3V5CA

Crystal structure of the mutant e234a of galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEAAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure of the mutant E234A of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Lyase
total genus 134
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v5cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v5cA01
4DWDA 2I5QA 4IL0A 3V5CA 4GGHA 4GYPC 3TTEA 2PP1A 3H8AA 5FJOA 4FI4A 1L8PA 2PU1A 2DW6A 3T9PA 2AKZA 4H2HA 3ZLHA 2MNRA 2AL2B 4GGBA 2POZA 2QJJA 2PTYA 2GGHA 1R6WA 3ZVIA 3R10A 5BOFA 3PWIA 1MDLA 2ZADA 3JZUA 4IL2A 1KKRA 1WUEA 3UJSA 3ZLFA 3ZVHA 4IP5A 4GIRA 3QLDA 3H70A 4E5TA 2PGWA 3RO6A 3FCPA 3CK5A 4IHCA 2XH7A 3SQSA 3IJIA 2PSNA 3QKEA 6ENLA 1PDYA 1TE6A 4DXKA 3OPSA 3RGTA 1NU5A 3PWGA 1BKHA 2GGEA 3QPEA 3P3BA 4Z1YA 4H83A 3UCDA 2O56A 2PU0A 2QGYA 2PTZA 3FV9A 2PTWA 4ZCWA 4DX3A 3BOXA 1EC7A 1ELSA 3PK7A 3IK4A 3MWCA 4ENLA 1DTNA 3DFYA 4HPNA 2FYMA 4MKSA 1SJCA 3MZNA 3KUMA 3U9IA 1ECQA 2OLAA 3FXGA 3OW1A 2OKTA 3FYYA 4GFIA 3DESA 2HXUA 2PP3A 3VC5A 1RVKA 3D46A 4G8TA 4HYRA 3ES8A 3VA8A 3DIPA 4EWJA 3P0WA 3R11A 2HZGA 2OPJA 3H12A 4GYPA 1OEPA 1EC8A 2OQHA 3I6TA 1FHVA 3T4WA 3MSYA 4FP1A 2P0IA 3H7VA 3ES7A 3MQTA 1IYXA 2GGJA 2ZC8A 3RITA 3EEZA 3VC6A 4YWSA 2MUCA 4DN1A 2GDQA 2GGIA 3NFUA 2XSXA 3N4FA 2OO6A 3Q45A 3NXLA 4KPLA 2OQYA 3DEQA 1P43A 3NZGA 1R0MA 3DG3A 1JPDX 1SJAA 4JN7A 3THUA 2XGZA 4MMWA 4JN8A 2OG9A 3STPA 2AL1A 3DGBA 4H19A 1JPMA 4JHMA 4KT2A 4GISA 2OFJA 3T8QA 4A6GA 4HCHA 3RCYA 2GSHA 3R1ZA 2PPGA 4DHGA 4F4RA 1XS2A 1XPYA 1F9CA 4HCDA 3S5SA 3OTRA 2QDEA 5FJRA 1SJBA 3CAWA 1TZZA 3RRAA 4MGGA 3FVDA 3TWAA 3TQPA 2RDXA 3SBFA 4A35A 4IZGA 5J04A 5ENLA 1E9IA 3BJSA 3UXKA 3ZLGA 3UJ2A 2P8BA 4E6MA 3R0UA 1WUFA 3VCNA 3V3WA 3V5FA 3HPFA 3ZVHB 3MKCA 2PMQA 1EBHA 3SJNA 2QVHA 1KKOA 2ONEA 3UJFA 3I4KA 3N4EA 2NQLA 2PP0A 1MNSA 2OZTA 3CYJA 4J1OA 2PS2A 3VDGA 1P48A 4E4FA 4Z17A 3N6JA 4E4UA 3VFCA 4GMEA 3OZYA 4K1WA 4DYEA 2QDDA 3S47A 2HXTA 2OX4A 1KD0A 3BSMA 3I6EA 3SN1A 3TJ4A 3TW9A 4A3RA 4HN8A 4J3ZA 1EC9A 4KWSA 4K2SA 3D47A 5BOEA 4M0XA 3GD6A 3DFHA 3IJLA 1TKKA 2PGEA 3UJEA 3GC2A 2QJMA 3N6HA 4E8GA 3TCSA 3OP2A 3TJIA 3OZMA 4ROPA 4G7FA 1MRAA 3UXLA 1EBGA 3DG6A 3FJ4A 4H1ZA 2QQ6A 3T6CA 3U4FA 2PA6A 2XH4A 1NELA 1MDRA 5FJTA 3QN3A 3ENLA 2CHRA 1MUCA 4K8GA 2P3ZA 4ZA0A 2PCEA 4M6UA 2P88A 3CXOA 3EKGA 2OZ8A 1W6TA 3DG7A 2GGGA 4IT1A 2OZ3A 3TOYA 1ONEA 3GO2A 2P8CA 3MY9A 4HNCA 3CT2A 3SSZA 1PDZA 5FJPA 3P93A 3K1GA 2XH2A 1SJDA 3R0KA 5EU9A 4X2PA 3SN4A 3SN0A 3NO1A 3GY1A 4KEMA 1JDFA 2PTXA 3MUCA 3V4BA 2AKMA 3IJQA 2AL2A 3R25A 4IP4A 3UGVA 3B97A 4HCLA 2DW7A 2QJNA 3PFRA 3VCCA 3UJRA 4HNLA 5IDZA 2PODA 2FKPA 1JCTA 3DERA 3QTPA 2HNEA 5FJUA 3TWBA 1YEYA 2GL5A 3RR1A 1FHUA 3JVAA 3UCCA 2OVLA 3CB3A 3Q4DA 3JW7A 1KCZA 7ENLA 2XH0A 3DDMA 1BQGA
chains in the Genus database with same CATH superfamily
4ZODA 2G3NA 3GR8A 1RD6A 3IIZA 4L65A 3GNDA 1F73A 3NR0A 1L8PA 3AC0A 1OFOA 4I6VA 3EANA 4H2HA 2C0AA 3AQUA 5BYWA 5ECVA 2E6DA 3LHWA 4C6MA 3MTWA 2INEA 5D33A 2XSAA 4WSHA 4CNOA 1BKSA 4ZOAA 1KN0A 3TYDA 3T7VA 1PWLA 4HNNA 5B7YA 2RDTA 3TLLA 3KHDA 3H4KA 4U4MA 3UF9A 3M0IA 1WUEA 1AMYA 3DH9A 1K03A 2ZXQA 5FD0A 4GIRA 1FFVC 4DJDC 4X0VA 1QASA 4GA8A 2DSVA 4UNIA 5BXRA 4DBSA 3HM7A 3VKAA 1T5AA 2HBXA 3NSNA 3ITGA 3W1LA 3PY2A 2NZLA 1BKHA 2GGEA 4PBGA 4C6QA 1TR9A 4UFLA 3VDAA 4PMQA 3WY1A 1YPIA 4R9OA 4F40A 1Q66A 1HIZA 2ZDRA 3PULA 1YDNA 3PZQA 2HJPA 3KBSA 3HZ3A 4M1RA 4N0RA 3YPIA 3EWYA 3IJ7A 5CG0A 4IPLA 2YXGA 2RGMA 3V1PA 4H6RA 4QSHA 5LGXA 3KEHA 3S6OA 4BHYA 5EBKA 1H7NA 3D9XA 1R86A 4G1NA 3A9IA 5A94A 3IVSA 3ID7A 1O66A 1QFEA 2IXVA 3JS3A 2NT1A 3QY7A 4YPJA 1RVKA 1X38A 3PM6A 4WLCA 3W7RA 3WMBA 2ZRUA 1E6ZA 1GVIA 1XBXA 3D46A 4D6FA 2NX1A 4JTLA 3M41A 3CH9A 3DIPA 4FNTA 2JGYA 2PLKA 2H9AB 4GYPA 1K6WA 1US2A 3SCSA 1UZ4A 4NI8A 5DX7A 4UQBA 4HOXA 3HMJG 1EFZA 2Z7GA 4WOZA 3DUGA 5FF2A 3AIEA 1KCKA 4Q8TA 1BAGA 2PCQA 1IXPA 2DSKA 1UUOA 3EKLA 5HWJA 1GKRA 2OO6A 3S0CA 4Q6JA 3VGEA 3BG3A 4YTUA 3W83A 3CXBA 1PTGA 3ATZA 4HJWA 2VD9A 4Q4MA 4TMCA 5XINA 3LV6A 1JFXA 4JKLA 3T44A 1RALA 3DEQA 2VTFA 4EAMA 3LXBA 4MSSA 4EF8A 3OGSA 4D1JA 2CPUA 3QXBA 4Q3MA 4UTHA 3P60A 3ETRB 4GZEA 3UR5A 3WQGA 2PZ0A 4TX8A 1GQLA 2FFCA 3DI1A 3VIOA 2QUNA 1E5NA 4HA0A 5CPLA 4DZAA 4JQ4A 4IIBA 1AH0A 3CZJA 4UQAA 5FI8A 4QHRA 5AHNA 3R1ZA 5AZ1A 3AUOA 2ZBTA 4WJ8A 1XBZA 4D8LA 3AS0A 1XW8A 4R33A 2W0UA 4P7NA 1NF7A 3VM5A 4L4OA 1VP5A 1UPPA 4CEUC 2FZBA 1DWIM 2WPBA 4XSLA 1XRFA 2CERA 2DY3A 4WK9A 3ORWA 1GRFA 4B92A 5BXTA 3VIMA 3E2SA 3S6DA 1C8YA 3W7NA 3T2PA 4FXJA 3B0YA 4Z2HA 1LUCA 2YSWA 2CZFA 4AD0A 1DHKA 2WQDA 3GU1A 3PBWA 2XWEA 2QNEA 2GJLA 4BEUA 1F07A 4H4YA 1W2PA 4FX9A 2PRHA 3M5VA 1UR2A 1B5TA 1TIWA 3WLJA 1E6PA 3BAWA 1LL6A 4CLMA 3UVAA 3TEVA 3AHXA 4B2DD 5MKGA 3TJ4A 4E0CA 1REQB 3TW9A 1TTPA 2DU2A 3U2CA 4KWSA 3KP1A 5KZMA 4M0XA 3S2MA 2CNCA 4XVDA 1WXJA 3TW7A 1SB3B 3DGZA 3AYSA 3QVQA 2PGEA 1FRBA 2VFEA 5HULA 3I7SA 3SUSA 3G1FA 4E8GA 2QLYA 2PF8A 3E49A 3PB0A 2B81A 2W54A 2R82A 1C93A 3TJIA 2OU4A 2WOVA 1TJPA 5I7GA 2VZUA 1ME8A 1MDRA 4XK2A 3OLDA 1NY1A 2I16A 1HG3A 4CQAA 4XVEA 1FH7A 2DT3A 2QZRA 3LUTA 3LNPA 3O06A 3B06A 2OZ8A 1Y0EA 4H7ZA 3LGGA 3TOYA 2BC0A 5F7UA 2P8CA 2NX9A 1V02A 3WH8A 4GLEA 2NV9A 2Z00A 3VUPA 1CBGA 1V77A 4Y9MA 2C71A 4GNKB 2CIPA 2TAAA 3G1XA 4JHZA 1YNYA 3NZQA 1EJUC 2OMAA 5C71A 2YGYA 4UFMA 4TVDA 2NX3A 3LK6A 2F38A 5M2FX 1HJVA 1CLXA 4JTJA 4O13A 2QJNA 3ARQA 1QWKA 6A3HA 1Q6CA 1XGDA 5TR3A 5HUOA 3W7QA 3BOFA 3CHCA 3VD7A 3NZPA 1O5RA 1W5OA 2DIEA 4KQNA 2HBVA 3DERA 3LYEA 3VM7A 4GHRA 1JJKA 1IHIA 2QDHA 4ILSA 2EF9A 4HZ8A 1XDLA 1NWUA 3VGGA 3AWNA 3EB4A 1QBBA 4H4IA 4QBXA 1QOPA 3WBAA 3ZQ9A 2W62A 2GVEA 4QE1A 4IGNA 3B8VA 4FIQA 4BEQA 2J3NA 1JPHA 4GACA 4O1BA 5FJOA 1G94A 1X7IA 5GNZA 2X99A 1G9HA 1JZ3A 1P7TB 2VFGA 2JKPA 3UWWA 1B9ZA 3LEPA 1N63C 2AKZA 2WBKA 2X1TA 3F5JA 1PPIA 4V2XA 3N3MA 1E43A 1JL8A 1KFWA 5I02A 4TVWA 3TN6A 1JYVA 4UMCA 1P0NA 3SDOA 4XAPA 3ITXA 4TO8A 2ACUA 3R6IA 2GR1A 2E8ZA 4GK8A 1GZGA 1GERA 1MDLA 2BHZA 4GI6A 2NUWA 1UYQA 3HN3A 4TX9A 4HNTA 1EPXA 1GPFA 2VZVA 3OBEA 1D3HA 1Z6KA 3GDKA 1Q2RA 2RGLA 4K1GA 1B31A 5D09A 3PP7A 5AYZA 3FCPA 2ZZ1A 1OYBA 5AC4A 2CLPA 4IHCA 3SQSA 1JRPA 5CSRA 1XSIA 6ENLA 5BW6A 6TIMA 4H9TA 1KFKA 2VVNA 3MYOA 3CBWA 3MMDA 3IUHA 2YDQA 2Z25A 4Z2KA 5IM51 3NWRA 4Q8PA 2OSWA 4ZMGA 4O11A 1W5PA 2PTZA 2QKFA 3BLOA 1EXBA 2IQDA 4W8AA 3MWCA 3HPAA 3G5EA 5CC6A 2XFFA 2C15A 3WX7A 1YE4A 5CZ0A 2WQPA 4AD3A 2QMKA 3VOFA 3USZA 4QSFA 5FA5A 1Q1WA 2XIOA 4MJ4A 3UQNA 1OX4A 4Y6GA 2HE5A 1VCVA 4D6GA 1B54A 3QR1A 4UWMA 2VC9A 3QMRA 3G6MA 4CQCA 3CT7A 3CLMA 2R6OA 1V02E 3BH4A 2FDSA 1R3WA 3DESA 3KCOA 4K37A 4WGHA 1VPYA 4H4RA 3MUXA 1H7PA 2NSOA 3DOPA 1CECA 1N55A 4QDPA 2H8XA 4JFTA 1ONWA 1FHVA 4Y7EA 3MSYA 1OC7A 3QEZA 2YJQA 1VHNA 3H2EA 1MI3A 1XLGA 3STCA 4RNIA 3LI0A 1JI1A 3KBVA 2MUCA 1JZ7A 1A5NC 4DQWA 3N4FA 5LIUX 4IM4A 3OA3A 3Q45A 4B4FA 2WVVB 3GHRA 3NXLA 4DEFA 3H53A 1TPUA 1E6QM 1DKWA 4FSAA 5BRBA 1NSJA 4FNUA 2BDQA 1VBUA 1OSEA 5HR6A 5JIPA 1H62A 2XGIA 4Q22A 2AAQA 1JYNA 1BTMA 3MMUA 5K3VA 4DVOA 4ZSUA 2ZUNA 2G97A 1C29A 1OZQA 3MBFA 8A3HA 3IV8A 2J8TA 3QH2A 4KT2A 2D3NA 3B40A 3M0HA 4UOZA 3GC5A 3G8RA 1R3RA 2E28A 2QCDA 4MY1A 2I56A 1OB0A 5H91A 2AQOA 2OEKA 3ARVA 3PBYA 3E9AA 1UIOA 4KWVA 2WMJA 1RP9A 4LIIA 3MCNA 1EIXA 2F2KA 1JQXA 1QPKA 4XBKA 3V0TA 2PLMA 4OZOA 1QBAA 3TE9A 4M56A 4QGCA 3WD3A 2EQ8A 1FY6A 1E72M 4CCZA 1NFPA 5G4HC 2J7EA 1UWTA 3HIJA 3NAVA 5K9CA 3L65A 3HQPA 2UY2A 5A69A 3SB0A 3RMEA 4UZUA 4HGXA 4K8EA 3VCNA 1TB3A 5KZEA 3JUGA 4AZGA 5A6JA 2VT0A 4Q8OA 3VNKA 4FNQA 3UJFA 3I4KA 1UMYA 1B3ZA 1BPLB 3V18A 2OKOA 3DYMA 3GVVA 3TFCA 2RABA 3G0XA 1XD1A 1PHQA 1LP6A 5CJNA 5XIMA 1PUDA 4ZQRA 2CLIA 1CLKA 1R7AA 1W9XA 2O9PA 4MM1A 3SAZA 1VGAA 4PEEA 4JTGA 5A8PA 1E70M 3FIGA 1TKKA 5L6UA 1C3FA 2J47A 2PWFA 4JFVA 4TQTA 4ZB2A 4PFHA 4L6HA 4YTTA 1N5XA 4XQ6A 4ADUA 3TZFA 4XAGA 3GD4A 1JD7A 3GRSA 4KFNA 4FX8A 3GM8A 4TR9A 4JQ9A 2QF8A 3NDOA 1GVQA 3MCMA 1EP1A 4E2BA 3GS6A 1G6CA 4AXKA 1Q45A 3OLIA 2VDGA 1QK2A 1NELA 2CU0A 3KTXA 3W7CA 3ONCA 9CGTA 3W6YA 4JFUA 4LS0A 3RPDA 3RHGA 4K8GA 1TJ2A 3EKZA 3RLUA 4MTVA 2FH8A 5A6LA 5HPCA 1HZYA 2PCEA 4HSOA 5H6HA 1TX0A 1OGBA 4B2DA 1V6XA 4GJIA 3D3AA 2OO0A 3PF3A 4IFKB 4WEVX 3P82A 5C54A 3KL3A 5BRQA 1VF8A 2E5BA 2V5DA 4DF1A 1OFRA 3FA4A 3P80A 1ITUA 4RNHA 4C6IA 4QDMA 4F0SA 3TYZA 2Z27A 3SJ3A 1G4EA 4JTRA 3P84A 2XN2A 4GABA 3NCOA 5DF0A 4U31A 4KEMA 3MDUA 3PFMA 3S4TA 1RY0A 1HKKA 1J11A 4DLMA 3ZJ6A 3B4YA 3VGBA 3C0JA 3T09A 3N73A 4JQ3A 1X96A 3AMZA 2INFA 5JXQA 4QLJA 4F0MA 1HGWA 3C0QA 1JCTA 2E5DA 1V7AA 4JXCA 1BG4A 2DSUA 1UD6A 3TWBA 4JYEA 3T2QA 4ML4A 3N34A 4MB5A 4FA3A 4L6OA 3LADA 1E0XA 5FSEC 5DY3A 1JG9A 1Q65A 4V1YA 2Y6ZA 3KZSA 1J9YA 2Y62A 5F4WA 3SR6B 4O19A 1E1CA 3TR2A 1JUBA 4ZXLA 1VFLA 4DWDA 1XANA 1TIMA 3LPGA 3H8AA 1KGWA 5DCBA 2J7HA 3GNNA 2PDUA 2IW0A 2PU1A 3VNYA 3PC0A 1WXZA 1XLJA 5CZJA 1MO0A 4Y9AA 3LXDA 4JEJA 1DJXA 1TTIA 1ZS2A 1RJQA 3U48A 3EMQA 2F9RA 4M80A 4QAWA 1NOWA 3O15A 3H23A 2XINA 3ZWSA 3L67A 3VNLA 4B5NA 2Y5EA 1WKYA 2E68A 8RUCA 4ZO8A 4Q8VA 3LMYA 4XB3A 1ADOA 1QNQA 2EPMX 5GNXA 1YKWA 3F4DA 2VDIA 4AYGA 4ERAA 3UWVA 1ZBWA 1S2TA 2IKGA 2OWWA 5DANA 3LX9A 1X1OA 3OG2A 3RYSA 4H9ZA 1OM0A 3O2LA 1KXTA 3KOYA 4HA4A 2NV1A 4Q8WA 3GWQA 4EIVA 3PSWA 1EWDA 2BP1A 5AHEA 2OQLA 3PWGA 1D8WA 2P3EA 1VFMA 3C2FA 4EQWA 4LY8A 3V5OA 5D2TA 3NOYA 1TE1A 2G3IA 2E5CA 3POHA 2AOSA 3S5YA 2VFHA 2G3FA 2C18A 4PTVA 3VNZA 2VGIA 3M6YA 2RDUA 3W70A 2D1ZA 5KSWA 2PGRA 2DZXA 2CITA 5HQLA 4JEQA 2QS8A 2P1FA 4O16A 3EB2A 4W86A 1X1NA 4Q32A 3U9IA 4PRRA 3VD3A 5C9RA 4Q4KA 5CH9A 1CXHA 2IMRA 3IUDA 1FWNA 1VENA 3G1RA 4C7DA 4ICNA 2WWDA 2CKSA 2Z1WA 5I6SA 1VQTA 3UYIA 3SI9A 9RUBA 4HHHA 1NHPA 3TW6A 2ZYFA 4GR1A 4AD1A 3D5HA 2QV5A 1LYXA 1UKSA 4K38A 5D2VA 3ALGA 4IIGA 2REQB 1BYBA 3SRDA 3G1HA 1VZWA 4DI8A 4QXIA 2WPEA 1BVZA 4NQ1A 3BG5A 4HU3A 4WQ6A 1SW3A 3PTKA 2A3HA 3W22A 1XG3A 5D8WA 1Q13A 3W85A 3PN8A 3B9EA 2QHAA 3R07C 5JIWA 2V5BA 2VEIA 4KWWA 3GIYA 3GSMA 1F8WA 1W8GA 4UQ9A 4R3UA 3DJGX 2FMOA 3W7OA 3N11A 1TJ0A 3A7AA 1R0MA 2Z2AA 1ZLPA 2ZKMX 3R8RA 4FB7A 4MMWA 3RX3A 1PHWA 3WD1A 1UWSA 4WY0A 2ISSA 4Q4RA 1EF3A 4UTFA 3C56A 1JPMA 1DEDA 4YVPA 2JALA 1UHVA 1EHAA 3BZGA 3VINA 1TPVA 3NL3A 2W63A 3T8QA 3QGVA 3OLEA 3R43A 5I78A 1E0TA 3TJLA 1G4TA 2V6AA 3M43A 4BQ5A 3T55A 2OODA 4EPBC 5FESA 5DCEA 1MXGA 2XISA 2HV5A 1W1ZA 1MQQA 4MGGA 2EKCA 3OVRA 4B9ZA 3VABA 4XD3A 2J9YA 1NDYA 4AZ5A 3AI0A 3FN9A 3HURA 1BXNA 1XV8A 2GJXB 1RVGA 3RX2A 1KB3A 2ZXAA 3QV8A 2LLEA 4PUWA 5AHFA 3STGA 4B3LA 4F2BA 2NVKX 3DXIA 3STFA 3APGA 1NVMA 1WKFA 2I5GA 3IRSA 2C7FA 3OZPA 4J1OA 3SCRA 3I7RA 1TPDA 1KM2A 2D2GA 3CHVA 1TWWA 1C9DA 2AAAA 4GMEA 4YL2A 2WLZA 1Y5XA 2OX4A 4JQAA 1XUZA 1R85A 4K2SA 2DZBA 3F5LA 3QGKC 2PWHA 3OB8A 2FFIA 1HP4A 4OIFA 3ME3A 3BCDA 4M5PA 1PYMA 3HQ1A 1RK6A 2QT3A 2NQ9A 1KV8A 5E0KA 1XLMA 3L5LA 4PUDA 1IF2A 1R3VA 1O60A 3G3MA 1NWRA 4JYFA 1GUVA 3DN5A 3OIXA 2NXIA 3CWNA 1F6KA 4QJ4B 2P3ZA 3IEBA 3TTYA 3IGUA 3P5ZA 3B04A 3CZKA 5HWNA 4LUJA 3W1AA 4MNJA 3W71A 4UTIA 5MKGB 3BJFA 1FP9A 1A5MC 3EOEA 1JR1A 3KW3A 1MVYA 2QCLA 2YQUA 4W8LA 1H49A 1DQXA 3NL6A 1Y5VA 4QLLA 1XLKA 5FJPA 3AN1A 1DP0A 4N9CA 4DLFA 5KINA 2EGZA 2VQTA 1FTXA 4LQ1A 1Q6EA 3HB9A 4A21A 4DJEC 1HKWA 1K6AA 4DRSA 3LLXA 5BROA 4NRRA 3TJXA 3W87A 2PWUA 3V4BA 4GINA 2ZZ5A 4HB7A 4AF0A 1R3SA 2WC4A 2AL2A 3KLJA 4S3GA 1EP3A 1FWRA 1UJQA 1W1PA 5EMKA 4EX4A 5EMJA 1JCNA 3RU8X 5FJJA 3AALA 3SCNA 2CLHA 1GQKA 2O9OA 3RIKA 2QCEA 1F3EA 3VGFA 4AD5A 4DWSD 4DI9A 2BCPA 1FDYA 1D2KA 1OIMA 3AS3A 4QS6A 4QR6A 3A9BA 2PWGA 4NG3A 3E0WA 1UMLA 1VLIA 5DY2A 2X0HA 1DJNA 3LPPA 4IPPA 1ISVA 4FR1A 5GRTA 3IUIA 3FSUA 3WLTA 1JEHA 5KETA 4H9MA 2Y63A 1OG6A 1DYSA 1A5UA 3WJSA 3MI2A 5DELA 4TVCA 5KEZA 4NAFB 2QJHA 2BY1A 1JUEA 4J3SA 1PIGA 4UFHA 3ZLHA 3KVLA 5M03A 5I3GA 2ZDSA 1NDVA 2VX7A 1BSLA 4QIUA 1GOXA 9XIMA 1ISYA 3M0ZA 1VBHA 4ERGA 3UNTA 2BXVA 4P8XA 4CU6A 3GDBA 4KERA 2BC1A 1LJYA 1VFUA 4A4AA 4FO4A 1VCGA 2Z2UA 1CXIA 5FS9A 3LXCA 4Q4OA 3TCEA 1CI1A 3PZIA 2XFRA 3QC3A 2J7GA 4DAFA 3IJIA 3UWQA 1PDYA 1QHPA 1C91A 1TE6A 3W72A 3CPUA 3RGTA 1Q6RA 4E3TA 4WJEA 1IGWA 4AWTA 2ZC1A 2WHJA 2XGBA 1F8IA 3I10A 4XD6A 4WSKA 1RBAA 2YPIA 5D9PA 1WZKA 2DSZA 2WVTA 3OJGA 1AH3A 3PJXA 3FOKA 4OWGA 1XP3A 3BGJA 1CGTA 3WNNA 5BWFA 1WBJA 1OX5A 2Y7DA 1U5VA 3N9RA 3W25A 3ITCA 5CSSA 1QOXA 1TPC1 3C2YA 4MLRA 1V8EA 3A4WA 3CS2A 2VDHA 4F79A 2JQXA 4Q8UA 2FPYA 1FWCC 3UXAA 4EWJA 1ZL1A 1V97A 1TFVA 3LRLA 1RPKA 2HPMA 2OQHA 1PKLA 2CXEA 3LBOA 3SGGA 3N9KA 3THCA 5E5CA 3DGRA 3TQ0A 2XZ7A 3K13A 3F4VA 3P14A 1WZAA 4ADSA 2FVKA 4JTHA 3T8LA 4XBJA 2XSXA 4KFPA 3AM9A 3GTFA 2HK0A 3QHMA 4U2YA 3CV2A 3PHAA 4HMNA 4DBUA 3NEVA 4NVTA 2BX7A 2WK2A 4G9PA 5HOSA 2G4JA 3IWPA 1FEBA 2DZSA 4I5UA 2OWCA 2VCCA 2Q8LA 3UZWA 2WWCA 4ORMA 2ACSA 3KBJA 3THUA 3APYA 1Q6QA 3F5KA 5D38A 1UH2A 3NQ2A 1ZUAX 2CZDA 2YOCA 3TU9A 3OC4A 1AW5A 4WD0A 4NZ1A 2WP5A 1QOQA 2WVSA 1GEUA 2YL8A 1OFQA 3DFPA 1MXSA 4A6GA 1Y5WA 1QDSA 1I2NA 1NTHA 3RCYA 1J2WA 4EM3A 4DHGA 4D2JA 4MLJA 1XBVA 5ER0A 3RU6A 3U7VA 1FBAA 1TWDA 3WF3A 3HFYA 1R3QA 3EB3A 7TIMA 5FJRA 7ODCA 4BURA 5CAHA 3LB8A 1TZZA 1BEUA 1CB7B 1QTWA 3SBFA 5I3KA 4W89A 2CZEA 1HF6A 2E3ZA 1LRTA 2NW0A 3SRKA 3P0XA 1MOKA 5AC6A 1A5BA 3V5FA 4JIEA 1B3OA 3CZLA 2QCMA 2Z1BA 2WMHA 4YYCA 1VD6A 1GOQA 2OZTA 4IGHA 4LRTA 1VC4A 3CYJA 3ARZA 3ITTA 1P48A 4Y8FA 3N2TA 3NSXA 1XQKA 4J2PA 5BNKA 2OEMA 4LA1A 1OK6A 3V36A 4C7FA 4LVAA 2I9UA 1MZHA 1KC7A 1BWVA 1JEZA 2HXTA 4Z2IA 3NQ8A 1VFTA 3C2OA 4CNUA 3BSMA 5FSDC 2VX6A 3UGRA 2QMJA 1OX6A 1Q8JA 2P53A 1Q6DA 5BOEA 5HMEA 3IJ6A 3UR8A 4CKQA 1NAL1 1SGJA 5BWAA 1KR1A 3KS5A 2VUYA 3W75A 4IXHA 2YL6A 1PX8A 2E25A 3S46A 2HVOA 2OTDA 3LXAA 4HNUA 2Q8ZA 3ELFA 5D02A 1IGSA 1IR2A 3ZT7A 2V3BA 1DXIA 3VGHA 3OZMA 4ROPA 4EANA 1BYCA 4NIRA 1M1BA 1QW8A 1Q63A 4PB5A 1OABA 4L80A 1PYFA 2XH4A 3C2EA 3W0KA 3M0KA 2VENA 1XD0A 3WNKA 4X3ZA 3BLIA 1DTUA 1WAUA 4D6EA 1OADA 4H2CA 1ZX9A 2B7PA 4LVBA 2P88A 2V8ZA 4ROQA 3TOPA 1JZ6A 4Y90A 4UTJA 1W6TA 4Q8NA 3W1RA 3AHVA 1ONEA 1U1JA 1X8CA 2WSQA 1UR0A 2CBUA 2NWRA 1Y65A 3RK8A 1PZ3A 4AY1A 3W2KA 4YHGA 3AICA 4S3DA 1KLYA 2V5LA 2Z6IA 2BZNA 3GY1A 1WV2A 4LPCA 3V16A 2AKMA 1Q4NX 1JAEA 4G56A 3A3XA 4JTDA 4MJZA 4DO6A 4XISA 1DQUA 3E96A 5HANA 1O5XA 5BU6A 5C6MA 1JPIA 4L4MA 3NQBA 1NOUA 1SFTA 3AIVA 2PODA 2KAUC 5AY7A 2VFFA 4EK7A 1H7OA 2G3MA 4MNKA 3TYCA 1VJZA 3VIFA 1DJWA 4ADTA 3F03K 4IPIA 1B2YA 1RUSA 3B05A 1OGGA 4A22A 1U2YA 4O15A 4AVNA 2WBAA 1WDSA 2BLEA 3E5PA 3GX9A 4WXZA 1YRRA 4LUYA 4DJFC 3BAKA 3B0PA 4B5UA 2NPXA 3MT1A 3GXTA 3B0XA 3LRKA 4GKTA 1Q85A 1WDDA 1UR9A 1YX1A 4I7VA 4HYWA 3TTOA 2Q3OA 3HTWA 3NPWA 4P2VA 4LCQA 1ZSXA 5LHFA 1BGGA 1S1PA 1EA9C 3P2VA 2PDHA 1XYBA 2E9BA 5HAOA 3ITYA 1OVDA 3ZMRA 1R6WA 3R10A 2W9MA 4QG9A 4NJIA 2EPNA 4H8UA 4RKAA 4DWSA 4FF7A 3TMQA 3G2GA 2E9MA 4DPQA 4YVVA 1EJSC 4R34A 4NILA 4C65A 4ACYA 3ZLFA 1AD1A 4DBWA 3M4HA 5LIKX 5MHBA 2BGQA 3QLDA 3WLKX 4BKNA 1PEZA 1HKIA 1P6CA 4S3BA 3LHVA 1K7FA 4M19A 4RDYA 1UA7A 2OEJA 4WKFA 2X2YA 1FHLA 1V08A 2PDYA 3VNDA 3P3BA 5HPOA 3IV3A 2FGZA 3AISA 2A1YA 5U1OA 4H01A 4QE4A 2E09A 2ZZBA 4FNPA 3ZIZA 2VZOA 3L5OA 2OB3A 4CUCA 4HNOA 3T0BA 2EQ6A 2HQMA 1IWAA 3WQ5A 3UW6A 2C3ZA 4RE0A 4BWLA 4MYAA 1SJCA 3NGFA 2P76A 5CGMA 3H2MA 4RW3A 5G2WA 3HBLA 2QPXA 3KBWA 1N5WC 3UY7A 1FWWA 2FVMA 4R88A 4J3TA 2VGFA 1QNRA 3MSRA 2PI6A 3GYEA 3AOFA 1TV5A 3RLHA 1N60C 3CZGA 3AU6A 1D9EA 1GOMA 2Z4GA 3OG3A 3FSTA 4R7JA 1E6XM 3O6CA 4EMJA 5I09A 2XFWA 1QI3A 1XM3A 1PTAA 3NVDA 2ZZ3A 3FA5A 5F4XA 4GZIA 2D23A 1OFEA 5CC5A 2WNWA 3UZXA 1WKEA 4A05A 2CDUA 3GH5A 5FMHA 4BR1A 2O55A 1V0NA 3KDNA 1ITQA 2GZXA 3FS2A 5LSMA 3EPMA 2J77A 2YFOA 1PZ2A 2YDSA 3KM8A 4O1DA 2FZDA 3GHSA 3OYZA 3LERA 2FPVA 3L23A 4MWAD 1OK4A 1FWDC 1IEQA 3WYZA 4X61A 3WFAA 3LB0A 4RUBA 1JGMA 4HMCA 4JAWA 1Z48A 3L66A 1CGXA 3DGBA 3J7HA 2C19A 4XTIA 3QC0A 4HK7A 4DJFD 2ALDA 2ZE0A 4C6DA 1VR6A 5F2MA 2ZTJA 1XRVA 4XKYA 2OCZA 3EXTA 2WPCA 3NVTA 1BVNP 5A95A 1B90A 1TA3B 4B90A 4XZWA 5CC3A 1VYSX 1PSCA 1J93A 1XIIA 4M24A 1G69A 1SJBA 3R79A 3UXIA 2CXGA 1OF6A 3MUAA 5CBBA 1UH3A 2DFAA 3MV11 5JUVA 1M6IA 1XYZA 5L9FA 3SY1A 1FHDA 3ALFA 1J10A 3P67A 4IZGA 1H51A 2PDJA 5CJMA 1E9IA 2PTDA 3LHZA 3UXKA 3QGAC 4E6MA 2GQ8A 4F2UA 1UZDA 3A4AA 3HPFA 1KBJA 1X6NA 5JH1A 1DIOA 2C13A 1NP2A 4WY0B 2NQLA 4HYVA 5DFAA 1MNSA 2OOFA 3MC5A 2J75A 3KRBA 1GRBA 2ZX5A 4L5ZA 4I8DA 3SECA 3HV9A 1TJ1A 5JCIA 5K9XA 1S2AA 4E4UA 2FDMA 3AMKA 2W3RA 2ISVA 4ACZB 1DXLA 4JNMA 2WVUA 3I4EA 3FDKA 1K8ZA 2ZZ4A 2BB0A 1GVSA 4AZ7A 4FNRA 3C6CA 3QZ6A 2BOEX 3EA2A 4LS1A 2BOFX 3ZO9A 1W3KA 1I0BA 1T7LA 1QI5A 1ZXIC 4MYXA 3DKLA 4QJ3B 1LBMA 3U2EA 4PA8A 2HCVA 3CQJA 4W7VA 1HUVA 4S3EA 4UR8A 1G7VA 1EBGA 1L6YA 1RA5A 4PSPA 4ZO6A 1OCBA 3NA8A 2R9RA 2Y8UA 3T6CA 3FJLA 1W37A 5F2IA 1WDQA 2CHRA 3S1GA 3RCMA 1GQJA 4RNJA 4DM2A 1A5OC 4XZNX 4A3HA 4AW7A 5AOUA 2WLYA 5D9NA 2HPIA 3WBEA 2YL9A 2E0PA 1K4GA 2QIIA 3GW3A 3W26A 5SWUA 1SZRA 3BGGA 3QQ1A 2C3CA 3S2NA 1GYNA 5CPTA 1A49A 4PMJA 3MSDA 3UERA 1P1XA 3K1GA 4DM1A 3NG3A 5EU9A 3VZZA 1HKMA 5K7JA 4JDBA 1TVLA 3RAOA 4DYKA 1KXVA 3KWXA 2PTXA 4UTLA 1PX3A 2J74A 1ZENA 1A5LC 3LLFA 3UG5A 3L4UA 2WJZA 3UJRA 2WHMA 1IQ8A 1W9UA 5CPMA 4YTQA 3W3OA 1I2QA 1LRQA 3L2IA 4CQ9A 1ISZA 1E73M 5HINA 1VBGA 2QYGA 4WDUA 1XFCA 5LGZA 2IPGA 2DT1A 6PTDA 1Q6OA 4RE2A 1K8XA 2V2HA 3A64A 3Q4DA 2PWVA 4O12A 3PZ9A 5AZ0A 1EZ2A 1M7OA 2ICSA 4XX6A 2QAFA 1V6VA 2XH0A 4E38A 1JROA 3UR2A 2R8WA 3U7BA 3TSDA 2JF6A 3A47A 2VKZG 1M3UA 1DNCA 4JL1A 1OCJA 1LQ0A 1YNQA 1DE5A 2DW6A 1PV8A 5AC7A 5I00A 1QI4A 2A4AA 3C3NA 1TCMA 4N6EA 2B4GA 4AF0B 1UZ1A 2AL2B 2UBPC 3E0FA 1UD5A 2EEXA 1LZOA 1H1ZA 1T8QA 2W55A 5DQPA 1YDOA 5EFDA 3ZVIA 1V59A 3SCUA 3ZYZA 3BMXA 2NV2A 3GXDA 1M04A 3WLRA 4GO8A 5H1WA 4UFJA 4LTSA 2D73A 3C61A 3F2BA 1I9CB 4MZ8A 1T99A 1OINA 3DFNA 3FKRA 1N82A 3CK5A 2XHYA 3D6NA 3RR4A 1MEIA 1GVFA 3CAKA 3LHUA 2D2JA 3UCDA 3ABZA 4P8VA 4MG4A 3NEHA 1DXEA 1AQ0A 3T08A 2PTWA 1L8NA 4KCTA 3EEGA 4IJCA 1XLLA 1PTDA 1J5TA 1REQA 4O0ZA 4C6BA 1DTNA 2OZ0A 3T0AA 1D3CA 3DECA 1XH1A 1LT8A 1E56A 3AROA 5KZDA 4JTFA 3FDGA 2CBIA 1CGWA 3DZ1A 1NDZA 4HA1A 4DZHA 3O05A 1IEXA 3I7QA 3W1MA 4AC7C 4UTWC 2J7DA 4AC1X 2QAEA 3UZYA 1UQZA 5GJPA 1E40A 4O28A 3OW1A 4E3VA 1BWLA 1NWTA 1T3QC 1KQYA 1I4NA 4YMZA 3B4UA 3GNOA 5D9OA 1M01A 3G1DA 3K4WA 4CD7A 2XSBA 3AMGA 1N61C 3R0DA 3S9ZA 1XH2A 4LAKA 3QHOA 2FHCA 4W5UA 1N2VA 2WKGA 1KWKA 3WIJA 1BHGA 1EUNA 1GYLA 3UA4A 3W88A 3WK1A 5DT7A 2Y1HA 2CLMA 2VL4A 3H12A 4R7OA 2R1NA 4KETA 3Q65A 1MQPA 1IWBA 3ANVA 5CSUA 4KEZA 4KRUA 1E9ZB 4PULA 4ZVJA 2CLEA 2FGLA 3TTQA 2R1PA 4LUTA 4L4LA 4KCVA 3ARSA 3QMTA 1IV8A 2GDQA 2F84A 3OYXA 1AJZA 3WUGA 3N2BA 2R14A 4EP8C 1FOBA 2GFTA 1G0CA 5D05A 2QF7A 2VC6A 1RQEA 1IEWA 2PBGA 3O3RA 3HG5A 2GDUA 2XZ9A 2VRJA 1O1ZA 3TYEA 3DG3A 3WNOA 3CWHA 3DFOA 4GIEA 1WBHA 1LQ2A 1SJAA 2X50A 4JCLA 1XBYA 3WSUA 5AHLA 2XGZA 3G8EA 1FDZA 4HVXA 4GVFA 2ZCGA 1R7OA 4PE8A 4JTSA 5BCAA 3S83A 2WCGA 3A13A 1GWJA 3WJYA 1I45A 2DV0A 4PGLA 1NHSA 3ABOA 1TWSA 1QK0A 1ZY9A 1LBFA 3BMVA 4AB4A 2DUAA 2C1IA 1V0KA 1V51A 1WCGA 3B8TA 4M7TA 4GQGA 1IXOA 2ZUVA 3CAWA 1HO4A 5IBXC 1XDJA 2WZEA 1XCFA 1R30A 3SQMA 1JFHA 3G77A 6CGTA 1P7TA 4ZOHB 3T0TA 2EQDA 1XIDA 3WNMA 5J04A 1JNDA 4O1EA 1HJQA 4MWAA 5C0QA 1A0CA 4PMUA 2P8BA 3V3WA 5M3WA 1PJ9A 3MKCA 3MV01 3PZNA 1M7XA 3SJNA 1ZCCA 3LCWA 1VRXA 3E6EA 4WJXA 3N4AA 4MJMA 3G24A 2PP0A 4PTNA 3QW3A 2EPLX 2NQ5A 4REQB 5I0DA 3EX4A 2X16A 2IPJA 3PTDA 2E6YA 2YCKX 3LI1A 4MUPA 2ACQA 3N6JA 2VRQA 2FQIA 1Z7AA 3VFCA 2ESCA 5CAKA 3II1A 3WO8A 4OOZA 1CDGA 2GQAA 3LLDA 3EOUA 1YMYA 3BCFA 5KVIA 4IICA 4QP0A 1FP8A 5BOOA 2J7FA 3AS1A 3VX0A 2MANA 2VR2A 4HTBA 3BARA 3PR2A 1FKXA 1XINA 4H6QA 1D8CA 1J79A 5H8PA 4LU0A 5E1QA 4PEKA 3G3DA 4ZE5A 2TPSA 4MPKA 5AHIA 3TN3A 1C8XA 2J78A 2B0MA 1N8FA 4DELA 1V93A 1GHSA 3QN3A 4R5EA 1X98A 2Q01A 1HW6A 4PTMA 4NI3A 3N12A 5B7ZA 3UFYA 3CV1A 4IQEA 3QYQA 2QUMA 5G5IA 2XM1A 1FVPA 3S6TA 2GQWA 2OZ3A 2TRSA 4EAYA 3PZOA 7A3HA 5LXEA 4HP5A 4P8UA 1JCYA 3E0VA 1NQ6A 5J5RA 1KTBA 1R3YA 3A7UA 2Q02A 1CNVA 1PDZA 4ZFMA 1VHCA 1GESA 3NOEA 2QULA 3GDTA 3I65A 2HK1A 1C90A 1EHNA 5GVJA 5JCMA 4IMDA 1H6VA 3R58A 2OGYA 3R25A 2YCJA 5JVLA 1HXJA 3B97A 3WELA 3DH7A 3N15A 4Q6XA 2EPOA 2WVVA 4RX0A 4CN4A 2C1GA 1AUSL 4IGMA 1OJTA 4R85A 2DDXA 2ZZ2A 2ZUWA 4O14A 4BCEA 2ZVRA 1WYIA 4XIMA 4LVGA 5HBFA 1IT8A 3IC9A 5FJUA 3SQLA 3IGSA 1FECA 4AZCB 4PUUA 4IMAA 3LBMA 1SFJA 3W7KA 1F61A 1CIUA 3WLNA 1XIEA 3G0UA 2QXWA 2YYTA 3WJWA 3ARUA 3DK4A 3FNDA 1U30A 3OQEA 4GD0A 1M7PA 4GNVA 4EPEC 3NTYA 4JTTA 1JYXA 2PP1A 2FLIA 2V67A 4DBEA 4GCAA 4RL3A 2E7FA 1GKPA 5JMUA 1ESWA 3HA1A 4WKHA 1TUXA 5AVNA 1Z32X 4KWOA 2EQ7A 1JXJA 4U28A 4DB7A 4W87A 1JDEA 1S38A 1L0PA 2OYKA 4HHMA 3PWIA 2DZUA 2D2HA 2DZTA 1RBLA 3B9NA 2QR6A 2BOGX 4K7YA 3WUBA 1NDAA 2PF0A 4RDWA 3RFAA 3B8IA 4XBSA 3GUWA 1QNPA 2ZWYA 4HHLA 3H54A 5EMLA 1WO2A 2V3FA 2EPKX 1OQFA 1OBAA 2XN1A 3PVFA 1ADDA 4AY7A 1EQPA 3PNUA 5FOOA 4DX3A 1J18A 3SRFA 1ELSA 2DQWA 1JVNA 2BMBA 2DVXA 3CLWA 5E6ZA 2CC0A 4F0LA 3CO4A 1J4EA 1MMFA 2YVFA 4ZXOA 1EJWC 2WMKA 4LJ3A 3BLDA 4IJRA 2W66A 4IPNB 4YTSA 4IMCA 5DBTA 4H4PA 4NAEB 4DWSB 5AYBA 5AN7A 3CL8A 3GTIA 3ZJ7A 3K5XA 1N7KA 1OCNA 1ZFJA 1H5VA 4ZBCA 1R47A 4CGTA 3LQGA 1JRCA 4H4QA 1SO6A 4AMAA 3BURA 1P6WA 2QEZA 2CCRA 1XKJA 4YCOA 1TREA 1EL3A 2PDWA 4US5A 3F1QA 3R11A 1RV8A 4BS0A 4ZQNA 4DZ5A 3TDFA 5MF5A 3I6TA 4FLOA 3WN6A 1JGIA 3ZR4A 4PMRA 3TFXA 4BI5A 2HVMA 1MW3A 4IFKA 4RPQA 2VEGA 2ZC8A 3RITA 4ZB0A 4O4VA 1XHGA 2GLKA 4DN1A 2L5HA 1US0A 4M81A 4JOMA 4LV9A 3ONBA 4D9PA 1GXFA 1J5SA 2WXDM 2NXHA 5LIYX 2J79A 4A3QA 3IRDA 3M0VA 4EXAA 4M52A 5A8OA 4H4ZA 5A8QA 4LANA 5LXXA 4CCEA 2G5WA 1JDCA 3DHUA 4W93A 1PIFA 3GU2A 4JN7A 3WJXA 3SFKA 1D7KA 1UH4A 1S3TC 1EGMA 4H8HA 4NNCA 4ATDA 4I5XA 2AL1A 3L21A 3LA4A 1ZU8A 3S5NA 4RLIA 4UR7A 3WQFA 3NVYB 4R7WA 3G1AA 2C14A 4PN2A 3K46A 4J57A 1MFUA 1AL7A 4AD4A 1MQRA 1H60A 5EFFA 3GZAA 1W9BM 2GSHA 1ISXA 2V3AA 1SO5A 1V3HA 1KNWA 1F9CA 3WLLA 4PC8A 4GE8A 4QAIA 1ONFA 1YTKA 3OTRA 3W1QA 5HWMA 3A3WA 2WW5A 4XIAA 3KOWA 3KL0A 4KS0A 1AODA 3DCPA 1R5YA 3OGVA 3MSGA 4L1WA 4JX4A 3BJSA 1Q6FA 1AZ2A 2ZTKA 1BYDA 3VOIA 4EE9A 2DIKA 2WZTA 4IMEA 3L8KA 3N04A 1LCOA 4ZQMA 3BICA 3B9JB 4C1LA 3V0SA 1QI0A 4U5IA 3T78A 1IZCA 1H7RA 1ZJAA 3NYDA 4OBRA 1A5KC 2A85A 4LY4A 4GVIA 4ZSTA 1RR2A 1B4EA 4V27A 4QROA 4XKYB 4DYEA 2YA1A 4M6QA 1HJUA 5G1YA 1KD0A 2XG9A 2QPSA 4KESA 1QR7A 4RW5A 3SN1A 3DFSA 4Q33A 1OG0A 1EC9A 1FFRA 2CETA 2GK1A 4UFIA 3M44A 2WBGA 1TQXA 2ZXBA 4H7CA 5C9XA 3RF9A 4H8VA 4AAJA 3NQVA 1MNZA 2YZ5A 2BY0A 5A5WA 5G1MA 4NZCA 5I3HA 1XISA 6XIMA 3CTTA 4H1ZA 3I68A 1RXOB 4JX6A 1UROA 1MZRA 4IMFA 5EBAA 4AWUA 1RH9A 2X41A 4JL2A 4JCMA 5DBUA 4AQLA 1GRHA 2PDFA 3WBWA 3HPSA 2J7BA 3QTGA 5HK4A 1FCUA 1EDGA 3OBAA 5LA2A 3NYZA 3W1PA 1MFVA 4AEFA 5HATA 3FXYA 2VVSA 2W27A 1GYMA 2C91A 4NZ4A 3BLPX 3MY9A 1FFQA 1Q1RA 3PTMA 3AIQA 1DL3A 3NO5A 5E0CA 3UETA 2I1OA 4NASA 2EKGA 2REQA 3N13A 3FW6A 4WHBA 5JRBA 2F8QA 2GUUA 5HR7A 4XD5A 4XUGA 4QRNA 1ITXA 1POJA 4UTMA 1GRAA 2YKKA 1SW7A 2WNQA 4W84A 4CCDA 1XIGA 3G1SA 4N02A 1XIJA 3MUIA 4Y96A 4IP4A 3E1F1 4JHOA 2YL5A 2FIQA 1I8JA 2UZ9A 3HV8A 1B3VA 2CKRA 5F2LA 2CLFA 3HJEA 4HZ7A 4QG6A 5I06A 3VMNA 4CNSA 3KVJA 3UP8A 2WC3A 5G5GB 1YEYA 1THFD 1FHUA 1PKMA 3PPCA 5G4WA 3QFAA 2OVLA 4V28A 3DX5A 1XXXA 4OKDA 1H11A 4F0RA 3NVWB 1GG0A 3UWEA 3NQEA 4IL0A 2IQTA 1RM6B 3U2OA 1R9YA 3O6AA 1ZJHA 1W5QA 4GFSA 4NY2A 2B7NA 2HISA 3AZSA 5F4SA 2D69A 3R13A 2I14A 1O6IA 4A2SA 4CVWA 3CGBA 3W9ZA 3NPXA 2NUYA 1XSJA 1SR0A 4AG0A 1LLWA 3KE0A 2POZA 3PPFA 1LL4A 2IKHA 1XR2A 1CLVA 4O8AA 3AJ7A 1KGUA 4LX4A 2CEQA 1RLDA 2YIHA 3ERPA 5D9MA 1SFLA 3JU2A 1HX0A 2GJXA 4IL2A 5TQLA 1EH9A 1WOAA 5DO8A 2CWXA 1EA0A 4LOCA 2PGWA 3QR3A 1BRLB 3WG6A 1EJRC 3LTPA 2PSNA 2ZE3A 1XLAA 2VCBA 1F3PA 3CPRA 3ABQA 3REQB 2VO5A 4NJGA 3K8LA 1W1IE 3PK7A 5E0FA 5ABFB 1KXQA 2QCFA 1CYGA 3EMCA 3TSMA 1OD0A 3SGUA 3KLKA 2VWSA 4CVUA 2H6RA 5H8UA 3P6LA 4MKSA 4IG2B 3NVVB 3BC9A 1RD5A 4M51A 2YVGA 1BXCA 2ATSA 4I9JA 3BWWA 1DWAM 2OLAA 3ARPA 4J40A 4G7EB 2V9DA 3SEPA 3CMGA 4DJDD 4CD4A 2ZFAA 3EOSA 2HXUA 3PB2A 1ZP3A 1DVJA 2R24A 1FUYA 3RO8A 1LT7A 2AQVA 1XIMA 3WDIA 5FKYA 4R9XA 2HZGA 3VUSA 4IP7A 2D0HA 1NP0A 1L6GA 1ZPTA 1AD4A 5JH2A 1GZJA 3GR4A 1U83A 3VOGA 3CGEA 1IZJA 3ZM8A 4GNJA 1TZ9A 1IYXA 1KA9F 3UWZA 8CGTA 3UYCA 1UBPC 1S7MA 4GUFA 1R9XA 1M7JA 2GGIA 2ZXDA 1TRIA 1J12A 2GJPA 3B3DA 1V3JA 3MPGA 4CU7A 3KAOA 4LGXA 4UTTA 3PG6A 3FJ6A 4DXVA 2OQYA 1YW1A 1YBQA 3MP5A 3KXQA 1X8FA 1E3ZA 2PDIA 3HFTA 2IUZA 4S2BA 5D8ZA 3VO0A 1K3UA 4NKCA 2WOWA 4FX6M 1XYLA 1F2JA 3UWYA 1OY0A 3SY5A 4H19A 4U3AA 1HN1A 4IISA 3LG3A 1DIDA 1UPMB 4IQLA 3SUVA 1TTJA 3H4GA 4P61A 1B3YA 5FS7A 4QNWA 4ZOBA 3W53A 1OT2A 4KIEA 4LUTB 4ZO7A 3I3EA 4NX5A 3LNMA 3N1AA 4FXRA 2FTPA 3R5EA 3ZOAA 4RDVA 1JI2A 4XG1A 3RRAA 3LD5A 3W82A 5IHRA 1K77A 4X9YA 5CLWA 3E38A 4I90A 4QTGA 2A79A 1JZ2A 4NAFA 4XO7A 4PMNA 4MVAA 3K4DA 4JX5A 4YWOA 4QEHA 3W7DA 1U5HA 3LY0A 2OSYA 3ZVHB 3STEA 3NQ7A 2PMQA 2WSRA 7REQA 1SR9A 1JD9A 1R9ZA 3II4A 1OFDA 4Z0SA 1KM5A 2B7OA 4M7SA 1VFFA 5D2YA 3A5FA 4Z17A 2VCAA 4GRTA 2G3JA 1WPCA 3S47A 1CXLA 5A8NA 4TUFA 2DZAA 5A6TC 1EF2A 5KMYA 3MZ2A 2PDQA 4PMZA 1PBGA 1K9TA 4KPRA 2DPEA 1VEMA 3GBEA 3TA9A 1Y8BA 2D24A 3N6HA 3UA3A 5C7VA 4ZENA 4MWAB 3TCSA 2XDFA 1Z41A 1YQ2A 3WENA 3B9OA 4E2DA 4P7QA 4QG8A 2QW5A 3AZRA 4UCFA 2AQWA 3R4IA 1SU5A 3HG4A 3DFTA 2NWSA 3U5YA 1O4UA 4FMVA 3UR7A 1KBIA 2F6UA 3TTSA 4O17A 1UWQA 5I2UA 4YS1A 4H4SA 4XUYA 1IT0A 1F4AA 1JRBA 5G2IA 1OJXA 3L4XA 3HPXA 4X9SA 3MP3A 4ZL1A 2V3EA 4NHVA 3C2RA 2R1MA 3DK8A 1RLCL 3P93A 4CCCA 2WNZA 3R0KA 2V30A 2VC5A 4JN6A 4GUHA 3A23A 4EM4A 1T0OA 2J24A 4PUKA 2A3AA 4U10A 2DT0A 3W7PA 3W7MA 3WDRA 3O16A 3BMWA 2E5AA 5ECUA 1GZ1A 3TYAA 3FX4A 3WLMA 4KEUA 4Q7IA 1SZNA 1GKQA 1NIUA 1GVYA 1JOAA 1YTDA 2VZSA 1R3TA 1SZEA 4PBFA 2ZUTA 3ITOA 5DT5A 4C6LA 2PGFA 4L7ZA 4BY3A 3WK0A 4TMBA 1N8WA 1MSSA 4YIWA 1DBTA 5A6BD 2EG7A 3VE7A 4Q8QA 4QQUA 1RCQA 3PUOA 2DJXA 3WQ8A 3TC3A 3GXMA 1UWRA 3RM8A 3TC6A 6REQB 3LSBA 1U5JA 3P61A 1J0HA 5DXYA 3T0CA 1Z89A 1G01A 3HGJA 1GV4A 1BQGA 2JFEX 1B4KA 2HWGA 4K7VA 1KM3A 4GQRA 1DE6A 2A6LA 3PPGA 4GYPC 3AXMA 1VPQA 1GVRA 1VIWA 4LC6A 4ASTA 1UC5A 1QHZA 1LWIA 5LZLA 1FWEC 2DJLA 3GHTA 2HTMA 2FHBA 5J8LA 2X8GA 4RE3A 4LNYA 1ME9A 3SIZA 2RUSA 2FJKA 4C1NA 4MNMA 3KBNA 1PZ1A 1DJIA 2WCAA 3DYOA 3WQPA 4TU1A 4IUGA 3WFLA 4QJ1A 4HMEA 4PRTA 2V38A 2J9XA 3H2FA 1XYFA 4H9XA 1VH7A 3GTNA 1M9HA 4QISA 5DMYA 2PLCA 1H2IA 1QXLA 1J0IA 2BFGA 4H83A 3OVPA 2QGYA 3FV9A 3RDKA 3Q6JA 4OTKA 3ABRA 3E5BA 1GRGA 4ENLA 1MWOA 3W01A 3S9YA 3S8HA 2BY2A 5K2ZA 4IIFA 2WOQA 3SY8A 5AECA 2BWGA 1HO1A 2QCHA 4AX7A 3VOCA 3W28A 1BD0A 1H61A 3V0UA 1GW9A 3URNA 2OYMA 5EMUA 1XLFA 3VMOA 1ECQA 4UIOA 1KW1A 1YXDA 4N7QA 4QS5A 1NJJA 1Q6GA 1I6NA 4HZMA 3S2LA 3FYYA 4ZR8A 3CH0A 3WF1A 4GFIA 3EWXA 5DRCA 1AQHA 5CQ1A 4BQ3A 3O6YX 2JE8A 1H1NA 3H2OA 4FOKA 2FB2A 5FS6A 4UNLA 1UW9A 3NQFA 3PG9A 2PWDA 3M1ZA 4PH6A 3R8GA 2ZA2A 3W2UA 1WE5A 4NXSA 2AGKA 1TMHA 3H7VA 5BMWA 3ITLA 4NJJA 3MQTA 1KV5A 1YXCA 1ZQ5A 4HN4A 2BSLA 3OBKA 3G6LA 1CT5A 2GH5A 1L6SA 4F66A 1K9EA 1F3WA 1UASA 2ABAA 3NQAA 5I24A 3PZMA 1G5AA 5LYRA 4E8DA 2ACRA 4J35A 3RCNA 1EUAA 3W38A 4DJDA 3B0UX 1OIFA 1M65A 3NDYA 5C2CA 3GDLA 1XWYA 2W6RA 4F0HA 4LS2A 2BVDA 5D2XA 1OHLA 5HMFA 4GY7A 2A3LA 1T8XA 1QNOA 3W86A 4A8LA 1ZAHA 3A22A 1HL8A 3WMCA 3ZJKA 4A3UA 4GISA 1IT7A 2GJRA 3T05A 1XH0A 1R2TA 1F74A 1GONA 4KF1A 3K8MA 1KFBA 1Q7QA 2VELA 3B8UA 4RR4A 3W24A 5HXMA 2QCGA 3NURA 1LWJA 4HCDA 3GU9A 4IIEA 1XLEA 3GG0A 3VKJA 3F4NA 5H2ZA 3W1NA 4C7GA 3MJMA 3GRIA 4A8NA 3DYPA 3SQPA 1V6WA 2RDXA 4W85A 4XV0A 5I3IA 3FJNA 1GPWA 2GSEA 3H6OA 4H3DA 5A6MA 1I1XA 3AMDA 1XLCA 1BVWA 4HJFA 4H8NA 3R0UA 4HKPA 4B4HA 4GRSA 2R1LA 4I5RA 1MW1A 3L68A 2ONEA 1FFUC 4ML9A 4K36A 2VFIA 1NHQA 2QPUA 2P0OA 3C86A 4C60A 3I6RA 3W7LA 4OBTA 3L2LA 4JZ5A 4E4FA 5T91A 1M6JA 4U3CA 4RK8A 1E4LA 1KM1A 3EDKA 1EJXC 4GJ1A 3R2GA 4K1WA 2HE8A 3EXSA 3VIGA 2Z1VA 3G1VA 2ON3A 3OHIA 3E2VA 5I79A 2VGGA 2BXZA 4ZGYA 3ZJ8A 3NUKA 3DFHA 3H7RA 3RLVA 1MW2A 2BVYA 4RNFA 4UQDA 3KTCA 3CM4A 5HNNA 2GOUA 3LN3A 1YQZA 3MWAA 2CBVA 2VC7A 1XCXA 2DUXA 3AIRA 1ZB5A 2Z24A 1UR3M 1W9DM 3W2JA 2NLYA 1EKOA 3CV6A 4H7VA 4FS9A 1TV4A 1XRSA 4M29A 4WDTA 1O7AA 1KO0A 3RM4A 2ZX8A 1RY8A 2Y61A 5DMMA 3XISA 2OT1A 1DIKA 1LG1A 3RM9A 1A3WA 5JBDA 2Z7KA 4IXXA 4WXYA 1SPQA 3QQWA 4B3KA 4M6UA 2Z28A 3KTSA 4GG9A 4HK6A 3EKGA 1KRCC 2ZRVA 1CENA 1M68A 1OFPA 4IT1A 4S3KA 1ZMCA 1ISWA 4G2DA 3LM7A 3HQNA 2BXYA 3LS9A 5I03A 1KGXA 2GK1B 2ZRZA 4S3FA 4LF1A 1YLVA 4W5ZA 2RDWA 1AG1O 1GETA 3TMLA 3QW4B 5GJNA 1J2BA 4B5XA 4RZ4A 1AFSA 4LVDA 3TH6A 3EDJA 1FA2A 4DNMA 1ITCA 3VD5A 3NXFA 4LALA 2DH2A 3BAJA 3NRZB 1HQTA 1XF0A 2FTYA 2FB3A 4CN1A 4IIDA 3S1UA 1OC6A 1PIIA 3WBYA 2Y7FA 4PMVA 2O4MA 2Y7GA 1FIQB 1GJPA 3UCCA 4FX7A 3XINA 3WK3A 3EX3A 2C79A 2E1WA 3WL1A 1VKFA 4O4WA 1NQKA 2RH9A 3C2VA 4ALDA 1XI3A 3GZ3A 3HRDC 3DDMA 3F2CA 2O7SA 1GHRA 4AISA 3V5CA 3FFSA 1ZKQA 4FI4A 3M16A 2Y8KA 4GVGA 3QOKA 5JCNA 1TA3A 4XZ9A 3T9PA 1K4HA 1ODUA 2E3TA 2MNRA 3R12A 1Z3NA 2W79A 3A4JA 1EO7A 4PSRA 1H2JA 2ZWZA 3AIBA 4Z2JA 3B9DA 1EDTA 3HOJA 1PX4A 5I3JA 3RJXA 5CPQA 1ODZA 2ZADA 3LENA 2VURA 5A2AA 3SZ8A 2VX4A 1YADA 5CXPA 5A6BA 1H1YA 1WDRA 1PCKA 2CHOA 3H70A 1UD2A 4BF9A 3KBMA 3M7SA 1S39A 2EPHA 3RO6A 1KFCA 1EYWA 1EGVA 1I1WA 4DXKA 1TUFA 2CLLA 4BF7A 5DLCA 3H21A 3M9YA 1V6TA 1J6PA 1XGEA 2H3BA 5HA7A 3KVKA 3ABSA 4RZ5A 4GYKA 2G96A 2WCSA 1V0MA 4JIRA 4Y9NA 1E4NA 1WDWA 2PC4A 4ACZA 2V69A 2BNJA 3AU2A 3DFYA 3U8GA 1DQWA 4M1BA 3N9SA 4UBPC 2VEKA 3BJTA 2W0HA 1EWEA 2CHNA 3NQCA 4A2RA 2E77A 4L56A 2JK6A 3WH7A 2J4GA 1M41A 1IXQA 4GXWA 5JCKA 3P8JA 1TELA 2OKTA 4ICCX 4BA0A 4JIIX 4FF5A 4N4QA 4JR5A 1ZCOA 1SZFA 3L4YA 3MDWA 4WKAA 4CQBA 1R38A 1WXYA 3VZXA 2I9EA 4HTYA 1OEPA 2YX0A 1V3MA 2WJDA 1HGYA 1O5KA 5M17A 1BYAA 4GYJA 3W2LA 3KDOA 5LHEA 5REQB 2E40A 3C5QA 4ICMA 2R91A 1N8IA 4CD8A 4HPJA 2RKXA 3LPOA 5C2XA 1VB9A 3VIIA 1GOWA 1GQIA 4NEVA 4KPLA 3FG2P 5M1TA 3WNPA 1TWIA 3SW6A 2CZVA 3EMZA 2HQAA 4I9MA 4AZIA 4J4KA 1GRTA 3UEQA 3MU7A 2F6XA 2YW4A 3MHFA 4L61A 3MVTA 1GTHA 1XFBA 3CZEA 3GXNA 4LXFA 2VNCA 1XQLA 3L4WA 3R94A 2E1DA 2J9ZA 1NFBA 4GUGA 4JHMA 3WLHA 1XICA 1IEIA 3KFTA 4S2CA 2H8ZA 1A4LA 3GXFA 4C6CA 1L2QA 5LA1A 4AZHA 4FPSA 4D8AA 2NT0A 4IFRA 1H0IA 4S1FA 4F4RA 1JYWA 2J88A 4TV6A 1F6YA 2A7NA 3BTNA 3FYPA 4L64A 1A53A 3KX6A 4C6KA 1E4MM 1X97A 3TQVA 1QWGA 1LORA 3GHUA 4J3UA 1U1UA 4MHBA 1NDWA 2PURA 4KCUA 1YBQB 2BBFA 3GVGA 2AGTA 1QW7A 4LC8A 2VI0A 4XZBA 3BQ5A 2PDNA 5FEZA 5A6SA 4LYQA 3SCVA 3AUJA 2E6FA 3QOMA 1V03A 4PUMA 2NLIA 4MAZA 5F1UA 1GORA 1WP6A 4HMDA 4PMOA 3AHZA 4DNAA 3L0NA 3BLEA 1KRMA 4EQXA 3AJXA 4G5DA 3S2CA 4QDWA 4B15A 3QYSA 4N9BA 1F3XA 4OE7A 2V5CA 3AFBA 1KM0A 3WD2A 4IJBA 1TV3A 3LCIA 3FEQA 1ZAJA 3QPYA 1LPFA 4J3ZA 3AXXA 3ZT6A 5U25A 3CIXA 1TCDA 3UZZA 2YCLB 3QY6A 3MKVA 2INZA 3VVGA 2C3DA 1J96A 4OV9A 1YXYA 1RQHA 3FLUA 4GJJA 4P8WA 1JQVA 1YDVA 4GQBA 2B31A 1Q3NA 4XWUA 4IPJA 2A3EA 3RN6A 3VIKA 4RE4A 1PS9A 7REQB 3VMPA 4GPNA 4NU7A 1UB3A 2QQ6A 3WLPA 4O1FA 1KLZA 3W6MA 3H26A 5HQEA 3WLSA 3ENLA 3LHTA 3VGDA 1NFGA 1A80A 2YFNA 4Q7BA 3W1UA 2V81A 1DPMA 2X7VA 2QJGA 4NUWA 3EDFA 2ZQ0A 2JK2A 1TPB1 1K70A 1F7BA 2C6QA 3DG7A 4LB3A 3GO2A 3BK0A 5HJLA 4EPDC 4O54A 4XZHA 4PMDA 4TTGA 3EWWA 3ZFHA 4YWIA 3QFEA 4B16A 5FAGA 3RLGA 2WJFA 3LCXA 1DWJM 3M5ZA 2OT0A 5CJ5A 2HEJA 3WQOA 4LAZA 1U22A 3M47A 3HW2A 3MS8A 3BW4A 3NPUA 1M5WA 4NNBA 1KBKA 4FZIA 3S5ZA 1PE1A 4UMAA 1ZAIA 2CZ5A 3ZSTA 4ECLA 5TAOA 2PAJA 4CN6A 1EZWA 1ZGDA 1Y7VA 4Q4PA 3V1HA 3DENA 1H41A 4DO7A 5KVHA 3RX4A 5D32A 1IE7C 4AXNA 4GOAA 1HJWA 1GVOA 4QFUA 1F4HA 1XL9A 4O53A 1FO4A 1BG9A 1V6UA 2VXNA 3O63A 4MPQA 1W31A 2V3DA 3T0DA 4JPGA 3P81A 3EPNA 1ZK7A 3WUEA 4BF5A 3PJUA 4ZOCA 4AFYA 4POCA 1X1ZA 1WNOA 3CL6A 3TTEA 2VMFA 2Y70A 4FXSA 2ZZ7A 4DJED 3SR7A 4PTWA 3VKDA 3VPLA 4YHEA 2ZRWA 2DZWA 4QM1A 4Y8EA 1FEAA 3W7GA 3VNIA 4WF7A 4BV6A 2DSWA 2VOTA 3SM0A 5FL1A 4JNZA 4GGBA 1ADSA 3ZS4A 2PTYA 3P7YA 2RJGA 1NEYA 4AIOA 4E8CA 4L9XA 1PKYA 3A3HA 4OQVA 1A50A 4HQVA 4WRHA 3S42A 4YCPA 2ZUMA 3PBGA 3R89A 2EG8A 3COTA 3FAWA 1UR8A 3JR2A 3O9NA 3MB9A 2UV8G 2XVGA 3FKKA 3U4AA 3VI2A 4EPKA 1XUUA 2YCEA 4REQA 1UKTA 2JEPA 3EXRA 1EBDA 2ODOA 4LF2A 3O8AA 3LSCA 1CGUA 1X7FA 2GWGA 1Q8AA 3NZRA 1LLZA 1W91A 5D30A 3EUB3 1WB0A 4TOQA 1EC7A 1HKVA 4JFWA 3GKFA 4GBDA 2J6XA 3L4VA 3N3TA 1ZBKA 3H2AA 1W1A1 4LRSA 2XUCA 3VIJA 2X0YA 1UD4A 4INFA 4O52A 2FZ8A 4QLKA 5EY5A 1KXHA 1JZ5A 1NWSA 2NQZA 2ZA1A 4C1NB 1K7XA 3ZSSA 4P7OA 3UG8A 3FXGA 5TF0A 2JF7A 3VAVA 3WLIA 3QFBA 4XZLX 1WAWA 4LUSB 2OELA 3LZ3A 2YYUA 4OJYA 3TKFA 3W4RA 4L9YA 4O10A 4LT9A 1AW2A 4G8TA 4BZYA 3P0WA 2EAWA 3UPBA 5I07A 3U5UA 1H4PA 3AYRA 5HNUA 1M53A 3AYTA 5HJXA 1RK5A 3ES7A 1HNYA 1CW2A 2GRTA 2GGJA 2O92A 1UIPA 9XIAA 4S3AA 4XKMA 3SGZA 4LB4A 1FCBA 5D2WA 2PDPA 3BW3A 3CC1A 1SVDA 2JGQA 4UQEA 3ARWA 4OBSA 2WANA 3BGAA 3FK4A 2Z1XA 4KKXA 3VFLA 2NXGA 5HNRA 4D6DA 4ERIA 1A47A 4EOUA 2EG6A 4GY0A 4GUJA 4WZHA 1EX1A 1F76A 1IIHA 2WSPA 3Q58A 3BQ6A 3U0HA 1BGAA 1K9DA 2X1SA 3H2NA 3CQKA 3M0JA 1IWPA 3N2XA 4R27A 1XIHA 4O0QA 3NDZA 1EB3A 1E71M 2BASA 1B57A 3BUVA 1Q5MA 4KFOA 2YBUA 4H41A 2QDGA 4AZCA 1ZJBA 4EXQA 4JGDA 1HVQA 4GIYA 3PJWA 1BWKA 5GNYA 2ZRYA 4M3PA 1F6PA 4U2ZA 3GNXA 4LUIA 4AEEA 5E70A 1Q2SA 3AO0A 2QDEA 3EDEA 1FQ0A 4DF2A 3BO9A 1KCLA 4Z08A 1D7YA 3TIMA 2Q71A 2Z1SA 1WZMA 3CPGA 1E0VA 2E6AA 3B0VC 1O1HA 3FEMA 3MHUA 4GI9A 1AJ0A 2YB4A 2G41A 2GVJA 5ENLA 3SCQA 1AH4A 2E9LA 2ZZCA 1E9YB 1EBHA 1QCWA 1KKOA 3W2MA 1MW0A 4NZ3A 1GOIA 1VS1A 1UD3A 4X63A 4OGZA 4UOQA 3EWUA 2GVLA 1EQCA 1QO2A 2O4QA 3K4AA 1R2RA 5JQ9A 4AWSA 3TN5A 2UY4A 4G6CA 1B9BA 1YIXA 3CJPA 1YYAA 1B3XA 1CXEA 3KLLA 1WKDA 4IQJA 4URIA 5DMLA 4PMXA 3AZTA 2V2DA 4MDPA 1HL2A 1XDIA 3L5AA 3GH7A 1RZMA 1XLBA 1K1DA 3ANYA 2ZX7A 2PDKA 1LVLA 3AIWA 1ENUA 4TIMA 3Q67A 5A6KA 4K39A 3NS1B 3FGCB 3V35A 3N17A 2VWTA 3UG3A 3CGCA 4WX2A 4TTUA 1JDDA 1VBJA 3PAJA 1RHCA 3W7HA 1IXNA 3UXLA 2ADAA 1ZNNA 2FZMA 3U4FA 4NAEA 3BLLA 3ZR5A 5BXSA 4L1XA 4IGSA 3GG1A 1UUQA 4WDWA 3NSMA 4W7UA 3HU7A 2J8GA 4B3ZA 1H7WA 1R2SA 1QW9A 3TN4A 6XIAA 3EBVA 2WZMA 2GGGA 1GEQA 1C8VA 2X30A 4UCGA 3EPOA 3VE9A 2ZRXA 1DWFM 1VRDA 1FX6A 2XU2A 2PDBA 2XVPA 4HPXA 1FWFC 2GUBA 2VRKA 3GVWA 3QPZA 3W1TA 1E9LA 3AMCA 4B5TA 4GUIA 3CEPA 3S5OA 4MFEA 1K02A 5CBJA 2IKJA 3QMSA 4YVXA 2YZRA 1VFOA 1DXFA 1XIBA 4FAMA 1LOSA 2W3SA 3UG4A 1KFEA 5AKQA 2I57A 1FH9A 2ZVIA 1NM9A 3WBXA 1T96A 3TXVA 3VNJA 1PKNA 1XYAA 3MI6A 1GEHA 3C0SA 4DUXA 1CGYA 4L1GA 1ZDLA 1WDPA 1X39A 3H4WA 4NL1A 1PWMA 5I23A 2Z0IA 4BQ2A 4JTCA 2WP6A 2A5HA 1DWGM 3LM3A 3P5YA 4EQRA 4BQ4A 1OCQA 5IDZA 1G67A 1W56A 4L9ZA 2FZ9A 2OSXA 3F4CA 2FKPA 2XN0A 1TSIA 1UP2A 4DNHA 1QUMA 2GL5A 3MBDA 1JCMP 4X0NA 2Y5JA 3UCQA 4H9VA 4QQ3A 1QHOA 2QCCA 3ZR6A 4H4VA 2W91A 4EMWA 2PC8A 4GGHA 5IFPA 1XIFA 3E0LA 1EO5A 4AH7A 3HO8A 2F5ZA 1Z8AA 1KRAC 3E3HA 1W9PA 3LMZA 1LG2A 2Y4SA 1C7TA 1UWIA 1NPXA 2QJJA 2WKLA 4LWWA 3CUFA 3WEOA 4GQQA 3B8WA 4D6CA 5BOFA 3GTHA 3W29A 3VOJA 1C7SA 2PB1A 4HK5A 3VIPA 4GH3A 3JZUA 3URHA 1P6BA 1KKRA 4J56A 1VAHA 1UR4A 1VJSA 5BRPA 4JY9A 1AOGA 4J2MA 4E5TA 1TPH1 1W5NA 3TUUA 4H4UA 2EBNA 1X6LA 3HQOA 3IIVA 4PCPA 2XH7A 1H09A 5U7SA 2XIJA 2A21A 5C2GA 5DRIA 3NPVA 3C8FA 2PE4A 3OPSA 1IIGA 4PCTA 4I9AA 3N14A 1C92A 1TWZA 1TPEA 2QJIA 3IVTA 4DJEA 2CFFA 4JS3A 2RHGA 3NL5A 2TMDA 2XJ7A 3GAYA 2WZHA 1HJXA 3PNZA 5CSYA 3GDRA 1CWYA 1O94A 3SUTA 5LNRA 4HPNA 4OT7A 1ZY8A 3QY8A 3W73A 5HJYA 4P7RA 3LTYA 4ZQPA 3MYPA 3MZNA 3BL3A 1QNSA 4NP7A 4AX6A 4MDOA 3CMJA 1CZ1A 4OUIA 4JQ2A 3UXDA 3LCGA 4P5UA 1TZ7A 3IPWA 3UPMA 5FEXA 5KTLA 3VYLA 2OXNA 3GDMA 1BLIA 2ZZ6A 4QEEA 3DJJA 4MZYA 3MUZ1 4B91A 3BSHA 1GW1A 2PRMA 5A3HA 3KHJA 1C9WA 3LQLA 4AUBA 3KP0A 1D7FA 2YLAA 3MO4A 1UD8A 3M0LA 2D22A 1HVXA 4MZ1A 1UBSA 4FP1A 5HQMA 3MI3A 2YW3A 1B1YA 3O0KA 1W3HA 3L5MA 4AHOA 2HS8A 3IJDA 1Q7ZA 3NFUA 1ZMDA 1SO3A 2PDMA 4AEOA 4QITA 4KRTA 3TZNA 3MCOA 4WR3A 2QUVA 4C1KA 1UWUA 5FCZA 1YDYA 3P8IA 3IANA 1O95A 1XC4A 1E1EA 2O0TA 2HSAA 1JPDX 3F4WA 1QNVA 3VKKA 5AC5A 2J25A 2ANUA 3WQWA 4W4QA 4AIBA 3VZYA 5EGRA 1SW0A 2BODX 3CHEA 3FHAA 1YHTA 1ONXA 3L0KA 3THQA 2OFJA 2XIMA 5TD4A 3NQDA 1NARA 3NNTA 3VDHA 1ICQA 2PPGA 1CGVA 1JF6A 2V0TA 1XS2A 3RMJA 5JBEA 4ZFCA 6TAAA 3N2OA 1LLOA 4MFDA 3C8NA 4MY8A 1PL9A 4GZJA 1A4MA 4YYFA 1QU4A 4CD5A 3E12A 3EA1A 2C8NA 2GOKA 2OJPA 4DZIA 1SFSA 2TPRA 3T42A 2WHLA 5FF7A 3AXHA 2D3LA 4GXMA 1JF5A 1TV8A 1ICPA 2PZNA 3W81A 5CPNA 1V79A 2GR3A 4D6IA 2H90A 1I2OA 4WSJA 3DK9A 5JU6A 2ZX6A 5EL1A 3PANA 2X8HA 4UTKA 1JCJA 2WMGA 4JYDA 4GI4A 2QIWA 1EGZA 2J8FA 3WUFA 1BWCA 1BRLA 3WCZA 4NZ5A 3IJ9A 3T1GA 3REQA 2CYGA 2XM2A 1H50A 2PDXA 3IGXA 5XIAA 2YXXA 5ABFA 5ABGA 2OLHA 3GKAA 3HGSA 1GJWA 3TA6A 1HKJA 4Y9OA 3HJZA 4H9UA 4DO5A 3V7PA 3DG6A 2X1UA 4IG2A 1CTNA 4LFYA 4RCXA 1XJBA 1SO4A 5FF0A 3D3FA 4GC3A 3IK2A 1GNXA 3EX6A 3EWDA 3WDPP 5CG7A 4G7EA 4DWSC 3DHDA 5C55A 3DBNA 3W02A 5C8BB 4ATLA 4HSNA 3CT2A 1E55A 1W8SA 5AYYA 7PTDA 2X42A 3PZGA 4JY8A 3UNDA 1BFNA 3G18A 3BZJA 2X7WA 4Z42C 3A5VA 4DBDA 4LH8A 3NVZB 1FWIC 3O07A 1JDFA 1YPXA 4GWEA 4DUWA 3WKZA 3OO2A 4JDYA 4MADA 1KTCA 2XWDA 1RBOB 3GB6A 3PUEA 3PFRA 2POTA 4ZTYA 3KRSA 1H63A 5TIMA 4Q4SA 4BWLC 4CNPA 3DFQA 4K3ZA 4GH1A 2O9RA 3TLQA 1DORA 1CB2A 1Z9AA 1T40A 1OF8A 7CGTA 3RJYA 1ML1A 4G1KA 2OOGA 1HFBA 4OECA 3CB3A 3UBPC 1JZ8A 2YAUA 2BGSA 4LEFA 2TYSA 3OODA 1FWTA 5CKSA 3ZWTA 7TAAA 4GZ7A 4PCSA 4ADWA 1UKOA 4FR6A 3GUGA 4FEZA 1RQBA 1MRQA 3CWOX 4WIWA 4Z1DA 3MO7A 2J27A 2Y2WA 3KOXA 4ZQCA 2CFYA 1EJ7L 3W23A 1ZJIA 1XHCA 1YNPA 3C52A 3KWSA 3EX2A 1E51A 2A7PA 4D72A 1FWGC 1SUXA 2Z6JA 3Q37A 4B5SA 1KTNA 1LUCB 4JICA 3DC8A 4J3XA 4J7RA 3DC0A 3GE7A 3N6QA 5FS8A 3U2ZA 2BHUA 5LIXX 1TPFA 4GBUA 5EPDA 4JTKA 3VD9A 1EP2A 3UJSA 1V5XA 4JD4A 3ZVHA 2G8ZA 1LOQA 2ZX9A 3NL2A 3MVIA 3CU2A 1N62C 1ICSA 4UR9A 2R9ZA 2VEFA 3A4XA 1E6RA 5A6AA 5CZKA 1NU5A 4CNTA 3M5XA 1K8CA 2O56A 1P5BA 1PCWA 1S5WA 4W8BA 3N18A 4C6OA 4ONVA 1IZKA 4XAFA 5T26A 4FK9A 3A21A 3BLFA 5I77A 1OWQA 3TQKA 4UC5A 4EXBA 3WF0A 4AHQA 2D2OA 4LBSA 1WOBA 1KQZA 4AHPA 1BF6A 3GBDA 1UUMA 2J66A 2FH6A 3TYBA 4RXGA 2ALRA 4UNKA 1A5AA 3AAMA 2GJNA 2R1KA 4LYPA 3A24A 2XYLA 2QGHA 4MAVA 2TSYA 5DN1A 3LGEA 3WK2A 1O12A 4PCFA 1A0DA 2PP3A 2CLKA 1JXKA 4H9YA 2RJHA 2UWFA 3PTQA 4DJFA 2OPJA 4PMYA 4A29A 2ATMA 1QI2A 1V6YA 2XVKA 1V7YA 1B3WA 4IMGA 3PSVA 4XO6A 5LNWA 2XVNA 3CZ8A 3T4WA 3UY8A 4FXFA 4FLRA 3VTRA 3S9IA 3H2CA 3N29A 1VCFA 5CGQA 1CXFA 4ATWA 4GO9A 3DU0A 3VU2A 1K4QA 4TVYA 4LBUA 3SCPA 2VQUA 5DEZA 1XKYA 2D0FA 4WUIA 2CESA 1FWBC 1FKWA 4IOTA 1E0WA 4F0KA 1JPKA 3MUY1 3AMLA 1E15A 3GRTA 1DJZA 1W3IA 4LNCA 4PL1A 1W17A 1OD8A 2OX1A 2OGJA 4JN8A 4HNVA 1KBBA 3QFWA 3M6DA 4XD4A 2VOMA 1LF1A 1G1YA 3HPZA 1W2VA 2A7RA 3EWCA 3WZ0E 3A6OA 4MNLA 1K7EA 2I5IA 3EF6A 3E02A 7XIMA 2VUNA 1KBLA 4K68A 2A3CA 4TVUA 2WPFA 1AL8A 4BFAA 3WJZA 2YB1A 6REQA 5EMMA 1SSDA 4O18A 4ZE4A 4FHAA 1GTEA 1JUKA 2J6VA 1UCWA 3R7MA 2QUUA 1VYRA 3VDBA 3TQPA 4LYRA 2GQ9A 2NVDA 3R8HA 4XSMA 3KVMA 3ECQA 1LRNA 3M07A 3ZLGA 2W61A 3UJ2A 3URAA 4PRWA 1QMLA 1WUFA 3DAQA 2VP8A 1ME7A 3IAQA 2WMIA 4NJKA 3UESA 3N4EA 5EB8A 4P7LA 3F2DA 5D4YA 2W5FA 5HNTA 1VIZA 2YBVA 3BG9A 2NVCA 3PUGA 4XAYA 3NZ1A 1DHPA 5BZAA 2Y0FA 1CXKA 2BY3A 3SCTA 3WMSA 5AFDA 4LBRA 4LCRA 1G4SA 2X1RA 3OHMB 3AIUA 5T9BG 2BVWA 5C5YA 3AYVA 3S2JA 3L12A 4MWAE 3TC7A 1OX4B 1E6NA 3RNDA 3UJEA 3ITVA 3QV6A 6ALDA 4WOQA 3QZAA 1QPOA 3IIOA 3WFZA 3OP2A 2Q3RA 3RXZA 1X2GA 4LYKA 3DHFA 1MUMA 3DKJA 3L4TA 3FJ4A 3O0HA 3W07A 4JTEA 4Y2WA 1TO3A 2V5KA 1KWGA 2PA6A 4K8DA 3CUJA 3CAQA 4K7ZA 4KGLA 4EF9A 3FVMA 5IOBA 5J5DA 2VFDA 1Q4WA 3MMWA 2OWXA 4EWND 3SURA 4GXPA 4OUEA 3CXOA 4C91A 3E74A 2GSJA 2NQJA 2PUZA 3K30A 1AW1A 1C8QA 1J0JA 3SSZA 2QCNA 4AZ6A 3JRKA 2B7QA 2EJAA 3GIQA 1HJSA 4PYSA 4ZQOA 3GYCA 3GQYA 4QE5A 3WQDA 3WEZA 4OFCA 1B0IA 1ZBCA 1DJYA 4NZFA 4JTIA 4DAIA 3SN4A 3SCOA 4MJ2A 3WDHA 1I75A 2GQ3A 3GH4A 1TRDA 3HGRA 1ALDA 2Y24A 1GT8A 5K4XA 3SADA 3N2CA 3UVIA 4NYUA 4Z0JA 4D6HA 4JTQA 3LCLA 3S1WA 1TYPA 4NEWA 1TJRA 3S3GA 5JCLA 4PL2A 5TNVA 4HNLA 1XYCA 2V82A 5I3FA 4UQCA 1UP0A 5I5RA 1DJHA 2WSKA 2HNEA 3HGOA 3OA5A 2Q6ZA 1A3XA 3QF0A 2IKIA 2QCDB 1WQ5A 2IQ0A 3RR1A 1FXQA 2V5JA 4ZB5A 2YVJA 1ZRQA 3SRHA 2F2HA 1XDMA 1UKQA 4HSHA 8TIMA 3JW7A 1KCZA 3Q94A 4CEXC 2AMGA 1RSCA 4C5YA 3IAPA 5CLTA 4TX6A 1VEPA 5IDIA 1EPVA 3B8DA 3AHTA 4O1CA 5ABHA 5ABTA 2EO7A 4C6PA 4MB4A 5HUPA 5IFTA 5U4NA 3CB8A 3VIHA 1QJWA 1PXGA 2V68A 4Z1BA 1OC5A 2VEMA 4KH2A 1VQZA 4C5ZA 2WO5A 3W7JA 1AQMA 4CQDA 1BSIA 5BMXA 4QJ5B 2IPWA 4PB4A 1KFJA 1FWAC 3NGJA 4LW7A 4TXEA 3TONA 4X22A 4Z1AA 4NX0A 4IP5A 5CGTA 2X8CA 1O5QA 2PWEA 4D6JA 4NYYA 2YLLA 4MUZA 2ZICA 3QKEA 4UOJA 4H04A 2WPGA 2E67A 3QPEA 1K8YA 3AWOA 2C1HA 3EDDA 3IACA 3ARXA 3WD0A 2PU0A 4DF0A 1ZZMA 4BI7A 2IPFA 4ZCWA 1OYCA 5RUBA 3BOXA 4JQ1A 4H6KA 1JULA 3IK4A 1I60A 2EXOA 3GNPA 3LGDA 4PODA 3QR0A 3QQ0A 3PZUA 1F5ZA 1HP5A 1AZ1A 5EYWA 4S3CA 3TV8A 3VILA 3URQA 3QM3A 4RV3A 4K6AA 3PBUA 2FYMA 2D20A 2X2GA 4MB3A 3M64A 4X60A 3W6LA 2HNHA 4XZIA 4WGXA 5G1TA 3BAXA 3TYUA 1S2UA 3E2RA 1G4PA 4RZ6A 3BDKA 3CUIA 1S5TA 5E09A 2YDAA 5GJMA 4ZEPA 5BU9A 1UQYA 2F7FA 4MWAC 4H6EA 1H7XA 4R53A 3VC5A 4W88A 3LPFA 3RNMA 3BAYA 3B03A 4FOJA 5DMNA 2XFYA 4DIAA 3VA8A 2DZVA 4DUVA 1ZHAA 3NQGA 1US3A 3H55A 2WKJA 2QVNA 2HVNA 2XVLA 1EC8A 4NZJA 1HL9A 2I17A 3HMCA 3WQ4A 1W3JA 1FWSA 1EXPA 3C4UA 1TTQA 3U57A 1SQ7A 1W3LA 3TSBA 2BGNE 3WH6A 2J7CA 4A3YA 2JKAA 4GIAA 1WZLA 2Y8VA 3CHFA 3OIHA 1TQJA 1TVPA 4FLSA 2Z2BA 4FALA 1BXBA 4HU4A 1DV7A 2PDGA 3CUZA 3P62A 4DYJA 4DPPA 5C7HA 3P74A 1PAMA 3QRHA 2X8RA 1ZBVA 5K4ZA