3V5XA

Structure of fbxl5 hemerythrin domain, c2 cell
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
151
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQYNVHKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords F-box/LRR-repeat protein 5
total genus 68
structure length 151
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5xA00
3CAXA 3V5ZA 3V5YA 3U9MA 2P0NA 3U9JA 3V5XA
chains in the Genus database with same CATH superfamily
1YARO 1Z23A 3G50A 3RH3A 2HZ8A 3I4UA 1YA7O 4XTKA 5KYUB 5B3IA 1QQ3A 2Q4FA 2M64A 2OCCC 2VH3A 3ABKC 3N0TA 5COMA 4OD4A 3QW1A 1D0YA 3EZIA 1Y4CA 1V54C 3DWWA 3KH2A 2J7PD 1YZAA 4G0HA 4AE4B 4IJJA 1LI5A 3GORA 3ZQVA 1G4US 3IQCA 4C3BA 3AG1C 1U6HA 1MQVA 2ZXOA 1CGNA 1QKRA 2GFHA 1MMGA 2DB4A 4HFFB 4C7OA 2OQMA 1K04A 2JPUA 4YJWA 4MTOA 1WWPA 3DD7A 3TOMA 1FFTC 2NSFA 4U5BE 1ZU4A 3FXHA 3S28A 1FFHA 2Y39A 4CDYA 1JRAA 4CSAA 1FTSA 2EPLX 4KNWA 2W4MA 3K6BA 4Q4ZF 4P9FA 3JT1A 4N4WA 4Z9JA 3C18A 3W4YA 3U9JA 1LE4A 3LUTB 3B29A 2AP3A 4CS8C 3FOPA 4NY3A 5L0JA 3K1HA 4MTGA 1Q0DA 1FNTc 4RDAA 2YKZA 1ZU5A 1YAUO 4BJ6C 2QTVA 5DVWA 3AG4C 4BJ5A 4J32B 3DE8A 1NSGB 2R05A 3DAFA 1NG1A 5EHHA 4IWBA 4E0IA 4EIYA 4BPMA 2KSFA 1K40A 2R7XA 2ICWG 4W8PA 2X0CA 3U8PA 4NTAA 5KYXA 2YLDA 3E9VA 1I4ZA 1T6UA 3FAPB 1V55C 5JVEA 3JCUQ 3S27A 4WGYA 1VYIA 3V5YA 3ZWIA 2P0NA 1DOVA 2LFDA 2A0UA 3I5PA 2EIJC 4CS7A 2AU5A 4ULWA 5AC4A 3WHNA 2IXPA 5FCLA 1H9TA 3EG9B 4RBNA 3EZHA 3W2WA 5AC5A 1XZPA 3JZ0A 2G62A 3NYLA 2YVKA 4J7YA 5AGFA 1J8YF 4NTBA 4XPXA 5CI8A 3NRHA 2H7BA 2MWQA 2ETSA 3DJUB 4JZAA 3TQOA 1SR2A 1V74B 3QZCA 2NPUA 4XWJA 1AVOB 4MW8A 4N06A 3C63A 3EHMA 3ZDLA 2YEVA 3VRCA 1R5ID 1A0BA 1C03A 2GA0A 3TJ6A 3JYYA 3U5SA 4I3MA 1EQ1A 1OCCC 1V4AA 1JPNA 3MLGA 3LLKA 4L6RA 3EHNA 5T3TA 3JSZA 4ANJA 5JT4A 1JR8A 1XWJA 2F22A 4NQFA 3JSEO 4O6YA 1ZHXA 4JC7A 5A6BD 4WABA 2XL8A 2GWWA 3F46A 1GQAA 5BQGA 2Q7RA 3VAYA 2EIMC 3DM9B 1OW6A 1G8XA 2M4EA 3C8GB 5D91A 2XXAB 5KYXB 1OQCA 2VCBA 3GANA 3GODA 3ZC4A 4E7SA 4YL0A 5DS6A 4Q5SF 2HV7A 1A7DA 2CCYA 4WJ0A 4PJMA 3TJ5A 4G7OF 4MVQA 5TJ5E 4E7ZA 2HJ3A 4YT4A 3Q7LA 3UNGC 4CS9C 1MNEA 1WASA 2WZGA 2ZD9A 2BC5A 4MVUA 2WVQA 3LNMB 4K7BA 2OEVA 3B9QA 4YK5A 4LDRA 3R7CA 1VOMA 1C02A 3UGOA 4JTAB 3KKBA 3PHF2 3AGTA 1LS4A 2W9YA 5CIVA 2RD9A 2HSQA 2W45A 2EILC 2QUPA 4YWQA 1LI7A 2XLWA 4GEHA 4XLPF 3U2MA 2NUPB 2HKVA 2C03A 2L7AA 3F47A 3V7OA 4IAOA 2DYSC 2P1AA 1CPQA 4G7ZF 1TKNA 1NZEA 4MW3A 1B68A 3IHUA 1VB5A 3M1CB 5A6BA 1Z7Qc 3RQFA 3RYLA 3W8IA 2HS5A 1VK5A 1OCOC 5E3CA 2R7OA 5D92A 2CYDA 4MS2A 4U5HA 5DQTA 3OA1A 1OW7A 3M79A 3ATPA 3ITFA 1APCA 2L81A 4ZLDA 1BZ4A 2XM4A 3SNHA 2NUTA 3SYNA 2LCHA 4PJNA 3WG7C 2YZSA 3GWLA 2R7VA 2Q9AA 1RMVA 1HMDA 2VB6A 4CS9A 1LKXA 1YDIA 3ZG1A 1SZIA 3SXZA 4CBEA 1PCXA 2PX0A 1JMWA 3DAGA 4XPWA 4EKWA 1CGME 2OG2A 4RD9A 2V3CC 3TULA 3IQ5A 2IXMA 3A11A 3US6A 2UUHA 1KU2A 2PX3A 1WN0A 2A68F 3O39A 4NTFA 5T1DB 3RFYA 3ASOC 1T6QA 2J8WA 2WVNA 3DKAA 3SEOA 3LEOA 4LLCA 3X1OA 1O87A 1LS1A 3I5QA 3LS1A 3EGDA 1NBBA 1ST6A 1TWAA 4JEBA 5HV9A 4U5GA 4JIOA 3Q6MA 4OIRF 3PCVA 3NYMA 4GYTA 4U5FE 1M56C 4YT2A 1U0BB 2AWYA 2DGJA 4Q7CA 1OR3A 3HNIA 3B0VC 4WGZA 4AK9A 5KYYB 3ZSUA 1RJ9A 1Q0FA 3SP1A 5A6JA 4MQ9F 2IM8A 1T5OA 3FOOA 5B1AC 5F5FA 4U9EA 3X2QC 3KYIA 2R9RB 2A69F 1FMWA 3WAQA 1M2VB 3BEHA 3EGXA 1E84A 4OIPF 1TFKB 1H9GA 2J45A 3C62A 4IB4A 4CIPA 2A0BA 5L3VA 1PD1A 5COGA 4CJGA 3K7DA 4P6IC 2J46A 3MX3A 2KYHA 5E3AA 1J8MF 2VASA 4IARA 3RVZA 4DJ9A 4JTDB 2WB7A 1ZHYA 2ASRA 1RJ9B 1ZW3A 3L8IA 4DBQA 4DBRA 4CSAC 3C7JA 4BEMJ 4C7OB 2HUJA 4XLNF 2Y3HA 1BBHA 3RIPA 4C3DA 4JCHA 4YT8A 3UMKA 4W8KA 3H65A 2EPNA 4PJLA 1YLMA 3R2PA 4A4AA 1RXQA 3H2UA 3TOLA 4CDAA 3O10A 4BEJA 2L6FA 4E17A 3LEVA 3ABMC 4DOZA 2NUTB 1NLXA 1H6GA 3C8GA 4OIOF 2X51A 2OKUA 2R7SA 2VC9A 1EKYA 4E0HA 1T9KA 3MYFA 4EUKB 3Q7GA 1QLEC 3GWNA 1HE9A 3RW0A 2ZXRA 3FMSA 4G78A 3EH1A 4OINF 3CEXA 1H7IA 1Q0KA 3NKDA 5DS4A 1QZXA 2KW3C 2VCCA 1KNYA 2XLMA 3C8ZA 1G4WR 2XLVA 3AG2C 3NYJA 3NDBB 4O6MA 4H4KC 2XXAA 3PDMP 1TWHA 2KC3A 2P61A 1HW2A 1OKKA 3TD7A 2HMQA 3C8GD 3S84A 3K1IA 1ZHTA 3GEIA 3UR3C 4BJ1A 3BRJA 4CIHA 4PACA 2GAQA 3EQLF 3RQGA 4Z9IA 5L0HA 1A7EA 3Q6NA 1UG7A 3QVYA 3G4ZA 2XLEA 2XSEA 3KMIA 3MYIA 3JYHA 5GPGB 3PMRA 1JOGA 3RF3A 4ZLCA 2R25A 2J7PA 3IQTA 1OW8A 1LVKA 1T01A 4DVZA 2YL3A 4DRHB 3IEEA 3OEOA 4KBLA 2J0WA 3H2VA 4M63A 3CSKA 2TMVP 4XEKA 2NUPA 1G5ZA 4JW1A 5L3QA 3U2LA 2HV6A 4JJGA 1D0ZA 2XM0A 5DLJA 1VLTA 2A1DD 5L0FA 1E86A 3M4CA 3POVA 2O9XA 1Y6DA 3HTKC 3L34A 3T6JA 1YYJA 3J06A 2J9UA 1Z63A 1Q0GA 3HNJA 2CW0F 4QI0A 1QVXA 1NU9C 2G3VA 2I8BA 2Z15A 5JP7A 2R7TA 3DI5A 2KGOA 3ZTZA 3GM3A 2IXOA 3K66A 3LLIA 1VLSA 3UMHA 4PJJA 1LPEA 2PBEA 3QVZA 1E83A 5KYNA 2W4BA 2JD3A 2XS1A 4HE8D 4EHPA 1M57C 2D5RB 1OXBA 2Q9BA 3SXKA 1PD0A 2YWAA 2L6GA 4H54A 3DJNB 4O6NA 2KQ9A 4BJ5C 4D4NA 2VCAA 3AJMA 2G3KA 5A6KA 1NFNA 3K1IC 3KL4A 2R7WA 4EBBA 2FGYA 3L1MA 1S7ZA 1ZVZA 2J0XA 3LNRA 2CGEA 3FVYA 2EPMX 3GEEA 2XLDA 3GM1A 4JTCB 2A6EF 2FAPB 4KC9A 4G7HF 4MVZA 5EK0A 1YZCA 1NFOA 5JUAA 4AX2A 2WVOA 4JCZA 3B0PA 1PV3A 3ZVRA 2NSGA 4U5EE 2Q9CA 1ORYA 2LFFA 1GGQA 1MMDA 2XLHA 3A9CA 3DXJF 2I15A 4BJ6A 3DM5A 2OOCA 1W2WA 3L8JA 1HE1A 2UUIA 4DRIB 3U0CA 1KTMA 2PNOA 5DS5A 2H7OA 2WZLA 3EFOA 3QW0A 4BJTA 3W8HA 4U9DA 2P7VA 2H7VC 2FFHA 3VYWA 1QSPA 3M15A 1I5NA 5F5HA 5K0IA 3AOUA 2H8AA 1EI7A 3LAYA 2P6VA 1TWGA 1FAPB 1LM3B 2CNWA 4LDKA 4PFPA 1GM5A 4Z9HA 1BR4A 5A6AA 2B0HA 2BL2A 1D1AA 1HY5A 2ZXPA 4K0DA 1SYQA 4LDQA 2IBFA 2LP4A 4CJOA 3VM6A 2Y3BA 2HSBA 1D1BA 3AQBA 2IOQA 4OIQF 2B0JA 2KNHA 3FAJA 4YL1A 4AE4A 2JX0A 4IAQA 2MHRA 2R7UA 1SF8A 4C3EA 1E2XA 3U8VA 4JURI 4KNVA 3RVYA 1ZHWA 5EGYA 2QE9A 4XPYA 4J7TA 5COFA 3VF0A 3GM2A 1DOWA 1K05A 1MMNA 2R7QA 1O3UA 3ECSA 1AEPA 1WGWA 2J9WA 3IQ6A 5DQZA 1ZW2A 2LQGA 2R02A 5E33A 4EWCA 4PR9A 1M2OA 4QDLA 1TFOB 1RKEB 1RCPA 1A41A 2XL4A 3SXMA 3SXYA 5KYWB 4U5CE 1TQGA 1UFBA 4I1OB 4JKVA 4XQ1A 1M6TA 3S9OA 1VMAA 3M4BA 4P9TA 3QTHA 3L0IA 1M2VA 3EGXB 3KYJA 2Y3GA 3LJBA 3CAXA 5T3WA 2YLGA 1YA9A 2XRHA 1I4YA 3CZ6A 2LK4A 4LLEA 2AVKA 2AWCA 3U9MA 4AL0A 2MYSA 1LIHA 2OJQA 5BUOA 5CI9A 1R4TA 5KYUA 4PFOA 1QPUA 1BDJB 3HNLA 1RKEA 4U5DE 2WL8A 5KYWA 3NMKA 4ULVA 3T6GB 5F28E 2WZFA 2KK1A 3E70C 3NKEA 4EBJA 2DI3A 4PK4A 3UMIA 1EA8A 4MTFA 1BR1A 1ZHZA 5JLIA 2XL6A 3MBGA 4DVYP 2IYLD 1WOLA 1XZQA 2YQYA 3QMKA 1RKCA 2PF4E 3EG9A 3EJNA 5L0CA 1SMYF 2LSEA 3ZQYA 1ZYRF 1L7CA 4JRZA 4XEVA 3JTLO 2R7RA 4J30B 1Z5ZA 5L0IA 2KJGA 4FX5A 3JRTA 1O5HA 1C17M 4ONSA 2R03A 1YVIA 2QLAA 3U3BA 1HMOA 3T6BA 3G4XA 5FZTA 5B1BC 1OKKD 1T6IA 2XLOA 5KYYA 3IPMO 1D0XA 1WTYA 4OD5A 1ZZPA 3AGUA 3B0UX 256BA 4JEAA 2ZPAA 2CNWD 3FDQA 1JPJA 1TWCA 2YL0A 1IZMA 1FMVA 3TK0A 3NMJA 2OJED 1L3PA 4R32A 1MMAA 2EPKX 2QNLA 1JAFA 4NC3A 4O79A 4HFKB 2DYRC 1YYXA 2HMZA 3HKKA 4IGGA 1S05A 2L9JA 4JVSA 2OEXA 4AL1A 5A69A 1CGOA 1WATA 2YL7A 4E18A 2EPOA 4I1MA 3KPHA 3SZRA 1E85A 3WODF 4MVSA 4D4XA 2J9BA 2NG1A 2D4UA 1VYKA 3T9OA 4MVOA 2ZXWC 2EIKC 4YL3A 4FWVA 4NCQA 4B6IA 5L0DA 2CDQA 2YL1A 5B3SC 3EGDB 3S90A 4A2NB 4DRJB 4F4BA 2YLIA 4N6HA 4IRUA 3N2ZB 5L0GA 3RQEA 3LESA 1U89A 5HSWA 4JE9A 5JRAA 5JS5A 4CX9A 1BR2A 2RSEB 3AG3C 3EFOB 3CQZA 1AUEA 2QY9A 2OU6A 3V5ZA 2C04A 1Z3IX 1IW7F 3AQCA 4LERA 4KI2A 1LE2A 1NU7D 3HJCA 2V26A 3S0XA 3ASNC 4UDVA 3ABLC 3DE9A 1TR2A 1OR2A 2A6HF 3RKOF 5BQHA 2PFDA 4QI2A 2Q3TA 2BE5F 1D1CA 3JRMO 2L6HA 3O55A 3O6XA 3LS0A 3V5XA 4EBKA 3EPVA 1ORJA 2GDCA 2PP4A 3HLZA 4GQHA 3W2VA 4BG0A 1OCZC 2HJMA 3U3FA 1CPRA 2LD6A 4O7GA 3EH2A 2XS8A 5JSLA 3FHDA 4XEFA 3S29A 3ZTMA 2YRFA 3GEHA 3UGPA 1ORSC 3T4RA 5E2QA 4MNDA 4X0RA 4YT5A 2Y69C 2YHSA 4FESA 4HEAJ 4N6CA 3K33A 4FAPB 1Z6AA 2Y3DA 3HNKA 2LIGA 2EINC 4CS8A 2HFIA 3ZIBA 2E87A 1Q0MA 3B71A 4ER9A 3NG1A 3OWTA 1VTMP 1N1CA 1F1MA 1OCRC 4MVRA 5BQIA 1HW1A 4DXWA 2J9VA 1MNDA 1A7VA 1OXKA 3DZAA 4YN0B 2Q00A 3DMDA 4JJFA 4CDVA 1GS9A 2IXNA 1FR0A 3N24A 4LACB 4K1OA 3NMIA 3MFNA 1YJGA 4MVMA 4I44A 5IY5C
chains in the Genus database with same CATH topology
3CAXA 3V5ZA 3V5YA 3U9MA 2P0NA 3U9JA 3V5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAX A;  3V5Z A;  3V5Y A;  3U9M A;  2P0N A;  3U9J A;  3V5X A; 
#chains in the Genus database with same CATH topology
 1YAR O;  1Z23 A;  3G50 A;  3RH3 A;  2HZ8 A;  3I4U A;  1YA7 O;  4XTK A;  5KYU B;  5B3I A;  1QQ3 A;  2Q4F A;  2M64 A;  2OCC C;  2VH3 A;  3ABK C;  3N0T A;  5COM A;  4OD4 A;  3QW1 A;  1D0Y A;  3EZI A;  1Y4C A;  1V54 C;  3DWW A;  3KH2 A;  2J7P D;  1YZA A;  4G0H A;  4AE4 B;  4IJJ A;  1LI5 A;  3GOR A;  3ZQV A;  1G4U S;  3IQC A;  4C3B A;  3AG1 C;  1U6H A;  1MQV A;  2ZXO A;  1CGN A;  1QKR A;  2GFH A;  1MMG A;  2DB4 A;  4HFF B;  4C7O A;  2OQM A;  1K04 A;  2JPU A;  4YJW A;  4MTO A;  1WWP A;  3DD7 A;  3TOM A;  1FFT C;  2NSF A;  4U5B E;  1ZU4 A;  3FXH A;  3S28 A;  1FFH A;  2Y39 A;  4CDY A;  1JRA A;  4CSA A;  1FTS A;  2EPL X;  4KNW A;  2W4M A;  3K6B A;  4Q4Z F;  4P9F A;  3JT1 A;  4N4W A;  4Z9J A;  3C18 A;  3W4Y A;  3U9J A;  1LE4 A;  3LUT B;  3B29 A;  2AP3 A;  4CS8 C;  3FOP A;  4NY3 A;  5L0J A;  3K1H A;  4MTG A;  1Q0D A;  1FNT c;  4RDA A;  2YKZ A;  1ZU5 A;  1YAU O;  4BJ6 C;  2QTV A;  5DVW A;  3AG4 C;  4BJ5 A;  4J32 B;  3DE8 A;  1NSG B;  2R05 A;  3DAF A;  1NG1 A;  5EHH A;  4IWB A;  4E0I A;  4EIY A;  4BPM A;  2KSF A;  1K40 A;  2R7X A;  2ICW G;  4W8P A;  2X0C A;  3U8P A;  4NTA A;  5KYX A;  2YLD A;  3E9V A;  1I4Z A;  1T6U A;  3FAP B;  1V55 C;  5JVE A;  3JCU Q;  3S27 A;  4WGY A;  1VYI A;  3V5Y A;  3ZWI A;  2P0N A;  1DOV A;  2LFD A;  2A0U A;  3I5P A;  2EIJ C;  4CS7 A;  2AU5 A;  4ULW A;  5AC4 A;  3WHN A;  2IXP A;  5FCL A;  1H9T A;  3EG9 B;  4RBN A;  3EZH A;  3W2W A;  5AC5 A;  1XZP A;  3JZ0 A;  2G62 A;  3NYL A;  2YVK A;  4J7Y A;  5AGF A;  1J8Y F;  4NTB A;  4XPX A;  5CI8 A;  3NRH A;  2H7B A;  2MWQ A;  2ETS A;  3DJU B;  4JZA A;  3TQO A;  1SR2 A;  1V74 B;  3QZC A;  2NPU A;  4XWJ A;  1AVO B;  4MW8 A;  4N06 A;  3C63 A;  3EHM A;  3ZDL A;  2YEV A;  3VRC A;  1R5I D;  1A0B A;  1C03 A;  2GA0 A;  3TJ6 A;  3JYY A;  3U5S A;  4I3M A;  1EQ1 A;  1OCC C;  1V4A A;  1JPN A;  3MLG A;  3LLK A;  4L6R A;  3EHN A;  5T3T A;  3JSZ A;  4ANJ A;  5JT4 A;  1JR8 A;  1XWJ A;  2F22 A;  4NQF A;  3JSE O;  4O6Y A;  1ZHX A;  4JC7 A;  5A6B D;  4WAB A;  2XL8 A;  2GWW A;  3F46 A;  1GQA A;  5BQG A;  2Q7R A;  3VAY A;  2EIM C;  3DM9 B;  1OW6 A;  1G8X A;  2M4E A;  3C8G B;  5D91 A;  2XXA B;  5KYX B;  1OQC A;  2VCB A;  3GAN A;  3GOD A;  3ZC4 A;  4E7S A;  4YL0 A;  5DS6 A;  4Q5S F;  2HV7 A;  1A7D A;  2CCY A;  4WJ0 A;  4PJM A;  3TJ5 A;  4G7O F;  4MVQ A;  5TJ5 E;  4E7Z A;  2HJ3 A;  4YT4 A;  3Q7L A;  3UNG C;  4CS9 C;  1MNE A;  1WAS A;  2WZG A;  2ZD9 A;  2BC5 A;  4MVU A;  2WVQ A;  3LNM B;  4K7B A;  2OEV A;  3B9Q A;  4YK5 A;  4LDR A;  3R7C A;  1VOM A;  1C02 A;  3UGO A;  4JTA B;  3KKB A;  3PHF 2;  3AGT A;  1LS4 A;  2W9Y A;  5CIV A;  2RD9 A;  2HSQ A;  2W45 A;  2EIL C;  2QUP A;  4YWQ A;  1LI7 A;  2XLW A;  4GEH A;  4XLP F;  3U2M A;  2NUP B;  2HKV A;  2C03 A;  2L7A A;  3F47 A;  3V7O A;  4IAO A;  2DYS C;  2P1A A;  1CPQ A;  4G7Z F;  1TKN A;  1NZE A;  4MW3 A;  1B68 A;  3IHU A;  1VB5 A;  3M1C B;  5A6B A;  1Z7Q c;  3RQF A;  3RYL A;  3W8I A;  2HS5 A;  1VK5 A;  1OCO C;  5E3C A;  2R7O A;  5D92 A;  2CYD A;  4MS2 A;  4U5H A;  5DQT A;  3OA1 A;  1OW7 A;  3M79 A;  3ATP A;  3ITF A;  1APC A;  2L81 A;  4ZLD A;  1BZ4 A;  2XM4 A;  3SNH A;  2NUT A;  3SYN A;  2LCH A;  4PJN A;  3WG7 C;  2YZS A;  3GWL A;  2R7V A;  2Q9A A;  1RMV A;  1HMD A;  2VB6 A;  4CS9 A;  1LKX A;  1YDI A;  3ZG1 A;  1SZI A;  3SXZ A;  4CBE A;  1PCX A;  2PX0 A;  1JMW A;  3DAG A;  4XPW A;  4EKW A;  1CGM E;  2OG2 A;  4RD9 A;  2V3C C;  3TUL A;  3IQ5 A;  2IXM A;  3A11 A;  3US6 A;  2UUH A;  1KU2 A;  2PX3 A;  1WN0 A;  2A68 F;  3O39 A;  4NTF A;  5T1D B;  3RFY A;  3ASO C;  1T6Q A;  2J8W A;  2WVN A;  3DKA A;  3SEO A;  3LEO A;  4LLC A;  3X1O A;  1O87 A;  1LS1 A;  3I5Q A;  3LS1 A;  3EGD A;  1NBB A;  1ST6 A;  1TWA A;  4JEB A;  5HV9 A;  4U5G A;  4JIO A;  3Q6M A;  4OIR F;  3PCV A;  3NYM A;  4GYT A;  4U5F E;  1M56 C;  4YT2 A;  1U0B B;  2AWY A;  2DGJ A;  4Q7C A;  1OR3 A;  3HNI A;  3B0V C;  4WGZ A;  4AK9 A;  5KYY B;  3ZSU A;  1RJ9 A;  1Q0F A;  3SP1 A;  5A6J A;  4MQ9 F;  2IM8 A;  1T5O A;  3FOO A;  5B1A C;  5F5F A;  4U9E A;  3X2Q C;  3KYI A;  2R9R B;  2A69 F;  1FMW A;  3WAQ A;  1M2V B;  3BEH A;  3EGX A;  1E84 A;  4OIP F;  1TFK B;  1H9G A;  2J45 A;  3C62 A;  4IB4 A;  4CIP A;  2A0B A;  5L3V A;  1PD1 A;  5COG A;  4CJG A;  3K7D A;  4P6I C;  2J46 A;  3MX3 A;  2KYH A;  5E3A A;  1J8M F;  2VAS A;  4IAR A;  3RVZ A;  4DJ9 A;  4JTD B;  2WB7 A;  1ZHY A;  2ASR A;  1RJ9 B;  1ZW3 A;  3L8I A;  4DBQ A;  4DBR A;  4CSA C;  3C7J A;  4BEM J;  4C7O B;  2HUJ A;  4XLN F;  2Y3H A;  1BBH A;  3RIP A;  4C3D A;  4JCH A;  4YT8 A;  3UMK A;  4W8K A;  3H65 A;  2EPN A;  4PJL A;  1YLM A;  3R2P A;  4A4A A;  1RXQ A;  3H2U A;  3TOL A;  4CDA A;  3O10 A;  4BEJ A;  2L6F A;  4E17 A;  3LEV A;  3ABM C;  4DOZ A;  2NUT B;  1NLX A;  1H6G A;  3C8G A;  4OIO F;  2X51 A;  2OKU A;  2R7S A;  2VC9 A;  1EKY A;  4E0H A;  1T9K A;  3MYF A;  4EUK B;  3Q7G A;  1QLE C;  3GWN A;  1HE9 A;  3RW0 A;  2ZXR A;  3FMS A;  4G78 A;  3EH1 A;  4OIN F;  3CEX A;  1H7I A;  1Q0K A;  3NKD A;  5DS4 A;  1QZX A;  2KW3 C;  2VCC A;  1KNY A;  2XLM A;  3C8Z A;  1G4W R;  2XLV A;  3AG2 C;  3NYJ A;  3NDB B;  4O6M A;  4H4K C;  2XXA A;  3PDM P;  1TWH A;  2KC3 A;  2P61 A;  1HW2 A;  1OKK A;  3TD7 A;  2HMQ A;  3C8G D;  3S84 A;  3K1I A;  1ZHT A;  3GEI A;  3UR3 C;  4BJ1 A;  3BRJ A;  4CIH A;  4PAC A;  2GAQ A;  3EQL F;  3RQG A;  4Z9I A;  5L0H A;  1A7E A;  3Q6N A;  1UG7 A;  3QVY A;  3G4Z A;  2XLE A;  2XSE A;  3KMI A;  3MYI A;  3JYH A;  5GPG B;  3PMR A;  1JOG A;  3RF3 A;  4ZLC A;  2R25 A;  2J7P A;  3IQT A;  1OW8 A;  1LVK A;  1T01 A;  4DVZ A;  2YL3 A;  4DRH B;  3IEE A;  3OEO A;  4KBL A;  2J0W A;  3H2V A;  4M63 A;  3CSK A;  2TMV P;  4XEK A;  2NUP A;  1G5Z A;  4JW1 A;  5L3Q A;  3U2L A;  2HV6 A;  4JJG A;  1D0Z A;  2XM0 A;  5DLJ A;  1VLT A;  2A1D D;  5L0F A;  1E86 A;  3M4C A;  3POV A;  2O9X A;  1Y6D A;  3HTK C;  3L34 A;  3T6J A;  1YYJ A;  3J06 A;  2J9U A;  1Z63 A;  1Q0G A;  3HNJ A;  2CW0 F;  4QI0 A;  1QVX A;  1NU9 C;  2G3V A;  2I8B A;  2Z15 A;  5JP7 A;  2R7T A;  3DI5 A;  2KGO A;  3ZTZ A;  3GM3 A;  2IXO A;  3K66 A;  3LLI A;  1VLS A;  3UMH A;  4PJJ A;  1LPE A;  2PBE A;  3QVZ A;  1E83 A;  5KYN A;  2W4B A;  2JD3 A;  2XS1 A;  4HE8 D;  4EHP A;  1M57 C;  2D5R B;  1OXB A;  2Q9B A;  3SXK A;  1PD0 A;  2YWA A;  2L6G A;  4H54 A;  3DJN B;  4O6N A;  2KQ9 A;  4BJ5 C;  4D4N A;  2VCA A;  3AJM A;  2G3K A;  5A6K A;  1NFN A;  3K1I C;  3KL4 A;  2R7W A;  4EBB A;  2FGY A;  3L1M A;  1S7Z A;  1ZVZ A;  2J0X A;  3LNR A;  2CGE A;  3FVY A;  2EPM X;  3GEE A;  2XLD A;  3GM1 A;  4JTC B;  2A6E F;  2FAP B;  4KC9 A;  4G7H F;  4MVZ A;  5EK0 A;  1YZC A;  1NFO A;  5JUA A;  4AX2 A;  2WVO A;  4JCZ A;  3B0P A;  1PV3 A;  3ZVR A;  2NSG A;  4U5E E;  2Q9C A;  1ORY A;  2LFF A;  1GGQ A;  1MMD A;  2XLH A;  3A9C A;  3DXJ F;  2I15 A;  4BJ6 A;  3DM5 A;  2OOC A;  1W2W A;  3L8J A;  1HE1 A;  2UUI A;  4DRI B;  3U0C A;  1KTM A;  2PNO A;  5DS5 A;  2H7O A;  2WZL A;  3EFO A;  3QW0 A;  4BJT A;  3W8H A;  4U9D A;  2P7V A;  2H7V C;  2FFH A;  3VYW A;  1QSP A;  3M15 A;  1I5N A;  5F5H A;  5K0I A;  3AOU A;  2H8A A;  1EI7 A;  3LAY A;  2P6V A;  1TWG A;  1FAP B;  1LM3 B;  2CNW A;  4LDK A;  4PFP A;  1GM5 A;  4Z9H A;  1BR4 A;  5A6A A;  2B0H A;  2BL2 A;  1D1A A;  1HY5 A;  2ZXP A;  4K0D A;  1SYQ A;  4LDQ A;  2IBF A;  2LP4 A;  4CJO A;  3VM6 A;  2Y3B A;  2HSB A;  1D1B A;  3AQB A;  2IOQ A;  4OIQ F;  2B0J A;  2KNH A;  3FAJ A;  4YL1 A;  4AE4 A;  2JX0 A;  4IAQ A;  2MHR A;  2R7U A;  1SF8 A;  4C3E A;  1E2X A;  3U8V A;  4JUR I;  4KNV A;  3RVY A;  1ZHW A;  5EGY A;  2QE9 A;  4XPY A;  4J7T A;  5COF A;  3VF0 A;  3GM2 A;  1DOW A;  1K05 A;  1MMN A;  2R7Q A;  1O3U A;  3ECS A;  1AEP A;  1WGW A;  2J9W A;  3IQ6 A;  5DQZ A;  1ZW2 A;  2LQG A;  2R02 A;  5E33 A;  4EWC A;  4PR9 A;  1M2O A;  4QDL A;  1TFO B;  1RKE B;  1RCP A;  1A41 A;  2XL4 A;  3SXM A;  3SXY A;  5KYW B;  4U5C E;  1TQG A;  1UFB A;  4I1O B;  4JKV A;  4XQ1 A;  1M6T A;  3S9O A;  1VMA A;  3M4B A;  4P9T A;  3QTH A;  3L0I A;  1M2V A;  3EGX B;  3KYJ A;  2Y3G A;  3LJB A;  3CAX A;  5T3W A;  2YLG A;  1YA9 A;  2XRH A;  1I4Y A;  3CZ6 A;  2LK4 A;  4LLE A;  2AVK A;  2AWC A;  3U9M A;  4AL0 A;  2MYS A;  1LIH A;  2OJQ A;  5BUO A;  5CI9 A;  1R4T A;  5KYU A;  4PFO A;  1QPU A;  1BDJ B;  3HNL A;  1RKE A;  4U5D E;  2WL8 A;  5KYW A;  3NMK A;  4ULV A;  3T6G B;  5F28 E;  2WZF A;  2KK1 A;  3E70 C;  3NKE A;  4EBJ A;  2DI3 A;  4PK4 A;  3UMI A;  1EA8 A;  4MTF A;  1BR1 A;  1ZHZ A;  5JLI A;  2XL6 A;  3MBG A;  4DVY P;  2IYL D;  1WOL A;  1XZQ A;  2YQY A;  3QMK A;  1RKC A;  2PF4 E;  3EG9 A;  3EJN A;  5L0C A;  1SMY F;  2LSE A;  3ZQY A;  1ZYR F;  1L7C A;  4JRZ A;  4XEV A;  3JTL O;  2R7R A;  4J30 B;  1Z5Z A;  5L0I A;  2KJG A;  4FX5 A;  3JRT A;  1O5H A;  1C17 M;  4ONS A;  2R03 A;  1YVI A;  2QLA A;  3U3B A;  1HMO A;  3T6B A;  3G4X A;  5FZT A;  5B1B C;  1OKK D;  1T6I A;  2XLO A;  5KYY A;  3IPM O;  1D0X A;  1WTY A;  4OD5 A;  1ZZP A;  3AGU A;  3B0U X;  256B A;  4JEA A;  2ZPA A;  2CNW D;  3FDQ A;  1JPJ A;  1TWC A;  2YL0 A;  1IZM A;  1FMV A;  3TK0 A;  3NMJ A;  2OJE D;  1L3P A;  4R32 A;  1MMA A;  2EPK X;  2QNL A;  1JAF A;  4NC3 A;  4O79 A;  4HFK B;  2DYR C;  1YYX A;  2HMZ A;  3HKK A;  4IGG A;  1S05 A;  2L9J A;  4JVS A;  2OEX A;  4AL1 A;  5A69 A;  1CGO A;  1WAT A;  2YL7 A;  4E18 A;  2EPO A;  4I1M A;  3KPH A;  3SZR A;  1E85 A;  3WOD F;  4MVS A;  4D4X A;  2J9B A;  2NG1 A;  2D4U A;  1VYK A;  3T9O A;  4MVO A;  2ZXW C;  2EIK C;  4YL3 A;  4FWV A;  4NCQ A;  4B6I A;  5L0D A;  2CDQ A;  2YL1 A;  5B3S C;  3EGD B;  3S90 A;  4A2N B;  4DRJ B;  4F4B A;  2YLI A;  4N6H A;  4IRU A;  3N2Z B;  5L0G A;  3RQE A;  3LES A;  1U89 A;  5HSW A;  4JE9 A;  5JRA A;  5JS5 A;  4CX9 A;  1BR2 A;  2RSE B;  3AG3 C;  3EFO B;  3CQZ A;  1AUE A;  2QY9 A;  2OU6 A;  3V5Z A;  2C04 A;  1Z3I X;  1IW7 F;  3AQC A;  4LER A;  4KI2 A;  1LE2 A;  1NU7 D;  3HJC A;  2V26 A;  3S0X A;  3ASN C;  4UDV A;  3ABL C;  3DE9 A;  1TR2 A;  1OR2 A;  2A6H F;  3RKO F;  5BQH A;  2PFD A;  4QI2 A;  2Q3T A;  2BE5 F;  1D1C A;  3JRM O;  2L6H A;  3O55 A;  3O6X A;  3LS0 A;  3V5X A;  4EBK A;  3EPV A;  1ORJ A;  2GDC A;  2PP4 A;  3HLZ A;  4GQH A;  3W2V A;  4BG0 A;  1OCZ C;  2HJM A;  3U3F A;  1CPR A;  2LD6 A;  4O7G A;  3EH2 A;  2XS8 A;  5JSL A;  3FHD A;  4XEF A;  3S29 A;  3ZTM A;  2YRF A;  3GEH A;  3UGP A;  1ORS C;  3T4R A;  5E2Q A;  4MND A;  4X0R A;  4YT5 A;  2Y69 C;  2YHS A;  4FES A;  4HEA J;  4N6C A;  3K33 A;  4FAP B;  1Z6A A;  2Y3D A;  3HNK A;  2LIG A;  2EIN C;  4CS8 A;  2HFI A;  3ZIB A;  2E87 A;  1Q0M A;  3B71 A;  4ER9 A;  3NG1 A;  3OWT A;  1VTM P;  1N1C A;  1F1M A;  1OCR C;  4MVR A;  5BQI A;  1HW1 A;  4DXW A;  2J9V A;  1MND A;  1A7V A;  1OXK A;  3DZA A;  4YN0 B;  2Q00 A;  3DMD A;  4JJF A;  4CDV A;  1GS9 A;  2IXN A;  1FR0 A;  3N24 A;  4LAC B;  4K1O A;  3NMI A;  3MFN A;  1YJG A;  4MVM A;  4I44 A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 3CAX A;  3V5Z A;  3V5Y A;  3U9M A;  2P0N A;  3U9J A;  3V5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...