3V5XA

Structure of fbxl5 hemerythrin domain, c2 cell
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
151
Chain Sequence
b'FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQYNVHKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 68
structure length 151
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5xA00
3CAXA 3U9MA 2P0NA 3V5ZA 3V5XA 3U9JA 3V5YA
chains in the Genus database with same CATH superfamily
5JLIA 2A0UA 3FHDA 4NTBA 3RQFA 3UGPA 2NUTB 3DM5A 4JEBA 4MNDA 5T3TA 2YVKA 5A6KA 1OW6A 2LFDA 3K1IC 4DBRA 4Q4ZF 2KSFA 4ER9A 2KGOA 2L7AA 4E7ZA 3R7CA 1AVOB 3SXZA 4O79A 1Y4CA 2OEVA 1CGOA 1DOVA 3WG7C 1WOLA 4JTDB 5CIVA 2CYDA 3KH2A 2J9WA 1MMDA 2CW0F 1MNEA 4KNWA 1R5ID 3S29A 4P9FA 5L3QA 3VRCA 1Q0GA 1KU2A 3ZSUA 4IB4A 2WZFA 5DS4A 3NMJA 2XL6A 3CQZA 3RVZA 1A7DA 2KK1A 2OCCC 4Z9HA 3SZRA 1LM3B 3U0CA 4M63A 4LACB 1WN0A 2VB6A 1OXKA 2YL3A 4CBEA 4F4BA 3QZCA 4J32B 3QVYA 2Q9BA 3ITFA 4PACA 4CJGA 1M2OA 1APCA 2XL8A 1T9KA 2AWCA 2G3VA 3C8ZA 1IW7F 4D4NA 1TWGA 1FFHA 4U5EE 5JP7A 3T4RA 3FMSA 2GWWA 1Z63A 1WWPA 1M57C 2H7OA 4G7OF 1G4WR 2PFDA 3RW0A 1JMWA 1VLTA 4JE9A 4MVZA 4DVZA 2XLMA 3QTHA 3KKBA 1E2XA 1WATA 3B29A 3JRTA 3MX3A 4AE4A 2A0BA 3DE8A 4RBNA 4MTFA 4U5HA 3HTKC 3MBGA 2LSEA 2R03A 4HE8D 1FTSA 1VYIA 2W4MA 4IJJA 2NG1A 4Z9JA 4JEAA 3FDQA 1MMNA 1LE4A 2H8AA 1C02A 3M4CA 1FMVA 2J46A 3LESA 5DQTA 1NFNA 2MWQA 3ABLC 2R02A 3M4BA 4JURI 3U9MA 2NUTA 3OEOA 4BJ5C 1TWCA 4Q5SF 3SXKA 2DYRC 4YT8A 1BZ4A 1MMGA 4BEJA 3DM9B 4EWCA 5AC4A 4PFOA 3ZDLA 1ZHXA 3EPVA 1QQ3A 1B68A 1U6HA 4G7HF 4DBQA 5T3WA 3PHF2 4XLPF 1O5HA 1OCZC 4HFFB 5KYNA 4U5FE 4LDKA 3C8GD 2YHSA 4JW1A 4OIRF 5L3VA 3LEOA 4G78A 3S0XA 3VM6A 3U2LA 1HE1A 2LP4A 2V26A 5KYWB 2XLHA 1FNTc 2HZ8A 1YZAA 4IWBA 1IZMA 3AGTA 3MFNA 3GWNA 2PNOA 1RXQA 1VOMA 2OQMA 2L6HA 1Z3IX 2YKZA 3I4UA 3JSZA 3OWTA 1QVXA 1VMAA 1ORSC 3X1OA 1A7VA 2HFIA 2AP3A 2L81A 2XS8A 2QE9A 1U89A 3FOOA 3RYLA 1OR2A 1ST6A 2HJ3A 2DYSC 5KYYB 4QI2A 4B6IA 1FR0A 1ZHYA 1GGQA 2PX0A 3DJUB 3NMIA 4QDLA 4E17A 2JX0A 3T6BA 2J8WA 1RKEB 1AUEA 2VC9A 3G4ZA 3HNKA 1TKNA 3DZAA 3EJNA 4N4WA 2Q4FA 2OKUA 2FFHA 2IBFA 3LAYA 2VCBA 3FOPA 4AK9A 5L0HA 3LJBA 2OU6A 1PV3A 1FMWA 1PCXA 1TQGA 1ZHTA 3DD7A 1RMVA 5JT4A 3JT1A 4NCQA 4BJ5A 4ANJA 2EPMX 3B0VC 1LS4A 2AU5A 4FESA 1CGNA 4I3MA 5EHHA 1XZPA 1V74B 3POVA 2J7PD 4JCZA 3QW0A 3U9JA 4ULWA 5F5HA 2HV6A 3WHNA 4U5CE 2IXNA 2LIGA 1XZQA 4H4KC 3GORA 3UMHA 2R9RB 2LD6A 1JPNA 3AJMA 1ZW3A 1NG1A 2CDQA 1YVIA 3ASOC 3TULA 5L0IA 2D5RB 1SMYF 3IQTA 3V5ZA 2IXOA 2C04A 2DI3A 2W4BA 3ECSA 3O10A 3K66A 4RD9A 4YJWA 3WAQA 4WABA 5EGYA 5JUAA 1CPQA 2XLOA 3LS1A 3W8HA 4DOZA 1E85A 3KL4A 1EI7A 2Q9CA 3DJNB 1E84A 5B1AC 3EFOB 4MW8A 2EPKX 3S90A 3TD7A 5KYWA 1Q0FA 4DRJB 4MVRA 3FVYA 1T6IA 2NSGA 3DXJF 4JJGA 1UG7A 4YWQA 2J45A 2GDCA 3DMDA 1FAPB 4MS2A 5DLJA 1J8MF 4GEHA 1RJ9B 4JTAB 4E18A 3K33A 1L7CA 3BRJA 5TJ5E 1TFKB 1ZHZA 2P0NA 3L1MA 4RDAA 2LFFA 1ZU4A 2J9VA 2TMVP 4HFKB 4PJJA 1M2VB 2JD3A 2XLDA 5A6JA 1OCOC 1O3UA 4WGYA 1F1MA 4XEKA 3TQOA 3E9VA 5KYYA 4C3BA 3EGXB 4H54A 2GAQA 2YQYA 3M15A 1JR8A 4MVMA 1QZXA 1ORJA 3W2VA 1TFOB 1H9GA 2IOQA 2KC3A 2Q3TA 2WVNA 3JZ0A 3LNMB 2ZXRA 1JAFA 1V4AA 1A0BA 2GA0A 3K6BA 4K7BA 4ULVA 1Z7Qc 1AEPA 1S7ZA 2A6EF 1OW7A 2KW3C 5A6AA 2YEVA 4O6YA 1E83A 2OEXA 3N0TA 2X0CA 2XLWA 3W8IA 1LE2A 4NTFA 1A7EA 4XPYA 2Y3GA 2EILC 5E3AA 4LLCA 3AG2C 1LPEA 3IQCA 1Z6AA 5BQGA 5E33A 5A6BD 4PR9A 2B0JA 3QVZA 3LEVA 4BJTA 4PJNA 2EINC 4U9EA 2NUPB 2Y69C 2YL0A 1HY5A 1T6UA 3F46A 4E7SA 4J30B 3SNHA 2E87A 3PCVA 4CDVA 1UFBA 4QI0A 1ZZPA 3U3FA 3GEIA 1KNYA 3LUTB 3NDBB 2YRFA 1OXBA 1OCCC 2J9UA 3L8JA 1G5ZA 4YK5A 3SYNA 4CS8A 3C8GA 2A69F 2AVKA 3VF0A 3C18A 1K04A 1Z23A 2BC5A 3I5PA 4GYTA 1BDJB 1OQCA 4XPWA 4CSAA 4NQFA 2UUHA 3EFOA 1HMOA 1J8YF 1SZIA 1ZW2A 2IXPA 4GQHA 2R7XA 4FX5A 3NMKA 4LDQA 1TWHA 2UUIA 2J9BA 1WGWA 1KTMA 3A9CA 3ZTMA 1LIHA 1RJ9A 4NY3A 4XLNF 4JVSA 1YLMA 5KYXB 3MYIA 1TR2A 3TJ5A 1OW8A 2XL4A 4P9TA 2MHRA 2Y39A 4IARA 1VTMP 3NKDA 3HNIA 1NU7D 1M2VA 3WODF 4I44A 3Q6NA 3JYHA 3HLZA 1D1BA 2YLGA 2QNLA 4PJMA 4MVQA 3SXMA 2GFHA 3EGXA 5DVWA 3S28A 3W4YA 2EIJC 2VCAA 2HUJA 2JPUA 3MLGA 3O55A 3EQLF 5GPGB 3TOLA 3TOMA 4AL0A 1LI5A 4JCHA 3PDMP 3R2PA 4O6NA 4N06A 4NC3A 3V5YA 1N1CA 2HSQA 2VCCA 3IQ6A 2QY9A 3E70C 4IRUA 5FZTA 1BBHA 4U5BE 3S27A 3T6GB 3W2WA 2J7PA 4OIPF 2P61A 2O9XA 4G7ZF 2R05A 256BA 2CNWA 2I15A 4N6CA 2PX3A 4U9DA 3AG3C 2Z15A 2C03A 2W9YA 1Z5ZA 4L6RA 4WJ0A 4EBKA 3LLKA 2A1DD 3G50A 3U2MA 3K7DA 3GEEA 1HW1A 1D0XA 2A68F 1C03A 2NUPA 3U8PA 3NRHA 1RKCA 4C3DA 5D91A 4AX2A 4U5DE 4LDRA 1YYJA 5COFA 2WL8A 3SXYA 1WTYA 3T9OA 4XWJA 1H9TA 1U0BB 3NG1A 4G0HA 3GEHA 3IQ5A 5E3CA 4MTOA 3GODA 4NTAA 3ATPA 5DS5A 4CIPA 2CGEA 1FFTC 3T6JA 1YAUO 4DRHB 3J06A 5F5FA 3B71A 4K0DA 2YLDA 2HMZA 3SP1A 2WZGA 1JPJA 3Q7GA 2VH3A 5L0FA 2ZXWC 1OKKD 3S84A 3B0UX 2CNWD 2R7UA 3AG4C 2WVQA 4Q7CA 2XXAA 1LS1A 2HV7A 2HJMA 2WB7A 4XQ1A 4BG0A 5E2QA 3EH1A 4YN0B 1EKYA 1VK5A 2Q9AA 2HS5A 4YT2A 4JZAA 5T1DB 3CEXA 2A6HF 5KYXA 2WZLA 3ABKC 4KNVA 2HSBA 4W8PA 4HEAJ 2L6FA 1ZYRF 3CAXA 2OOCA 2OJQA 2YLIA 4J7TA 3S9OA 1GM5A 4JTCB 1I4YA 4U5GA 2LCHA 5IY5C 3EZIA 4O6MA 2Y3HA 1G8XA 4D4XA 1K05A 1SF8A 2QUPA 2V3CC 3GM1A 4MVSA 1TWAA 4WGZA 4BPMA 1MNDA 1MMAA 1Y6DA 2X51A 5B1BC 4CS8C 2OG2A 3KYIA 4JJFA 4P6IC 3SEOA 3U5SA 5A6BA 4A2NB 3VAYA 3BEHA 1GS9A 4CSAC 5FCLA 4DRIB 3JRMO 3DAGA 4XEVA 3GANA 4EBJA 4YT4A 3LLIA 1VYKA 3RQGA 2I8BA 2R7VA 4N6HA 2R7OA 1BR4A 1RKEA 3NKEA 2EPOA 4EBBA 4CS7A 4C7OB 5JS5A 2XLVA 1HE9A 2YL7A 3LNRA 3VYWA 2R7QA 2AWYA 3UGOA 2EPNA 2G3KA 3NYLA 2HMQA 2J0XA 4ZLCA 5CI8A 1NZEA 3HNLA 4JC7A 3CZ6A 2DB4A 1R4TA 2HKVA 5BUOA 2XM4A 2NPUA 3A11A 1QSPA 5F28E 1OCRC 4CIHA 2WVOA 2XM0A 3B9QA 3EG9B 3OA1A 3FXHA 5JRAA 4X0RA 2M4EA 4DJ9A 2BE5F 4CDYA 2LK4A 2QTVA 2G62A 2Y3DA 5A69A 1EQ1A 3QW1A 4DVYP 4BJ6C 2KNHA 3EGDB 5JVEA 1RCPA 4IAQA 4I1MA 3TJ6A 1D1CA 2ZXOA 1QLEC 2IM8A 2PF4E 4MW3A 3DAFA 4YL1A 1GQAA 4MTGA 4Z9IA 3TK0A 4AL1A 3ABMC 3I5QA 1DOWA 5DQZA 5B3IA 1T01A 1YYXA 1QPUA 4OD5A 5CI9A 3ZC4A 4E0HA 2EIMC 3DI5A 3GM2A 2IYLD 3ASNC 1LVKA 3KYJA 2NSFA 3UMKA 2EPLX 1Q0MA 3PMRA 1PD1A 5EK0A 5BQIA 1PD0A 3AQCA 4LERA 5AC5A 4UDVA 4EUKB 4XTKA 4OINF 3C62A 2BL2A 5KYUB 2XXAB 1Q0DA 1XWJA 1VLSA 2ZD9A 2ASRA 3MYFA 2ICWG 2L6GA 3H2VA 2Q7RA 2L9JA 1YZCA 2ZXPA 4FAPB 2R7WA 3JYYA 3UR3C 1ORYA 2YL1A 3US6A 3GM3A 4CJOA 3KMIA 1NFOA 1T5OA 4OIOF 2YZSA 1MQVA 2PP4A 1YA7O 2RD9A 3C7JA 3HJCA 3RFYA 2DGJA 3ZIBA 3RVYA 1A41A 3K1IA 4KC9A 3EHMA 4BEMJ 3U3BA 4KBLA 3U8VA 3B0PA 5COGA 2XSEA 3ZTZA 3AGUA 3ZVRA 1E86A 3FAJA 1D0YA 4C7OA 1NBBA 1M6TA 3AQBA 3AOUA 1V55C 2W45A 2RSEB 2ETSA 3M1CB 2XLEA 2Y3BA 3Q6MA 5HV9A 1G4US 3HKKA 1LI7A 1L3PA 1OR3A 1C17M 4BJ6A 1OKKA 2EIKC 3F47A 4K1OA 5HSWA 2D4UA 1JOGA 3L8IA 4PK4A 3EG9A 4O7GA 4I1OB 5BQHA 1JRAA 2P1AA 5AGFA 1LKXA 1HW2A 1W2WA 3FAPB 3HNJA 3ZWIA 3NYMA 4CS9C 3RIPA 4EHPA 4IGGA 3V5XA 2P7VA 1CPRA 4EKWA 3EGDA 2P6VA 3C63A 3JCUQ 5B3SC 2Q00A 3IPMO 1NSGB 5L0GA 4XEFA 4YL3A 4OIQF 1O87A 1HMDA 3DWWA 3O6XA 3ZQVA 3EH2A 4MQ9F 2CCYA 2FGYA 2XS1A 2R7SA 4ZLDA 4A4AA 3H2UA 5JSLA 3V7OA 3DE9A 3RQEA 1T6QA 2ZPAA 2R7RA 1Q0KA 2R25A 4IAOA 3RKOF 2KJGA 5COMA 4CDAA 3ZQYA 1NLXA 1ZVZA 5KYUA 1D1AA 1M56C 2LQGA 3NYJA 3LS0A 3AG1C 4J7YA 1ZHWA 2XRHA 3KPHA 4JIOA 4LLEA 4MVUA 4JRZA 1YARO 3UNGC 2J0WA 3ZG1A 2FAPB 2PBEA 2QLAA 1K40A 1H6GA 1I4ZA 3DKAA 3L0IA 3G4XA 1BR1A 4YL0A 3Q7LA 1WASA 4JKVA 4KI2A 3JSEO 4PJLA 3N24A 4W8KA 2KYHA 1D0ZA 4DXWA 1I5NA 3QMKA 4CX9A 2R7TA 2VASA 3UMIA 3IEEA 4PFPA 4R32A 4OD4A 5DS6A 3EHNA 2KQ9A 4XPXA 3X2QC 3EZHA 1YJGA 4YT5A 4CS9A 3GWLA 1BR2A 1EA8A 3JTLO 1SYQA 4EIYA 2H7VC 1ZU5A 4FWVA 2YWAA 3RH3A 3RF3A 2B0HA 3L34A 5L0DA 1V54C 4MVOA 3C8GB 4AE4B 2M64A 2F22A 4ONSA 4BJ1A 5K0IA 5L0CA 3CSKA 2IXMA 5D92A 5L0JA 1YA9A 3O39A 1CGME 2OJED 2MYSA 1NU9C 3N2ZB 4C3EA 3IHUA 1SR2A 1S05A 1YDIA 2H7BA 4E0IA 3M79A 3K1HA 1VB5A 1H7IA 3H65A 1QKRA
chains in the Genus database with same CATH topology
3CAXA 3U9MA 2P0NA 3V5ZA 3V5XA 3U9JA 3V5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAX A;  3U9M A;  2P0N A;  3V5Z A;  3V5X A;  3U9J A;  3V5Y A; 
#chains in the Genus database with same CATH topology
 5JLI A;  2A0U A;  3FHD A;  4NTB A;  3RQF A;  3UGP A;  2NUT B;  3DM5 A;  4JEB A;  4MND A;  5T3T A;  2YVK A;  5A6K A;  1OW6 A;  2LFD A;  3K1I C;  4DBR A;  4Q4Z F;  2KSF A;  4ER9 A;  2KGO A;  2L7A A;  4E7Z A;  3R7C A;  1AVO B;  3SXZ A;  4O79 A;  1Y4C A;  2OEV A;  1CGO A;  1DOV A;  3WG7 C;  1WOL A;  4JTD B;  5CIV A;  2CYD A;  3KH2 A;  2J9W A;  1MMD A;  2CW0 F;  1MNE A;  4KNW A;  1R5I D;  3S29 A;  4P9F A;  5L3Q A;  3VRC A;  1Q0G A;  1KU2 A;  3ZSU A;  4IB4 A;  2WZF A;  5DS4 A;  3NMJ A;  2XL6 A;  3CQZ A;  3RVZ A;  1A7D A;  2KK1 A;  2OCC C;  4Z9H A;  3SZR A;  1LM3 B;  3U0C A;  4M63 A;  4LAC B;  1WN0 A;  2VB6 A;  1OXK A;  2YL3 A;  4CBE A;  4F4B A;  3QZC A;  4J32 B;  3QVY A;  2Q9B A;  3ITF A;  4PAC A;  4CJG A;  1M2O A;  1APC A;  2XL8 A;  1T9K A;  2AWC A;  2G3V A;  3C8Z A;  1IW7 F;  4D4N A;  1TWG A;  1FFH A;  4U5E E;  5JP7 A;  3T4R A;  3FMS A;  2GWW A;  1Z63 A;  1WWP A;  1M57 C;  2H7O A;  4G7O F;  1G4W R;  2PFD A;  3RW0 A;  1JMW A;  1VLT A;  4JE9 A;  4MVZ A;  4DVZ A;  2XLM A;  3QTH A;  3KKB A;  1E2X A;  1WAT A;  3B29 A;  3JRT A;  3MX3 A;  4AE4 A;  2A0B A;  3DE8 A;  4RBN A;  4MTF A;  4U5H A;  3HTK C;  3MBG A;  2LSE A;  2R03 A;  4HE8 D;  1FTS A;  1VYI A;  2W4M A;  4IJJ A;  2NG1 A;  4Z9J A;  4JEA A;  3FDQ A;  1MMN A;  1LE4 A;  2H8A A;  1C02 A;  3M4C A;  1FMV A;  2J46 A;  3LES A;  5DQT A;  1NFN A;  2MWQ A;  3ABL C;  2R02 A;  3M4B A;  4JUR I;  3U9M A;  2NUT A;  3OEO A;  4BJ5 C;  1TWC A;  4Q5S F;  3SXK A;  2DYR C;  4YT8 A;  1BZ4 A;  1MMG A;  4BEJ A;  3DM9 B;  4EWC A;  5AC4 A;  4PFO A;  3ZDL A;  1ZHX A;  3EPV A;  1QQ3 A;  1B68 A;  1U6H A;  4G7H F;  4DBQ A;  5T3W A;  3PHF 2;  4XLP F;  1O5H A;  1OCZ C;  4HFF B;  5KYN A;  4U5F E;  4LDK A;  3C8G D;  2YHS A;  4JW1 A;  4OIR F;  5L3V A;  3LEO A;  4G78 A;  3S0X A;  3VM6 A;  3U2L A;  1HE1 A;  2LP4 A;  2V26 A;  5KYW B;  2XLH A;  1FNT c;  2HZ8 A;  1YZA A;  4IWB A;  1IZM A;  3AGT A;  3MFN A;  3GWN A;  2PNO A;  1RXQ A;  1VOM A;  2OQM A;  2L6H A;  1Z3I X;  2YKZ A;  3I4U A;  3JSZ A;  3OWT A;  1QVX A;  1VMA A;  1ORS C;  3X1O A;  1A7V A;  2HFI A;  2AP3 A;  2L81 A;  2XS8 A;  2QE9 A;  1U89 A;  3FOO A;  3RYL A;  1OR2 A;  1ST6 A;  2HJ3 A;  2DYS C;  5KYY B;  4QI2 A;  4B6I A;  1FR0 A;  1ZHY A;  1GGQ A;  2PX0 A;  3DJU B;  3NMI A;  4QDL A;  4E17 A;  2JX0 A;  3T6B A;  2J8W A;  1RKE B;  1AUE A;  2VC9 A;  3G4Z A;  3HNK A;  1TKN A;  3DZA A;  3EJN A;  4N4W A;  2Q4F A;  2OKU A;  2FFH A;  2IBF A;  3LAY A;  2VCB A;  3FOP A;  4AK9 A;  5L0H A;  3LJB A;  2OU6 A;  1PV3 A;  1FMW A;  1PCX A;  1TQG A;  1ZHT A;  3DD7 A;  1RMV A;  5JT4 A;  3JT1 A;  4NCQ A;  4BJ5 A;  4ANJ A;  2EPM X;  3B0V C;  1LS4 A;  2AU5 A;  4FES A;  1CGN A;  4I3M A;  5EHH A;  1XZP A;  1V74 B;  3POV A;  2J7P D;  4JCZ A;  3QW0 A;  3U9J A;  4ULW A;  5F5H A;  2HV6 A;  3WHN A;  4U5C E;  2IXN A;  2LIG A;  1XZQ A;  4H4K C;  3GOR A;  3UMH A;  2R9R B;  2LD6 A;  1JPN A;  3AJM A;  1ZW3 A;  1NG1 A;  2CDQ A;  1YVI A;  3ASO C;  3TUL A;  5L0I A;  2D5R B;  1SMY F;  3IQT A;  3V5Z A;  2IXO A;  2C04 A;  2DI3 A;  2W4B A;  3ECS A;  3O10 A;  3K66 A;  4RD9 A;  4YJW A;  3WAQ A;  4WAB A;  5EGY A;  5JUA A;  1CPQ A;  2XLO A;  3LS1 A;  3W8H A;  4DOZ A;  1E85 A;  3KL4 A;  1EI7 A;  2Q9C A;  3DJN B;  1E84 A;  5B1A C;  3EFO B;  4MW8 A;  2EPK X;  3S90 A;  3TD7 A;  5KYW A;  1Q0F A;  4DRJ B;  4MVR A;  3FVY A;  1T6I A;  2NSG A;  3DXJ F;  4JJG A;  1UG7 A;  4YWQ A;  2J45 A;  2GDC A;  3DMD A;  1FAP B;  4MS2 A;  5DLJ A;  1J8M F;  4GEH A;  1RJ9 B;  4JTA B;  4E18 A;  3K33 A;  1L7C A;  3BRJ A;  5TJ5 E;  1TFK B;  1ZHZ A;  2P0N A;  3L1M A;  4RDA A;  2LFF A;  1ZU4 A;  2J9V A;  2TMV P;  4HFK B;  4PJJ A;  1M2V B;  2JD3 A;  2XLD A;  5A6J A;  1OCO C;  1O3U A;  4WGY A;  1F1M A;  4XEK A;  3TQO A;  3E9V A;  5KYY A;  4C3B A;  3EGX B;  4H54 A;  2GAQ A;  2YQY A;  3M15 A;  1JR8 A;  4MVM A;  1QZX A;  1ORJ A;  3W2V A;  1TFO B;  1H9G A;  2IOQ A;  2KC3 A;  2Q3T A;  2WVN A;  3JZ0 A;  3LNM B;  2ZXR A;  1JAF A;  1V4A A;  1A0B A;  2GA0 A;  3K6B A;  4K7B A;  4ULV A;  1Z7Q c;  1AEP A;  1S7Z A;  2A6E F;  1OW7 A;  2KW3 C;  5A6A A;  2YEV A;  4O6Y A;  1E83 A;  2OEX A;  3N0T A;  2X0C A;  2XLW A;  3W8I A;  1LE2 A;  4NTF A;  1A7E A;  4XPY A;  2Y3G A;  2EIL C;  5E3A A;  4LLC A;  3AG2 C;  1LPE A;  3IQC A;  1Z6A A;  5BQG A;  5E33 A;  5A6B D;  4PR9 A;  2B0J A;  3QVZ A;  3LEV A;  4BJT A;  4PJN A;  2EIN C;  4U9E A;  2NUP B;  2Y69 C;  2YL0 A;  1HY5 A;  1T6U A;  3F46 A;  4E7S A;  4J30 B;  3SNH A;  2E87 A;  3PCV A;  4CDV A;  1UFB A;  4QI0 A;  1ZZP A;  3U3F A;  3GEI A;  1KNY A;  3LUT B;  3NDB B;  2YRF A;  1OXB A;  1OCC C;  2J9U A;  3L8J A;  1G5Z A;  4YK5 A;  3SYN A;  4CS8 A;  3C8G A;  2A69 F;  2AVK A;  3VF0 A;  3C18 A;  1K04 A;  1Z23 A;  2BC5 A;  3I5P A;  4GYT A;  1BDJ B;  1OQC A;  4XPW A;  4CSA A;  4NQF A;  2UUH A;  3EFO A;  1HMO A;  1J8Y F;  1SZI A;  1ZW2 A;  2IXP A;  4GQH A;  2R7X A;  4FX5 A;  3NMK A;  4LDQ A;  1TWH A;  2UUI A;  2J9B A;  1WGW A;  1KTM A;  3A9C A;  3ZTM A;  1LIH A;  1RJ9 A;  4NY3 A;  4XLN F;  4JVS A;  1YLM A;  5KYX B;  3MYI A;  1TR2 A;  3TJ5 A;  1OW8 A;  2XL4 A;  4P9T A;  2MHR A;  2Y39 A;  4IAR A;  1VTM P;  3NKD A;  3HNI A;  1NU7 D;  1M2V A;  3WOD F;  4I44 A;  3Q6N A;  3JYH A;  3HLZ A;  1D1B A;  2YLG A;  2QNL A;  4PJM A;  4MVQ A;  3SXM A;  2GFH A;  3EGX A;  5DVW A;  3S28 A;  3W4Y A;  2EIJ C;  2VCA A;  2HUJ A;  2JPU A;  3MLG A;  3O55 A;  3EQL F;  5GPG B;  3TOL A;  3TOM A;  4AL0 A;  1LI5 A;  4JCH A;  3PDM P;  3R2P A;  4O6N A;  4N06 A;  4NC3 A;  3V5Y A;  1N1C A;  2HSQ A;  2VCC A;  3IQ6 A;  2QY9 A;  3E70 C;  4IRU A;  5FZT A;  1BBH A;  4U5B E;  3S27 A;  3T6G B;  3W2W A;  2J7P A;  4OIP F;  2P61 A;  2O9X A;  4G7Z F;  2R05 A;  256B A;  2CNW A;  2I15 A;  4N6C A;  2PX3 A;  4U9D A;  3AG3 C;  2Z15 A;  2C03 A;  2W9Y A;  1Z5Z A;  4L6R A;  4WJ0 A;  4EBK A;  3LLK A;  2A1D D;  3G50 A;  3U2M A;  3K7D A;  3GEE A;  1HW1 A;  1D0X A;  2A68 F;  1C03 A;  2NUP A;  3U8P A;  3NRH A;  1RKC A;  4C3D A;  5D91 A;  4AX2 A;  4U5D E;  4LDR A;  1YYJ A;  5COF A;  2WL8 A;  3SXY A;  1WTY A;  3T9O A;  4XWJ A;  1H9T A;  1U0B B;  3NG1 A;  4G0H A;  3GEH A;  3IQ5 A;  5E3C A;  4MTO A;  3GOD A;  4NTA A;  3ATP A;  5DS5 A;  4CIP A;  2CGE A;  1FFT C;  3T6J A;  1YAU O;  4DRH B;  3J06 A;  5F5F A;  3B71 A;  4K0D A;  2YLD A;  2HMZ A;  3SP1 A;  2WZG A;  1JPJ A;  3Q7G A;  2VH3 A;  5L0F A;  2ZXW C;  1OKK D;  3S84 A;  3B0U X;  2CNW D;  2R7U A;  3AG4 C;  2WVQ A;  4Q7C A;  2XXA A;  1LS1 A;  2HV7 A;  2HJM A;  2WB7 A;  4XQ1 A;  4BG0 A;  5E2Q A;  3EH1 A;  4YN0 B;  1EKY A;  1VK5 A;  2Q9A A;  2HS5 A;  4YT2 A;  4JZA A;  5T1D B;  3CEX A;  2A6H F;  5KYX A;  2WZL A;  3ABK C;  4KNV A;  2HSB A;  4W8P A;  4HEA J;  2L6F A;  1ZYR F;  3CAX A;  2OOC A;  2OJQ A;  2YLI A;  4J7T A;  3S9O A;  1GM5 A;  4JTC B;  1I4Y A;  4U5G A;  2LCH A;  5IY5 C;  3EZI A;  4O6M A;  2Y3H A;  1G8X A;  4D4X A;  1K05 A;  1SF8 A;  2QUP A;  2V3C C;  3GM1 A;  4MVS A;  1TWA A;  4WGZ A;  4BPM A;  1MND A;  1MMA A;  1Y6D A;  2X51 A;  5B1B C;  4CS8 C;  2OG2 A;  3KYI A;  4JJF A;  4P6I C;  3SEO A;  3U5S A;  5A6B A;  4A2N B;  3VAY A;  3BEH A;  1GS9 A;  4CSA C;  5FCL A;  4DRI B;  3JRM O;  3DAG A;  4XEV A;  3GAN A;  4EBJ A;  4YT4 A;  3LLI A;  1VYK A;  3RQG A;  2I8B A;  2R7V A;  4N6H A;  2R7O A;  1BR4 A;  1RKE A;  3NKE A;  2EPO A;  4EBB A;  4CS7 A;  4C7O B;  5JS5 A;  2XLV A;  1HE9 A;  2YL7 A;  3LNR A;  3VYW A;  2R7Q A;  2AWY A;  3UGO A;  2EPN A;  2G3K A;  3NYL A;  2HMQ A;  2J0X A;  4ZLC A;  5CI8 A;  1NZE A;  3HNL A;  4JC7 A;  3CZ6 A;  2DB4 A;  1R4T A;  2HKV A;  5BUO A;  2XM4 A;  2NPU A;  3A11 A;  1QSP A;  5F28 E;  1OCR C;  4CIH A;  2WVO A;  2XM0 A;  3B9Q A;  3EG9 B;  3OA1 A;  3FXH A;  5JRA A;  4X0R A;  2M4E A;  4DJ9 A;  2BE5 F;  4CDY A;  2LK4 A;  2QTV A;  2G62 A;  2Y3D A;  5A69 A;  1EQ1 A;  3QW1 A;  4DVY P;  4BJ6 C;  2KNH A;  3EGD B;  5JVE A;  1RCP A;  4IAQ A;  4I1M A;  3TJ6 A;  1D1C A;  2ZXO A;  1QLE C;  2IM8 A;  2PF4 E;  4MW3 A;  3DAF A;  4YL1 A;  1GQA A;  4MTG A;  4Z9I A;  3TK0 A;  4AL1 A;  3ABM C;  3I5Q A;  1DOW A;  5DQZ A;  5B3I A;  1T01 A;  1YYX A;  1QPU A;  4OD5 A;  5CI9 A;  3ZC4 A;  4E0H A;  2EIM C;  3DI5 A;  3GM2 A;  2IYL D;  3ASN C;  1LVK A;  3KYJ A;  2NSF A;  3UMK A;  2EPL X;  1Q0M A;  3PMR A;  1PD1 A;  5EK0 A;  5BQI A;  1PD0 A;  3AQC A;  4LER A;  5AC5 A;  4UDV A;  4EUK B;  4XTK A;  4OIN F;  3C62 A;  2BL2 A;  5KYU B;  2XXA B;  1Q0D A;  1XWJ A;  1VLS A;  2ZD9 A;  2ASR A;  3MYF A;  2ICW G;  2L6G A;  3H2V A;  2Q7R A;  2L9J A;  1YZC A;  2ZXP A;  4FAP B;  2R7W A;  3JYY A;  3UR3 C;  1ORY A;  2YL1 A;  3US6 A;  3GM3 A;  4CJO A;  3KMI A;  1NFO A;  1T5O A;  4OIO F;  2YZS A;  1MQV A;  2PP4 A;  1YA7 O;  2RD9 A;  3C7J A;  3HJC A;  3RFY A;  2DGJ A;  3ZIB A;  3RVY A;  1A41 A;  3K1I A;  4KC9 A;  3EHM A;  4BEM J;  3U3B A;  4KBL A;  3U8V A;  3B0P A;  5COG A;  2XSE A;  3ZTZ A;  3AGU A;  3ZVR A;  1E86 A;  3FAJ A;  1D0Y A;  4C7O A;  1NBB A;  1M6T A;  3AQB A;  3AOU A;  1V55 C;  2W45 A;  2RSE B;  2ETS A;  3M1C B;  2XLE A;  2Y3B A;  3Q6M A;  5HV9 A;  1G4U S;  3HKK A;  1LI7 A;  1L3P A;  1OR3 A;  1C17 M;  4BJ6 A;  1OKK A;  2EIK C;  3F47 A;  4K1O A;  5HSW A;  2D4U A;  1JOG A;  3L8I A;  4PK4 A;  3EG9 A;  4O7G A;  4I1O B;  5BQH A;  1JRA A;  2P1A A;  5AGF A;  1LKX A;  1HW2 A;  1W2W A;  3FAP B;  3HNJ A;  3ZWI A;  3NYM A;  4CS9 C;  3RIP A;  4EHP A;  4IGG A;  3V5X A;  2P7V A;  1CPR A;  4EKW A;  3EGD A;  2P6V A;  3C63 A;  3JCU Q;  5B3S C;  2Q00 A;  3IPM O;  1NSG B;  5L0G A;  4XEF A;  4YL3 A;  4OIQ F;  1O87 A;  1HMD A;  3DWW A;  3O6X A;  3ZQV A;  3EH2 A;  4MQ9 F;  2CCY A;  2FGY A;  2XS1 A;  2R7S A;  4ZLD A;  4A4A A;  3H2U A;  5JSL A;  3V7O A;  3DE9 A;  3RQE A;  1T6Q A;  2ZPA A;  2R7R A;  1Q0K A;  2R25 A;  4IAO A;  3RKO F;  2KJG A;  5COM A;  4CDA A;  3ZQY A;  1NLX A;  1ZVZ A;  5KYU A;  1D1A A;  1M56 C;  2LQG A;  3NYJ A;  3LS0 A;  3AG1 C;  4J7Y A;  1ZHW A;  2XRH A;  3KPH A;  4JIO A;  4LLE A;  4MVU A;  4JRZ A;  1YAR O;  3UNG C;  2J0W A;  3ZG1 A;  2FAP B;  2PBE A;  2QLA A;  1K40 A;  1H6G A;  1I4Z A;  3DKA A;  3L0I A;  3G4X A;  1BR1 A;  4YL0 A;  3Q7L A;  1WAS A;  4JKV A;  4KI2 A;  3JSE O;  4PJL A;  3N24 A;  4W8K A;  2KYH A;  1D0Z A;  4DXW A;  1I5N A;  3QMK A;  4CX9 A;  2R7T A;  2VAS A;  3UMI A;  3IEE A;  4PFP A;  4R32 A;  4OD4 A;  5DS6 A;  3EHN A;  2KQ9 A;  4XPX A;  3X2Q C;  3EZH A;  1YJG A;  4YT5 A;  4CS9 A;  3GWL A;  1BR2 A;  1EA8 A;  3JTL O;  1SYQ A;  4EIY A;  2H7V C;  1ZU5 A;  4FWV A;  2YWA A;  3RH3 A;  3RF3 A;  2B0H A;  3L34 A;  5L0D A;  1V54 C;  4MVO A;  3C8G B;  4AE4 B;  2M64 A;  2F22 A;  4ONS A;  4BJ1 A;  5K0I A;  5L0C A;  3CSK A;  2IXM A;  5D92 A;  5L0J A;  1YA9 A;  3O39 A;  1CGM E;  2OJE D;  2MYS A;  1NU9 C;  3N2Z B;  4C3E A;  3IHU A;  1SR2 A;  1S05 A;  1YDI A;  2H7B A;  4E0I A;  3M79 A;  3K1H A;  1VB5 A;  1H7I A;  3H65 A;  1QKR A; 
#chains in the Genus database with same CATH homology
 3CAX A;  3U9M A;  2P0N A;  3V5Z A;  3V5X A;  3U9J A;  3V5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...