3V5UA

Structure of sodium/calcium exchanger from methanocaldococcus jannaschii dsm 2661
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
304
structure length
297
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
molecule tags Metal transport
source organism Methanocaldococcus jannaschii
publication title Structural insight into the ion-exchange mechanism of the sodium/calcium exchanger.
pubmed doi rcsb
total genus 130
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3v5uA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 3v5uA02
5HXEA 5HXCA 5JDLA 5HXRA 5JDNA 5HYAA 5HXHA 5JDQA 3V5SA 3V5UA 5JDGA 5JDMA 5HWXA 5HXSA 5JDFA 5JDHA 5HWYA
chains in the Genus database with same CATH superfamily
2WZHA 5ABFA 3LK2B 4JEHB 5EK2A 2LJLA 2V1DB 3KV4A 4KHZF 3P50A 3HKCE 3A8YC 1I6ZA 2V5CA 1M7KA 3ZYLA 3H3AA 5L4HA 3KDSE 1E1HB 2Q9QC 2YEVC 3VJZA 3K3NA 1QLBA 5LXTE 4LF9T 3K3OA 2XQ6A 2QA7A 2WDVA 4JI8T 3JC6C 2B76A 1D0YA 4J2CA 2CHNA 4JUYA 4E7SA 4PNIA 2E5LT 1Y01A 1KFYA 3R6NA 3PV0F 2CA5A 4DV7T 3M65A 4MFRA 2SPCA 5JVDE 4H9NC 4ZI2C 5HCJA 3N9MA 1QUUA 2BG9E 4B3ST 3RIUA 2R6GF 3OVUA 5L3FB 5AQNB 4YLHA 2NTYA 5A1LA 2ZM6T 2DWKA 3C64A 1SJ7A 2XAQB 3GWHA 3FBLA 3QC9A 3RYCE 4GKKT 2EHOC 4GOUA 4E7ZA 3ZMZB 3SS1A 1XNQT 3F57A 1J5ET 1LVFA 3NRYA 2LHRA 5L3GB 1CHUA 1FJGT 4IE5A 1BR2A 2K9AA 2BKNA 4U72A 2X0CA 4TWDA 3AE6A 5DABA 2KSRA 1XNRT 3IF8B 3CVRA 4HFHA 2W63A 3CWZB 4UXNB 4BJNA 4KBMB 1O3XA 1T7SA 2MYSA 3PU8A 3QOFA 5FYMA 3RC3A 1UURA 5J2TE 3C4WA 2UUAT 3AA0B 5IYZE 4LF4T 2XQ7A 2DWGA 4DIDB 4O4HE 2BG9B 2EHOA 5L3BB 3A7MA 2QVAA 4ZHQE 3CX6B 2J4GA 4IE6A 1G73A 2LT3A 3SFEA 1UK5A 4QX7B 2V5DA 2XQAA 2IDOB 3L39A 3ZMSB 2IAKA 4NUVA 4CI3B 4GKJT 3O1HA 3AA7B 5LG4A 1KNZA 1AJ3A 2LSYA 4A56A 3WSCA 3J9X1 5LGNB 3N2GE 4A97A 2VURA 3K8PC 4HFVA 4PJMA 4G2AA 4O2AE 5TAOA 2YDRA 3RPUA 4OK0A 5CA1E 3UTKA 3LBXB 5IWAT 5L3EB 1HNZT 5LHGB 4AKIA 4EYYR 4F6RC 1IJ5A 2UXXB 1MIYA 5AQUB 3AA1B 3LFMA 2YN6A 4IIJE 3GN5B 3LSVA 4IDQA 4EZHA 2E9XB 4DR6T 4U31A 2LRKA 2WDRA 2CMRA 2C0SA 4GYSA 4DO0A 1KNRA 2FJEA 4KHPT 3FYQA 5LGTB 1X9BA 3ANWB 3B5MA 3EVYA 3VR8A 4ADZA 1D1CA 4ASKA 4YHHT 1JNRA 4GYRA 4PK6A 3B57A 4L5GA 2VB6A 4MLKA 2WP9A 3ZJ2A 5JTGA 2YU1A 5AQRB 4ZZBA 2CHOA 2VWAA 2JIWA 3C4XA 4TWHA 5FVLA 4B6XA 2XSAA 3AAEB 3L3PA 1XMOT 3M1CA 2LSGA 2XQ4A 4H9QC 3RIFA 3TLTA 1HCIA 2LM2A 4IREA 1W0AA 1YKEB 2KT9A 4MALA 1H7CA 4UV8B 2NTXA 4X62T 5JDMA 4F7GB 3DJBA 2WB5A 3E22E 2VASA 4DV2T 4GK0E 3FHNA 4ISSA 1L0VA 3PUWF 2PG8A 2IIUA 3IEEA 3N9PA 5AQJB 5LMNT 4H63V 2DL1A 3AE5A 4YHJA 3ZSTA 2D0UA 2CLYB 4DMVA 4EXTA 4LF6T 4LFAT 3N9LA 3PTRB 4WNKA 5CB4E 3AE4A 3CX7B 4H9RC 1MMNA 4LMLA 4U7IA 3H37A 4UEMA 3UQ7A 4X5TA 3UFGA 2H7OA 2VKHA 2W4XA 3BK9A 3F31A 3QNUA 4QH5A 3TLUA 3ZYMA 3VKGA 2C5JA 5FY7A 4TN7B 3UU6A 2X9HA 2W0GA 2XQ8A 2BG9C 3O1JA 4HWIB 4QH4A 1OEDB 3ZLIA 1ZHCA 3DP7A 1W0BA 3O1IA 4TNWA 3WAJA 3ONXA 1NEKA 2KNDA 1QSDA 1YXRA 2I59A 3RX6A 4IT4A 2W2UA 5ABFB 1KNPA 3MKDA 4IE7A 2M67A 4PFOA 2IHR1 2X9XA 3AVRA 3ETVA 4UVCB 1HNXT 2L9QA 4B3TT 3N2KE 4ILUA 4AQFA 4CXWA 5C2TA 4K0KT 2XAHB 3K3QC 3P8CD 2WM9A 2MTQA 4G63A 3RRWA 3TLVA 5LCYA 3U78A 5LYJE 1M62A 3CPZA 4M1PA 5AQOB 3AECA 2WQYA 2XQ5A 2IW5B 2V8SV 3UUBA 2BBHA 3AXJB 4ZI3D 5C3JA 4L0RA 2JPFA 3H3MA 2PJQA 2H89A 5CJ5A 2LE8A 3LJCA 2YINA 4U33A 3ZKRA 4ZI2D 5JR9B 3BQKA 5HEHA 3RH3A 2JMKA 4I43B 3T1YT 2X51A 1U4QA 5L2LA 3NZPA 3ZCIA 2V7KA 1HG2A 2FJAA 4O4LE 4LFBT 4QKNA 2UUCT 4DV5T 3AE2A 5EZYE 1J5WA 4P0AA 4AQYT 2D2SA 5LOVE 5DQVA 2LKGA 3RF1A 3V5UA 2CRBA 3AXJA 4DV1T 1I94T 2YK0A 4UIGA 3IHRA 1MNEA 2QGSA 3RKOA 3ZN1B 2X9YA 3ZT6A 3HA4A 2KINB 2N1GA 2ODVA 2NP9A 5AQFB 3ZT7A 2IMLA 2MAWA 2NW8A 2QRXA 2G0UA 1D1BA 2FJDA 3EI0A 4YXDA 3CMLA 3W15B 2WS3A 2OLTA 5LP6E 4FI5A 3KV6A 4HFDA 2V7IA 2WWVA 4HWFA 5HXHA 1W9RA 2A3DA 5F3JA 4CZZB 3HR0A 1S35A 2NW7A 4AISA 1N32T 5FXVA 2ZM0A 1OEDA 1HNWT 2XAFB 4OYJA 4TV9E 3SWHA 3E0ZA 3BQLA 4DR4T 2X67A 4WW0A 2M6IA 4ECGA 2FUPA 3JAEA 3RGLA 1BR0A 1X79A 3I1AA 5GONE 3CQCB 3NRXA 4H9PC 5JR9A 3KVBA 5J2UE 5FVKA 4LMKA 5FMNA 2X66A 1UCUA 2BZBA 3Q5WA 3OPCA 2LKHA 2YDQA 3AB3B 1YQ3A 1HF8A 4K0UA 3R84B 5L3CB 4H9OC 2MPKA 2P9BA 2WMNA 3N5LA 4BA9A 3EDUA 5FL0A 4IE0A 4L9IA 3PUYF 3OJAA 2BKPA 2WDQA 3UUNA 2CBJA 5FY0A 4HTEA 4U2ZA 2OA5A 4TNVA 2WWUA 5FY1A 5H6RB 4OFZA 4BGOA 2D0TA 2WU2A 2MOZA 4JI2T 2L7NA 1UGOA 4QHOA 4YSZA 4I4TE 3QB5A 4OHFA 5KX5E 3PJAA 4YTNA 1B7TA 1NAFA 4TX5A 1LKXA 4AKRB 5AQQB 3PU3A 3U3IA 5JQGE 3ZMTB 2HH7A 1CUNA 3MA9A 1ZV4X 1EZ3A 3P4WA 2CPTA 2I6HA 3RQUA 4TZ4C 4YJ2E 2CEAA 3JADA 4B3MT 2XM2A 3ZSSA 1WYBA 3T1HT 3QUJA 4IDZA 3ESLA 4QX8B 3UU3A 1HTJF 5J1GA 3Q5XA 2CCQA 4LFCT 2LOSA 3ANWA 5LG3A 2AXDS 4O8SA 4QWNB 2CWYA 4YTPA 3ONJA 1N33T 3GN5A 2XPKA 2H7VC 2E9XD 3JCFA 4ZI7E 4EZ4A 2F4VT 1UX5A 2D9DA 4HE8A 3FZKB 4O4IE 2H3RA 3CQXC 4PK4A 1SJ8A 2ACXA 1ZOYA 2XQ9A 3C51A 2VQFT 4BJMA 1MIWA 2V26A 2BG9A 2KZ7B 3AEDA 4IDOA 4EYUA 3TKLB 2YKSA 3GMIA 3RKGA 2UU9T 5HEOA 4NIQA 4TUYE 5LHIB 2FBWA 1YQ4A 2BKOA 3ABVA 5LMUT 1ZEEA 2CLYC 4DR1T 4IHJE 2Q9QD 3CK6A 2HPJA 3AA6B 2BVLA 3PUSA 4QH1A 5FXWA 5LBMA 4EEBA 4X66T 3CX8B 4CN6A 4ONRA 2LEHA 2NOXA 2EHOB 4O4JE 5ADXL 4X1YE 4PJJA 2LSIA 5F5WA 2BS4A 2DNXA 2VQET 5AQLB 1LRZA 4ISTA 4I55E 2WY2A 3P4SA 3S4UA 2UXDT 3I9YA 4EB6E 3RC8A 3M3ZB 4Z90A 5DJQC 3ZPOA 1OXZA 2PBIA 3ZT5A 3LDQB 3P4QA 3MJXA 3OBVE 1XWMA 4ANJA 5HXCA 4EEDA 3KBTA 3LK42 1FIOA 2A2FX 1US7B 2NR4A 4YJ3E 4AQFC 2QYWA 1WYCA 2V7MA 5AQGB 3MZKB 1FEWA 4PFPA 2WBLA 3Q5DA 4I0UA 4AKLA 4F8HA 5LBQB 1Z0PA 3RYHE 3RYIE 4DUYT 3VRBA 2VVSA 4YFSA 3EDVA 1DU2A 3AY5A 3UU4A 2BVMA 2K3WA 4HKAA 5BR8T 4WYVA 2EHOD 1YD8G 2E9XC 4JV5T 4WBNE 2JQ9A 2J47A 4UV9B 4YY3T 4JI7T 3EUHA 5AQMB 2JJ9A 4DBRA 2I0MA 4IDNA 3O9XA 3PE0A 3AT7A 4NPPA 2E5VA 3T8OA 5FXZA 3UULA 2UXBT 2KVPA 4DR3T 2RA1A 3VHLA 2LSJA 5KDMC 2KMFA 3LG7A 3ZJ1A 2AE9A 3KINB 3UU5A 1OEDC 3PUVF 4H9SE 4TWFA 3SRZA 4DMWA 4HFIA 2LM9A 4DVDA 2BS2A 5HEJA 5L3DB 5LHHB 3SFDA 5J0ZA 4ZZCA 4JI0T 4AKGA 5AQTB 3N9OA 4HN9A 3UQ4A 1GQEA 4DV4T 3E08A 2KBBA 1WLXA 2DLRA 2E9XA 2A9UA 2J62A 5HWYA 4H63H 5JDHA 1SUMB 2W67A 2LHNA 2ES0A 3P4RA 5LNKA 2HN2A 3GA8A 1YW0A 3LBXA 4EV6A 5JH7E 1HS7A 1NWMX 4ILAA 4QXCB 4X1IE 5E0OA 3AEGA 3PURA 4BAYB 3I0OA 5ABEA 1HX8A 5LJNA 2JRKA 2HHHT 1WR0A 4CI1B 5BMVE 4JBWF 2X0YA 5JRCA 3Q9DA 3KBUA 3L8RA 4MHCA 3FXEB 5JR9C 4AQGA 5F8PA 4AKHA 2V6YA 4CXXA 1XDPA 4HEAA 4XBFB 4YTMA 2W61A 2LLYA 1S94A 3K1SA 1BR1A 3CIRA 3PDYA 5KMGP 3AE8A 2NWBA 2V7JA 2LSKA 1MMDA 3NVOA 4X1KE 2XAGB 3PF0A 3ZC1A 3FZMB 3PUAA 4TV8E 4X20E 1HFAA 4U2YA 1XZYA 3UT5E 2NW9A 3EAMA 4P1NA 5HWXA 5ETWA 4JYAT 1HR0T 5FXXA 1VRBA 4NXNT 2W62A 4YSXA 2XHEB 4X64T 5EK4A 1WR6A 3G06A 4HFBA 5KXJA 3KV5A 1SA0E 1WFDA 2XAJB 3Q2MA 3ETUA 3F2EA 3QK6A 4EOZB 3NWIA 1W09A 2XSBA 3P7IA 4HWDA 3PUGA 1SE7A 4PW8A 4UELA 5EK3A 3RRCA 3IA3A 2ODUA 4EGWA 4DR2T 4Q25A 4UF0B 1LVKA 1Y64B 3J7Yq 2KWIB 2LOPA 2VKOA 1U5PA 1Z8UA 3A5XA 3I0QA 3AEAA 2ZMAA 2XQ3A 1XMQT 3WI3A 2KWHA 3PUZF 5C8YE 4OYKA 2ZLYA 5H6QB 3RLFF 1J1JA 5AQPB 4LF8T 4Z8XA 3D0TA 4DUZT 4KX6A 1N34T 5HXSA 3OYXA 4P09A 2KLQA 2IUBA 3FZLB 4DNDA 2W66A 3HKBE 2JQHA 4KUMB 3NBXX 5HYAA 4IGUA 5DQWA 2VL8A 4PJNA 5IUXA 4UVBB 4KI0F 2VL0A 4PK5A 4N78D 1V9DA 3I9WA 4HFCA 5AQIB 2UXNB 3KVAA 3WAKA 5CA0E 1IBMT 2Y48B 1T8BA 2N2NA 3MXZA 2UUBT 3N9NA 4COFA 4B3RT 1MIVA 2KXPB 4GK5E 2PTFA 3FZFB 3HKDE 2K48A 5IHYA 3UUMA 3JAFA 4KP3C 2V6XA 2CM0A 5HEGA 4UR9A 4AIUA 5HXEA 5JDLA 5T1DA 4X65T 4LF7T 1ZKEA 1IAPA 1KK7A 2JMHA 2RPAA 2V6YB 3C50A 3QB5K 4EAHA 4WBOA 2DI4A 4ZI3C 2XTLA 5HEUA 3ZYKA 2BDEA 2BBJA 3FB2A 2DHRA 3HL6A 3VR9A 3VU7H 2ZM2A 4JI5T 3ZCJA 2B1EA 4ILCA 2X0HA 1UUSA 3RIAA 5M4YA 4A98A 4CQIA 4ZS2A 3OKQA 3DTOA 1VCSA 4CN4A 2MBGA 2WZIA 3VKHA 2CBIA 2Q9QB 4MBQA 4UF0A 2OV9A 3AEEA 2CWOA 5LB7B 4ZEYA 2CXDA 4LMJA 4ERRA 5JDNA 2X68A 3PHF1 2L3LA 3RIUC 1MNDA 3PUQA 5AQSB 5AQVB 5FZTA 2XM1A 3C4ZA 3NZQA 4FJOA 5L4EA 2E8IA 2YU2A 3ZEFB 4DR7T 2KGXA 2LQUA 5HXRA 2VKDA 2WSSV 3RQWA 4EIWA 4XAXB 2E2AA 3AAAB 3AVSA 4JI1T 2ZM8A 4IL4A 2HPLA 1R8IA 1D0XA 2CE7A 2HN1A 2WCAA 3MK7C 2VK9A 4GIWA 4ZS3A 5LA6E 3AE9A 2YDSA 4YT0A 5AFUL 4DV3T 4OX9T 3AE3A 3UU8A 2CXFA 3FXDB 4O2BE 4ZXLA 3V5SA 4A5XA 3IBPA 2K5BB 5ABGA 3L09A 2GK9A 1IBKT 3B13A 2Y6XA 2YOEA 2XZEA 4CXYA 1XDOA 2CXLA 5L47A 1WRDA 2JQQA 2Q9QA 3EHZA 3AEBA 4JI3T 5JDQA 4W8PA 1D1AA 3AE7A 3EABA 4HFEA 4ILBA 4HGAA 3KFWX 4KMCA 4PAGA 4NUUA 3N2OA 3VRAA 2BS3A 4WZXA 2W00A 3KV9A 5JRCB 2VVNA 1T72A 2ACZA 4I50E 4JLEA 4DV6T 1G8XA 4V1Av 3LK3B 3P4PA 2IC9A 5FNVE 5JDGA 1FMVA 1OEDE 5LJMA 2J1DG 1WCRA 3HKEE 1D0ZA 4IL9A 3TLSA 1OWAA 2UXCT 4JI6T 3AAIA 5HAXA 4AI6A 1VOMA 2Y8DA 3FZHB 3ONLC 3DYJA 4ZOLE 5CGMA 2WU5A 4YSYA 2XY8B 3AEFA 1IZNB 5HCMA 3X1DA 5JREA 4NXMT 1E7PA 3HI2A 4Z91A 1HX1B 4C90A 3C98B 4XZCA 3BQIA 5AQHB 5FKYA 3RI5A 3CQGB 2XQYA 2IC6A 3OTOT 4UVAB 5FL1A 1E2AA 2JQKA 3JC6D 4DV0T 4U7YA 4JEUB 4U3CA 3NKZA 4QXHB 2DCFA 3AE1A 1UX4A 2V7LA 4IDPA 3SOLA 3ZMVB 4C91A 1MMAA 1JNZA 4P0BA 2K24A 1T98A 3UFEA 3ZC0A 4PJLA 4CI2B 2LRLA 2X9WA 3WURA 2D5UA 3RHWA 4DR5T 3OYZA 4JI4T 2N9DA 4CN1A 2WAUA 2XASB 2XJ7A 3Q5EA 3RYFE 2L8KA 1IJ6A 2VKJA 2FJBA 3N9QA 5AQKB 3ZN0B 4QXBB 4LF5T 2X0LB 5JDFA 1IBLT 3CKDA 4HWHA 1ZP0A 1KEYA 1BR4A 1YKHB 2C5KT 3PJAJ 4U74A 3TLWA 3UUXB 1N36T 2MTCA 3ZMUB 2Z6EA 4HWCA 5FP3A 5CFBA 2M6BA 2PFVA 1MMGA 2A72A 1NENA 4IE4A 1KF6A 2H88A 2WMOA 1FMWA 3FBZA 1SHZC 5LGUB 3O4XE 4DBQA 2C5IT 2XUEA 2RP4A 1HG5A 3MACA 1VCTA 5ABHA 2L10A 4AXPA 3PUXF
chains in the Genus database with same CATH topology
3LK2B 4JEHB 5EK2A 2LJLA 2V1DB 3KV4A 3HKCE 3ZYLA 3H3AA 3KDSE 1E1HB 2Q9QC 2YEVC 3VJZA 3K3NA 5LXTE 3K3OA 2QA7A 3JC6C 1D0YA 4J2CA 4JUYA 4E7SA 4PNIA 3R6NA 2CA5A 3M65A 4MFRA 2SPCA 5JVDE 4H9NC 3N9MA 1QUUA 5L3FB 4YLHA 2NTYA 5A1LA 2DWKA 3C64A 2XAQB 3GWHA 3FBLA 3QC9A 3RYCE 2EHOC 4GOUA 4E7ZA 3ZMZB 3SS1A 3F57A 1LVFA 3NRYA 2LHRA 5L3GB 4IE5A 1BR2A 2K9AA 4U72A 5DABA 3IF8B 3CVRA 4BJNA 2W63A 3CWZB 4UXNB 4KBMB 1O3XA 2MYSA 3PU8A 5FYMA 3RC3A 5J2TE 3C4WA 3AA0B 5IYZE 2DWGA 4O4HE 5L3BB 2EHOA 4ZHQE 3CX6B 4IE6A 1G73A 2LT3A 4QX7B 3ZMSB 2IAKA 4NUVA 4CI3B 1AJ3A 3O1HA 3AA7B 5LG4A 1KNZA 2LSYA 4A56A 3WSCA 3J9X1 5LGNB 3N2GE 3K8PC 4HFVA 4PJMA 4G2AA 4O2AE 5TAOA 3RPUA 4OK0A 5CA1E 3UTKA 3LBXB 5L3EB 5LHGB 4EYYR 4F6RC 1IJ5A 2UXXB 1MIYA 3AA1B 3LFMA 4IIJE 3GN5B 4EZHA 2E9XB 4DO0A 2CMRA 2C0SA 4GYSA 5LGTB 3ANWB 3EVYA 4ADZA 4ASKA 1D1CA 4GYRA 4PK6A 3B57A 4L5GA 2VB6A 4MLKA 3ZJ2A 2YU1A 2VWAA 3C4XA 4B6XA 3AAEB 3L3PA 3M1CA 2LSGA 4H9QC 4ZI2C 1HCIA 4UV8B 1YKEB 2KT9A 4MALA 1H7CA 2NTXA 5JDMA 3DJBA 3E22E 2VASA 4GK0E 3FHNA 4ISSA 2PG8A 3IEEA 3N9PA 4H63V 4YHJA 4DMVA 2D0UA 2CLYB 4EXTA 3N9LA 3PTRB 4WNKA 5CB4E 3CX7B 4H9RC 1MMNA 3H37A 4UEMA 3F31A 2H7OA 3BK9A 2VKHA 3ZYMA 3VKGA 2C5JA 5FY7A 4TN7B 2X9HA 2W0GA 3O1JA 3ZLIA 1ZHCA 3DP7A 3O1IA 3WAJA 3ONXA 2KNDA 1QSDA 2I59A 3RX6A 4IE7A 3MKDA 4PFOA 2M67A 2X9XA 3AVRA 3ETVA 4UVCB 2L9QA 3N2KE 4ILUA 4AQFA 4CXWA 2XAHB 3K3QC 3P8CD 2WM9A 2MTQA 4G63A 3RRWA 3U78A 5LCYA 5LYJE 3CPZA 4M1PA 2IW5B 4ZI3D 4L0RA 2JPFA 2PJQA 2LE8A 3LJCA 2YINA 5JR9B 4ZI2D 3BQKA 3RH3A 2JMKA 4I43B 2X51A 1U4QA 5L2LA 3NZPA 3ZCIA 2V7KA 1HG2A 4O4LE 4QKNA 5EZYE 4P0AA 2D2SA 5LOVE 5DQVA 3V5UA 2YK0A 4UIGA 3IHRA 1MNEA 2QGSA 3RKOA 3ZN1B 2X9YA 3HA4A 2KINB 2N1GA 2ODVA 2NP9A 2NW8A 2G0UA 1D1BA 3CMLA 3W15B 5LP6E 4FI5A 3KV6A 2V7IA 5HXHA 2A3DA 5F3JA 4CZZB 3HR0A 1S35A 2NW7A 5FXVA 2ZM0A 2XAFB 4OYJA 4TV9E 3SWHA 3E0ZA 3BQLA 2X67A 4WW0A 4ECGA 1BR0A 1X79A 3I1AA 5GONE 3CQCB 3NRXA 4H9PC 5JR9A 3KVBA 5J2UE 5FMNA 2X66A 1UCUA 2BZBA 3Q5WA 5L3CB 3AB3B 3R84B 4K0UA 1HF8A 4H9OC 2P9BA 2WMNA 4BA9A 3N5LA 3EDUA 4IE0A 4L9IA 3OJAA 3UUNA 5FY0A 4HTEA 2OA5A 2WWUA 5FY1A 5H6RB 4OFZA 4BGOA 2D0TA 2MOZA 4QHOA 4I4TE 5KX5E 4OHFA 1B7TA 1NAFA 4TX5A 1LKXA 4AKRB 5JQGE 3PU3A 3U3IA 3ZMTB 2HH7A 1CUNA 3MA9A 1ZV4X 1EZ3A 4TZ4C 4YJ2E 2CEAA 1WYBA 3QUJA 4IDZA 3ESLA 4QX8B 1HTJF 5J1GA 3Q5XA 2CCQA 2LOSA 3ANWA 4O8SA 4QWNB 2CWYA 3GN5A 4ZI7E 2H7VC 2E9XD 4EZ4A 1UX5A 4HE8A 4O4IE 2H3RA 3CQXC 4PK4A 2ACXA 3C51A 4BJMA 1MIWA 2V26A 2KZ7B 4EYUA 3TKLB 3GMIA 5LHIB 4TUYE 1ZEEA 2CLYC 4IHJE 2Q9QD 2HPJA 3AA6B 2BVLA 3PUSA 5FXWA 5LBMA 3CX8B 4ONRA 2LEHA 2NOXA 2EHOB 4O4JE 5ADXL 4X1YE 4PJJA 2LSIA 2DNXA 1LRZA 4ISTA 4I55E 3S4UA 3I9YA 4EB6E 3RC8A 5DJQC 3ZPOA 1OXZA 2PBIA 3MJXA 3OBVE 4ANJA 5HXCA 3KBTA 3LK42 1FIOA 2A2FX 1US7B 4YJ3E 4AQFC 1WYCA 2V7MA 3MZKB 1FEWA 4PFPA 2WBLA 4AKLA 5LBQB 1Z0PA 3RYHE 3RYIE 4YFSA 3EDVA 2BVMA 4HKAA 2EHOD 1YD8G 2E9XC 4WBNE 4UV9B 3EUHA 2JJ9A 4DBRA 3O9XA 3PE0A 3AT7A 3UULA 3T8OA 5FXZA 2RA1A 3VHLA 2LSJA 5KDMC 2KMFA 3LG7A 3ZJ1A 3KINB 4DMWA 4H9SE 3SRZA 2LM9A 4DVDA 5L3DB 5LHHB 4AKGA 3N9OA 4HN9A 3E08A 1WLXA 2DLRA 2E9XA 5HWYA 5JDHA 4H63H 2LHNA 2ES0A 5LNKA 3GA8A 1YW0A 3LBXA 5JH7E 1HS7A 1NWMX 4QXCB 4X1IE 5E0OA 3PURA 4BAYB 3I0OA 1HX8A 5LJNA 2JRKA 4CI1B 5BMVE 5JRCA 3Q9DA 3KBUA 4MHCA 3FXEB 5JR9C 4AQGA 5F8PA 4AKHA 4CXXA 4HEAA 4XBFB 2W61A 1S94A 1BR1A 3PDYA 5KMGP 2NWBA 2V7JA 2LSKA 1MMDA 4X1KE 3PF0A 2XAGB 3ZC1A 3PUAA 4TV8E 4X20E 1HFAA 3UT5E 2NW9A 5ETWA 5FXXA 1VRBA 2W62A 2XHEB 5EK4A 1WR6A 3KV5A 1SA0E 2XAJB 4EOZB 3Q2MA 3ETUA 3F2EA 3QK6A 3PHF1 3P7IA 4PW8A 5HWXA 3PUGA 4UELA 5EK3A 3RRCA 2ODUA 4UF0B 1LVKA 1Y64B 3J7Yq 2KWIB 2LOPA 2VKOA 1U5PA 3A5XA 3I0QA 2ZMAA 3WI3A 2KWHA 5C8YE 4OYKA 2ZLYA 5H6QB 4Z8XA 3D0TA 5HXSA 3OYXA 4P09A 2KLQA 4DNDA 3HKBE 4KUMB 3NBXX 5HYAA 4IGUA 5DQWA 2VL8A 4PJNA 4UVBB 4PK5A 4N78D 1V9DA 3I9WA 3WAKA 2UXNB 3KVAA 5CA0E 2Y48B 2N2NA 3MXZA 3N9NA 1MIVA 2KXPB 4GK5E 3HKDE 2K48A 5IHYA 3UUMA 4KP3C 2CM0A 5HXEA 5T1DA 5JDLA 1ZKEA 1IAPA 1KK7A 2JMHA 3C50A 4EAHA 4WBOA 2DI4A 4ZI3C 2XTLA 3ZYKA 2BDEA 3FB2A 2DHRA 3HL6A 3VU7H 2ZM2A 3ZCJA 2B1EA 5M4YA 4CQIA 4ZS2A 3OKQA 3DTOA 2MBGA 3VKHA 2Q9QB 4MBQA 4UF0A 2CWOA 2CXDA 4ERRA 5JDNA 2X68A 2L3LA 1MNDA 3PUQA 3C4ZA 4FJOA 3NZQA 2E8IA 2YU2A 3ZEFB 2LQUA 5HXRA 2VKDA 2WSSV 4EIWA 4XAXB 3AAAB 3AVSA 2ZM8A 2HPLA 2CE7A 1D0XA 3MK7C 4ZS3A 4GIWA 2VK9A 5LA6E 5AFUL 3V5SA 2CXFA 3FXDB 4O2BE 3IBPA 2K5BB 3L09A 2GK9A 3B13A 2Y6XA 4CXYA 2CXLA 1WRDA 2JQQA 2Q9QA 5JDQA 1D1AA 4HGAA 3KFWX 4KMCA 4PAGA 4NUUA 3N2OA 2W00A 3KV9A 5JRCB 4JLEA 4I50E 1G8XA 4V1Av 3LK3B 2IC9A 5FNVE 5JDGA 1FMVA 5LJMA 2J1DG 3HKEE 1D0ZA 1OWAA 3AAIA 5HAXA 4AI6A 1VOMA 2Y8DA 4ZOLE 5JREA 1IZNB 3HI2A 4C90A 3C98B 4XZCA 3BQIA 4AKIA 2XQYA 2IC6A 4UVAB 3JC6D 4JEUB 4QXHB 2DCFA 1UX4A 2V7LA 3SOLA 3ZMVB 4C91A 1MMAA 4P0BA 2K24A 1T98A 3UFEA 3ZC0A 4PJLA 4CI2B 2X9WA 3WURA 2D5UA 3OYZA 2N9DA 2WAUA 2XASB 3RYFE 2L8KA 1IJ6A 2VKJA 3ZN0B 3N9QA 4QXBB 2X0LB 5JDFA 3CKDA 1BR4A 1YKHB 2C5KT 4U74A 3UUXB 2MTCA 3ZMUB 2Z6EA 5FP3A 2PFVA 1MMGA 2A72A 4IE4A 2WMOA 1FMWA 3FBZA 1SHZC 5LGUB 3O4XE 4DBQA 2C5IT 2XUEA 2RP4A 1HG5A 3MACA 3CQGB 4AXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5HXC A;  5JDL A;  5HXR A;  5JDN A;  5HYA A;  5HXH A;  5JDQ A;  3V5S A;  3V5U A;  5JDG A;  5JDM A;  5HWX A;  5HXS A;  5JDF A;  5JDH A;  5HWY A; 
#chains in the Genus database with same CATH topology
 2WZH A;  5ABF A;  3LK2 B;  4JEH B;  5EK2 A;  2LJL A;  2V1D B;  3KV4 A;  4KHZ F;  3P50 A;  3HKC E;  3A8Y C;  1I6Z A;  2V5C A;  1M7K A;  3ZYL A;  3H3A A;  5L4H A;  3KDS E;  1E1H B;  2Q9Q C;  2YEV C;  3VJZ A;  3K3N A;  1QLB A;  5LXT E;  4LF9 T;  3K3O A;  2XQ6 A;  2QA7 A;  2WDV A;  4JI8 T;  3JC6 C;  2B76 A;  1D0Y A;  4J2C A;  2CHN A;  4JUY A;  4E7S A;  4PNI A;  2E5L T;  1Y01 A;  1KFY A;  3R6N A;  3PV0 F;  2CA5 A;  4DV7 T;  3M65 A;  4MFR A;  2SPC A;  5JVD E;  4H9N C;  4ZI2 C;  5HCJ A;  3N9M A;  1QUU A;  2BG9 E;  4B3S T;  3RIU A;  2R6G F;  3OVU A;  5L3F B;  5AQN B;  4YLH A;  2NTY A;  5A1L A;  2ZM6 T;  2DWK A;  3C64 A;  1SJ7 A;  2XAQ B;  3GWH A;  3FBL A;  3QC9 A;  3RYC E;  4GKK T;  2EHO C;  4GOU A;  4E7Z A;  3ZMZ B;  3SS1 A;  1XNQ T;  3F57 A;  1J5E T;  1LVF A;  3NRY A;  2LHR A;  5L3G B;  1CHU A;  1FJG T;  4IE5 A;  1BR2 A;  2K9A A;  2BKN A;  4U72 A;  2X0C A;  4TWD A;  3AE6 A;  5DAB A;  2KSR A;  1XNR T;  3IF8 B;  3CVR A;  4HFH A;  2W63 A;  3CWZ B;  4UXN B;  4BJN A;  4KBM B;  1O3X A;  1T7S A;  2MYS A;  3PU8 A;  3QOF A;  5FYM A;  3RC3 A;  1UUR A;  5J2T E;  3C4W A;  2UUA T;  3AA0 B;  5IYZ E;  4LF4 T;  2XQ7 A;  2DWG A;  4DID B;  4O4H E;  2BG9 B;  2EHO A;  5L3B B;  3A7M A;  2QVA A;  4ZHQ E;  3CX6 B;  2J4G A;  4IE6 A;  1G73 A;  2LT3 A;  3SFE A;  1UK5 A;  4QX7 B;  2V5D A;  2XQA A;  2IDO B;  3L39 A;  3ZMS B;  2IAK A;  4NUV A;  4CI3 B;  4GKJ T;  3O1H A;  3AA7 B;  5LG4 A;  1KNZ A;  1AJ3 A;  2LSY A;  4A56 A;  3WSC A;  3J9X 1;  5LGN B;  3N2G E;  4A97 A;  2VUR A;  3K8P C;  4HFV A;  4PJM A;  4G2A A;  4O2A E;  5TAO A;  2YDR A;  3RPU A;  4OK0 A;  5CA1 E;  3UTK A;  3LBX B;  5IWA T;  5L3E B;  1HNZ T;  5LHG B;  4AKI A;  4EYY R;  4F6R C;  1IJ5 A;  2UXX B;  1MIY A;  5AQU B;  3AA1 B;  3LFM A;  2YN6 A;  4IIJ E;  3GN5 B;  3LSV A;  4IDQ A;  4EZH A;  2E9X B;  4DR6 T;  4U31 A;  2LRK A;  2WDR A;  2CMR A;  2C0S A;  4GYS A;  4DO0 A;  1KNR A;  2FJE A;  4KHP T;  3FYQ A;  5LGT B;  1X9B A;  3ANW B;  3B5M A;  3EVY A;  3VR8 A;  4ADZ A;  1D1C A;  4ASK A;  4YHH T;  1JNR A;  4GYR A;  4PK6 A;  3B57 A;  4L5G A;  2VB6 A;  4MLK A;  2WP9 A;  3ZJ2 A;  5JTG A;  2YU1 A;  5AQR B;  4ZZB A;  2CHO A;  2VWA A;  2JIW A;  3C4X A;  4TWH A;  5FVL A;  4B6X A;  2XSA A;  3AAE B;  3L3P A;  1XMO T;  3M1C A;  2LSG A;  2XQ4 A;  4H9Q C;  3RIF A;  3TLT A;  1HCI A;  2LM2 A;  4IRE A;  1W0A A;  1YKE B;  2KT9 A;  4MAL A;  1H7C A;  4UV8 B;  2NTX A;  4X62 T;  5JDM A;  4F7G B;  3DJB A;  2WB5 A;  3E22 E;  2VAS A;  4DV2 T;  4GK0 E;  3FHN A;  4ISS A;  1L0V A;  3PUW F;  2PG8 A;  2IIU A;  3IEE A;  3N9P A;  5AQJ B;  5LMN T;  4H63 V;  2DL1 A;  3AE5 A;  4YHJ A;  3ZST A;  2D0U A;  2CLY B;  4DMV A;  4EXT A;  4LF6 T;  4LFA T;  3N9L A;  3PTR B;  4WNK A;  5CB4 E;  3AE4 A;  3CX7 B;  4H9R C;  1MMN A;  4LML A;  4U7I A;  3H37 A;  4UEM A;  3UQ7 A;  4X5T A;  3UFG A;  2H7O A;  2VKH A;  2W4X A;  3BK9 A;  3F31 A;  3QNU A;  4QH5 A;  3TLU A;  3ZYM A;  3VKG A;  2C5J A;  5FY7 A;  4TN7 B;  3UU6 A;  2X9H A;  2W0G A;  2XQ8 A;  2BG9 C;  3O1J A;  4HWI B;  4QH4 A;  1OED B;  3ZLI A;  1ZHC A;  3DP7 A;  1W0B A;  3O1I A;  4TNW A;  3WAJ A;  3ONX A;  1NEK A;  2KND A;  1QSD A;  1YXR A;  2I59 A;  3RX6 A;  4IT4 A;  2W2U A;  5ABF B;  1KNP A;  3MKD A;  4IE7 A;  2M67 A;  4PFO A;  2IHR 1;  2X9X A;  3AVR A;  3ETV A;  4UVC B;  1HNX T;  2L9Q A;  4B3T T;  3N2K E;  4ILU A;  4AQF A;  4CXW A;  5C2T A;  4K0K T;  2XAH B;  3K3Q C;  3P8C D;  2WM9 A;  2MTQ A;  4G63 A;  3RRW A;  3TLV A;  5LCY A;  3U78 A;  5LYJ E;  1M62 A;  3CPZ A;  4M1P A;  5AQO B;  3AEC A;  2WQY A;  2XQ5 A;  2IW5 B;  2V8S V;  3UUB A;  2BBH A;  3AXJ B;  4ZI3 D;  5C3J A;  4L0R A;  2JPF A;  3H3M A;  2PJQ A;  2H89 A;  5CJ5 A;  2LE8 A;  3LJC A;  2YIN A;  4U33 A;  3ZKR A;  4ZI2 D;  5JR9 B;  3BQK A;  5HEH A;  3RH3 A;  2JMK A;  4I43 B;  3T1Y T;  2X51 A;  1U4Q A;  5L2L A;  3NZP A;  3ZCI A;  2V7K A;  1HG2 A;  2FJA A;  4O4L E;  4LFB T;  4QKN A;  2UUC T;  4DV5 T;  3AE2 A;  5EZY E;  1J5W A;  4P0A A;  4AQY T;  2D2S A;  5LOV E;  5DQV A;  2LKG A;  3RF1 A;  3V5U A;  2CRB A;  3AXJ A;  4DV1 T;  1I94 T;  2YK0 A;  4UIG A;  3IHR A;  1MNE A;  2QGS A;  3RKO A;  3ZN1 B;  2X9Y A;  3ZT6 A;  3HA4 A;  2KIN B;  2N1G A;  2ODV A;  2NP9 A;  5AQF B;  3ZT7 A;  2IML A;  2MAW A;  2NW8 A;  2QRX A;  2G0U A;  1D1B A;  2FJD A;  3EI0 A;  4YXD A;  3CML A;  3W15 B;  2WS3 A;  2OLT A;  5LP6 E;  4FI5 A;  3KV6 A;  4HFD A;  2V7I A;  2WWV A;  4HWF A;  5HXH A;  1W9R A;  2A3D A;  5F3J A;  4CZZ B;  3HR0 A;  1S35 A;  2NW7 A;  4AIS A;  1N32 T;  5FXV A;  2ZM0 A;  1OED A;  1HNW T;  2XAF B;  4OYJ A;  4TV9 E;  3SWH A;  3E0Z A;  3BQL A;  4DR4 T;  2X67 A;  4WW0 A;  2M6I A;  4ECG A;  2FUP A;  3JAE A;  3RGL A;  1BR0 A;  1X79 A;  3I1A A;  5GON E;  3CQC B;  3NRX A;  4H9P C;  5JR9 A;  3KVB A;  5J2U E;  5FVK A;  4LMK A;  5FMN A;  2X66 A;  1UCU A;  2BZB A;  3Q5W A;  3OPC A;  2LKH A;  2YDQ A;  3AB3 B;  1YQ3 A;  1HF8 A;  4K0U A;  3R84 B;  5L3C B;  4H9O C;  2MPK A;  2P9B A;  2WMN A;  3N5L A;  4BA9 A;  3EDU A;  5FL0 A;  4IE0 A;  4L9I A;  3PUY F;  3OJA A;  2BKP A;  2WDQ A;  3UUN A;  2CBJ A;  5FY0 A;  4HTE A;  4U2Z A;  2OA5 A;  4TNV A;  2WWU A;  5FY1 A;  5H6R B;  4OFZ A;  4BGO A;  2D0T A;  2WU2 A;  2MOZ A;  4JI2 T;  2L7N A;  1UGO A;  4QHO A;  4YSZ A;  4I4T E;  3QB5 A;  4OHF A;  5KX5 E;  3PJA A;  4YTN A;  1B7T A;  1NAF A;  4TX5 A;  1LKX A;  4AKR B;  5AQQ B;  3PU3 A;  3U3I A;  5JQG E;  3ZMT B;  2HH7 A;  1CUN A;  3MA9 A;  1ZV4 X;  1EZ3 A;  3P4W A;  2CPT A;  2I6H A;  3RQU A;  4TZ4 C;  4YJ2 E;  2CEA A;  3JAD A;  4B3M T;  2XM2 A;  3ZSS A;  1WYB A;  3T1H T;  3QUJ A;  4IDZ A;  3ESL A;  4QX8 B;  3UU3 A;  1HTJ F;  5J1G A;  3Q5X A;  2CCQ A;  4LFC T;  2LOS A;  3ANW A;  5LG3 A;  2AXD S;  4O8S A;  4QWN B;  2CWY A;  4YTP A;  3ONJ A;  1N33 T;  3GN5 A;  2XPK A;  2H7V C;  2E9X D;  3JCF A;  4ZI7 E;  4EZ4 A;  2F4V T;  1UX5 A;  2D9D A;  4HE8 A;  3FZK B;  4O4I E;  2H3R A;  3CQX C;  4PK4 A;  1SJ8 A;  2ACX A;  1ZOY A;  2XQ9 A;  3C51 A;  2VQF T;  4BJM A;  1MIW A;  2V26 A;  2BG9 A;  2KZ7 B;  3AED A;  4IDO A;  4EYU A;  3TKL B;  2YKS A;  3GMI A;  3RKG A;  2UU9 T;  5HEO A;  4NIQ A;  4TUY E;  5LHI B;  2FBW A;  1YQ4 A;  2BKO A;  3ABV A;  5LMU T;  1ZEE A;  2CLY C;  4DR1 T;  4IHJ E;  2Q9Q D;  3CK6 A;  2HPJ A;  3AA6 B;  2BVL A;  3PUS A;  4QH1 A;  5FXW A;  5LBM A;  4EEB A;  4X66 T;  3CX8 B;  4CN6 A;  4ONR A;  2LEH A;  2NOX A;  2EHO B;  4O4J E;  5ADX L;  4X1Y E;  4PJJ A;  2LSI A;  5F5W A;  2BS4 A;  2DNX A;  2VQE T;  5AQL B;  1LRZ A;  4IST A;  4I55 E;  2WY2 A;  3P4S A;  3S4U A;  2UXD T;  3I9Y A;  4EB6 E;  3RC8 A;  3M3Z B;  4Z90 A;  5DJQ C;  3ZPO A;  1OXZ A;  2PBI A;  3ZT5 A;  3LDQ B;  3P4Q A;  3MJX A;  3OBV E;  1XWM A;  4ANJ A;  5HXC A;  4EED A;  3KBT A;  3LK4 2;  1FIO A;  2A2F X;  1US7 B;  2NR4 A;  4YJ3 E;  4AQF C;  2QYW A;  1WYC A;  2V7M A;  5AQG B;  3MZK B;  1FEW A;  4PFP A;  2WBL A;  3Q5D A;  4I0U A;  4AKL A;  4F8H A;  5LBQ B;  1Z0P A;  3RYH E;  3RYI E;  4DUY T;  3VRB A;  2VVS A;  4YFS A;  3EDV A;  1DU2 A;  3AY5 A;  3UU4 A;  2BVM A;  2K3W A;  4HKA A;  5BR8 T;  4WYV A;  2EHO D;  1YD8 G;  2E9X C;  4JV5 T;  4WBN E;  2JQ9 A;  2J47 A;  4UV9 B;  4YY3 T;  4JI7 T;  3EUH A;  5AQM B;  2JJ9 A;  4DBR A;  2I0M A;  4IDN A;  3O9X A;  3PE0 A;  3AT7 A;  4NPP A;  2E5V A;  3T8O A;  5FXZ A;  3UUL A;  2UXB T;  2KVP A;  4DR3 T;  2RA1 A;  3VHL A;  2LSJ A;  5KDM C;  2KMF A;  3LG7 A;  3ZJ1 A;  2AE9 A;  3KIN B;  3UU5 A;  1OED C;  3PUV F;  4H9S E;  4TWF A;  3SRZ A;  4DMW A;  4HFI A;  2LM9 A;  4DVD A;  2BS2 A;  5HEJ A;  5L3D B;  5LHH B;  3SFD A;  5J0Z A;  4ZZC A;  4JI0 T;  4AKG A;  5AQT B;  3N9O A;  4HN9 A;  3UQ4 A;  1GQE A;  4DV4 T;  3E08 A;  2KBB A;  1WLX A;  2DLR A;  2E9X A;  2A9U A;  2J62 A;  5HWY A;  4H63 H;  5JDH A;  1SUM B;  2W67 A;  2LHN A;  2ES0 A;  3P4R A;  5LNK A;  2HN2 A;  3GA8 A;  1YW0 A;  3LBX A;  4EV6 A;  5JH7 E;  1HS7 A;  1NWM X;  4ILA A;  4QXC B;  4X1I E;  5E0O A;  3AEG A;  3PUR A;  4BAY B;  3I0O A;  5ABE A;  1HX8 A;  5LJN A;  2JRK A;  2HHH T;  1WR0 A;  4CI1 B;  5BMV E;  4JBW F;  2X0Y A;  5JRC A;  3Q9D A;  3KBU A;  3L8R A;  4MHC A;  3FXE B;  5JR9 C;  4AQG A;  5F8P A;  4AKH A;  2V6Y A;  4CXX A;  1XDP A;  4HEA A;  4XBF B;  4YTM A;  2W61 A;  2LLY A;  1S94 A;  3K1S A;  1BR1 A;  3CIR A;  3PDY A;  5KMG P;  3AE8 A;  2NWB A;  2V7J A;  2LSK A;  1MMD A;  3NVO A;  4X1K E;  2XAG B;  3PF0 A;  3ZC1 A;  3FZM B;  3PUA A;  4TV8 E;  4X20 E;  1HFA A;  4U2Y A;  1XZY A;  3UT5 E;  2NW9 A;  3EAM A;  4P1N A;  5HWX A;  5ETW A;  4JYA T;  1HR0 T;  5FXX A;  1VRB A;  4NXN T;  2W62 A;  4YSX A;  2XHE B;  4X64 T;  5EK4 A;  1WR6 A;  3G06 A;  4HFB A;  5KXJ A;  3KV5 A;  1SA0 E;  1WFD A;  2XAJ B;  3Q2M A;  3ETU A;  3F2E A;  3QK6 A;  4EOZ B;  3NWI A;  1W09 A;  2XSB A;  3P7I A;  4HWD A;  3PUG A;  1SE7 A;  4PW8 A;  4UEL A;  5EK3 A;  3RRC A;  3IA3 A;  2ODU A;  4EGW A;  4DR2 T;  4Q25 A;  4UF0 B;  1LVK A;  1Y64 B;  3J7Y q;  2KWI B;  2LOP A;  2VKO A;  1U5P A;  1Z8U A;  3A5X A;  3I0Q A;  3AEA A;  2ZMA A;  2XQ3 A;  1XMQ T;  3WI3 A;  2KWH A;  3PUZ F;  5C8Y E;  4OYK A;  2ZLY A;  5H6Q B;  3RLF F;  1J1J A;  5AQP B;  4LF8 T;  4Z8X A;  3D0T A;  4DUZ T;  4KX6 A;  1N34 T;  5HXS A;  3OYX A;  4P09 A;  2KLQ A;  2IUB A;  3FZL B;  4DND A;  2W66 A;  3HKB E;  2JQH A;  4KUM B;  3NBX X;  5HYA A;  4IGU A;  5DQW A;  2VL8 A;  4PJN A;  5IUX A;  4UVB B;  4KI0 F;  2VL0 A;  4PK5 A;  4N78 D;  1V9D A;  3I9W A;  4HFC A;  5AQI B;  2UXN B;  3KVA A;  3WAK A;  5CA0 E;  1IBM T;  2Y48 B;  1T8B A;  2N2N A;  3MXZ A;  2UUB T;  3N9N A;  4COF A;  4B3R T;  1MIV A;  2KXP B;  4GK5 E;  2PTF A;  3FZF B;  3HKD E;  2K48 A;  5IHY A;  3UUM A;  3JAF A;  4KP3 C;  2V6X A;  2CM0 A;  5HEG A;  4UR9 A;  4AIU A;  5HXE A;  5JDL A;  5T1D A;  4X65 T;  4LF7 T;  1ZKE A;  1IAP A;  1KK7 A;  2JMH A;  2RPA A;  2V6Y B;  3C50 A;  3QB5 K;  4EAH A;  4WBO A;  2DI4 A;  4ZI3 C;  2XTL A;  5HEU A;  3ZYK A;  2BDE A;  2BBJ A;  3FB2 A;  2DHR A;  3HL6 A;  3VR9 A;  3VU7 H;  2ZM2 A;  4JI5 T;  3ZCJ A;  2B1E A;  4ILC A;  2X0H A;  1UUS A;  3RIA A;  5M4Y A;  4A98 A;  4CQI A;  4ZS2 A;  3OKQ A;  3DTO A;  1VCS A;  4CN4 A;  2MBG A;  2WZI A;  3VKH A;  2CBI A;  2Q9Q B;  4MBQ A;  4UF0 A;  2OV9 A;  3AEE A;  2CWO A;  5LB7 B;  4ZEY A;  2CXD A;  4LMJ A;  4ERR A;  5JDN A;  2X68 A;  3PHF 1;  2L3L A;  3RIU C;  1MND A;  3PUQ A;  5AQS B;  5AQV B;  5FZT A;  2XM1 A;  3C4Z A;  3NZQ A;  4FJO A;  5L4E A;  2E8I A;  2YU2 A;  3ZEF B;  4DR7 T;  2KGX A;  2LQU A;  5HXR A;  2VKD A;  2WSS V;  3RQW A;  4EIW A;  4XAX B;  2E2A A;  3AAA B;  3AVS A;  4JI1 T;  2ZM8 A;  4IL4 A;  2HPL A;  1R8I A;  1D0X A;  2CE7 A;  2HN1 A;  2WCA A;  3MK7 C;  2VK9 A;  4GIW A;  4ZS3 A;  5LA6 E;  3AE9 A;  2YDS A;  4YT0 A;  5AFU L;  4DV3 T;  4OX9 T;  3AE3 A;  3UU8 A;  2CXF A;  3FXD B;  4O2B E;  4ZXL A;  3V5S A;  4A5X A;  3IBP A;  2K5B B;  5ABG A;  3L09 A;  2GK9 A;  1IBK T;  3B13 A;  2Y6X A;  2YOE A;  2XZE A;  4CXY A;  1XDO A;  2CXL A;  5L47 A;  1WRD A;  2JQQ A;  2Q9Q A;  3EHZ A;  3AEB A;  4JI3 T;  5JDQ A;  4W8P A;  1D1A A;  3AE7 A;  3EAB A;  4HFE A;  4ILB A;  4HGA A;  3KFW X;  4KMC A;  4PAG A;  4NUU A;  3N2O A;  3VRA A;  2BS3 A;  4WZX A;  2W00 A;  3KV9 A;  5JRC B;  2VVN A;  1T72 A;  2ACZ A;  4I50 E;  4JLE A;  4DV6 T;  1G8X A;  4V1A v;  3LK3 B;  3P4P A;  2IC9 A;  5FNV E;  5JDG A;  1FMV A;  1OED E;  5LJM A;  2J1D G;  1WCR A;  3HKE E;  1D0Z A;  4IL9 A;  3TLS A;  1OWA A;  2UXC T;  4JI6 T;  3AAI A;  5HAX A;  4AI6 A;  1VOM A;  2Y8D A;  3FZH B;  3ONL C;  3DYJ A;  4ZOL E;  5CGM A;  2WU5 A;  4YSY A;  2XY8 B;  3AEF A;  1IZN B;  5HCM A;  3X1D A;  5JRE A;  4NXM T;  1E7P A;  3HI2 A;  4Z91 A;  1HX1 B;  4C90 A;  3C98 B;  4XZC A;  3BQI A;  5AQH B;  5FKY A;  3RI5 A;  3CQG B;  2XQY A;  2IC6 A;  3OTO T;  4UVA B;  5FL1 A;  1E2A A;  2JQK A;  3JC6 D;  4DV0 T;  4U7Y A;  4JEU B;  4U3C A;  3NKZ A;  4QXH B;  2DCF A;  3AE1 A;  1UX4 A;  2V7L A;  4IDP A;  3SOL A;  3ZMV B;  4C91 A;  1MMA A;  1JNZ A;  4P0B A;  2K24 A;  1T98 A;  3UFE A;  3ZC0 A;  4PJL A;  4CI2 B;  2LRL A;  2X9W A;  3WUR A;  2D5U A;  3RHW A;  4DR5 T;  3OYZ A;  4JI4 T;  2N9D A;  4CN1 A;  2WAU A;  2XAS B;  2XJ7 A;  3Q5E A;  3RYF E;  2L8K A;  1IJ6 A;  2VKJ A;  2FJB A;  3N9Q A;  5AQK B;  3ZN0 B;  4QXB B;  4LF5 T;  2X0L B;  5JDF A;  1IBL T;  3CKD A;  4HWH A;  1ZP0 A;  1KEY A;  1BR4 A;  1YKH B;  2C5K T;  3PJA J;  4U74 A;  3TLW A;  3UUX B;  1N36 T;  2MTC A;  3ZMU B;  2Z6E A;  4HWC A;  5FP3 A;  5CFB A;  2M6B A;  2PFV A;  1MMG A;  2A72 A;  1NEN A;  4IE4 A;  1KF6 A;  2H88 A;  2WMO A;  1FMW A;  3FBZ A;  1SHZ C;  5LGU B;  3O4X E;  4DBQ A;  2C5I T;  2XUE A;  2RP4 A;  1HG5 A;  3MAC A;  1VCT A;  5ABH A;  2L10 A;  4AXP A;  3PUX F; 
#chains in the Genus database with same CATH homology
 3LK2 B;  4JEH B;  5EK2 A;  2LJL A;  2V1D B;  3KV4 A;  3HKC E;  3ZYL A;  3H3A A;  3KDS E;  1E1H B;  2Q9Q C;  2YEV C;  3VJZ A;  3K3N A;  5LXT E;  3K3O A;  2QA7 A;  3JC6 C;  1D0Y A;  4J2C A;  4JUY A;  4E7S A;  4PNI A;  3R6N A;  2CA5 A;  3M65 A;  4MFR A;  2SPC A;  5JVD E;  4H9N C;  3N9M A;  1QUU A;  5L3F B;  4YLH A;  2NTY A;  5A1L A;  2DWK A;  3C64 A;  2XAQ B;  3GWH A;  3FBL A;  3QC9 A;  3RYC E;  2EHO C;  4GOU A;  4E7Z A;  3ZMZ B;  3SS1 A;  3F57 A;  1LVF A;  3NRY A;  2LHR A;  5L3G B;  4IE5 A;  1BR2 A;  2K9A A;  4U72 A;  5DAB A;  3IF8 B;  3CVR A;  4BJN A;  2W63 A;  3CWZ B;  4UXN B;  4KBM B;  1O3X A;  2MYS A;  3PU8 A;  5FYM A;  3RC3 A;  5J2T E;  3C4W A;  3AA0 B;  5IYZ E;  2DWG A;  4O4H E;  5L3B B;  2EHO A;  4ZHQ E;  3CX6 B;  4IE6 A;  1G73 A;  2LT3 A;  4QX7 B;  3ZMS B;  2IAK A;  4NUV A;  4CI3 B;  1AJ3 A;  3O1H A;  3AA7 B;  5LG4 A;  1KNZ A;  2LSY A;  4A56 A;  3WSC A;  3J9X 1;  5LGN B;  3N2G E;  3K8P C;  4HFV A;  4PJM A;  4G2A A;  4O2A E;  5TAO A;  3RPU A;  4OK0 A;  5CA1 E;  3UTK A;  3LBX B;  5L3E B;  5LHG B;  4EYY R;  4F6R C;  1IJ5 A;  2UXX B;  1MIY A;  3AA1 B;  3LFM A;  4IIJ E;  3GN5 B;  4EZH A;  2E9X B;  4DO0 A;  2CMR A;  2C0S A;  4GYS A;  5LGT B;  3ANW B;  3EVY A;  4ADZ A;  4ASK A;  1D1C A;  4GYR A;  4PK6 A;  3B57 A;  4L5G A;  2VB6 A;  4MLK A;  3ZJ2 A;  2YU1 A;  2VWA A;  3C4X A;  4B6X A;  3AAE B;  3L3P A;  3M1C A;  2LSG A;  4H9Q C;  4ZI2 C;  1HCI A;  4UV8 B;  1YKE B;  2KT9 A;  4MAL A;  1H7C A;  2NTX A;  5JDM A;  3DJB A;  3E22 E;  2VAS A;  4GK0 E;  3FHN A;  4ISS A;  2PG8 A;  3IEE A;  3N9P A;  4H63 V;  4YHJ A;  4DMV A;  2D0U A;  2CLY B;  4EXT A;  3N9L A;  3PTR B;  4WNK A;  5CB4 E;  3CX7 B;  4H9R C;  1MMN A;  3H37 A;  4UEM A;  3F31 A;  2H7O A;  3BK9 A;  2VKH A;  3ZYM A;  3VKG A;  2C5J A;  5FY7 A;  4TN7 B;  2X9H A;  2W0G A;  3O1J A;  3ZLI A;  1ZHC A;  3DP7 A;  3O1I A;  3WAJ A;  3ONX A;  2KND A;  1QSD A;  2I59 A;  3RX6 A;  4IE7 A;  3MKD A;  4PFO A;  2M67 A;  2X9X A;  3AVR A;  3ETV A;  4UVC B;  2L9Q A;  3N2K E;  4ILU A;  4AQF A;  4CXW A;  2XAH B;  3K3Q C;  3P8C D;  2WM9 A;  2MTQ A;  4G63 A;  3RRW A;  3U78 A;  5LCY A;  5LYJ E;  3CPZ A;  4M1P A;  2IW5 B;  4ZI3 D;  4L0R A;  2JPF A;  2PJQ A;  2LE8 A;  3LJC A;  2YIN A;  5JR9 B;  4ZI2 D;  3BQK A;  3RH3 A;  2JMK A;  4I43 B;  2X51 A;  1U4Q A;  5L2L A;  3NZP A;  3ZCI A;  2V7K A;  1HG2 A;  4O4L E;  4QKN A;  5EZY E;  4P0A A;  2D2S A;  5LOV E;  5DQV A;  3V5U A;  2YK0 A;  4UIG A;  3IHR A;  1MNE A;  2QGS A;  3RKO A;  3ZN1 B;  2X9Y A;  3HA4 A;  2KIN B;  2N1G A;  2ODV A;  2NP9 A;  2NW8 A;  2G0U A;  1D1B A;  3CML A;  3W15 B;  5LP6 E;  4FI5 A;  3KV6 A;  2V7I A;  5HXH A;  2A3D A;  5F3J A;  4CZZ B;  3HR0 A;  1S35 A;  2NW7 A;  5FXV A;  2ZM0 A;  2XAF B;  4OYJ A;  4TV9 E;  3SWH A;  3E0Z A;  3BQL A;  2X67 A;  4WW0 A;  4ECG A;  1BR0 A;  1X79 A;  3I1A A;  5GON E;  3CQC B;  3NRX A;  4H9P C;  5JR9 A;  3KVB A;  5J2U E;  5FMN A;  2X66 A;  1UCU A;  2BZB A;  3Q5W A;  5L3C B;  3AB3 B;  3R84 B;  4K0U A;  1HF8 A;  4H9O C;  2P9B A;  2WMN A;  4BA9 A;  3N5L A;  3EDU A;  4IE0 A;  4L9I A;  3OJA A;  3UUN A;  5FY0 A;  4HTE A;  2OA5 A;  2WWU A;  5FY1 A;  5H6R B;  4OFZ A;  4BGO A;  2D0T A;  2MOZ A;  4QHO A;  4I4T E;  5KX5 E;  4OHF A;  1B7T A;  1NAF A;  4TX5 A;  1LKX A;  4AKR B;  5JQG E;  3PU3 A;  3U3I A;  3ZMT B;  2HH7 A;  1CUN A;  3MA9 A;  1ZV4 X;  1EZ3 A;  4TZ4 C;  4YJ2 E;  2CEA A;  1WYB A;  3QUJ A;  4IDZ A;  3ESL A;  4QX8 B;  1HTJ F;  5J1G A;  3Q5X A;  2CCQ A;  2LOS A;  3ANW A;  4O8S A;  4QWN B;  2CWY A;  3GN5 A;  4ZI7 E;  2H7V C;  2E9X D;  4EZ4 A;  1UX5 A;  4HE8 A;  4O4I E;  2H3R A;  3CQX C;  4PK4 A;  2ACX A;  3C51 A;  4BJM A;  1MIW A;  2V26 A;  2KZ7 B;  4EYU A;  3TKL B;  3GMI A;  5LHI B;  4TUY E;  1ZEE A;  2CLY C;  4IHJ E;  2Q9Q D;  2HPJ A;  3AA6 B;  2BVL A;  3PUS A;  5FXW A;  5LBM A;  3CX8 B;  4ONR A;  2LEH A;  2NOX A;  2EHO B;  4O4J E;  5ADX L;  4X1Y E;  4PJJ A;  2LSI A;  2DNX A;  1LRZ A;  4IST A;  4I55 E;  3S4U A;  3I9Y A;  4EB6 E;  3RC8 A;  5DJQ C;  3ZPO A;  1OXZ A;  2PBI A;  3MJX A;  3OBV E;  4ANJ A;  5HXC A;  3KBT A;  3LK4 2;  1FIO A;  2A2F X;  1US7 B;  4YJ3 E;  4AQF C;  1WYC A;  2V7M A;  3MZK B;  1FEW A;  4PFP A;  2WBL A;  4AKL A;  5LBQ B;  1Z0P A;  3RYH E;  3RYI E;  4YFS A;  3EDV A;  2BVM A;  4HKA A;  2EHO D;  1YD8 G;  2E9X C;  4WBN E;  4UV9 B;  3EUH A;  2JJ9 A;  4DBR A;  3O9X A;  3PE0 A;  3AT7 A;  3UUL A;  3T8O A;  5FXZ A;  2RA1 A;  3VHL A;  2LSJ A;  5KDM C;  2KMF A;  3LG7 A;  3ZJ1 A;  3KIN B;  4DMW A;  4H9S E;  3SRZ A;  2LM9 A;  4DVD A;  5L3D B;  5LHH B;  4AKG A;  3N9O A;  4HN9 A;  3E08 A;  1WLX A;  2DLR A;  2E9X A;  5HWY A;  5JDH A;  4H63 H;  2LHN A;  2ES0 A;  5LNK A;  3GA8 A;  1YW0 A;  3LBX A;  5JH7 E;  1HS7 A;  1NWM X;  4QXC B;  4X1I E;  5E0O A;  3PUR A;  4BAY B;  3I0O A;  1HX8 A;  5LJN A;  2JRK A;  4CI1 B;  5BMV E;  5JRC A;  3Q9D A;  3KBU A;  4MHC A;  3FXE B;  5JR9 C;  4AQG A;  5F8P A;  4AKH A;  4CXX A;  4HEA A;  4XBF B;  2W61 A;  1S94 A;  1BR1 A;  3PDY A;  5KMG P;  2NWB A;  2V7J A;  2LSK A;  1MMD A;  4X1K E;  3PF0 A;  2XAG B;  3ZC1 A;  3PUA A;  4TV8 E;  4X20 E;  1HFA A;  3UT5 E;  2NW9 A;  5ETW A;  5FXX A;  1VRB A;  2W62 A;  2XHE B;  5EK4 A;  1WR6 A;  3KV5 A;  1SA0 E;  2XAJ B;  4EOZ B;  3Q2M A;  3ETU A;  3F2E A;  3QK6 A;  3PHF 1;  3P7I A;  4PW8 A;  5HWX A;  3PUG A;  4UEL A;  5EK3 A;  3RRC A;  2ODU A;  4UF0 B;  1LVK A;  1Y64 B;  3J7Y q;  2KWI B;  2LOP A;  2VKO A;  1U5P A;  3A5X A;  3I0Q A;  2ZMA A;  3WI3 A;  2KWH A;  5C8Y E;  4OYK A;  2ZLY A;  5H6Q B;  4Z8X A;  3D0T A;  5HXS A;  3OYX A;  4P09 A;  2KLQ A;  4DND A;  3HKB E;  4KUM B;  3NBX X;  5HYA A;  4IGU A;  5DQW A;  2VL8 A;  4PJN A;  4UVB B;  4PK5 A;  4N78 D;  1V9D A;  3I9W A;  3WAK A;  2UXN B;  3KVA A;  5CA0 E;  2Y48 B;  2N2N A;  3MXZ A;  3N9N A;  1MIV A;  2KXP B;  4GK5 E;  3HKD E;  2K48 A;  5IHY A;  3UUM A;  4KP3 C;  2CM0 A;  5HXE A;  5T1D A;  5JDL A;  1ZKE A;  1IAP A;  1KK7 A;  2JMH A;  3C50 A;  4EAH A;  4WBO A;  2DI4 A;  4ZI3 C;  2XTL A;  3ZYK A;  2BDE A;  3FB2 A;  2DHR A;  3HL6 A;  3VU7 H;  2ZM2 A;  3ZCJ A;  2B1E A;  5M4Y A;  4CQI A;  4ZS2 A;  3OKQ A;  3DTO A;  2MBG A;  3VKH A;  2Q9Q B;  4MBQ A;  4UF0 A;  2CWO A;  2CXD A;  4ERR A;  5JDN A;  2X68 A;  2L3L A;  1MND A;  3PUQ A;  3C4Z A;  4FJO A;  3NZQ A;  2E8I A;  2YU2 A;  3ZEF B;  2LQU A;  5HXR A;  2VKD A;  2WSS V;  4EIW A;  4XAX B;  3AAA B;  3AVS A;  2ZM8 A;  2HPL A;  2CE7 A;  1D0X A;  3MK7 C;  4ZS3 A;  4GIW A;  2VK9 A;  5LA6 E;  5AFU L;  3V5S A;  2CXF A;  3FXD B;  4O2B E;  3IBP A;  2K5B B;  3L09 A;  2GK9 A;  3B13 A;  2Y6X A;  4CXY A;  2CXL A;  1WRD A;  2JQQ A;  2Q9Q A;  5JDQ A;  1D1A A;  4HGA A;  3KFW X;  4KMC A;  4PAG A;  4NUU A;  3N2O A;  2W00 A;  3KV9 A;  5JRC B;  4JLE A;  4I50 E;  1G8X A;  4V1A v;  3LK3 B;  2IC9 A;  5FNV E;  5JDG A;  1FMV A;  5LJM A;  2J1D G;  3HKE E;  1D0Z A;  1OWA A;  3AAI A;  5HAX A;  4AI6 A;  1VOM A;  2Y8D A;  4ZOL E;  5JRE A;  1IZN B;  3HI2 A;  4C90 A;  3C98 B;  4XZC A;  3BQI A;  4AKI A;  2XQY A;  2IC6 A;  4UVA B;  3JC6 D;  4JEU B;  4QXH B;  2DCF A;  1UX4 A;  2V7L A;  3SOL A;  3ZMV B;  4C91 A;  1MMA A;  4P0B A;  2K24 A;  1T98 A;  3UFE A;  3ZC0 A;  4PJL A;  4CI2 B;  2X9W A;  3WUR A;  2D5U A;  3OYZ A;  2N9D A;  2WAU A;  2XAS B;  3RYF E;  2L8K A;  1IJ6 A;  2VKJ A;  3ZN0 B;  3N9Q A;  4QXB B;  2X0L B;  5JDF A;  3CKD A;  1BR4 A;  1YKH B;  2C5K T;  4U74 A;  3UUX B;  2MTC A;  3ZMU B;  2Z6E A;  5FP3 A;  2PFV A;  1MMG A;  2A72 A;  4IE4 A;  2WMO A;  1FMW A;  3FBZ A;  1SHZ C;  5LGU B;  3O4X E;  4DBQ A;  2C5I T;  2XUE A;  2RP4 A;  1HG5 A;  3MAC A;  3CQG B;  4AXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...