VA 2PFHA 3PZNA 2VCBA 1G4TA 1XLKA 3GC2A 2QCMA 3EWXA 4UOQA 5LIYX 1BPLB 4CD7A 3B4YA 3VKJA 4GNJA 2RDTA 4TQTA 2EPMX 1NDZA 2Y70A 2A3AA 1UC5A 2ZX7A 3VNDA 2X7WA 3B9JB 1P0DA 3GHRA 4FOKA 1GERA 3WIJA 1R9ZA 3DESA 3M0HA 4HHHA 3AMKA 4C6KA 4ZFMA 5JBEA 2DSWA 4QG9A 4IG2B 3DJJA 3R12A 1G69A 1YE4A 3DBPA 9XIMA 3AIVA 4TMBA 4C7FA 1UJPA 1EBGA 1REQB 4UMBA 4AISA 4ORMA 3QN3A 3I7RA 5IOBA 3TDFA 2OODA 3AIRA 1XBYA 4D2JA 4IPLA 4FR6A 1N8FA 2V2CA 3M0JA 4HPGA 2J7GA 4R27A 3II4A 3QKEA 1GOXA 3A5FA 3MSRA 5ABEA 3NGFA 1JF6A 4C60A 5A8PA 3I7QA 4QLJA 1O5XA 4QM1A 3D0CA 3EB3A 3A5VA 3OG2A 5A5WA 1AA1B 3TOYA 2QNEA 4B5NA 1I8JA 5AC8A 4GGHA 4TOQA 3ITTA 4AMCA 1X8CA 2FZ9A 5AYXA 2A6LA 3TA6A 3FKRA 2P3EA 1XYFA 1XQKA 5FSEC 3B9AA 1OX5A 2CLEA 1POKA 1SU5A 1O7AA 4ZXLA 3OHMB 3NL6A 2VEIA 3ZT5A 3OLGA 1BGAA 3A12A 1AD1A 4NAEB 3B06A 4LFYA 5GNXA 4HMCA 1WZAA 4LUSA 1WXYA 4GXWA 4FDCB 3WLHA 2WQPA 2VFEA 2P0IA 4ZZ9A 3S2NA 4G1KA 2OGJA 4QP0A 2X0SA 4S3BA 2F61A 1LL6A 3LI0A 4Q6XA 3FEQA 2DZAA 1L8NA 4DBEA 4UBPC 3TQVA 2RKXA 3LTSA 3BLDA 3OLDA 3SR7A 3TLLA 4DYJA 4F3HA 4DJDC 3PAOA 1LLZA 4WDXA 2IKIA 3IC9A 4S2CA 1FH8A 3C0LA 3KVLA 2XUCA 4C6NA 4Z2LA 4EWND 4K38A 1DIOA 1BFNA 4O1DA 4FLRA 4K7VA 4O8AA 1NHPA 4IX2A 1CENA 3TOPA 2W63A 3L2LA 1NWSA 4MKNA 1W3HA 2JF6A 4Q6JA 1ZK7A 3PJXA 1EC7A 4AZGA 3GR4A 5CSRA 1TFVA 5FKYA 3SUWA 4AC1X 2PD9A 2HBVA 4ECLA 3KBMA 1A5BA 7TAAA 4LEFA 3CIWA 2YFNA 3R0UA 3ABQA 4F2UA 2VVNA 1XHCA 3GG8A 3AIQA 4NZCA 1JZ4A 2Q02A 2OMAA 5CPMA 2W0UA 1XSKA 1W1PA 2WNWA 1M03A 4KEZA 3N15A 3T78A 1O5KA 1DOSA 1TYGA 3PPFA 1C7SA 4HD5A 3L4VA 1EHAA 2C13A 2FJUB 1H41A 2I14A 1GZJA 2WKGA 2RABA 1WZLA 4PUEA 4S3GA 3D9XA 3Q2DA 3POHA 1R38A 1IQ8A 5G5IA 2WJEA 2HS6A 4GI9A 3G0UA 3SBFA 1V6XA 3LU2A 3U5UA 3KS5A 4OU1A 4HYWA 3W73A 2CZEA 4GYPA 4MZ8A 3GXFA 3T0DA 4IPIA 3A9BA 2PI6A 1B3XA 1GNXA 2ZXQA 3SRFA 4NNCA 1VBUA 4L6DA 1VR6A 5EBAA 2CEQA 1C8QA 4CUCA 1UR2A 5FD0A 2E9MA 2VM8A 2BG5A 3G1YA 1FO4A 2ZX9A 1E6QM 3BAKA 3LCIA 5EBKA 3W75A 4FX9A 4UTIA 1PTGA 2OOFA 3MMWA 3AHVA 5CZKA 3C0QA 1A3XA 4QFUA 5IDZA 3N2XA 1K02A 4A8RA 4YHGA 5FF0A 2G50A 5EMUA 3ABXA 3C61A 2A0NA 3EDEA 1SO6A 3AIEA 3DECA 2W61A 3AYTA 1FY6A 2YL8A 3GDMA 3QLLA 4OFCA 2R14A 4B5VA 5BU9A 4GRTA 4XZ9A 2A3HA 2Z24A 1S1PA 1A47A 3WYZA 3QFEA 3T8QA 1R2TA 3KRSA 5KZEA 2PDHA 2TPSA 3AHZA 4P8XA 2B7PA 1W9BM 3LXCA 1KM0A 1M7PA 3LXAA 1W5MA 2DIEA 2X8RA 4O11A 4E2DA 1JFHA 4JYDA 4J5NA 3W2MA 4E4FA 2XN2A 1ZY8A 2Y5JA 4WJXA 3RCNA 4EE9A 1FP9A 1Q13A 2CXEA 3E2VA 4L7ZA 3AISA 6TIMA 3Q6JA 2ACQA 1E1CA 3TYEA 4DJEA 2YCKX 4YWSA 3GU1A 3IACA 2Y61A 2GGHA 4QCEA 3V0TA 1JEHA 1X6NA 3THUA 4US5D 1W5PA 4RLIA 2VUNA 4G6CA 5AHLA 4JN7A 3MY9A 4GQRA 1RP8A 1AJ2A 3KHDA 3A4WA 4JZ5A 3BVJA 4Y96A 1LWJA 3U9IA 2E28A 1GV4A 2YVFA 1E9LA 4LVAA 4BI7A 1ZY9A 2BS9A 1PVNA 5LA2A 5ECVA 4GUHA 5I3GA 1LM1A 1MVYA 1NH6A 3LLDA 1ELSA 3BOFA 3H2CA 4I6KA 3L65A 4Z2JA 3TQPA 3ARTA 4PCTA 1GYMA 5C9RA 4IFKA 5REQB 2DW6A 1C8VA 3WQ8A 2FZ8A 1TJ1A 4EMJA 4EPBC 2QDEA 3NQMA 1Q4NX 4FAMA 5T8GA 1EA9C 3RU8X 3ARXA 3ITOA 4L56A 1GW1A 2WHLA 2ZC1A 4EXAA 4XKYA 3EX2A 1I0DA 4A21A 1NDVA 3W7OA 3WQEA 1SW0A 4KS0A 5E6YA 3FJ4A 4ML4A 4GXMA 3I3DA 4JD4A 3N2TA 4HTYA 4IPNB 1F3WA 2OZ0A 2D0FA 1BSIA 1I2NA 1TJ0A 3M47A 4IXXA 4DO6A 1HL8A 2BOEX 4LVBA 5KZMA 3TYAA 1HP4A 4AVNA 4IFKB 1XCFA 2X1TA 1EJVC 4PBGA 1D3HA 4IQDA 4XBKA 4O13A 5DMNA 3KWSA 4Q4QA 2ACSA 3LV6A 2FHCA 3L8KA 3FS2A 2OZ3A 4WOQA 1CXFA 4O54A 3WJXA 1T3QC 1OD0A 1LP6A 1W9XA 1DWGM 1KTNA 7TIMA 3KL5A 3L5MA 3M0MA 3EKGA 3LTPA 1MI3A 3RJXA 2A79A 3SY8A 4DPQA 4BURA 1H7RA 3MMDA 3T1GA 5DRIA 1NHQA 3CMGA 2GVJA 2P3ZA 4CQBA 3NVZB 4GUJA 2E67A 2FZDA 3AS0A 1L6YA 5AVNA 3AIUA 1JUKA 1E1CB 1R8LA 2WVUA 5JBDA 5M2FX 4AZCB 1TTJA 1YDNA 3AMGA 2QAPA 3AJXA 3OIHA 1UD8A 1UKTA 3PZGA 2ZA3A 3VDBA 1NOFA 1ZALA 3I6EA 4ZSUA 2TSYA 1TVLA 4NAFA 3H4XA 3JUGA 3AU6A 4DBSA 4O14A 3T0BA 3DN5A 3CU2A 3F1QA 4JTEA 3WO8A 4HIBA 2WC4A 3EXRA 4MG4A 4CU8A 1HN1A 2BXZA 1XBZA 3H4GA 3FA4A 3MC5A 1DJXA 3JVAA 1XICA 4JTIA 1S38A 4R85A 2FKPA 3A7UA 1ALDA 1RA5A 3ZLHA 4TUFA 1W1TA 1H1NA 1JZ6A 2F5ZA 1V0NA 3EUB3 3DG3A 5EA9A 4LALA 1VBJA 4V2XA 3MA8A 3B40A 2QDGA 1GK8A 2CLFA 1FFVC 5E09A 2CHRA 1F3TA 1YHTA 1ZCCA 4X9SA 1LRQA 2OZ8A 3NO1A 3UPWA 1IEXA 5I02A 3TC6A 5JCIA 3K30A 4WKFA 3QJAA 3EBVA 4S39A 1RY0A 2VD8A 3L4XA 3CQKA 4M0XA 3WELA 3QZAA 3L9CA 4FX8A 3GNRA 3H2OA 3W38A 1M68A 5K4ZA 2HQMA 2J7DA 2H8XA 2O7SA 3EYPA 4XKMA 4LUTA 4JEJA 4L6OA 4DWSB 1XXXA 3N6QA 4ZQNA 2QYGA 4CD6A 1VGAA 5LGZA 1DJGA 4NUWA 3CIVA 1S7MA 1W5OA 1R0MA 4ZBCA 2V5JA 4GPNA 3E0VA 3FYPA 4AU0A 3ONBA 1R3TA 4O1FA 3H70A 4KMQA 1DJWA 2FVMA 3NSXA 3QC0A 4IF2A 1XDJA 3QFBA 4Z1CA 1FHLA 2IQ0A 4PTNA 1KFCA 3NOEA 1CLKA 5DMYA 2O4QA 1XFBA 2Z2UA 5EFDA 2VGGA 4BF5A 1K3UA 3M16A 5C8BB 4AH7A 1I4NA 1KFWA 3E2SA 2CZDA 3C0SA 2WP6A 3O6DA 3WJWA 1QK0A 3DIPA 2DH2A 4W84A 2ZRUA 4HN4A 4DAFA 4NRRA 2QGHA 3F4VA 1VB9A 1EPVA 1LTDA 4MSSA 4DIAA 3ZS4A 2PF8A 5FMHA 2BGQA 5KETA 1MEHA 2ZRZA 1NARA 3CGCA 1K6WA 4JEQA 4JIPA 4B5SA 3SFKA 1PSCA 1TPEA 4J1OA 4PTWA 2PTYA 1W54A 1JDCA 2RGLA 2OTDA 3UCDA 4XZBA 4XSLA 1SFTA 2WM1A 2A7RA 3UNDA 4L9YA 4NZ3A 1Y5WA 3AYSA 4H1ZA 3N2MA 5BXRA 4I9TA 3KS6A 1J4EA 2FIQA 3ZJKA 3AALA 4PMDA 2Q3RA 4GYKA 3M0YA 5B7YA 4Q4RA 2ZUWA 4PTXA 4V27A 4GA8A 2E25A 4U2YA 1N8IA 1TWWA 4M1BA 1O1ZA 2Y85A 2ZZ4A 4DJFA 3SI9A 4DO5A 1M1BA 4PE8A 4J27A 2I1OA 3EOSA 1GOMA 4IIHA 5TD4A 1AUSL 3A6OA 5E5CA 2ISFA 3AYVA 1W1A1 4C1KA 1QBAA 3C4UA 3A4XA 4Y2WA 3NL3A 3SCQA 2P8CA 2Q71A 3OO2A 2OCZA 3PAJA 3BURA 1J10A 1D9EA 2WP5A 3MDWA 4LJ3A 2BTMA 3RIKA 4H7CA 1EBHA 1XSIA 1U2YA 2ZA2A 1Q7ZA 5CPSA 1ZLPA 3QOMA 4NAEA 1O1HA 1PKLA 1TV7A 1WZKA 5U7SA 3AHTA 1XP3A 4PRTA 4HZMA 4I3GA 4E6MA 3MUCA 3GH7A 3W02A 1ZZMA 4BEQA 2Y7GA 5FS9A 3TTSA 3RX3A 4AIUA 2WVTA 1DWIM 2Q8XA 3WLSA 4DZAA 2UY2A 3FW6A 3CGTA 1XYZA 1XH0A 3DUGA 1SSGA 2IPJA 4LYPA 3KRZA 5KVIA 3BJTA 5F1UA 4ZOCA 4INFA 4CN1A 5AHIA 3BV4A 2NXIA 3G1DA 2PDWA 4JFWA 4JR5A 5ER0A 3R8RA 3G1AA 1MQRA 3VX1A 3OYZA 4MF4A 4S38A 3ZZ1A 1RBAA 3TR2A 1ODUA 1OHLA 1JF5A 2ZDRA 3GR8A 2P53A 2PDGA 1NELA 2YXXA 2J75A 3FEMA 1JDEA 4IG2A 2PWEA 5XIMA 4CQCA 4BJHA 1EGMA 4ZOBA 4GINA 2O56A 4W4QA 5DXXA 4JIRA 4W5UA 4KGJA 3N14A 5IDIA 1NOWA 1WAWA 4F79A 1K8CA 6CGTA 1JNEA 1TG7A 2FDMA 4AZ7A 3VIMA 1ZB5A 3UT0A 3QMRA 1UCWA 2IPFA 3R7MA 3GNOA 2GDVA 1A0DA 3MVTA 5JMUA 3PANA 1I1WA 3F7JA 3K4AA 1EB3A 2POTA 5JU6A 3THAA 3E6EA 1M01A 5ABFB 3V4BA 4AYGA 3QSRA 3BLFA 4RNJA 1GRTA 5H91A 2VKZG 3WBAA 1N7KA 3WFAA 1CLVA 3L23A 4ERGA 4AEOA 2HPMA 2P0OA 4XBJA 1U5JA 3GNXA 4Z2GA 1TR1A 1W1B1 4L5ZA 3LK6A 2C7FA 1FDJA 4NZ1A 1G6CA 3RCMA 5C2GA 1Q1RA 3WD3A 2J7HA 1GRBA 1TB3A 2J24A 1GTHA 1NFBA 3O06A 3P84A 1WCGA 3FSTA 3IAQA 3RU6A 2CC0A 4Y9PA 2BB0A 2GLKA 2AMXA 3L2IA 1EF3A 4Y8EA 2X2YA 2X42A 4ZODA 3ARPA 2J9XA 2OQLA 4RUBA 4GIYA 4K37A 3P6LA 4YHEA 2PDKA 2DZSA 4OWGA 4Q8NA 5DCDA 4D6JA 1L0PA 2YR1A 4Q22A 3KBWA 5HATA 5LZLA 1J11A 5EMMA 6ALDA 1SJAA 3VD9A 3U8GA 3P2VA 3UWZA 3SGGA 3CZ8A 1J01A 2OLSA 4WKAA 1B4KA 4ZOHB 1S46A 2ZWZA 1TIMA 3FKKA 3MT1A 4ONVA 1FWBC 5MKGB 2FPYA 3WD4A 2PGRA 1W5QA 1KBJA 2ZCGA 4X63A 4DZ5A 4QAWA 3KCOA 3QZ6A 4QXIA 5HR6A 2NQLA 1MUCA 4HA1A 7REQB 2DIJA 1UBPC 3DHUA 1HJUA 3LSBA 5D04C 4EM4A 1XIFA 3VNZA 2HS8A 4ZEPA 3IJ6A 4DF1A 1TYTA 4URIA 5FS8A 3S2MA 2XIIA 4YTUA 3OQ8A 3QR3A 1NF0A 1SGJA 2QDHA 2VFFA 1DNCA 1XKYA 2CLKA 5L6UA 2BVTA 1S5WA 2BY1A 3LS9A 2J78A 1VJIA 3R1ZA 3S5YA 4RPQA 1DEDA 4CCCA 1Q6FA 3M0KA 3UWUA 1U22A 1XIHA 4K6AA 3RPMA 1C9DA 2ZC8A 1R87A 1UKOA 1ECEA 2ICSA 1MRAA 1XQLA 3OLEA 3VX0A 4O57A 3CGBA 3G1FA 3IPWA 4IMDA 1PL9A 4EM3A 5HANA 1W3NA 3B8IA 2VI0A 4PB4A 4LAZA 3PZMA 4O10A 3S2LA 3O1NA 4O18A 3CASA 4C6CA 3NL5A 5HJLA 3MUIA 1F4HA 2Z1VA 3LNPA 1LJYA 2XYLA 1YTEA 2AGKA 2WXDM 3W83A 1FBAA 2AGTA 3DOPA 2GGEA 3BH4A 2G0WA 3NDOA 3DC0A 5D33A 3RAOA 1YXYA 3N17A 2J7BA 4JYEA 2GJLA 3T4WA 4OECA 5AVHA 1A5KC 1NEYA 1EDTA 4GK8A 4XISA 1EOMA 2WBKA 4D6FA 4QROA 4I9JA 1EJWC 1ZX9A 4HPXA 2ATSA 4Z2KA 3UA4A 4HK6A 1MXSA 1CXIA 1V08A 4MY1A 2D0GA 4L1WA 3SGUA 1A5CA 3G3DA 2PSNA 5C0QA 2DEPA 1XW8A 4WDUA 4ZOEA 1M7JA 1TWZA 4F0LA 5A2CA 2ZZBA 4CNPA 3WLNA 5J5RA 1P6WA 4E5TA 2R1NA 3USZA 3WMLA 2L5HA 5JBFA 1XYLA 1PV8A 3L0NA 4W8AA 1C9WA 4GH3A 1JQVA 4LU0A 3UESA 4MB4A 5LKYA 1B57A 1IIHA 1ADOA 4UTMA 2ZICA 5TF0A 1P7TB 1JZ2A 2ZVIA 2WSPA 2YDRA 4IIDA 5F4SA 1QAPA 4H8UA 2X1IA 1PE1A 4C6LA 3QW4B 5AKQA 3RR1A 5AYBA 1RD6A 1ESWA 5C55A 4W9TA 4N4PA 2B7NA 5AOUA 4B5WA 2WYSA 3QSTA 1PIFA 3U2EA 1RK5A 4J7RA 1UZHA 2HWGA 2V5BA 1XPGA 1QBBA 3W53A 3UYIA 4GHRA 1HTIA 4A4AA 3WD0A 4UR9A 1C93A 2JK2A 1QNOA 1KQYA 3ZIZA 4B91A 1DXFA 1XJBA 3K46A 2YJQA 3EPOA 3SY5A 5U4NA 2DIKA 3TEVA 3TN4A 5IFPA 4QE4A 4FXFA 2D73A 3HG5A 1KD0A 1RD5A 4IGHA 4ZQOA 3NPXA 1UH3A 3QM3A 3KCLA 4CD5A 2QPSA 1KM6A 3BANA 3L5OA 2WB5A 3LPGA 4NSBA 4XWUA 1MXDA 3CLMA 4HOZA 3E02A 2J13A 2D2GA 3B04A 4MDPA 4EXBA 1TMLA 1W31A 5D38A 4LQ1A 1MQPA 3UBPC 3G18A 3PR2A 3PUDA 4KRTA 4JN6A 4NZFA 2WC3A 3NXLA 5GJNA 1RK6A 2GJXA 4OKDA 4JTKA 2YIHA 4R7WA 3T44A 3S5OA 1M53A 3DCPA 4CNTA 4LX4A 4QX4A 5CGQA 1E40A 4GI6A 5CSUA 3W7HA 4D6HA 2WMIB 1M5WA 1R30A 4QGCA 2AMGA 4U10A 3NEHA 3N4FA 3GNPA 3W7QA 3CGDA 1Z8AA 4ROPA 1Z32X 4NVTA 2WOVA 1XBVA 3D3FA 3Q4DA 4Q32A 4HMEA 3BSGA 4WDTA 4DBUA 3TMQA 1V51A 2EO7A 3NQ7A 1ITXA 2IXVA 4PMYA 3G8RA 1C3FA 2Y7DA 2VC7A 2CFFA 3S2JA 5HJYA 2D3LA 1MO0A 4MWAE 5AB3A 5LNUA 1XINA 1JZ7A 3SCOA 1OCQA 3M07A 2PDFA 4OUEA 2B4GA 1LBMA 3QQWA 3S9IA 1ML1A 4HHPA 2PS2A 3DG7A 4IP5A 3EDFA 1X1ZA 3MYOA 2QJHA 2XTKA 3CPRA 5J8LA 3AWOA 5CZSA 1A5OC 3B8UA 3Q65A 1O4UA 2QCFA 2DVUA 2Z1XA 2QJGA 3OA3A 3UNTA 2VGBA 5EMKA 1SM9A 1CGUA 1W3LA 4H04A 3QGKC 2X2GA 1F5ZA 4DM2A 1RCXB 5D8WA 5C9WA 2BMBA 3CWNA 4BA0A 3APYA 3INPA 4TMCA 2EPOA 3EMZA 4D8AA 1XYBA 4K68A 2XFWA 3TNBA 1OF8A 1Q6CA 1E3XA 1EFZA 2D2OA 3ZQ9A 3KRUA 5FF7A 2Y89A 1B3YA 1UOZA 5KZDA 4DN1A 4NI3A 1F76A 1S5VA 1Q6QA 4R33A 5AC5A 3W7DA 2ZDSA 4JPGA 1NDYA 1WAUA 4ATDA 3NVDA 4UR7A 2ISWA 3LXDA 2C71A 4NY2A 2B31A 3VMNA 1JQXA 4IXHA 2AL2B 2WVVA 5AZ0A 1M04A 1Y5XA 5DBTA 4EPDC 5HNNA 1LRNA 4R3UA 5FACA 2INZA 4LPCA 2VCCA 2OR2A 3GZAA 4GFIA 1BTMA 2WHJA 3VINA 2WVVB 3L2MA 3UVIA 1UIOA 3GW0A 5D9PA 4ZMGA 3WNOA 1PPIA 3FDGA 4F4RA 3KBNA 3GM8A 1VCGA 4RDYA 4A2RA 1JAEA 4ZOAA 4CNNA 4LT9A 3FSUA 2MNRA 4M5PA 3ZSTA 4F2TA 3S9YA 2I5IA 3O8AA 3CYJA 4LCSA 4EK7A 3ZVHB 3RMJA 1ISYA 4E8CA 2W3ZA 3CQHA 3SN0A 5DFAA 3AS1A 7XIMA 1EUNA 2G37A 4H9TA 4A3UA 1H3GA 3H12A 2QJNA 2EKGA 3FVMA 1BGGA 2HXTA 5I3DA 1X6LA 1SO3A 1XM3A 3TUUA 1GTEA 1IEVA 1WDPA 1RV8A 4M29A 3STGA 4DPPA 1VPQA 3WSUA 4DWSD 4HU4A 3FXYA 2O9PA 1N63C 5L9FA 4RXFA 1ZJIA 2WK2A 3AZRA 2XH0A 1E6ZA 1ONRA 3RM8A 5IRPA 1UP3A 3BLKA 4AG0A 4L65A 4MUZA 2P1FA 4UTWC 2FZMA 1JJKA 2W4XA 1ISWA 1UWQA 2Z27A 4H9YA 4ADUA 3AUJA 2C3DA 1N2VA 4W5ZA 1WXJA 5FOOA 1V3JA 3AU2A 3VIOA 4J56A 1QNPA 2XVNA 4LRSA 1M6IA 4A8LA 4HSNA 4FF5A 2PB1A 2WPGA 5DMLA 1TV3A 2PDJA 4QRNA 4CN4A 1Q85A 1B9ZA 2GH5A 3E3HA 2R94A 5D9MA 2OO6A 5A69A 3EX1A 5CC5A 4TVUA 1KN0A 5EMLA 4PBEA 1R7OA 2E1WA 3MWAA 3OG3A 4LRTA 5FEWA 1EA0A 4LAUA 2Q8ZA 1FCVA 1FIQB 5AECA 4NNBA 3PBYA 1YE6A 1G0CA 4HB7A 4FF7A 4XVDA 4ICMA 1E4NA 1D7YA 3ARQA 4KGLA 2QVNA 2YL9A 4B2DD 3PTKA 4A05A 4B4HA 1GZ1A 5LNVA 4H4VA 2DSZA 3VDHA 2JIWA 1B9BA 2F6KA 3MV11 3GBEA 3MV01 3URAA 3DEQA 2ADAA 1E6NA 3UY7A 2VDGA 1ZNNA 1K7EA 2GWNA 1KRMA 3HURA 2X30A 8XIMA 1VPYA 2J6VA 4JQ4A 4N7QA 4LC6A 1TO3A 2E6DA 1FWWA 3W85A 1A5UA 4M19A 5CAHA 5LXEA 4D1IA 1CIUA 1I9CB 3KE0A 3GFXA 4B92A 1YEYA 1YTKA 3W7IA 3CH9A 4BQ4A 2PDIA 4KQNA 3W4RA 3W3OA 2FTYA 3IIVA 2GUBA 1F8IA 1SZEA 1FRBA 1HW6A 1X2HA 3HV8A 4YXGA 3S1GA 3R79A 4FA3A 1F6PA 3WNPA 3H7UA 5F2GA 1HKKA 1F3EA 1P1XA 3QMSA 4KWUA 3EMQA 3MPGA 4G56A 4A3RA 5HDRA 1K4GA 3CB3A 1AMYA 4RZ6A 1XGDA 4ZVJA 1R2RA 2ZRVA 3QPZA 4Q4KA 3U4FA 3ES8A 3REQB 1VQZA 3ENLA 4Y9OA 1WA3A 4M80A 2YYTA 1JCYA 3WLLA 1TR9A 2WZMA 4PB3A 2DQWA 3T42A 3GS6A 3RR4A 2WM0A 3BGAA 1T8XA 1W3JA 4ZO6A 3EX6A 3NPVA 3AYRA 1P7TA 4DJFD 4I7WA 2Z1SA 5HPOA 2ZRXA 2BCPA 3HO8A 1UZ1A 5ABTA 3DFPA 5EB8A 3RG6A 3U7VA 2PBOA 5LIUX 1L6FA 4GKTA 3SUVA 5H1WA 3U4AA 2PMQA 5DF0A 3GVRA 4CLMA 4NJJA 3U48A 4YTSA 1Q4WA 1XC6A 1RP9A 3P14A 5EU9A 3WNMA 5DEZA 1FDZA 3U2ZA 5H8MA 1UC4A 1VKFA 4JYFA 2Y7EA 5BNKA 4ML9A 3WUEA 3H4KA 4L6HA 4NJIA 1ME8A 3P60A 3BUVA 2JBMA 4U5IA 3RDKA 1UP0A 1GUVA 5KMYA 2Y62A 1JXKA 2RGMA 3DI1A 1U1HA 1XD1A 2YL6A 1A4LA 2J8FA 2PPGA 3CUFA 4AY8A 5HWMA 5AC7A 3TCEA 4WF7A 3HTWA 5JCKA 4PEKA 4TX6A 1W9UA 1DQWA 2G3NA 1P6BA 5LHFA 2HBXA 3PNUA 4DAIA 1V7YA 3DI0A 1YDYA 4U3AA 4AD1A 4E8GA 4A35A 3B0PA 2BGSA 4DJFC 1NDAA 4IPPA 2W3SA 4O1AA 3EKLA 4HT3A 4MUPA 1CDGA 1QMLA 1MOKA 2ONEA 1J0YA 3AO0A 3TAOA 4X3ZA 1OFEA 4UQCA 3GH5A 3OB8A 5FS6A 2YXOA 4GRSA 4H3DA 3GHUA 5TQLA 4H8NA 3KBVA 1PZ2A 1UWSA 3IK2A 3ZJ8A 3B0YA 2BC1A 3VE7A 3VFLA 3PPCA 1V7AA 3R94A 2R91A 4OE7A 1V02E 3MUAA 5I3HA 1AOGA 4YCPA 3CT2A 2GUYA 2UV8G 4R34A 5CC6A 1FWGC 5G1MA 5IBXC 4S1FA 1IXPA 4WZHA 5KTLA 3MB9A 3N4AA 4IHCA 3GTXA 4AZBA 4GUFA 1SW7A 6ENLA 1QT1A 4B90A 2NT1A 2WLYA 5CEWA 2Q3OA 3BLEA 3TN6A 1NDWA 2Z26A 2NZLA 4QE1A 3T0AA 4GVGA 1DIEA 3UVAA 1UUQA 5LIWX 5FIPA 1F07A 1W9DM 3QHOA 3CK5A 1JCXA 1E1EA 1GVFA 4DNHA 2X1UA 3W0KA 3QHNA 4QJ3B 4PMJA 4OZOA 1KBKA 3DU0A 3SQLA 4V1YA 1J0HA 3TJLA 1BYCA 1SFSA 4WSJA 4ZE5A 5FEPA 4UTTA 3ID7A 3THCA 4UTJA 3ABSA 1GKRA 4WLCA 4XZLX 4AHOA 3NYZA 3O0HA 4ERIA 3LCLA 1W8GA 4GFSA 1KLZA 1XR2A 1DXIA 1FH7A 5I3IA 4PUDA 2VXNA 3KHJA 3OGVA 3VO0A 3LPFA 1RQHA 1MEIA 2ZZ6A 4PGLA 4FLQA 1KGWA 2GZXA 3M0XA 3MSDA 2FGBA 3EAOA 3VD4A 1X97A 1EJ7L 3VAVA 3FVDA 2VFDA 3PB0A 1OK4A 2OB3A 3DK8A 5I0DA 3WDQA 1PDYA 3HGRA 4Q7IA 3PVFA 3KOYA 5HUOA 1Q3NA 3GH4A 1HVXA 1UQYA 1AW2A 3QW3A 1POJA 4GIAA 3S9ZA 3AZTA 4O8RA 1AODA 4GX9A 3N13A 1KW1A 3WEZA 3GD3A 1SMDA 3UR7A 1D2KA 1OG6A 1VBRA 5G4HC 4QE5A 1QASA 1KKOA 5A6KA 1BQCA 4AHPA 3QV8A 2VWTA 1Q6LA 3RUBL 1NWTA 2KZHA 5A8NA 1XCWA 2RDXA 2PRMA 4UQ9A 1MFUA 1OC6A 3FLUA 2OEMA 2C18A 3NYDA 1RJRA 2OSYA 5EY5A 4LH8A 1H0GA 3S8HA 1HKJA 1CB7B 2WBAA 3HM7A 2X0HA 3QZEA 3VILA 3O05A 4QJ4B 3EAUA 4XAZA 1RUSA 3AFBA 3PWIA 3RLGA 3GXPA 2H9AB 3LLFA 4J3UA 3SCNA 4L4OA 1H2IA 5AHEA 1OD8A 4AZ6A 2PTDA 3LZ5A 2JIEA 4MB3A 2J27A 4C6DA 3UA3A 4JL2A 5BOFA 3VK5A 4YPJA 3GYEA 1WXZA 4N9BA 1F8MA 2V5LA 3S6TA 4OOZA 3TZNA 2AQVA 2XVKA 3ANUA 4GGBA 1LVLA 1US3A 3PPHA 4AEFA 5LXXA 3LRLA 4JDBA 3VNLA 3BAWA 4LCRA 1OT2A 1WOBA 3SRDA 2RFGA 2XG9A 3DK9A 4LV4A 1UR4A 3WJYA 3TYCA 3DFOA 3KOFA 1D7FA 2PDPA 1XIMA 2Y2WA 2HXUA 4US6A 2AAAA 1BVZA 1Q65A 4PUNA 3F5KA 1B3VA 1J79A 4KPLA 2QS8A 1SQ7A 3VIGA 3CEUA 1XLJA 3NQFA 1OB0A 2EF9A 3QC3A 4HTBA 2V5KA 3QXBA 3U57A 4H00A 3HFTA 2C79A 2C3CA 1THFD 2PZ0A 1UMLA 2Y4SA 5A3HA 3H55A 4K8GA 3E5PA 2W92A 1W3TA 5DY3A 1EP1A 2PLCA 3UEQA 4P2VA 3MKVA 4UR8A 3NCOA 4HPHA 2J7CA 3LUTA 1GEQA 1GOKA 3T0TA 4A8IA 1E6PA 1LL4A 3WY1A 2JALA 5E9AA 4O50A 1VJZA 1RCQA 4IZGA 3M0ZA 3WH6A 2G4JA 1LZOA 2XIBA 1DORA 1A0EA 1WO2A 1W56A 4I5RA 2WCGA 4J3XA 4MPQA 4AY1A 2PLJA 3OBEA 1DXEA 1P0NA 1GEUA 9CGTA 1ADDA 2ZX6A 3VKBA 1DHPA 4ATWA 1I60A 3PG6A 4G9PA 3TYZA 2YVGA 3ZR5A 1CW2A 4H4XA 3P61A 3S1WA 3KWXA 1RBLA 3H24A 2J62A 3P82A 4XZNX 2HK0A 1M9HA 3GIPA 3OTRA 4QG8A 2XZ7A 4IIFA 1E0WA 1G5AA 2WQDA 3CHVA 3EKZA 4G7EA 1DQXA 1TTQA 4XIAA 2W5FA 1HJWA 1BG4A 1E71M 5CH9A 1UWIA 1OWQA 4IIGA 1L2QA 2IXUA 2PUZA 3DH7A 2GOKA 3GDBA 1I2OA 1B0IA 1LLWA 4HCDA 2VC6A 4QITA 4UFIA 1W2PA 2Z4GA 5E0CA 4XG1A 2HISA 3DGBA 2E3ZA 3H2FA 4PMVA 2ZE0A 2CBUA 5I00A 4OUIA 1JCJA 3IWPA 1CXEA 1XDMA 1QNVA 3VOCA 5HPCA 2G3MA 4LXFA 3IJLA 1TPDA 4HPNA 1ZQ5A 4PB5A 3C3UA 1BQGA 1ZRQA 3JU2A 5I3KA 4N02A 5FF4A 4C1LA 4AF0A 4TR9A 1JG9A 1OINA 4V33A 3GVGA 1B3OA 2E6AA 2E5CA 4D72A 1GQLA 4IGSA 2YDQA 1DWAM 3MW7A 4RZ4A 3SB0A 4QISA 1VEOA 4EIVA 4CNUA 3CT7A 4LBSA 1KRAC 2PCQA 2HEJA 2WMGA 3TTQA 4MAZA 3W1QA 3GRTA 4P8WA 2ZBTA 1B1YA 4O0KA 4JDRA 4E3TA 1J0ZA 3LHVA 3MYPA 4GNVA 3KLKA 4WY0B 4UTFA 2YYUA 4IUGA 4GBDA 1BYDA 2OX4A 1OFAA 1IZJA 3OQEA 3Q94A 3KZSA 4RPPA 4K8HA 1NHRA 5JRBA 1YPIA 4POCA 4H4WA 1W3IA 2EHHA 1OFQA 3UG8A 2DUXA 1XLHA 3EZ4A 1B90A 1T6MA 3DHFA 1TPVA 2YW3A 5C2CA 4RE4A 2UZ9A 3BAXA 3GXNA 5SWUA 2QUTA 1SFJA 4DJEC 1XRVA 5HULA 3UY8A 1VBHA 3W7LA 1GKQA 3NM1A 4HNUA 2AKMA 1JIBA 1R3VA 5AC4A 1X1OA 1FWAC 1V3KA 3IVTA 4NRSA 3GRIA 1FKWA 3T9PA 4MGGA 2YFOA 5AHFA 1H61A 5FCZA 4F8XA 1XD0A 4DZIA 3MCOA 3VNJA 4S3JA 3R4IA 3C3NA 1UH4A 5K7JA 3BTNA 2WMJA 1GVQA 1V6WA 6A3HA 4Y90A 4NEWA 2DZVA 1FWRA 1LBFA 3AMCA 4HZ6A 2DP3A 3N2CA 3VOIA 4UNKA 4GY7A 3UETA 2C16A 4OBSA 1VAHA 4NAFB 4O53A 3TWBA 3EXTA 1BKSA 1RALA 2W67A 5FAGA 1R9XA 3R07C 1EP2A 4R7JA 5T9CE 2BHYA 4JICA 1NIUA 1OIMA 2H3BA 1MZHA 4EXQA 2FHFA 3ZVHA 3UWQA 3GYCA 2QXWA 3TC3A 3WH5A 2O4MA 1NM9A 4DF2A 3EDDA 3BL3A 3NQDA 1UWTA 2QF8A 5BRQA 1JI2A 1W5NA 2B0MA 3O6AA 4LB3A 3NZRA 4IGNA 3V75A 4JTDA 2GJRA 3NO3A 4LBUA 2VT0A 3RLHA 3P7YA 1YDVA 1GRFA 3BMXA 1XCXA 4ADSA 1UWAA 1IR2A 1JCMP 3WLRA 1PX8A 2OYLA 3W1XA 1PKNA 3RFAA 4JS3A 3UG4A 2AQOA 4A3QA 3V0SA 4B3ZA 3W1TA 4UWMA 4UUIA 1UWRA 3DK4A 2OZTA 4PL1A 3MBFA 2OT1A 2XVPA 4MZYA 4KRZA 3H8AA 2J4GA 2YAUA 4TV5A 5A1AA 3NAVA 4GVFA 1TYPA 1V3HA 1NPXA 4LGXA 1E0UA 4DXXA 3KLJA 2DZXA 1JCTA 3B97A 3FNDA 2OLHA 2NV2A 4QAIA 2C1GA 4JTCA 5BYWA 2PTZA 3CAKA 4GYFA 1QI5A 1X96A 3LD5A 1J0IA 3C86A 2PWVA 2ZZ7A 4XAGA 4MWAD 4WUIA 1C29A 3CYVA 1FCQA 5A6SA 3A4JA 3UZZA 5FL0A 4GH1A 1JAKA 1Q63A 5JUVA 5D4YA 2YKKA 4H4RA 2E4TA 4UTHA 3TTEA 4C1NA 4JTFA 5E9XA 3VUPA 4ZO7A 1BVWA 4NJHA 1KRCC 1Z89A 3SUUA 3F03K 3F4WA 3T2PA 3TZFA 4FP1A 3IJ9A 4Z1YA 4GI8A 7A3HA 3M44A 2QJJA 3UWWA 3ZWTA 2V6OA 2E68A 2GQ8A 4AZIA 1NQ6A 4UQDA 4FNSA 4QS5A 2C0AA 3WL1A 2YA2A 2WZIA 2QIIA 4J3TA 2X09A 3T55A 1MFVA 5CBJA 3BAIA 1FWDC 3I6RA 2ZZ0A 3MTWA 4IQJA 1SZNA 2FJKA 2QW5A 3P74A 2UY3A 4B3LA 1MDRA 2J66A 1HKIA 1LROA 1JR1A 1YLVA 2NLYA 2WMFA 4TVWA 2HDJA 4IX0A 4W8LA 2CKSA 2V6AA 5I03A 3Q58A 5D9NA 5FI8A 3WL0A 2VNCA 4GC3A 4RNHA 3ITYA 1NWUA 3OGRA 5A6JA 2Z7KA 3IGHX 2E3TA 2X16A 2GOUA 2D24A 1FHVA 5FJPA 2QCEA 1ZJAA 3KBSA 1R47A 2WSRA