3V5IA

The crystal structure of the mutant clpp s98a (staphylococcus aureus)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
190
structure length
184
Chain Sequence
IPTVIERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAAAMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into structural network responsible for oligomerization and activity of bacterial virulence regulator caseinolytic protease P (ClpP) protein.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 66
structure length 184
sequence length 190
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3v5iA00
3ZWAA 4JCQA 3IAVA 4ASIA 3M6NA 4FN8A 3HLN1 3HRXA 1Y7OA 4L6WA 3GLMA 3ZWBA 1HZDA 2J5II 1ON3A 3TT6A 5CTCA 3Q1TA 5G1SA 3RSIA 5MGBA 3TLFA 3TZ3A 3U9TB 5DU6A 1TG6A 3H02A 4RYFH 2J5SA 1XNYA 2Q35A 4MXIA 2DEOA 4I42A 2GTRA 2FW2A 1JXZA 5KDRB 2F9IA 3U9RB 3TDCA 4EMLA 2J5IA 4FNBA 5FIFA 3MYBA 1PJHA 2F6IA 2VSUE 1UIYA 3PZKA 3H81A 5DKPA 4ZDBA 1FC7A 3TV5A 4FJWD 3SLLA 2VSUA 4JFCA 4Q0GA 3LAOA 3KTIA 1OD4A 3H0SA 2VSSF 4MOUA 4DI1A 1X0UA 3BEZA 4NNQA 2PBPA 1EF9A 3PGQA 3MFMA 2VREA 3HP0A 3QWDA 1HNOA 4JJTA 3GF7A 3ZW9A 4EMPA 4U0HA 2ZL0A 3HINA 2J5GA 5JBXA 2X58A 3P5MA 4HC8A 1FC6A 2ZL2A 3MT6A 5DTPA 3RRVA 3KTKA 5INIA 2VSSE 4FNDA 4IZCA 4JSBA 3K50A 5DL1A 1WDLA 2ZL4A 3STAA 2F6QA 3H0JA 1J7XA 4U0GA 3V5IA 4MI2A 1W2XA 3OT6A 3VIVA 5G1RA 2F9IB 1NZYB 2VSSA 4ZDCA 2A81A 1N6EA 2F9YA 4I4ZA 3R9TA 5CTBA 3ISAA 1Q51A 4FZWC 2VX2A 3QYRA 2A7SA 1K39A 5DU8A 2ZL3A 4FZWA 2IEXA 4ZU2A 3GF3A 3KTGA 3U9SB 3IBBA 1K32A 3ST9A 1UYVA 3IB9A 4EMMA 3DORA 4L8KA 5G1QA 1YG6A 5KJPA 4FN7A 3QXZA 1EY3A 2Q34A 3FF6A 4JOTA 3GKBA 3ZWCA 4JVTA 4B3HA 2VSUF 5E0NX 5DTWA 4U1AA 4RYFA 5C9GA 3OMEA 4Z0MA 2BZRA 2ZQRA 1RJNA 3TVUA 4G2RA 2J5IB 1FCFA 2D3TA 4JCTA 3FDUA 5DZKH 1SZOA 3SWXA 2HW5A 1XNWA 4GHNA 5DUFA 1UYRA 4F47A 3TVWA 3G64A 5JBWA 3TRRA 3BF0A 3I47A 3RSTA 5DZKA 4JCRA 4ELWA 2NP9A 5INFA 4QIIA 3R9QA 3ZW8A 1NZYA 3QK8A 4ZDEA 5E0SH 4ZDDA 3H0UA 4KD6A 3R6HA 4NEKA 4K2NA 3K8XA 4WCZA 3M6MA 3T8AA 3V5EA 4B3IA 4OMRA 3TT7A 3L3SA 2WTBA 3LKEA 3DJAA 4OG1A 4Q1IA 4IZDA 1YG8A 1WDMA 3KTJA 1UYSA 4U18A 4FB8A 1N6FA 1ON9A 3QREA 2FZSA 1FC9A 4KPKA 4K29A 3HE2A 3JU1A 3NJDA 1OD2A 3BPPA 5C90A 1WZ8A 2EJ5A 1DCIA 2PPYA 4JYJA 1VRGA 2F9YB 3H0QA 4U19A 2A7KA 1SG4A 1PIXA 3OC7A 1Q52A 3MOYA 1N6DA 3WG5A 2UZFA 4B3JA 5E0SA 1MJ3A 2CE3A 1TYFA 3Q0GA 4I52A 3R0OA 4HNKA 2QQ3A 4QFEA 3T3WA 1EF8A 5FUSA 3T89A 4KNPA 4GM2A 4WYOB 3T8BA 4RCNA 1DUBA 4ZDFA 4JWVA 5KDRA 1HNUA 3QKAA 3KTHA 3NJBA 4QIJA 2ZQQA 3KQFA 2Q2XA 3P2LA 4U0GH 4IZBA 2X24A 4WZ8B 4JCSA 3N6RB 3Q7HA 4OLQA 4KWBA 1RJMA 2PG8A 1XO6A 1XX4A 4JYLA 4ELSA 5DU4A 5INGA 2VSUC 2FBMA 4LK5A 3QXIA 2CBYA 1O8UA 1WDKA 2C8TA 2J5GD 2W3PA 1UYTA 3T88A 3P85A 4ELXA 3PE8A 4YLHA 3Q0JA 3QMJA 3GMAA 3PEAA 2DUBA 4K3WA 5DUCA 3R9SA 5IKLB 1XNVA
chains in the Genus database with same CATH superfamily
3ZWAA 4JCQA 3IAVA 4ASIA 3M6NA 4FN8A 3HLN1 3HRXA 1Y7OA 4L6WA 3GLMA 3ZWBA 1HZDA 2J5II 1ON3A 3TT6A 5CTCA 3Q1TA 5G1SA 3RSIA 5MGBA 3TLFA 3TZ3A 3U9TB 5DU6A 1TG6A 3H02A 4RYFH 2J5SA 1XNYA 2Q35A 4MXIA 4HDTA 2DEOA 4I42A 2GTRA 2FW2A 1JXZA 5KDRB 2F9IA 3U9RB 3TDCA 4EMLA 2YJGA 2J5IA 4FNBA 5FIFA 3MYBA 1PJHA 2F6IA 2VSUE 1UIYA 3PZKA 3H81A 5DKPA 4ZDBA 1FC7A 3TV5A 4FJWD 3SLLA 2VSUA 4JFCA 4Q0GA 3LAOA 3KTIA 1OD4A 3H0SA 2VSSF 4MOUA 4DI1A 1X0UA 3BEZA 4NNQA 2PBPA 1EF9A 3PGQA 3MFMA 2VREA 3HP0A 3QWDA 1HNOA 4JJTA 3GF7A 3ZW9A 4EMPA 4U0HA 2ZL0A 3HINA 2J5GA 5JBXA 2X58A 3P5MA 4HC8A 1FC6A 2ZL2A 3MT6A 5DTPA 3RRVA 3KTKA 5INIA 2VSSE 3BPTA 4FNDA 4IZCA 4JSBA 3K50A 5DL1A 1WDLA 2ZL4A 3STAA 2F6QA 3H0JA 1J7XA 4U0GA 3V5IA 4MI2A 1W2XA 3OT6A 3VIVA 5G1RA 2F9IB 1NZYB 2VSSA 4ZDCA 2A81A 1N6EA 2F9YA 4I4ZA 3R9TA 5CTBA 3ISAA 1Q51A 4FZWC 2VX2A 3QYRA 2A7SA 1K39A 5DU8A 2ZL3A 4FZWA 2IEXA 4ZU2A 3GF3A 3KTGA 3U9SB 3IBBA 1K32A 3ST9A 1UYVA 3IB9A 4EMMA 3DORA 4L8KA 5G1QA 1YG6A 4J2UA 5KJPA 4FN7A 3QXZA 1EY3A 2Q34A 3FF6A 4JOTA 3GKBA 3ZWCA 4JVTA 4B3HA 2VSUF 5E0NX 5DTWA 4U1AA 4RYFA 5C9GA 3OMEA 4Z0MA 2BZRA 2ZQRA 1RJNA 3TVUA 4G2RA 2J5IB 1FCFA 2D3TA 4JCTA 3FDUA 5DZKH 1SZOA 3SWXA 2HW5A 5HUQA 1XNWA 4GHNA 5DUFA 1UYRA 4F47A 3TVWA 3G64A 5JBWA 3TRRA 3BF0A 3I47A 3RSTA 5DZKA 4JCRA 4ELWA 2NP9A 4NARA 5INFA 4QIIA 3R9QA 3ZW8A 1NZYA 3QK8A 4ZDEA 5E0SH 4ZDDA 3H0UA 4KD6A 3R6HA 4NEKA 4K2NA 3K8XA 4WCZA 3M6MA 3T8AA 3V5EA 4B3IA 4OMRA 3TT7A 3L3SA 2WTBA 3LKEA 3DJAA 4OG1A 4Q1IA 4IZDA 1YG8A 1WDMA 3KTJA 1UYSA 4U18A 4FB8A 1N6FA 1ON9A 3QREA 2FZSA 1FC9A 4KPKA 4K29A 3HE2A 3JU1A 3NJDA 1OD2A 3BPPA 5C90A 1WZ8A 2EJ5A 1DCIA 2PPYA 4JYJA 1VRGA 2F9YB 3H0QA 4U19A 2A7KA 1SG4A 1PIXA 3OC7A 1Q52A 3MOYA 1N6DA 3WG5A 2UZFA 4B3JA 5E0SA 1MJ3A 2CE3A 1TYFA 3Q0GA 4I52A 3R0OA 4HNKA 2QQ3A 4QFEA 3T3WA 1EF8A 5FUSA 3T89A 4KNPA 4GM2A 4WYOB 3T8BA 4RCNA 1DUBA 4ZDFA 4JWVA 5KDRA 1HNUA 3QKAA 3KTHA 3NJBA 4QIJA 2ZQQA 3KQFA 2Q2XA 3P2LA 4U0GH 4IZBA 2X24A 4WZ8B 4JCSA 3N6RB 3Q7HA 4OLQA 4KWBA 1RJMA 2PG8A 1XO6A 1XX4A 4JYLA 4ELSA 5DU4A 5INGA 2VSUC 2FBMA 4LK5A 3QXIA 2CBYA 1O8UA 1WDKA 2C8TA 2J5GD 2W3PA 1UYTA 3T88A 3P85A 4ELXA 3PE8A 4YLHA 3Q0JA 3QMJA 3GMAA 3PEAA 2DUBA 4K3WA 5DUCA 3R9SA 5IKLB 1XNVA
chains in the Genus database with same CATH topology
3ZWAA 4JCQA 3IAVA 4ASIA 3M6NA 4FN8A 3HLN1 3HRXA 1Y7OA 4L6WA 3GLMA 3ZWBA 1HZDA 2J5II 1ON3A 3TT6A 5CTCA 3Q1TA 5G1SA 3RSIA 5MGBA 3TLFA 3TZ3A 3U9TB 5DU6A 1TG6A 3H02A 4RYFH 2J5SA 1XNYA 2Q35A 4MXIA 4HDTA 2DEOA 4I42A 2GTRA 2FW2A 1JXZA 5KDRB 2F9IA 3U9RB 3TDCA 4EMLA 2YJGA 2J5IA 4FNBA 5FIFA 3MYBA 1PJHA 2F6IA 2VSUE 1UIYA 3PZKA 3H81A 5DKPA 4ZDBA 1FC7A 3TV5A 4FJWD 3SLLA 2VSUA 4JFCA 4Q0GA 3LAOA 3KTIA 1OD4A 3H0SA 2VSSF 4MOUA 4DI1A 1X0UA 3BEZA 4NNQA 2PBPA 1EF9A 3PGQA 3MFMA 2VREA 3HP0A 3QWDA 1HNOA 4JJTA 3GF7A 3ZW9A 4EMPA 4U0HA 2ZL0A 3HINA 2J5GA 5JBXA 2X58A 3P5MA 4HC8A 1FC6A 2ZL2A 3MT6A 5DTPA 3RRVA 3KTKA 5INIA 2VSSE 3BPTA 4FNDA 4IZCA 4JSBA 3K50A 5DL1A 1WDLA 2ZL4A 3STAA 2F6QA 3H0JA 1J7XA 4U0GA 3V5IA 4MI2A 1W2XA 3OT6A 3VIVA 5G1RA 2F9IB 1NZYB 2VSSA 4ZDCA 2A81A 1N6EA 2F9YA 4I4ZA 3R9TA 5CTBA 3ISAA 1Q51A 4FZWC 2VX2A 3QYRA 2A7SA 1K39A 5DU8A 2ZL3A 4FZWA 2IEXA 4ZU2A 3GF3A 3KTGA 3U9SB 3IBBA 1K32A 3ST9A 1UYVA 3IB9A 4EMMA 3DORA 4L8KA 5G1QA 1YG6A 4J2UA 5KJPA 4FN7A 3QXZA 1EY3A 2Q34A 3FF6A 4JOTA 3GKBA 3ZWCA 4JVTA 4B3HA 2VSUF 5E0NX 5DTWA 4U1AA 4RYFA 5C9GA 3OMEA 4Z0MA 2BZRA 2ZQRA 1RJNA 3TVUA 4G2RA 2J5IB 1FCFA 2D3TA 4JCTA 3FDUA 5DZKH 1SZOA 3SWXA 2HW5A 5HUQA 1XNWA 4GHNA 5DUFA 1UYRA 4F47A 3TVWA 3G64A 5JBWA 3TRRA 3BF0A 3I47A 3RSTA 5DZKA 4JCRA 4ELWA 2NP9A 4NARA 5INFA 4QIIA 3R9QA 3ZW8A 1NZYA 3QK8A 4ZDEA 5E0SH 4ZDDA 3H0UA 4KD6A 3R6HA 4NEKA 4K2NA 3K8XA 4WCZA 3M6MA 3T8AA 3V5EA 4B3IA 4OMRA 3TT7A 3L3SA 2WTBA 3LKEA 3DJAA 4OG1A 4Q1IA 4IZDA 1YG8A 1WDMA 3KTJA 1UYSA 4U18A 4FB8A 1N6FA 1ON9A 3QREA 2FZSA 1FC9A 4KPKA 4K29A 3HE2A 3JU1A 3NJDA 1OD2A 3BPPA 5C90A 1WZ8A 2EJ5A 1DCIA 2PPYA 4JYJA 1VRGA 2F9YB 3H0QA 4U19A 2A7KA 1SG4A 1PIXA 3OC7A 1Q52A 3MOYA 1N6DA 3WG5A 2UZFA 4B3JA 5E0SA 1MJ3A 2CE3A 1TYFA 3Q0GA 4I52A 3R0OA 4HNKA 2QQ3A 4QFEA 3T3WA 1EF8A 5FUSA 3T89A 4KNPA 4GM2A 4WYOB 3T8BA 4RCNA 1DUBA 4ZDFA 4JWVA 5KDRA 1HNUA 3QKAA 3KTHA 3NJBA 4QIJA 2ZQQA 3KQFA 2Q2XA 3P2LA 4U0GH 4IZBA 2X24A 4WZ8B 4JCSA 3N6RB 3Q7HA 4OLQA 4KWBA 1RJMA 2PG8A 1XO6A 1XX4A 4JYLA 4ELSA 5DU4A 5INGA 2VSUC 2FBMA 4LK5A 3QXIA 2CBYA 1O8UA 1WDKA 2C8TA 2J5GD 2W3PA 1UYTA 3T88A 3P85A 4ELXA 3PE8A 4YLHA 3Q0JA 3QMJA 3GMAA 3PEAA 2DUBA 4K3WA 5DUCA 3R9SA 5IKLB 1XNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWA A;  4JCQ A;  3IAV A;  4ASI A;  3M6N A;  4FN8 A;  3HLN 1;  3HRX A;  1Y7O A;  4L6W A;  3GLM A;  3ZWB A;  1HZD A;  2J5I I;  1ON3 A;  3TT6 A;  5CTC A;  3Q1T A;  5G1S A;  3RSI A;  5MGB A;  3TLF A;  3TZ3 A;  3U9T B;  5DU6 A;  1TG6 A;  3H02 A;  4RYF H;  2J5S A;  1XNY A;  2Q35 A;  4MXI A;  2DEO A;  4I42 A;  2GTR A;  2FW2 A;  1JXZ A;  5KDR B;  2F9I A;  3U9R B;  3TDC A;  4EML A;  2J5I A;  4FNB A;  5FIF A;  3MYB A;  1PJH A;  2F6I A;  2VSU E;  1UIY A;  3PZK A;  3H81 A;  5DKP A;  4ZDB A;  1FC7 A;  3TV5 A;  4FJW D;  3SLL A;  2VSU A;  4JFC A;  4Q0G A;  3LAO A;  3KTI A;  1OD4 A;  3H0S A;  2VSS F;  4MOU A;  4DI1 A;  1X0U A;  3BEZ A;  4NNQ A;  2PBP A;  1EF9 A;  3PGQ A;  3MFM A;  2VRE A;  3HP0 A;  3QWD A;  1HNO A;  4JJT A;  3GF7 A;  3ZW9 A;  4EMP A;  4U0H A;  2ZL0 A;  3HIN A;  2J5G A;  5JBX A;  2X58 A;  3P5M A;  4HC8 A;  1FC6 A;  2ZL2 A;  3MT6 A;  5DTP A;  3RRV A;  3KTK A;  5INI A;  2VSS E;  4FND A;  4IZC A;  4JSB A;  3K50 A;  5DL1 A;  1WDL A;  2ZL4 A;  3STA A;  2F6Q A;  3H0J A;  1J7X A;  4U0G A;  3V5I A;  4MI2 A;  1W2X A;  3OT6 A;  3VIV A;  5G1R A;  2F9I B;  1NZY B;  2VSS A;  4ZDC A;  2A81 A;  1N6E A;  2F9Y A;  4I4Z A;  3R9T A;  5CTB A;  3ISA A;  1Q51 A;  4FZW C;  2VX2 A;  3QYR A;  2A7S A;  1K39 A;  5DU8 A;  2ZL3 A;  4FZW A;  2IEX A;  4ZU2 A;  3GF3 A;  3KTG A;  3U9S B;  3IBB A;  1K32 A;  3ST9 A;  1UYV A;  3IB9 A;  4EMM A;  3DOR A;  4L8K A;  5G1Q A;  1YG6 A;  5KJP A;  4FN7 A;  3QXZ A;  1EY3 A;  2Q34 A;  3FF6 A;  4JOT A;  3GKB A;  3ZWC A;  4JVT A;  4B3H A;  2VSU F;  5E0N X;  5DTW A;  4U1A A;  4RYF A;  5C9G A;  3OME A;  4Z0M A;  2BZR A;  2ZQR A;  1RJN A;  3TVU A;  4G2R A;  2J5I B;  1FCF A;  2D3T A;  4JCT A;  3FDU A;  5DZK H;  1SZO A;  3SWX A;  2HW5 A;  1XNW A;  4GHN A;  5DUF A;  1UYR A;  4F47 A;  3TVW A;  3G64 A;  5JBW A;  3TRR A;  3BF0 A;  3I47 A;  3RST A;  5DZK A;  4JCR A;  4ELW A;  2NP9 A;  5INF A;  4QII A;  3R9Q A;  3ZW8 A;  1NZY A;  3QK8 A;  4ZDE A;  5E0S H;  4ZDD A;  3H0U A;  4KD6 A;  3R6H A;  4NEK A;  4K2N A;  3K8X A;  4WCZ A;  3M6M A;  3T8A A;  3V5E A;  4B3I A;  4OMR A;  3TT7 A;  3L3S A;  2WTB A;  3LKE A;  3DJA A;  4OG1 A;  4Q1I A;  4IZD A;  1YG8 A;  1WDM A;  3KTJ A;  1UYS A;  4U18 A;  4FB8 A;  1N6F A;  1ON9 A;  3QRE A;  2FZS A;  1FC9 A;  4KPK A;  4K29 A;  3HE2 A;  3JU1 A;  3NJD A;  1OD2 A;  3BPP A;  5C90 A;  1WZ8 A;  2EJ5 A;  1DCI A;  2PPY A;  4JYJ A;  1VRG A;  2F9Y B;  3H0Q A;  4U19 A;  2A7K A;  1SG4 A;  1PIX A;  3OC7 A;  1Q52 A;  3MOY A;  1N6D A;  3WG5 A;  2UZF A;  4B3J A;  5E0S A;  1MJ3 A;  2CE3 A;  1TYF A;  3Q0G A;  4I52 A;  3R0O A;  4HNK A;  2QQ3 A;  4QFE A;  3T3W A;  1EF8 A;  5FUS A;  3T89 A;  4KNP A;  4GM2 A;  4WYO B;  3T8B A;  4RCN A;  1DUB A;  4ZDF A;  4JWV A;  5KDR A;  1HNU A;  3QKA A;  3KTH A;  3NJB A;  4QIJ A;  2ZQQ A;  3KQF A;  2Q2X A;  3P2L A;  4U0G H;  4IZB A;  2X24 A;  4WZ8 B;  4JCS A;  3N6R B;  3Q7H A;  4OLQ A;  4KWB A;  1RJM A;  2PG8 A;  1XO6 A;  1XX4 A;  4JYL A;  4ELS A;  5DU4 A;  5ING A;  2VSU C;  2FBM A;  4LK5 A;  3QXI A;  2CBY A;  1O8U A;  1WDK A;  2C8T A;  2J5G D;  2W3P A;  1UYT A;  3T88 A;  3P85 A;  4ELX A;  3PE8 A;  4YLH A;  3Q0J A;  3QMJ A;  3GMA A;  3PEA A;  2DUB A;  4K3W A;  5DUC A;  3R9S A;  5IKL B;  1XNV A; 
#chains in the Genus database with same CATH topology
 3ZWA A;  4JCQ A;  3IAV A;  4ASI A;  3M6N A;  4FN8 A;  3HLN 1;  3HRX A;  1Y7O A;  4L6W A;  3GLM A;  3ZWB A;  1HZD A;  2J5I I;  1ON3 A;  3TT6 A;  5CTC A;  3Q1T A;  5G1S A;  3RSI A;  5MGB A;  3TLF A;  3TZ3 A;  3U9T B;  5DU6 A;  1TG6 A;  3H02 A;  4RYF H;  2J5S A;  1XNY A;  2Q35 A;  4MXI A;  4HDT A;  2DEO A;  4I42 A;  2GTR A;  2FW2 A;  1JXZ A;  5KDR B;  2F9I A;  3U9R B;  3TDC A;  4EML A;  2YJG A;  2J5I A;  4FNB A;  5FIF A;  3MYB A;  1PJH A;  2F6I A;  2VSU E;  1UIY A;  3PZK A;  3H81 A;  5DKP A;  4ZDB A;  1FC7 A;  3TV5 A;  4FJW D;  3SLL A;  2VSU A;  4JFC A;  4Q0G A;  3LAO A;  3KTI A;  1OD4 A;  3H0S A;  2VSS F;  4MOU A;  4DI1 A;  1X0U A;  3BEZ A;  4NNQ A;  2PBP A;  1EF9 A;  3PGQ A;  3MFM A;  2VRE A;  3HP0 A;  3QWD A;  1HNO A;  4JJT A;  3GF7 A;  3ZW9 A;  4EMP A;  4U0H A;  2ZL0 A;  3HIN A;  2J5G A;  5JBX A;  2X58 A;  3P5M A;  4HC8 A;  1FC6 A;  2ZL2 A;  3MT6 A;  5DTP A;  3RRV A;  3KTK A;  5INI A;  2VSS E;  3BPT A;  4FND A;  4IZC A;  4JSB A;  3K50 A;  5DL1 A;  1WDL A;  2ZL4 A;  3STA A;  2F6Q A;  3H0J A;  1J7X A;  4U0G A;  3V5I A;  4MI2 A;  1W2X A;  3OT6 A;  3VIV A;  5G1R A;  2F9I B;  1NZY B;  2VSS A;  4ZDC A;  2A81 A;  1N6E A;  2F9Y A;  4I4Z A;  3R9T A;  5CTB A;  3ISA A;  1Q51 A;  4FZW C;  2VX2 A;  3QYR A;  2A7S A;  1K39 A;  5DU8 A;  2ZL3 A;  4FZW A;  2IEX A;  4ZU2 A;  3GF3 A;  3KTG A;  3U9S B;  3IBB A;  1K32 A;  3ST9 A;  1UYV A;  3IB9 A;  4EMM A;  3DOR A;  4L8K A;  5G1Q A;  1YG6 A;  4J2U A;  5KJP A;  4FN7 A;  3QXZ A;  1EY3 A;  2Q34 A;  3FF6 A;  4JOT A;  3GKB A;  3ZWC A;  4JVT A;  4B3H A;  2VSU F;  5E0N X;  5DTW A;  4U1A A;  4RYF A;  5C9G A;  3OME A;  4Z0M A;  2BZR A;  2ZQR A;  1RJN A;  3TVU A;  4G2R A;  2J5I B;  1FCF A;  2D3T A;  4JCT A;  3FDU A;  5DZK H;  1SZO A;  3SWX A;  2HW5 A;  5HUQ A;  1XNW A;  4GHN A;  5DUF A;  1UYR A;  4F47 A;  3TVW A;  3G64 A;  5JBW A;  3TRR A;  3BF0 A;  3I47 A;  3RST A;  5DZK A;  4JCR A;  4ELW A;  2NP9 A;  4NAR A;  5INF A;  4QII A;  3R9Q A;  3ZW8 A;  1NZY A;  3QK8 A;  4ZDE A;  5E0S H;  4ZDD A;  3H0U A;  4KD6 A;  3R6H A;  4NEK A;  4K2N A;  3K8X A;  4WCZ A;  3M6M A;  3T8A A;  3V5E A;  4B3I A;  4OMR A;  3TT7 A;  3L3S A;  2WTB A;  3LKE A;  3DJA A;  4OG1 A;  4Q1I A;  4IZD A;  1YG8 A;  1WDM A;  3KTJ A;  1UYS A;  4U18 A;  4FB8 A;  1N6F A;  1ON9 A;  3QRE A;  2FZS A;  1FC9 A;  4KPK A;  4K29 A;  3HE2 A;  3JU1 A;  3NJD A;  1OD2 A;  3BPP A;  5C90 A;  1WZ8 A;  2EJ5 A;  1DCI A;  2PPY A;  4JYJ A;  1VRG A;  2F9Y B;  3H0Q A;  4U19 A;  2A7K A;  1SG4 A;  1PIX A;  3OC7 A;  1Q52 A;  3MOY A;  1N6D A;  3WG5 A;  2UZF A;  4B3J A;  5E0S A;  1MJ3 A;  2CE3 A;  1TYF A;  3Q0G A;  4I52 A;  3R0O A;  4HNK A;  2QQ3 A;  4QFE A;  3T3W A;  1EF8 A;  5FUS A;  3T89 A;  4KNP A;  4GM2 A;  4WYO B;  3T8B A;  4RCN A;  1DUB A;  4ZDF A;  4JWV A;  5KDR A;  1HNU A;  3QKA A;  3KTH A;  3NJB A;  4QIJ A;  2ZQQ A;  3KQF A;  2Q2X A;  3P2L A;  4U0G H;  4IZB A;  2X24 A;  4WZ8 B;  4JCS A;  3N6R B;  3Q7H A;  4OLQ A;  4KWB A;  1RJM A;  2PG8 A;  1XO6 A;  1XX4 A;  4JYL A;  4ELS A;  5DU4 A;  5ING A;  2VSU C;  2FBM A;  4LK5 A;  3QXI A;  2CBY A;  1O8U A;  1WDK A;  2C8T A;  2J5G D;  2W3P A;  1UYT A;  3T88 A;  3P85 A;  4ELX A;  3PE8 A;  4YLH A;  3Q0J A;  3QMJ A;  3GMA A;  3PEA A;  2DUB A;  4K3W A;  5DUC A;  3R9S A;  5IKL B;  1XNV A; 
#chains in the Genus database with same CATH homology
 3ZWA A;  4JCQ A;  3IAV A;  4ASI A;  3M6N A;  4FN8 A;  3HLN 1;  3HRX A;  1Y7O A;  4L6W A;  3GLM A;  3ZWB A;  1HZD A;  2J5I I;  1ON3 A;  3TT6 A;  5CTC A;  3Q1T A;  5G1S A;  3RSI A;  5MGB A;  3TLF A;  3TZ3 A;  3U9T B;  5DU6 A;  1TG6 A;  3H02 A;  4RYF H;  2J5S A;  1XNY A;  2Q35 A;  4MXI A;  4HDT A;  2DEO A;  4I42 A;  2GTR A;  2FW2 A;  1JXZ A;  5KDR B;  2F9I A;  3U9R B;  3TDC A;  4EML A;  2YJG A;  2J5I A;  4FNB A;  5FIF A;  3MYB A;  1PJH A;  2F6I A;  2VSU E;  1UIY A;  3PZK A;  3H81 A;  5DKP A;  4ZDB A;  1FC7 A;  3TV5 A;  4FJW D;  3SLL A;  2VSU A;  4JFC A;  4Q0G A;  3LAO A;  3KTI A;  1OD4 A;  3H0S A;  2VSS F;  4MOU A;  4DI1 A;  1X0U A;  3BEZ A;  4NNQ A;  2PBP A;  1EF9 A;  3PGQ A;  3MFM A;  2VRE A;  3HP0 A;  3QWD A;  1HNO A;  4JJT A;  3GF7 A;  3ZW9 A;  4EMP A;  4U0H A;  2ZL0 A;  3HIN A;  2J5G A;  5JBX A;  2X58 A;  3P5M A;  4HC8 A;  1FC6 A;  2ZL2 A;  3MT6 A;  5DTP A;  3RRV A;  3KTK A;  5INI A;  2VSS E;  3BPT A;  4FND A;  4IZC A;  4JSB A;  3K50 A;  5DL1 A;  1WDL A;  2ZL4 A;  3STA A;  2F6Q A;  3H0J A;  1J7X A;  4U0G A;  3V5I A;  4MI2 A;  1W2X A;  3OT6 A;  3VIV A;  5G1R A;  2F9I B;  1NZY B;  2VSS A;  4ZDC A;  2A81 A;  1N6E A;  2F9Y A;  4I4Z A;  3R9T A;  5CTB A;  3ISA A;  1Q51 A;  4FZW C;  2VX2 A;  3QYR A;  2A7S A;  1K39 A;  5DU8 A;  2ZL3 A;  4FZW A;  2IEX A;  4ZU2 A;  3GF3 A;  3KTG A;  3U9S B;  3IBB A;  1K32 A;  3ST9 A;  1UYV A;  3IB9 A;  4EMM A;  3DOR A;  4L8K A;  5G1Q A;  1YG6 A;  4J2U A;  5KJP A;  4FN7 A;  3QXZ A;  1EY3 A;  2Q34 A;  3FF6 A;  4JOT A;  3GKB A;  3ZWC A;  4JVT A;  4B3H A;  2VSU F;  5E0N X;  5DTW A;  4U1A A;  4RYF A;  5C9G A;  3OME A;  4Z0M A;  2BZR A;  2ZQR A;  1RJN A;  3TVU A;  4G2R A;  2J5I B;  1FCF A;  2D3T A;  4JCT A;  3FDU A;  5DZK H;  1SZO A;  3SWX A;  2HW5 A;  5HUQ A;  1XNW A;  4GHN A;  5DUF A;  1UYR A;  4F47 A;  3TVW A;  3G64 A;  5JBW A;  3TRR A;  3BF0 A;  3I47 A;  3RST A;  5DZK A;  4JCR A;  4ELW A;  2NP9 A;  4NAR A;  5INF A;  4QII A;  3R9Q A;  3ZW8 A;  1NZY A;  3QK8 A;  4ZDE A;  5E0S H;  4ZDD A;  3H0U A;  4KD6 A;  3R6H A;  4NEK A;  4K2N A;  3K8X A;  4WCZ A;  3M6M A;  3T8A A;  3V5E A;  4B3I A;  4OMR A;  3TT7 A;  3L3S A;  2WTB A;  3LKE A;  3DJA A;  4OG1 A;  4Q1I A;  4IZD A;  1YG8 A;  1WDM A;  3KTJ A;  1UYS A;  4U18 A;  4FB8 A;  1N6F A;  1ON9 A;  3QRE A;  2FZS A;  1FC9 A;  4KPK A;  4K29 A;  3HE2 A;  3JU1 A;  3NJD A;  1OD2 A;  3BPP A;  5C90 A;  1WZ8 A;  2EJ5 A;  1DCI A;  2PPY A;  4JYJ A;  1VRG A;  2F9Y B;  3H0Q A;  4U19 A;  2A7K A;  1SG4 A;  1PIX A;  3OC7 A;  1Q52 A;  3MOY A;  1N6D A;  3WG5 A;  2UZF A;  4B3J A;  5E0S A;  1MJ3 A;  2CE3 A;  1TYF A;  3Q0G A;  4I52 A;  3R0O A;  4HNK A;  2QQ3 A;  4QFE A;  3T3W A;  1EF8 A;  5FUS A;  3T89 A;  4KNP A;  4GM2 A;  4WYO B;  3T8B A;  4RCN A;  1DUB A;  4ZDF A;  4JWV A;  5KDR A;  1HNU A;  3QKA A;  3KTH A;  3NJB A;  4QIJ A;  2ZQQ A;  3KQF A;  2Q2X A;  3P2L A;  4U0G H;  4IZB A;  2X24 A;  4WZ8 B;  4JCS A;  3N6R B;  3Q7H A;  4OLQ A;  4KWB A;  1RJM A;  2PG8 A;  1XO6 A;  1XX4 A;  4JYL A;  4ELS A;  5DU4 A;  5ING A;  2VSU C;  2FBM A;  4LK5 A;  3QXI A;  2CBY A;  1O8U A;  1WDK A;  2C8T A;  2J5G D;  2W3P A;  1UYT A;  3T88 A;  3P85 A;  4ELX A;  3PE8 A;  4YLH A;  3Q0J A;  3QMJ A;  3GMA A;  3PEA A;  2DUB A;  4K3W A;  5DUC A;  3R9S A;  5IKL B;  1XNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...