3V5UA

Structure of sodium/calcium exchanger from methanocaldococcus jannaschii dsm 2661
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
304
structure length
297
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Structural insight into the ion-exchange mechanism of the sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 130
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3v5uA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 3v5uA02
5HWYA 3V5UA 5HYAA 5JDQA 5HXHA 3V5SA 5JDHA 5JDNA 5HXEA 5HXCA 5HWXA 5JDLA 5HXRA 5JDGA 5JDMA 5HXSA 5JDFA
chains in the Genus database with same CATH superfamily
3RYFE 3OYXA 5AQJB 4H9QC 1DU2A 2CHNA 2BKPA 2JRKA 3AVSA 5AQFB 5KDMC 4EV6A 1BR0A 4PFOA 1KK7A 4XBFB 3BQKA 2E9XC 3FHNA 2I59A 4U2ZA 3VHLA 2Q9QA 1YW0A 1SA0E 1ZOYA 2VB6A 5JDFA 3RRCA 3RYHE 2WY2A 3F2EA 3C98B 5FVKA 1CHUA 2LT3A 3PV0F 3LK3B 4EB6E 3S4UA 5FZTA 4TWHA 3ZT7A 4OHFA 1NEKA 1XNRT 2ODUA 5L4HA 4HFBA 3CX7B 1U4QA 3SS1A 3P4QA 4CXXA 5CGMA 4HN9A 3D0TA 4QWNB 4B3RT 2HHHT 5L3EB 1N33T 3R6NA 5FY1A 3R84B 3LBXB 2X51A 1MIYA 2XSBA 4L0RA 2KWIB 2XHEB 2P9BA 2A72A 4JI7T 1KFYA 3V5UA 2J62A 1SJ7A 1HG5A 2XAHB 3FYQA 3AE1A 3MJXA 4QXHB 5BMVE 4JUYA 2HH7A 4X1KE 3JC6C 1LVKA 1UK5A 3P4SA 2VASA 3FZLB 2Q9QC 4JI6T 5ABGA 2XAFB 3E08A 2PTFA 5JREA 4L9IA 2CXFA 4KI0F 3KV5A 2MAWA 2JIWA 3Q2MA 2G0UA 3KV6A 1HFAA 4UIGA 1OWAA 5FXVA 1NENA 2FBWA 3V5SA 3MACA 3AY5A 3PUGA 3JCFA 3ZT6A 1MIWA 3RIFA 2XQ3A 2DWGA 5FVLA 2WZHA 1XDPA 1HG2A 4ERRA 4ZOLE 4GKJT 4PFPA 5CJ5A 3ZSTA 4QH4A 2LM2A 3VR8A 3TLWA 5HXSA 4YT0A 4DR7T 3W15B 4GOUA 2V26A 1IJ6A 1H7CA 3AEAA 3KINB 4U74A 4CN1A 5M4YA 1UGOA 3CX6B 2D0UA 4GK5E 3AEEA 5H6RB 4TV8E 4UEMA 4DR1T 5J0ZA 4I50E 3MXZA 4BGOA 3GN5B 1BR1A 3L39A 4JBWF 2XASB 3OYZA 5LB7B 4ISSA 1FEWA 2W63A 2V5DA 3HL6A 1OEDE 1NAFA 3IEEA 2V5CA 3AE9A 4XAXB 5FL0A 3UU4A 3LK42 2SPCA 3PE0A 3QOFA 4DV4T 4GK0E 4JI0T 5J2UE 4B3TT 2BKNA 3M3ZB 3BQIA 4N78D 2KXPB 4AISA 4LFCT 3LG7A 4DV6T 5C8YE 1N36T 4UELA 1G8XA 5AQLB 3CVRA 3NZPA 3UU5A 2CLYC 3ZEFB 2ODVA 5JRCB 5ABHA 3UQ7A 1KNRA 1LRZA 4NUVA 4H9OC 3EABA 1Y64B 4ZI3C 5HEHA 4JV5T 4CXYA 2MBGA 4TUYE 3FZHB 3ZN1B 1JNRA 5KX5E 4KUMB 4TX5A 4Z91A 2PG8A 3PUXF 3ZN0B 4TN7B 5LJNA 1WR0A 3JAEA 4K0KT 3P4PA 3LBXA 1X9BA 3UUMA 2QYWA 4KHPT 3I0OA 1XZYA 4ADZA 4F7GB 2HN1A 3RQUA 5CA1E 3CQGB 2X9HA 1ZEEA 1WR6A 3HI2A 3PUVF 5KXJA 2E5LT 4LMKA 4YFSA 4DV7T 2VL8A 3F57A 4MFRA 4MLKA 3HR0A 1JNZA 4EYUA 4HE8A 4CI2B 2WWVA 4HTEA 2V8SV 2W00A 4X64T 2JQQA 4PK6A 3FXDB 4PJLA 2H88A 3ZT5A 2V7LA 2X68A 3OKQA 4NXMT 3VR9A 4X66T 4X62T 2VKJA 4W8PA 3KV4A 1HNZT 4QH1A 1E2AA 2X9YA 5HAXA 4IDOA 1D1BA 4YHHT 5IWAT 1IZNB 2FJDA 1VOMA 2VK9A 4UVCB 3OTOT 3J9X1 3QUJA 2V6YA 4IHJE 3N2GE 1I6ZA 3UFEA 3QNUA 3QK6A 3KBUA 2MTQA 3LSVA 4IIJE 2CEAA 4A5XA 2C0SA 1U5PA 3RC8A 1MNEA 4HGAA 4IE0A 3PF0A 3JADA 2JMHA 4NIQA 3MK7C 1W0AA 1HF8A 1UX5A 4LMJA 2V1DB 3VJZA 2PJQA 5EK2A 3ZYMA 3UU8A 5HEUA 5AQGB 4UV9B 3VU7H 2LEHA 4YY3T 2JQ9A 2JQHA 3GN5A 4JI8T 1IBKT 3ZPOA 2D9DA 4P09A 2XAGB 3BK9A 2FUPA 2V6XA 1WYCA 4HFIA 1D0YA 5FMNA 2H3RA 2CWOA 3GWHA 1XWMA 4IE4A 3ABVA 4AXPA 3GMIA 3WURA 2CXLA 4E7SA 4H63H 3SRZA 1T98A 1N32T 4IDQA 2LSKA 3J7Yq 1MMDA 4QXBB 4EOZB 4DVDA 5EK4A 2KGXA 4WNKA 4X1YE 4J2CA 3N9NA 1WCRA 3UUNA 5AQHB 4ZZBA 5T1DA 2ACXA 2CM0A 1SUMB 3O4XE 2EHOB 2VURA 3LJCA 3HA4A 4JEUB 5JRCA 5DQVA 4FJOA 4WZXA 3ETVA 2D0TA 4CN6A 1MMGA 4X5TA 5IUXA 3AEDA 4JI3T 2E9XD 3C51A 3RF1A 5JDNA 3NRYA 3ZCJA 2L10A 5J2TE 3RYIE 3K8PC 2XM1A 3H3AA 1J5ET 1FJGT 3E22E 5F8PA 5HWXA 2BBHA 3AEFA 2W2UA 4GYSA 2VKHA 3H3MA 3LK2B 4O4HE 4I43B 4B6XA 3WI3A 2X9WA 4DUZT 3OPCA 2XQ7A 2LKGA 4H9SE 4DR4T 1VCTA 2YINA 4QXCB 3KFWX 2QGSA 2B76A 3SFEA 4ONRA 2XQ6A 2N2NA 3NKZA 3ZYKA 3PUAA 4OYJA 4Q25A 3RX6A 2PFVA 3NWIA 3ZLIA 2LHRA 2YDQA 4X20E 5AFUL 3NRXA 2NTYA 2ES0A 3FXEB 2M67A 4HWDA 3O1IA 1SE7A 2V7MA 5CFBA 2W66A 4YXDA 2WDQA 4HFCA 3ZMTB 5LP6E 3Q5DA 1YQ3A 2KMFA 1UCUA 5JQGE 3TLUA 1J5WA 5AQQB 1HTJF 3Q9DA 4YLHA 3PUQA 2R6GF 4ZS2A 3AAIA 4AQYT 2X67A 2XSAA 2XQAA 3JC6D 4IL4A 4QX7B 4OX9T 1XMOT 3AE5A 2LSGA 5EK3A 4LF6T 2Q9QD 2CA5A 4F6RC 3K3NA 5CB4E 1XDOA 2N1GA 2UUBT 3ZMVB 2OA5A 3FBZA 3RKOA 1Z8UA 3ZYLA 5FXXA 2KT9A 1T72A 2WP9A 3AA6B 4HFVA 2YK0A 2IIUA 3U3IA 2HN2A 2XPKA 2QRXA 4HEAA 5FL1A 2ZLYA 3UUBA 1O3XA 5JVDE 1LKXA 2BKOA 2HPJA 4BJNA 1IAPA 4U7IA 1AJ3A 4GIWA 2M6IA 4EZ4A 1WLXA 2QVAA 2X0HA 1D1CA 1ZHCA 2RA1A 4HWHA 4BJMA 2ACZA 5HEOA 5AQUB 4U33A 4E7ZA 3PUYF 4PK4A 2V6YB 2YKSA 5L3CB 2IC6A 3DTOA 5AQKB 3CWZB 3UULA 2KNDA 2X9XA 4NUUA 3Q5EA 4H9PC 3CQXC 1KF6A 4DV3T 3HKBE 3ZMZB 4DR5T 4U31A 5LGTB 2BG9B 1M62A 5FXWA 4IL9A 3CK6A 2I0MA 4UV8B 2JJ9A 1NWMX 1ZKEA 2YU1A 4ASKA 1IBMT 2C5IT 4IE6A 4DIDB 3EVYA 2IC9A 2EHOA 3UT5E 3Q5WA 5LYJE 2WAUA 5JR9A 2LOSA 4HWCA 4O4LE 3SOLA 4IDZA 4V1Av 5LOVE 3UQ4A 3ZJ1A 4JLEA 3PDYA 3AA1B 2BVLA 2WDRA 1E7PA 4K0UA 3ONLC 3AE8A 4IDNA 3OVUA 4UXNB 3AE7A 4U3CA 3N2KE 3ZC1A 3N5LA 5LHGB 4UF0B 4ZI3D 5ADXL 2CWYA 1G73A 2WU2A 2D2SA 4X65T 1FIOA 3ZSSA 4CZZB 1SHZC 2WDVA 4WBOA 3TLVA 5LG3A 3OBVE 2I6HA 3FZMB 4MHCA 1IBLT 2UXCT 3RIUA 3MKDA 5LCYA 1D1AA 2UUAT 3RQWA 4EZHA 4OFZA 3RC3A 1D0XA 3ESLA 3IHRA 3AE2A 2EHOC 3PU8A 3PHF1 2M6BA 4CQIA 2FJBA 3RH3A 2CXDA 3PUWF 4JEHB 3PJAA 4DR6T 3P4RA 2DWKA 5JR9C 3ONJA 4L5GA 4DUYT 1KNPA 4PNIA 1KEYA 3ZCIA 3AECA 4DR2T 5LMUT 2UXNB 3WSCA 3AXJB 3K1SA 4U2YA 2PBIA 4YJ2E 4B3ST 1IJ5A 2NW8A 5AQRB 4YTNA 2WSSV 1HCIA 2XTLA 4AKRB 2H89A 5LA6E 3ZMSB 2DHRA 2AXDS 3N9OA 4EEBA 3AA0B 5FYMA 3T1HT 1V9DA 4TWFA 1L0VA 1MIVA 4H9NC 2C5KT 4DBRA 3CKDA 4PK5A 2UU9T 2CRBA 4ZI2C 5AQSB 1LVFA 3WAJA 2ZM0A 3RIUC 4A98A 3EI0A 4LFAT 2KWHA 4EEDA 3TKLB 4P0BA 2V7JA 2WQYA 4UVAB 5FY0A 1HNWT 2CBJA 2H7OA 2N9DA 4ILBA 4LF9T 5HCMA 2CBIA 2XY8B 2K48A 1XMQT 2X66A 3RRWA 1Y01A 4KHZF 5AQIB 4PJNA 3CMLA 5AQPB 3K3OA 5A1LA 5LNKA 4UVBB 4DBQA 2BS3A 2VQET 3L09A 5HXEA 4C90A 2DI4A 5ABFB 4EIWA 2BG9A 2KBBA 1OEDB 3C64A 2LSYA 2YEVC 2W62A 3KDSE 2ZM2A 4NPPA 3KVBA 2Y48B 4NXNT 3VKGA 5FNVE 4Z90A 2J47A 5JDLA 3ZKRA 3EDVA 1BR2A 3CPZA 3KBTA 5CA0E 4HFEA 2IW5B 2CMRA 1QUUA 4DO0A 3B13A 4DV2T 3AVRA 3AT7A 2CHOA 2CE7A 2LOPA 3I9YA 5L3FB 4AKIA 3HKEE 2XZEA 4PAGA 2QA7A 3PTRB 4MBQA 1HNXT 3CQCB 3NVOA 4I4TE 4I0UA 2IHR1 4EXTA 5LGUB 3F31A 2XQ4A 4AKGA 2LSJA 1J1JA 4LF4T 4KX6A 4UF0A 5BR8T 5JR9B 2BG9C 4O2BE 4BAYB 2A2FX 1HR0T 2LE8A 3NBXX 2K24A 2JMKA 4YSYA 4PJMA 5L3GB 2VL0A 3T1YT 1QLBA 1YD8G 1UX4A 3C4XA 3FB2A 2JPFA 3NZQA 5ETWA 4H63V 3I9WA 4IREA 5AQVB 5LHHB 4IT4A 4CI1B 3MA9A 3PURA 2KLQA 2IDOB 3QB5A 4YSXA 2WCAA 4DV5T 1MMAA 2BS2A 4AKHA 5HXRA 4TNVA 1VRBA 4HFHA 3UUXB 3VRBA 2RPAA 2JQKA 2WWUA 4B3MT 1WRDA 4JI5T 3AXJA 5LBQB 1CUNA 2XQ9A 4XZCA 4ZZCA 3E0ZA 2LQUA 5LMNT 4DV0T 2NTXA 3UU3A 3BQLA 3C4WA 4HWIB 1MNDA 2XQ5A 4LF5T 3EDUA 4MALA 1OXZA 4AQFA 3O1HA 2W61A 1YXRA 2XUEA 1W9RA 2YOEA 4WYVA 3N9MA 3IF8B 2BVMA 1XNQT 2OV9A 3JAFA 2AE9A 4HKAA 2IMLA 5HCJA 2LHNA 4YTPA 4BA9A 5L4EA 5LBMA 3P4WA 2WMNA 5FXZA 4ZEYA 4O4JE 4YSZA 2K5BB 1N34T 2D5UA 2WMOA 2VQFT 4ZXLA 1W09A 1W0BA 2ZM8A 1US7B 2B1EA 2WU5A 3T8OA 2K9AA 4TZ4C 3IA3A 2XQYA 2WS3A 3FBLA 4AQGA 4U72A 1MMNA 2XM2A 2L9QA 2XAQB 3ZMUB 3ANWB 4OYKA 2X0YA 4TV9E 3K3QC 1UUSA 2W67A 2DCFA 2V7KA 2NP9A 2XJ7A 4A97A 4LF7T 2MYSA 1T7SA 5ABFA 3P7IA 1WFDA 5HXCA 2KSRA 4O8SA 4YHJA 4WBNE 2C5JA 4AQFC 3N9LA 4IGUA 5FKYA 1YQ4A 3G06A 1KNZA 2UXBT 5L47A 1OEDA 2A9UA 2NOXA 2ZMAA 2Y8DA 5F3JA 3PJAJ 5JDHA 4GYRA 4PJJA 4DNDA 2XAJB 1I94T 2ZM6T 2XQ8A 2NWBA 3N2OA 4G2AA 5L3DB 1WYBA 4QX8B 3ZC0A 5IYZE 2YDSA 2BBJA 5AQOB 3A5XA 5LXTE 5E0OA 3AAEB 5DQWA 4ISTA 3FZFB 3TLSA 3RGLA 2OLTA 2WBLA 5L2LA 4DMWA 4AKLA 2LM9A 3SWHA 4KBMB 2W0GA 4O4IE 2J4GA 5LGNB 3M1CA 4F8HA 2LRKA 3PUZF 3QC9A 5H6QB 5KMGP 4QHOA 2UUCT 2E9XB 4COFA 1D0ZA 2BDEA 1YKHB 5HEGA 1OEDC 5F5WA 3HKCE 3DP7A 2DNXA 3X1DA 4OK0A 2KZ7B 4JI2T 4CI3B 2WM9A 3IBPA 2HPLA 1X79A 4HFDA 2LKHA 2UXXB 4P0AA 2Y6XA 3ONXA 3UFGA 4LF8T 4YJ3E 3O1JA 3ETUA 4ILUA 5JTGA 4X1IE 5DJQC 1ZV4X 4I55E 2VKOA 4EGWA 4ECGA 4ZI7E 2LRLA 4P1NA 1EZ3A 3LFMA 5L3BB 2MOZA 5TAOA 1UURA 4G63A 4JI4T 2X0LB 4ILCA 2E2AA 5JDGA 2EHOD 3WAKA 3EAMA 4IDPA 3RLFF 4CXWA 2Z6EA 2VWAA 2KVPA 3KVAA 4KP3C 3CIRA 1GQEA 2CCQA 3AE6A 4JYAT 2WB5A 5GONE 3MZKB 2Q9QB 2LSIA 5ABEA 5C3JA 2V7IA 3RKGA 5EZYE 4UR9A 3FZKB 5HXHA 4WW0A 1HX8A 4DV1T 4CN4A 4QH5A 2YU2A 3SFDA 3VKHA 3OJAA 4FI5A 2MPKA 5IHYA 2W4XA 4ANJA 3PU3A 2FJEA 3EHZA 2F4VT 2J1DG 3I1AA 1HX1B 4IE7A 3L3PA 3C4ZA 4ZI2D 4LMLA 3RIAA 5JDQA 2LLYA 4TNWA 3ANWA 4KMCA 3AE4A 3AB3B 2A3DA 3AE3A 4AI6A 2NR4A 4DR3T 4LFBT 2YDRA 1R8IA 3UU6A 1T8BA 5C2TA 4ZHQE 3TLTA 3KV9A 5AQMB 4GKKT 3O9XA 2LJLA 3A7MA 3VRAA 3QB5K 5AQNB 2X0CA 1BR4A 4EAHA 3U78A 2UXDT 2L8KA 2NW7A 2NW9A 2DLRA 4A56A 3N9PA 4H9RC 1Z0PA 5FY7A 3ZJ2A 1B7TA 2CPTA 4ILAA 2BS4A 2VVSA 2IAKA 3UTKA 3RYCE 3H37A 2GK9A 4U7YA 5HYAA 4Z8XA 3PUSA 3RPUA 3AEBA 2VKDA 1VCSA 3M65A 3B57A 2E5VA 2VVNA 3Q5XA 4DMVA 2YN6A 1QSDA 2BZBA 3RI5A 5AQTB 4EYYR 3AA7B 3AEGA 1ZP0A 5LJMA 5HWYA 3C50A 1E1HB 1M7KA 4TWDA 2L3LA 4IE5A 4C91A 2IUBA 2K3WA 3EUHA 2MTCA 2E9XA 3A8YC 5FP3A 3RHWA 4AIUA 1FMWA 1S35A 3L8RA 4O2AE 2CLYB 1SJ8A 3DJBA 2WZIA 2E8IA 2L7NA 4YTMA 4PW8A 3DYJA 3N9QA 5DABA 4M1PA 5JH7E 2DL1A 3P50A 5LG4A 5J1GA 1S94A 3LDQB 3P8CD 3GA8A 3CX8B 1FMVA 2KINB 3I0QA 3HKDE 3B5MA 4HWFA 4QKNA 5HEJA 5JDMA 2FJAA 1YKEB 1HS7A 2RP4A 5LHIB 4ZS3A 4JI1T 2H7VC 3AAAB 2BG9E
chains in the Genus database with same CATH topology
3ZMUB 3ANWB 4OYKA 4TV9E 3K3QC 3RYFE 4UXNB 3OYXA 2DCFA 2V7KA 1VOMA 2NP9A 3N2KE 2VK9A 4UVCB 2MYSA 3ZC1A 3N5LA 4H9QC 3J9X1 5LHGB 3P7IA 3QUJA 4UF0B 4ZI3D 4IHJE 5ADXL 3N2GE 2CWYA 5HXCA 2JRKA 3UFEA 1G73A 3AVSA 3QK6A 4O8SA 5KDMC 4YHJA 3KBUA 4WBNE 2C5JA 2MTQA 2D2SA 4AQFC 3N9LA 4IIJE 4IGUA 1BR0A 2CEAA 1KNZA 4PFOA 1KK7A 4XBFB 1FIOA 2C0SA 3BQKA 4CZZB 1SHZC 1U5PA 2E9XC 4WBOA 3FHNA 2I59A 2NOXA 3RC8A 1MNEA 2ZMAA 4HGAA 4IE0A 3OBVE 3PF0A 2Y8DA 4MHCA 3VHLA 2Q9QA 5F3JA 2XAQB 5JDHA 2JMHA 3MKDA 4GYRA 3MK7C 1D1AA 5LCYA 1HF8A 4PJJA 1YW0A 1SA0E 5JDFA 2VB6A 4DNDA 2XAJB 4EZHA 3RRCA 3RYHE 4OFZA 1UX5A 2NWBA 3RC3A 2V1DB 3N2OA 1D0XA 4G2AA 3ESLA 2PJQA 1WYBA 3IHRA 4QX8B 5L3DB 3VJZA 5EK2A 3ZC0A 3F2EA 5IYZE 3ZYMA 2EHOC 3PU8A 3PHF1 4CQIA 3C98B 3RH3A 2CXDA 2LT3A 3LK3B 4JEHB 4EB6E 3S4UA 2DWKA 3A5XA 4UV9B 5LXTE 3VU7H 5JR9C 4OHFA 2LEHA 5E0OA 2ODUA 3GN5A 4L5GA 3CX7B 4PNIA 3AAEB 1U4QA 3ZCIA 5DQWA 4ISTA 3ZPOA 3SS1A 2UXNB 3WSCA 4CXXA 4P09A 2PBIA 4HN9A 4YJ2E 3D0TA 4QWNB 1IJ5A 2NW8A 2WBLA 2XAGB 3BK9A 5L2LA 5L3EB 4DMWA 1WYCA 2WSSV 3R6NA 5FY1A 4AKLA 1HCIA 2LM9A 2XTLA 1D0YA 5FMNA 2H3RA 3R84B 3SWHA 4AKRB 3LBXB 2CWOA 2X51A 3GWHA 5LA6E 3ZMSB 1MIYA 2DHRA 4KBMB 4L0RA 2KWIB 2XHEB 3N9OA 4IE4A 2P9BA 2A72A 4AXPA 2W0GA 3GMIA 4O4IE 3WURA 2CXLA 4E7SA 5LGNB 3AA0B 4H63H 5FYMA 3M1CA 1V9DA 3SRZA 1T98A 3V5UA 3QC9A 2LSKA 5H6QB 3J7Yq 1MMDA 4QXBB 4EOZB 5KMGP 1MIVA 1HG5A 4QHOA 2XAHB 4H9NC 4DVDA 2E9XB 2C5KT 5EK4A 4DBRA 1D0ZA 2BDEA 3MJXA 3CKDA 4QXHB 5BMVE 4PK5A 4JUYA 4WNKA 1YKHB 2HH7A 4X1YE 4J2CA 3N9NA 4X1KE 3HKCE 3JC6C 4ZI2C 1LVKA 3DP7A 3UUNA 1LVFA 2DNXA 2VASA 2Q9QC 5T1DA 3WAJA 2ZM0A 2ACXA 4OK0A 2XAFB 2KZ7B 3E08A 2KWHA 2CM0A 3TKLB 5JREA 4L9IA 4P0BA 2V7JA 3O4XE 2EHOB 2CXFA 4UVAB 4CI3B 3LJCA 3HA4A 4JEUB 5JRCA 2WM9A 3IBPA 3KV5A 5DQVA 2HPLA 1X79A 5FY0A 4FJOA 2UXXB 3ETVA 2D0TA 3Q2MA 2N9DA 2H7OA 2G0UA 3KV6A 1HFAA 4UIGA 4P0AA 2Y6XA 1OWAA 5FXVA 3ONXA 1MMGA 4YJ3E 3O1JA 3ETUA 4ILUA 2K48A 4X1IE 2X66A 2E9XD 5DJQC 3C51A 3RRWA 1ZV4X 3V5SA 5JDNA 4I55E 3NRYA 3ZCJA 2VKOA 5J2TE 3RYIE 3K8PC 3MACA 4ECGA 4ZI7E 3PUGA 3H3AA 4PJNA 1MIWA 3CMLA 1EZ3A 3E22E 3K3OA 3LFMA 2MOZA 5F8PA 5HWXA 5TAOA 5L3BB 4G63A 5A1LA 5LNKA 2DWGA 2X0LB 4UVBB 4DBQA 4GYSA 2VKHA 1HG2A 4ERRA 4ZOLE 3L09A 3LK2B 4O4HE 4I43B 5HXEA 4PFPA 2EHOD 3WAKA 3WI3A 2X9WA 4B6XA 5JDGA 4C90A 2DI4A 4H9SE 4EIWA 4CXWA 2YINA 2Z6EA 4QXCB 3KFWX 2QGSA 2VWAA 4ONRA 5HXSA 3KVAA 4KP3C 3W15B 2N2NA 4GOUA 2CCQA 3ZYKA 3C64A 2LSYA 3PUAA 2V26A 2YEVC 2W62A 4OYJA 1IJ6A 5GONE 3RX6A 2PFVA 3MZKB 3ZLIA 2Q9QB 3KDSE 2LHRA 4X20E 2LSIA 5AFUL 1H7CA 3KINB 2ZM2A 3NRXA 2NTYA 2V7IA 4U74A 2ES0A 3FXEB 5M4YA 5EZYE 2M67A 3CX6B 3KVBA 2Y48B 3O1IA 2D0UA 2V7MA 5HXHA 3VKGA 4WW0A 1HX8A 3ZMTB 5FNVE 5LP6E 4GK5E 2YU2A 2KMFA 3VKHA 1UCUA 3OJAA 5JQGE 5JDLA 3EDVA 5H6RB 1BR2A 4TV8E 4FI5A 3CPZA 1HTJF 4UEMA 3KBTA 3Q9DA 4YLHA 3PUQA 5IHYA 4I50E 4ZS2A 5CA0E 3MXZA 4ANJA 3AAIA 2IW5B 4BGOA 3GN5B 3PU3A 1BR1A 2J1DG 2CMRA 1QUUA 2XASB 2X67A 3OYZA 3I1AA 4DO0A 3B13A 4IE7A 3L3PA 3JC6D 4QX7B 3C4ZA 4ZI2D 3AVRA 3AT7A 5JDQA 2LOPA 2CE7A 5EK3A 2LSGA 3I9YA 4ISSA 2Q9QD 5L3FB 4AKIA 1FEWA 3HKEE 4PAGA 2W63A 2CA5A 2QA7A 4F6RC 3PTRB 3K3NA 4MBQA 3ANWA 4KMCA 5CB4E 3AB3B 2A3DA 2N1GA 3CQCB 4I4TE 3HL6A 2OA5A 3ZMVB 4EXTA 3F31A 5LGUB 3FBZA 3RKOA 1NAFA 4AI6A 3ZYLA 5FXXA 2KT9A 4AKGA 2LSJA 3IEEA 4UF0A 4ZHQE 3AA6B 3KV9A 3O9XA 4XAXB 3LK42 2LJLA 2SPCA 3PE0A 4HFVA 5JR9B 2YK0A 4O2BE 4BAYB 2A2FX 4GK0E 2LE8A 3NBXX 3U3IA 5J2UE 2K24A 4HEAA 2JMKA 1BR4A 3BQIA 2ZLYA 4N78D 4EAHA 2KXPB 3U78A 4PJMA 5L3GB 3LG7A 1O3XA 5JVDE 1LKXA 2L8KA 2HPJA 4BJNA 1YD8G 2NW7A 5C8YE 1IAPA 2NW9A 1UX4A 3C4XA 3FB2A 4UELA 2JPFA 3NZQA 1AJ3A 2DLRA 4A56A 4GIWA 5ETWA 3N9PA 1G8XA 4H63V 3I9WA 4EZ4A 3CVRA 3NZPA 5LHHB 4H9RC 1WLXA 2CLYC 3ZEFB 2ODVA 3MA9A 1D1CA 3PURA 4CI1B 5JRCB 1Z0PA 1ZHCA 5FY7A 3ZJ2A 1B7TA 2KLQA 2RA1A 4BJMA 1LRZA 4NUVA 4H9OC 1MMAA 4E7ZA 1Y64B 4ZI3C 2IAKA 3UTKA 4AKHA 5HXRA 3RYCE 4PK4A 3H37A 2GK9A 1VRBA 4CXYA 5HYAA 4Z8XA 5L3CB 2IC6A 2MBGA 3PUSA 3DTOA 3UUXB 3CWZB 3RPUA 4TUYE 2WWUA 2VKDA 3ZN1B 3UULA 1WRDA 3M65A 3B57A 5LBQB 1CUNA 5KX5E 3Q5XA 4KUMB 4TX5A 4DMVA 2KNDA 2PG8A 2X9XA 3ZN0B 4NUUA 4TN7B 5LJNA 4XZCA 1QSDA 4H9PC 2BZBA 3E0ZA 2LQUA 3CQXC 4EYYR 2NTXA 3LBXA 3AA7B 3BQLA 3UUMA 3I0OA 3C4WA 3HKBE 3ZMZB 1MNDA 4ADZA 5LJMA 5HWYA 3C50A 1E1HB 5CA1E 3EDUA 4MALA 3CQGB 2X9HA 5LGTB 2L3LA 4IE5A 1OXZA 4AQFA 3O1HA 2W61A 5FXWA 1ZEEA 4C91A 1WR6A 2XUEA 3HI2A 3EUHA 2MTCA 2E9XA 3N9MA 3IF8B 5FP3A 4UV8B 2JJ9A 1NWMX 2BVMA 1ZKEA 2YU1A 4YFSA 4ASKA 1FMWA 1S35A 2C5IT 4HKAA 4IE6A 2VL8A 3F57A 4O2AE 4MFRA 4MLKA 3HR0A 4EYUA 2CLYB 2LHNA 3EVYA 4HE8A 4BA9A 2IC9A 5LBMA 4CI2B 3DJBA 2WMNA 5FXZA 2E8IA 2EHOA 4HTEA 4PW8A 3UT5E 3Q5WA 2W00A 3N9QA 5DABA 2JQQA 4M1PA 5JH7E 5LYJE 4PK6A 3FXDB 4PJLA 2WAUA 4O4JE 5JR9A 2K5BB 2D5UA 2V7LA 2X68A 2WMOA 5LG4A 2LOSA 1S94A 3P8CD 5J1GA 3GA8A 3CX8B 3OKQA 1FMVA 2ZM8A 4O4LE 3SOLA 1US7B 4IDZA 2KINB 2VKJA 2B1EA 4V1Av 3T8OA 3I0QA 5LOVE 2K9AA 3HKDE 3KV4A 4TZ4C 4QKNA 2XQYA 5JDMA 3FBLA 3ZJ1A 4JLEA 2X9YA 1YKEB 4AQGA 5HAXA 3PDYA 3AA1B 1HS7A 2RP4A 4U72A 5LHIB 2BVLA 1MMNA 1D1BA 2L9QA 4ZS3A 4K0UA 2H7VC 3AAAB 1IZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWY A;  3V5U A;  5HYA A;  5JDQ A;  5HXH A;  3V5S A;  5JDH A;  5JDN A;  5HXE A;  5HXC A;  5HWX A;  5JDL A;  5HXR A;  5JDG A;  5JDM A;  5HXS A;  5JDF A; 
#chains in the Genus database with same CATH topology
 3RYF E;  3OYX A;  5AQJ B;  4H9Q C;  1DU2 A;  2CHN A;  2BKP A;  2JRK A;  3AVS A;  5AQF B;  5KDM C;  4EV6 A;  1BR0 A;  4PFO A;  1KK7 A;  4XBF B;  3BQK A;  2E9X C;  3FHN A;  2I59 A;  4U2Z A;  3VHL A;  2Q9Q A;  1YW0 A;  1SA0 E;  1ZOY A;  2VB6 A;  5JDF A;  3RRC A;  3RYH E;  2WY2 A;  3F2E A;  3C98 B;  5FVK A;  1CHU A;  2LT3 A;  3PV0 F;  3LK3 B;  4EB6 E;  3S4U A;  5FZT A;  4TWH A;  3ZT7 A;  4OHF A;  1NEK A;  1XNR T;  2ODU A;  5L4H A;  4HFB A;  3CX7 B;  1U4Q A;  3SS1 A;  3P4Q A;  4CXX A;  5CGM A;  4HN9 A;  3D0T A;  4QWN B;  4B3R T;  2HHH T;  5L3E B;  1N33 T;  3R6N A;  5FY1 A;  3R84 B;  3LBX B;  2X51 A;  1MIY A;  2XSB A;  4L0R A;  2KWI B;  2XHE B;  2P9B A;  2A72 A;  4JI7 T;  1KFY A;  3V5U A;  2J62 A;  1SJ7 A;  1HG5 A;  2XAH B;  3FYQ A;  3AE1 A;  3MJX A;  4QXH B;  5BMV E;  4JUY A;  2HH7 A;  4X1K E;  3JC6 C;  1LVK A;  1UK5 A;  3P4S A;  2VAS A;  3FZL B;  2Q9Q C;  4JI6 T;  5ABG A;  2XAF B;  3E08 A;  2PTF A;  5JRE A;  4L9I A;  2CXF A;  4KI0 F;  3KV5 A;  2MAW A;  2JIW A;  3Q2M A;  2G0U A;  3KV6 A;  1HFA A;  4UIG A;  1OWA A;  5FXV A;  1NEN A;  2FBW A;  3V5S A;  3MAC A;  3AY5 A;  3PUG A;  3JCF A;  3ZT6 A;  1MIW A;  3RIF A;  2XQ3 A;  2DWG A;  5FVL A;  2WZH A;  1XDP A;  1HG2 A;  4ERR A;  4ZOL E;  4GKJ T;  4PFP A;  5CJ5 A;  3ZST A;  4QH4 A;  2LM2 A;  3VR8 A;  3TLW A;  5HXS A;  4YT0 A;  4DR7 T;  3W15 B;  4GOU A;  2V26 A;  1IJ6 A;  1H7C A;  3AEA A;  3KIN B;  4U74 A;  4CN1 A;  5M4Y A;  1UGO A;  3CX6 B;  2D0U A;  4GK5 E;  3AEE A;  5H6R B;  4TV8 E;  4UEM A;  4DR1 T;  5J0Z A;  4I50 E;  3MXZ A;  4BGO A;  3GN5 B;  1BR1 A;  3L39 A;  4JBW F;  2XAS B;  3OYZ A;  5LB7 B;  4ISS A;  1FEW A;  2W63 A;  2V5D A;  3HL6 A;  1OED E;  1NAF A;  3IEE A;  2V5C A;  3AE9 A;  4XAX B;  5FL0 A;  3UU4 A;  3LK4 2;  2SPC A;  3PE0 A;  3QOF A;  4DV4 T;  4GK0 E;  4JI0 T;  5J2U E;  4B3T T;  2BKN A;  3M3Z B;  3BQI A;  4N78 D;  2KXP B;  4AIS A;  4LFC T;  3LG7 A;  4DV6 T;  5C8Y E;  1N36 T;  4UEL A;  1G8X A;  5AQL B;  3CVR A;  3NZP A;  3UU5 A;  2CLY C;  3ZEF B;  2ODV A;  5JRC B;  5ABH A;  3UQ7 A;  1KNR A;  1LRZ A;  4NUV A;  4H9O C;  3EAB A;  1Y64 B;  4ZI3 C;  5HEH A;  4JV5 T;  4CXY A;  2MBG A;  4TUY E;  3FZH B;  3ZN1 B;  1JNR A;  5KX5 E;  4KUM B;  4TX5 A;  4Z91 A;  2PG8 A;  3PUX F;  3ZN0 B;  4TN7 B;  5LJN A;  1WR0 A;  3JAE A;  4K0K T;  3P4P A;  3LBX A;  1X9B A;  3UUM A;  2QYW A;  4KHP T;  3I0O A;  1XZY A;  4ADZ A;  4F7G B;  2HN1 A;  3RQU A;  5CA1 E;  3CQG B;  2X9H A;  1ZEE A;  1WR6 A;  3HI2 A;  3PUV F;  5KXJ A;  2E5L T;  4LMK A;  4YFS A;  4DV7 T;  2VL8 A;  3F57 A;  4MFR A;  4MLK A;  3HR0 A;  1JNZ A;  4EYU A;  4HE8 A;  4CI2 B;  2WWV A;  4HTE A;  2V8S V;  2W00 A;  4X64 T;  2JQQ A;  4PK6 A;  3FXD B;  4PJL A;  2H88 A;  3ZT5 A;  2V7L A;  2X68 A;  3OKQ A;  4NXM T;  3VR9 A;  4X66 T;  4X62 T;  2VKJ A;  4W8P A;  3KV4 A;  1HNZ T;  4QH1 A;  1E2A A;  2X9Y A;  5HAX A;  4IDO A;  1D1B A;  4YHH T;  5IWA T;  1IZN B;  2FJD A;  1VOM A;  2VK9 A;  4UVC B;  3OTO T;  3J9X 1;  3QUJ A;  2V6Y A;  4IHJ E;  3N2G E;  1I6Z A;  3UFE A;  3QNU A;  3QK6 A;  3KBU A;  2MTQ A;  3LSV A;  4IIJ E;  2CEA A;  4A5X A;  2C0S A;  1U5P A;  3RC8 A;  1MNE A;  4HGA A;  4IE0 A;  3PF0 A;  3JAD A;  2JMH A;  4NIQ A;  3MK7 C;  1W0A A;  1HF8 A;  1UX5 A;  4LMJ A;  2V1D B;  3VJZ A;  2PJQ A;  5EK2 A;  3ZYM A;  3UU8 A;  5HEU A;  5AQG B;  4UV9 B;  3VU7 H;  2LEH A;  4YY3 T;  2JQ9 A;  2JQH A;  3GN5 A;  4JI8 T;  1IBK T;  3ZPO A;  2D9D A;  4P09 A;  2XAG B;  3BK9 A;  2FUP A;  2V6X A;  1WYC A;  4HFI A;  1D0Y A;  5FMN A;  2H3R A;  2CWO A;  3GWH A;  1XWM A;  4IE4 A;  3ABV A;  4AXP A;  3GMI A;  3WUR A;  2CXL A;  4E7S A;  4H63 H;  3SRZ A;  1T98 A;  1N32 T;  4IDQ A;  2LSK A;  3J7Y q;  1MMD A;  4QXB B;  4EOZ B;  4DVD A;  5EK4 A;  2KGX A;  4WNK A;  4X1Y E;  4J2C A;  3N9N A;  1WCR A;  3UUN A;  5AQH B;  4ZZB A;  5T1D A;  2ACX A;  2CM0 A;  1SUM B;  3O4X E;  2EHO B;  2VUR A;  3LJC A;  3HA4 A;  4JEU B;  5JRC A;  5DQV A;  4FJO A;  4WZX A;  3ETV A;  2D0T A;  4CN6 A;  1MMG A;  4X5T A;  5IUX A;  3AED A;  4JI3 T;  2E9X D;  3C51 A;  3RF1 A;  5JDN A;  3NRY A;  3ZCJ A;  2L10 A;  5J2T E;  3RYI E;  3K8P C;  2XM1 A;  3H3A A;  1J5E T;  1FJG T;  3E22 E;  5F8P A;  5HWX A;  2BBH A;  3AEF A;  2W2U A;  4GYS A;  2VKH A;  3H3M A;  3LK2 B;  4O4H E;  4I43 B;  4B6X A;  3WI3 A;  2X9W A;  4DUZ T;  3OPC A;  2XQ7 A;  2LKG A;  4H9S E;  4DR4 T;  1VCT A;  2YIN A;  4QXC B;  3KFW X;  2QGS A;  2B76 A;  3SFE A;  4ONR A;  2XQ6 A;  2N2N A;  3NKZ A;  3ZYK A;  3PUA A;  4OYJ A;  4Q25 A;  3RX6 A;  2PFV A;  3NWI A;  3ZLI A;  2LHR A;  2YDQ A;  4X20 E;  5AFU L;  3NRX A;  2NTY A;  2ES0 A;  3FXE B;  2M67 A;  4HWD A;  3O1I A;  1SE7 A;  2V7M A;  5CFB A;  2W66 A;  4YXD A;  2WDQ A;  4HFC A;  3ZMT B;  5LP6 E;  3Q5D A;  1YQ3 A;  2KMF A;  1UCU A;  5JQG E;  3TLU A;  1J5W A;  5AQQ B;  1HTJ F;  3Q9D A;  4YLH A;  3PUQ A;  2R6G F;  4ZS2 A;  3AAI A;  4AQY T;  2X67 A;  2XSA A;  2XQA A;  3JC6 D;  4IL4 A;  4QX7 B;  4OX9 T;  1XMO T;  3AE5 A;  2LSG A;  5EK3 A;  4LF6 T;  2Q9Q D;  2CA5 A;  4F6R C;  3K3N A;  5CB4 E;  1XDO A;  2N1G A;  2UUB T;  3ZMV B;  2OA5 A;  3FBZ A;  3RKO A;  1Z8U A;  3ZYL A;  5FXX A;  2KT9 A;  1T72 A;  2WP9 A;  3AA6 B;  4HFV A;  2YK0 A;  2IIU A;  3U3I A;  2HN2 A;  2XPK A;  2QRX A;  4HEA A;  5FL1 A;  2ZLY A;  3UUB A;  1O3X A;  5JVD E;  1LKX A;  2BKO A;  2HPJ A;  4BJN A;  1IAP A;  4U7I A;  1AJ3 A;  4GIW A;  2M6I A;  4EZ4 A;  1WLX A;  2QVA A;  2X0H A;  1D1C A;  1ZHC A;  2RA1 A;  4HWH A;  4BJM A;  2ACZ A;  5HEO A;  5AQU B;  4U33 A;  4E7Z A;  3PUY F;  4PK4 A;  2V6Y B;  2YKS A;  5L3C B;  2IC6 A;  3DTO A;  5AQK B;  3CWZ B;  3UUL A;  2KND A;  2X9X A;  4NUU A;  3Q5E A;  4H9P C;  3CQX C;  1KF6 A;  4DV3 T;  3HKB E;  3ZMZ B;  4DR5 T;  4U31 A;  5LGT B;  2BG9 B;  1M62 A;  5FXW A;  4IL9 A;  3CK6 A;  2I0M A;  4UV8 B;  2JJ9 A;  1NWM X;  1ZKE A;  2YU1 A;  4ASK A;  1IBM T;  2C5I T;  4IE6 A;  4DID B;  3EVY A;  2IC9 A;  2EHO A;  3UT5 E;  3Q5W A;  5LYJ E;  2WAU A;  5JR9 A;  2LOS A;  4HWC A;  4O4L E;  3SOL A;  4IDZ A;  4V1A v;  5LOV E;  3UQ4 A;  3ZJ1 A;  4JLE A;  3PDY A;  3AA1 B;  2BVL A;  2WDR A;  1E7P A;  4K0U A;  3ONL C;  3AE8 A;  4IDN A;  3OVU A;  4UXN B;  3AE7 A;  4U3C A;  3N2K E;  3ZC1 A;  3N5L A;  5LHG B;  4UF0 B;  4ZI3 D;  5ADX L;  2CWY A;  1G73 A;  2WU2 A;  2D2S A;  4X65 T;  1FIO A;  3ZSS A;  4CZZ B;  1SHZ C;  2WDV A;  4WBO A;  3TLV A;  5LG3 A;  3OBV E;  2I6H A;  3FZM B;  4MHC A;  1IBL T;  2UXC T;  3RIU A;  3MKD A;  5LCY A;  1D1A A;  2UUA T;  3RQW A;  4EZH A;  4OFZ A;  3RC3 A;  1D0X A;  3ESL A;  3IHR A;  3AE2 A;  2EHO C;  3PU8 A;  3PHF 1;  2M6B A;  4CQI A;  2FJB A;  3RH3 A;  2CXD A;  3PUW F;  4JEH B;  3PJA A;  4DR6 T;  3P4R A;  2DWK A;  5JR9 C;  3ONJ A;  4L5G A;  4DUY T;  1KNP A;  4PNI A;  1KEY A;  3ZCI A;  3AEC A;  4DR2 T;  5LMU T;  2UXN B;  3WSC A;  3AXJ B;  3K1S A;  4U2Y A;  2PBI A;  4YJ2 E;  4B3S T;  1IJ5 A;  2NW8 A;  5AQR B;  4YTN A;  2WSS V;  1HCI A;  2XTL A;  4AKR B;  2H89 A;  5LA6 E;  3ZMS B;  2DHR A;  2AXD S;  3N9O A;  4EEB A;  3AA0 B;  5FYM A;  3T1H T;  1V9D A;  4TWF A;  1L0V A;  1MIV A;  4H9N C;  2C5K T;  4DBR A;  3CKD A;  4PK5 A;  2UU9 T;  2CRB A;  4ZI2 C;  5AQS B;  1LVF A;  3WAJ A;  2ZM0 A;  3RIU C;  4A98 A;  3EI0 A;  4LFA T;  2KWH A;  4EED A;  3TKL B;  4P0B A;  2V7J A;  2WQY A;  4UVA B;  5FY0 A;  1HNW T;  2CBJ A;  2H7O A;  2N9D A;  4ILB A;  4LF9 T;  5HCM A;  2CBI A;  2XY8 B;  2K48 A;  1XMQ T;  2X66 A;  3RRW A;  1Y01 A;  4KHZ F;  5AQI B;  4PJN A;  3CML A;  5AQP B;  3K3O A;  5A1L A;  5LNK A;  4UVB B;  4DBQ A;  2BS3 A;  2VQE T;  3L09 A;  5HXE A;  4C90 A;  2DI4 A;  5ABF B;  4EIW A;  2BG9 A;  2KBB A;  1OED B;  3C64 A;  2LSY A;  2YEV C;  2W62 A;  3KDS E;  2ZM2 A;  4NPP A;  3KVB A;  2Y48 B;  4NXN T;  3VKG A;  5FNV E;  4Z90 A;  2J47 A;  5JDL A;  3ZKR A;  3EDV A;  1BR2 A;  3CPZ A;  3KBT A;  5CA0 E;  4HFE A;  2IW5 B;  2CMR A;  1QUU A;  4DO0 A;  3B13 A;  4DV2 T;  3AVR A;  3AT7 A;  2CHO A;  2CE7 A;  2LOP A;  3I9Y A;  5L3F B;  4AKI A;  3HKE E;  2XZE A;  4PAG A;  2QA7 A;  3PTR B;  4MBQ A;  1HNX T;  3CQC B;  3NVO A;  4I4T E;  4I0U A;  2IHR 1;  4EXT A;  5LGU B;  3F31 A;  2XQ4 A;  4AKG A;  2LSJ A;  1J1J A;  4LF4 T;  4KX6 A;  4UF0 A;  5BR8 T;  5JR9 B;  2BG9 C;  4O2B E;  4BAY B;  2A2F X;  1HR0 T;  2LE8 A;  3NBX X;  2K24 A;  2JMK A;  4YSY A;  4PJM A;  5L3G B;  2VL0 A;  3T1Y T;  1QLB A;  1YD8 G;  1UX4 A;  3C4X A;  3FB2 A;  2JPF A;  3NZQ A;  5ETW A;  4H63 V;  3I9W A;  4IRE A;  5AQV B;  5LHH B;  4IT4 A;  4CI1 B;  3MA9 A;  3PUR A;  2KLQ A;  2IDO B;  3QB5 A;  4YSX A;  2WCA A;  4DV5 T;  1MMA A;  2BS2 A;  4AKH A;  5HXR A;  4TNV A;  1VRB A;  4HFH A;  3UUX B;  3VRB A;  2RPA A;  2JQK A;  2WWU A;  4B3M T;  1WRD A;  4JI5 T;  3AXJ A;  5LBQ B;  1CUN A;  2XQ9 A;  4XZC A;  4ZZC A;  3E0Z A;  2LQU A;  5LMN T;  4DV0 T;  2NTX A;  3UU3 A;  3BQL A;  3C4W A;  4HWI B;  1MND A;  2XQ5 A;  4LF5 T;  3EDU A;  4MAL A;  1OXZ A;  4AQF A;  3O1H A;  2W61 A;  1YXR A;  2XUE A;  1W9R A;  2YOE A;  4WYV A;  3N9M A;  3IF8 B;  2BVM A;  1XNQ T;  2OV9 A;  3JAF A;  2AE9 A;  4HKA A;  2IML A;  5HCJ A;  2LHN A;  4YTP A;  4BA9 A;  5L4E A;  5LBM A;  3P4W A;  2WMN A;  5FXZ A;  4ZEY A;  4O4J E;  4YSZ A;  2K5B B;  1N34 T;  2D5U A;  2WMO A;  2VQF T;  4ZXL A;  1W09 A;  1W0B A;  2ZM8 A;  1US7 B;  2B1E A;  2WU5 A;  3T8O A;  2K9A A;  4TZ4 C;  3IA3 A;  2XQY A;  2WS3 A;  3FBL A;  4AQG A;  4U72 A;  1MMN A;  2XM2 A;  2L9Q A;  2XAQ B;  3ZMU B;  3ANW B;  4OYK A;  2X0Y A;  4TV9 E;  3K3Q C;  1UUS A;  2W67 A;  2DCF A;  2V7K A;  2NP9 A;  2XJ7 A;  4A97 A;  4LF7 T;  2MYS A;  1T7S A;  5ABF A;  3P7I A;  1WFD A;  5HXC A;  2KSR A;  4O8S A;  4YHJ A;  4WBN E;  2C5J A;  4AQF C;  3N9L A;  4IGU A;  5FKY A;  1YQ4 A;  3G06 A;  1KNZ A;  2UXB T;  5L47 A;  1OED A;  2A9U A;  2NOX A;  2ZMA A;  2Y8D A;  5F3J A;  3PJA J;  5JDH A;  4GYR A;  4PJJ A;  4DND A;  2XAJ B;  1I94 T;  2ZM6 T;  2XQ8 A;  2NWB A;  3N2O A;  4G2A A;  5L3D B;  1WYB A;  4QX8 B;  3ZC0 A;  5IYZ E;  2YDS A;  2BBJ A;  5AQO B;  3A5X A;  5LXT E;  5E0O A;  3AAE B;  5DQW A;  4IST A;  3FZF B;  3TLS A;  3RGL A;  2OLT A;  2WBL A;  5L2L A;  4DMW A;  4AKL A;  2LM9 A;  3SWH A;  4KBM B;  2W0G A;  4O4I E;  2J4G A;  5LGN B;  3M1C A;  4F8H A;  2LRK A;  3PUZ F;  3QC9 A;  5H6Q B;  5KMG P;  4QHO A;  2UUC T;  2E9X B;  4COF A;  1D0Z A;  2BDE A;  1YKH B;  5HEG A;  1OED C;  5F5W A;  3HKC E;  3DP7 A;  2DNX A;  3X1D A;  4OK0 A;  2KZ7 B;  4JI2 T;  4CI3 B;  2WM9 A;  3IBP A;  2HPL A;  1X79 A;  4HFD A;  2LKH A;  2UXX B;  4P0A A;  2Y6X A;  3ONX A;  3UFG A;  4LF8 T;  4YJ3 E;  3O1J A;  3ETU A;  4ILU A;  5JTG A;  4X1I E;  5DJQ C;  1ZV4 X;  4I55 E;  2VKO A;  4EGW A;  4ECG A;  4ZI7 E;  2LRL A;  4P1N A;  1EZ3 A;  3LFM A;  5L3B B;  2MOZ A;  5TAO A;  1UUR A;  4G63 A;  4JI4 T;  2X0L B;  4ILC A;  2E2A A;  5JDG A;  2EHO D;  3WAK A;  3EAM A;  4IDP A;  3RLF F;  4CXW A;  2Z6E A;  2VWA A;  2KVP A;  3KVA A;  4KP3 C;  3CIR A;  1GQE A;  2CCQ A;  3AE6 A;  4JYA T;  2WB5 A;  5GON E;  3MZK B;  2Q9Q B;  2LSI A;  5ABE A;  5C3J A;  2V7I A;  3RKG A;  5EZY E;  4UR9 A;  3FZK B;  5HXH A;  4WW0 A;  1HX8 A;  4DV1 T;  4CN4 A;  4QH5 A;  2YU2 A;  3SFD A;  3VKH A;  3OJA A;  4FI5 A;  2MPK A;  5IHY A;  2W4X A;  4ANJ A;  3PU3 A;  2FJE A;  3EHZ A;  2F4V T;  2J1D G;  3I1A A;  1HX1 B;  4IE7 A;  3L3P A;  3C4Z A;  4ZI2 D;  4LML A;  3RIA A;  5JDQ A;  2LLY A;  4TNW A;  3ANW A;  4KMC A;  3AE4 A;  3AB3 B;  2A3D A;  3AE3 A;  4AI6 A;  2NR4 A;  4DR3 T;  4LFB T;  2YDR A;  1R8I A;  3UU6 A;  1T8B A;  5C2T A;  4ZHQ E;  3TLT A;  3KV9 A;  5AQM B;  4GKK T;  3O9X A;  2LJL A;  3A7M A;  3VRA A;  3QB5 K;  5AQN B;  2X0C A;  1BR4 A;  4EAH A;  3U78 A;  2UXD T;  2L8K A;  2NW7 A;  2NW9 A;  2DLR A;  4A56 A;  3N9P A;  4H9R C;  1Z0P A;  5FY7 A;  3ZJ2 A;  1B7T A;  2CPT A;  4ILA A;  2BS4 A;  2VVS A;  2IAK A;  3UTK A;  3RYC E;  3H37 A;  2GK9 A;  4U7Y A;  5HYA A;  4Z8X A;  3PUS A;  3RPU A;  3AEB A;  2VKD A;  1VCS A;  3M65 A;  3B57 A;  2E5V A;  2VVN A;  3Q5X A;  4DMV A;  2YN6 A;  1QSD A;  2BZB A;  3RI5 A;  5AQT B;  4EYY R;  3AA7 B;  3AEG A;  1ZP0 A;  5LJM A;  5HWY A;  3C50 A;  1E1H B;  1M7K A;  4TWD A;  2L3L A;  4IE5 A;  4C91 A;  2IUB A;  2K3W A;  3EUH A;  2MTC A;  2E9X A;  3A8Y C;  5FP3 A;  3RHW A;  4AIU A;  1FMW A;  1S35 A;  3L8R A;  4O2A E;  2CLY B;  1SJ8 A;  3DJB A;  2WZI A;  2E8I A;  2L7N A;  4YTM A;  4PW8 A;  3DYJ A;  3N9Q A;  5DAB A;  4M1P A;  5JH7 E;  2DL1 A;  3P50 A;  5LG4 A;  5J1G A;  1S94 A;  3LDQ B;  3P8C D;  3GA8 A;  3CX8 B;  1FMV A;  2KIN B;  3I0Q A;  3HKD E;  3B5M A;  4HWF A;  4QKN A;  5HEJ A;  5JDM A;  2FJA A;  1YKE B;  1HS7 A;  2RP4 A;  5LHI B;  4ZS3 A;  4JI1 T;  2H7V C;  3AAA B;  2BG9 E; 
#chains in the Genus database with same CATH homology
 3ZMU B;  3ANW B;  4OYK A;  4TV9 E;  3K3Q C;  3RYF E;  4UXN B;  3OYX A;  2DCF A;  2V7K A;  1VOM A;  2NP9 A;  3N2K E;  2VK9 A;  4UVC B;  2MYS A;  3ZC1 A;  3N5L A;  4H9Q C;  3J9X 1;  5LHG B;  3P7I A;  3QUJ A;  4UF0 B;  4ZI3 D;  4IHJ E;  5ADX L;  3N2G E;  2CWY A;  5HXC A;  2JRK A;  3UFE A;  1G73 A;  3AVS A;  3QK6 A;  4O8S A;  5KDM C;  4YHJ A;  3KBU A;  4WBN E;  2C5J A;  2MTQ A;  2D2S A;  4AQF C;  3N9L A;  4IIJ E;  4IGU A;  1BR0 A;  2CEA A;  1KNZ A;  4PFO A;  1KK7 A;  4XBF B;  1FIO A;  2C0S A;  3BQK A;  4CZZ B;  1SHZ C;  1U5P A;  2E9X C;  4WBO A;  3FHN A;  2I59 A;  2NOX A;  3RC8 A;  1MNE A;  2ZMA A;  4HGA A;  4IE0 A;  3OBV E;  3PF0 A;  2Y8D A;  4MHC A;  3VHL A;  2Q9Q A;  5F3J A;  2XAQ B;  5JDH A;  2JMH A;  3MKD A;  4GYR A;  3MK7 C;  1D1A A;  5LCY A;  1HF8 A;  4PJJ A;  1YW0 A;  1SA0 E;  5JDF A;  2VB6 A;  4DND A;  2XAJ B;  4EZH A;  3RRC A;  3RYH E;  4OFZ A;  1UX5 A;  2NWB A;  3RC3 A;  2V1D B;  3N2O A;  1D0X A;  4G2A A;  3ESL A;  2PJQ A;  1WYB A;  3IHR A;  4QX8 B;  5L3D B;  3VJZ A;  5EK2 A;  3ZC0 A;  3F2E A;  5IYZ E;  3ZYM A;  2EHO C;  3PU8 A;  3PHF 1;  4CQI A;  3C98 B;  3RH3 A;  2CXD A;  2LT3 A;  3LK3 B;  4JEH B;  4EB6 E;  3S4U A;  2DWK A;  3A5X A;  4UV9 B;  5LXT E;  3VU7 H;  5JR9 C;  4OHF A;  2LEH A;  5E0O A;  2ODU A;  3GN5 A;  4L5G A;  3CX7 B;  4PNI A;  3AAE B;  1U4Q A;  3ZCI A;  5DQW A;  4IST A;  3ZPO A;  3SS1 A;  2UXN B;  3WSC A;  4CXX A;  4P09 A;  2PBI A;  4HN9 A;  4YJ2 E;  3D0T A;  4QWN B;  1IJ5 A;  2NW8 A;  2WBL A;  2XAG B;  3BK9 A;  5L2L A;  5L3E B;  4DMW A;  1WYC A;  2WSS V;  3R6N A;  5FY1 A;  4AKL A;  1HCI A;  2LM9 A;  2XTL A;  1D0Y A;  5FMN A;  2H3R A;  3R84 B;  3SWH A;  4AKR B;  3LBX B;  2CWO A;  2X51 A;  3GWH A;  5LA6 E;  3ZMS B;  1MIY A;  2DHR A;  4KBM B;  4L0R A;  2KWI B;  2XHE B;  3N9O A;  4IE4 A;  2P9B A;  2A72 A;  4AXP A;  2W0G A;  3GMI A;  4O4I E;  3WUR A;  2CXL A;  4E7S A;  5LGN B;  3AA0 B;  4H63 H;  5FYM A;  3M1C A;  1V9D A;  3SRZ A;  1T98 A;  3V5U A;  3QC9 A;  2LSK A;  5H6Q B;  3J7Y q;  1MMD A;  4QXB B;  4EOZ B;  5KMG P;  1MIV A;  1HG5 A;  4QHO A;  2XAH B;  4H9N C;  4DVD A;  2E9X B;  2C5K T;  5EK4 A;  4DBR A;  1D0Z A;  2BDE A;  3MJX A;  3CKD A;  4QXH B;  5BMV E;  4PK5 A;  4JUY A;  4WNK A;  1YKH B;  2HH7 A;  4X1Y E;  4J2C A;  3N9N A;  4X1K E;  3HKC E;  3JC6 C;  4ZI2 C;  1LVK A;  3DP7 A;  3UUN A;  1LVF A;  2DNX A;  2VAS A;  2Q9Q C;  5T1D A;  3WAJ A;  2ZM0 A;  2ACX A;  4OK0 A;  2XAF B;  2KZ7 B;  3E08 A;  2KWH A;  2CM0 A;  3TKL B;  5JRE A;  4L9I A;  4P0B A;  2V7J A;  3O4X E;  2EHO B;  2CXF A;  4UVA B;  4CI3 B;  3LJC A;  3HA4 A;  4JEU B;  5JRC A;  2WM9 A;  3IBP A;  3KV5 A;  5DQV A;  2HPL A;  1X79 A;  5FY0 A;  4FJO A;  2UXX B;  3ETV A;  2D0T A;  3Q2M A;  2N9D A;  2H7O A;  2G0U A;  3KV6 A;  1HFA A;  4UIG A;  4P0A A;  2Y6X A;  1OWA A;  5FXV A;  3ONX A;  1MMG A;  4YJ3 E;  3O1J A;  3ETU A;  4ILU A;  2K48 A;  4X1I E;  2X66 A;  2E9X D;  5DJQ C;  3C51 A;  3RRW A;  1ZV4 X;  3V5S A;  5JDN A;  4I55 E;  3NRY A;  3ZCJ A;  2VKO A;  5J2T E;  3RYI E;  3K8P C;  3MAC A;  4ECG A;  4ZI7 E;  3PUG A;  3H3A A;  4PJN A;  1MIW A;  3CML A;  1EZ3 A;  3E22 E;  3K3O A;  3LFM A;  2MOZ A;  5F8P A;  5HWX A;  5TAO A;  5L3B B;  4G63 A;  5A1L A;  5LNK A;  2DWG A;  2X0L B;  4UVB B;  4DBQ A;  4GYS A;  2VKH A;  1HG2 A;  4ERR A;  4ZOL E;  3L09 A;  3LK2 B;  4O4H E;  4I43 B;  5HXE A;  4PFP A;  2EHO D;  3WAK A;  3WI3 A;  2X9W A;  4B6X A;  5JDG A;  4C90 A;  2DI4 A;  4H9S E;  4EIW A;  4CXW A;  2YIN A;  2Z6E A;  4QXC B;  3KFW X;  2QGS A;  2VWA A;  4ONR A;  5HXS A;  3KVA A;  4KP3 C;  3W15 B;  2N2N A;  4GOU A;  2CCQ A;  3ZYK A;  3C64 A;  2LSY A;  3PUA A;  2V26 A;  2YEV C;  2W62 A;  4OYJ A;  1IJ6 A;  5GON E;  3RX6 A;  2PFV A;  3MZK B;  3ZLI A;  2Q9Q B;  3KDS E;  2LHR A;  4X20 E;  2LSI A;  5AFU L;  1H7C A;  3KIN B;  2ZM2 A;  3NRX A;  2NTY A;  2V7I A;  4U74 A;  2ES0 A;  3FXE B;  5M4Y A;  5EZY E;  2M67 A;  3CX6 B;  3KVB A;  2Y48 B;  3O1I A;  2D0U A;  2V7M A;  5HXH A;  3VKG A;  4WW0 A;  1HX8 A;  3ZMT B;  5FNV E;  5LP6 E;  4GK5 E;  2YU2 A;  2KMF A;  3VKH A;  1UCU A;  3OJA A;  5JQG E;  5JDL A;  3EDV A;  5H6R B;  1BR2 A;  4TV8 E;  4FI5 A;  3CPZ A;  1HTJ F;  4UEM A;  3KBT A;  3Q9D A;  4YLH A;  3PUQ A;  5IHY A;  4I50 E;  4ZS2 A;  5CA0 E;  3MXZ A;  4ANJ A;  3AAI A;  2IW5 B;  4BGO A;  3GN5 B;  3PU3 A;  1BR1 A;  2J1D G;  2CMR A;  1QUU A;  2XAS B;  2X67 A;  3OYZ A;  3I1A A;  4DO0 A;  3B13 A;  4IE7 A;  3L3P A;  3JC6 D;  4QX7 B;  3C4Z A;  4ZI2 D;  3AVR A;  3AT7 A;  5JDQ A;  2LOP A;  2CE7 A;  5EK3 A;  2LSG A;  3I9Y A;  4ISS A;  2Q9Q D;  5L3F B;  4AKI A;  1FEW A;  3HKE E;  4PAG A;  2W63 A;  2CA5 A;  2QA7 A;  4F6R C;  3PTR B;  3K3N A;  4MBQ A;  3ANW A;  4KMC A;  5CB4 E;  3AB3 B;  2A3D A;  2N1G A;  3CQC B;  4I4T E;  3HL6 A;  2OA5 A;  3ZMV B;  4EXT A;  3F31 A;  5LGU B;  3FBZ A;  3RKO A;  1NAF A;  4AI6 A;  3ZYL A;  5FXX A;  2KT9 A;  4AKG A;  2LSJ A;  3IEE A;  4UF0 A;  4ZHQ E;  3AA6 B;  3KV9 A;  3O9X A;  4XAX B;  3LK4 2;  2LJL A;  2SPC A;  3PE0 A;  4HFV A;  5JR9 B;  2YK0 A;  4O2B E;  4BAY B;  2A2F X;  4GK0 E;  2LE8 A;  3NBX X;  3U3I A;  5J2U E;  2K24 A;  4HEA A;  2JMK A;  1BR4 A;  3BQI A;  2ZLY A;  4N78 D;  4EAH A;  2KXP B;  3U78 A;  4PJM A;  5L3G B;  3LG7 A;  1O3X A;  5JVD E;  1LKX A;  2L8K A;  2HPJ A;  4BJN A;  1YD8 G;  2NW7 A;  5C8Y E;  1IAP A;  2NW9 A;  1UX4 A;  3C4X A;  3FB2 A;  4UEL A;  2JPF A;  3NZQ A;  1AJ3 A;  2DLR A;  4A56 A;  4GIW A;  5ETW A;  3N9P A;  1G8X A;  4H63 V;  3I9W A;  4EZ4 A;  3CVR A;  3NZP A;  5LHH B;  4H9R C;  1WLX A;  2CLY C;  3ZEF B;  2ODV A;  3MA9 A;  1D1C A;  3PUR A;  4CI1 B;  5JRC B;  1Z0P A;  1ZHC A;  5FY7 A;  3ZJ2 A;  1B7T A;  2KLQ A;  2RA1 A;  4BJM A;  1LRZ A;  4NUV A;  4H9O C;  1MMA A;  4E7Z A;  1Y64 B;  4ZI3 C;  2IAK A;  3UTK A;  4AKH A;  5HXR A;  3RYC E;  4PK4 A;  3H37 A;  2GK9 A;  1VRB A;  4CXY A;  5HYA A;  4Z8X A;  5L3C B;  2IC6 A;  2MBG A;  3PUS A;  3DTO A;  3UUX B;  3CWZ B;  3RPU A;  4TUY E;  2WWU A;  2VKD A;  3ZN1 B;  3UUL A;  1WRD A;  3M65 A;  3B57 A;  5LBQ B;  1CUN A;  5KX5 E;  3Q5X A;  4KUM B;  4TX5 A;  4DMV A;  2KND A;  2PG8 A;  2X9X A;  3ZN0 B;  4NUU A;  4TN7 B;  5LJN A;  4XZC A;  1QSD A;  4H9P C;  2BZB A;  3E0Z A;  2LQU A;  3CQX C;  4EYY R;  2NTX A;  3LBX A;  3AA7 B;  3BQL A;  3UUM A;  3I0O A;  3C4W A;  3HKB E;  3ZMZ B;  1MND A;  4ADZ A;  5LJM A;  5HWY A;  3C50 A;  1E1H B;  5CA1 E;  3EDU A;  4MAL A;  3CQG B;  2X9H A;  5LGT B;  2L3L A;  4IE5 A;  1OXZ A;  4AQF A;  3O1H A;  2W61 A;  5FXW A;  1ZEE A;  4C91 A;  1WR6 A;  2XUE A;  3HI2 A;  3EUH A;  2MTC A;  2E9X A;  3N9M A;  3IF8 B;  5FP3 A;  4UV8 B;  2JJ9 A;  1NWM X;  2BVM A;  1ZKE A;  2YU1 A;  4YFS A;  4ASK A;  1FMW A;  1S35 A;  2C5I T;  4HKA A;  4IE6 A;  2VL8 A;  3F57 A;  4O2A E;  4MFR A;  4MLK A;  3HR0 A;  4EYU A;  2CLY B;  2LHN A;  3EVY A;  4HE8 A;  4BA9 A;  2IC9 A;  5LBM A;  4CI2 B;  3DJB A;  2WMN A;  5FXZ A;  2E8I A;  2EHO A;  4HTE A;  4PW8 A;  3UT5 E;  3Q5W A;  2W00 A;  3N9Q A;  5DAB A;  2JQQ A;  4M1P A;  5JH7 E;  5LYJ E;  4PK6 A;  3FXD B;  4PJL A;  2WAU A;  4O4J E;  5JR9 A;  2K5B B;  2D5U A;  2V7L A;  2X68 A;  2WMO A;  5LG4 A;  2LOS A;  1S94 A;  3P8C D;  5J1G A;  3GA8 A;  3CX8 B;  3OKQ A;  1FMV A;  2ZM8 A;  4O4L E;  3SOL A;  1US7 B;  4IDZ A;  2KIN B;  2VKJ A;  2B1E A;  4V1A v;  3T8O A;  3I0Q A;  5LOV E;  2K9A A;  3HKD E;  3KV4 A;  4TZ4 C;  4QKN A;  2XQY A;  5JDM A;  3FBL A;  3ZJ1 A;  4JLE A;  2X9Y A;  1YKE B;  4AQG A;  5HAX A;  3PDY A;  3AA1 B;  1HS7 A;  2RP4 A;  4U72 A;  5LHI B;  2BVL A;  1MMN A;  1D1B A;  2L9Q A;  4ZS3 A;  4K0U A;  2H7V C;  3AAA B;  1IZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...