3V5XA

Structure of fbxl5 hemerythrin domain, c2 cell
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
151
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQYNVHKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 68
structure length 151
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5xA00
3V5ZA 3U9JA 3CAXA 3U9MA 2P0NA 3V5XA 3V5YA
chains in the Genus database with same CATH superfamily
3TJ6A 4D4XA 3JZ0A 2AP3A 1LI7A 2YLDA 4D4NA 3FOPA 4IRUA 2YEVA 2Q9BA 3M4BA 4J7YA 3U0CA 2JD3A 4LDKA 3DE8A 3HNLA 2RSEB 1O87A 2AVKA 2OG2A 1QKRA 2HJMA 2R7UA 4OINF 3QW0A 3US6A 1NFNA 4JCHA 1CGOA 5KYNA 4Q5SF 5D92A 2NG1A 3SEOA 4MQ9F 2EPLX 2OOCA 5AGFA 2ZXPA 3N0TA 3JYYA 2DYRC 5BQGA 3MBGA 4YJWA 4GYTA 3ZC4A 2YL3A 2A68F 2W4BA 3AG3C 2XLOA 4XPYA 1Q0FA 3LUTB 2DB4A 2YWAA 1DOWA 3DAGA 4QDLA 4CDVA 4JTDB 2XL6A 4WABA 1T6QA 1VYKA 1PCXA 2J46A 2L6HA 2Y69C 2Y3DA 1BBHA 4JCZA 2LFFA 2YL0A 5KYUB 4FWVA 4G7ZF 2OJQA 2PP4A 1HE9A 1I5NA 2QY9A 1GGQA 4AE4A 3C8GA 3BRJA 4ANJA 4EBJA 1NU9C 1VOMA 3U8PA 1NSGB 2WZGA 2XLVA 1EI7A 4YT2A 3W8IA 2OQMA 1S05A 2YZSA 3S27A 5BUOA 3B0PA 1K40A 4MW3A 1E83A 2EIMC 2L81A 5COGA 4KBLA 1RKEA 2CW0F 4DBQA 2ZD9A 2HJ3A 1V4AA 1APCA 3NYJA 1N1CA 1LIHA 4Z9HA 1YJGA 1LS1A 3G4ZA 1YZAA 4MVQA 3W4YA 2LSEA 2PF4E 4BJ5A 2ZXRA 3R7CA 4CX9A 1M6TA 3A9CA 3K1IC 3LESA 2XS1A 2KNHA 3L8IA 1MNEA 3V7OA 3S84A 2Y3HA 4IARA 4N6HA 3CZ6A 4C3EA 5IY5C 2B0JA 3VAYA 4EHPA 3NG1A 2DI3A 2HMZA 2R05A 3ABLC 4KC9A 2R7OA 4BEJA 1UFBA 4DOZA 5HSWA 2IXPA 4FESA 3ZVRA 2ICWG 3KKBA 1ZZPA 3O39A 4M63A 1LKXA 2WL8A 3ZQYA 5EK0A 3CEXA 2MWQA 4HE8D 4AE4B 2VCAA 3C8GB 3OA1A 1FMVA 4MNDA 3V5ZA 3FXHA 2LCHA 2PX0A 1MMGA 1ORSC 3DJNB 4HEAJ 1O5HA 4JJGA 3RF3A 3WAQA 3B9QA 2JPUA 1C17M 4QI2A 1Q0MA 4K0DA 1LE4A 1Q0GA 2XLDA 3IQ6A 5GPGB 3U2MA 3UGOA 1CGNA 1JPJA 1RKEB 2G3KA 1QVXA 3MX3A 4JRZA 4CJGA 2AU5A 4YL0A 5B1BC 1H9GA 3C7JA 3RYLA 4JIOA 1LVKA 1OCCC 3RVYA 2XLEA 4E17A 4YWQA 3T4RA 3VYWA 1HW2A 2EILC 4CS8C 5T3TA 2HMQA 2Q7RA 4JW1A 2NSFA 5DQZA 5DS6A 4P9TA 1G8XA 1QLEC 3DD7A 3Q6NA 1OKKA 1DOVA 2LP4A 2PX3A 3IQTA 3N2ZB 2NSGA 4EUKB 3OEOA 4I1MA 3UGPA 1D1BA 4GEHA 2CNWD 1GM5A 2J0XA 2R7SA 2A6HF 4XQ1A 4YT4A 4EWCA 3C8ZA 3JSEO 1JOGA 1W2WA 2R02A 4CS9A 3EHNA 2A6EF 3DMDA 3E9VA 3NMIA 4XEVA 3AG4C 5EGYA 4XLPF 3TD7A 2ZXWC 1QSPA 2R03A 3WHNA 2XLHA 1O3UA 1TWHA 4OIQF 1H6GA 1A7EA 4MW8A 1TWCA 3I4UA 4MS2A 4W8KA 2P61A 3NDBB 2LIGA 1NG1A 3GM1A 3IHUA 4I1OB 3ZWIA 3LAYA 3C63A 1FNTc 3O55A 1FR0A 2EPNA 3DJUB 3M79A 4XTKA 1M2OA 2IBFA 3KH2A 3PDMP 1G4WR 3F46A 2PNOA 2VASA 4U5EE 1ZU4A 3UMIA 4BJ6A 3ASNC 3TULA 1MQVA 3QTHA 4ULVA 2HV7A 2L7AA 3IPMO 1G5ZA 3EHMA 3EPVA 1WWPA 3EGXA 4A2NB 3C8GD 4NTFA 4F4BA 3FAPB 3RQGA 4QI0A 5BQHA 3ATPA 5A6JA 4JURI 4I3MA 1Z63A 2TMVP 3K33A 4C7OA 2KSFA 2FAPB 4JTAB 3ZIBA 2OCCC 5E2QA 2Q00A 1HW1A 5JP7A 4RDAA 5DQTA 5A6BA 3HNJA 1RXQA 3E70C 2CNWA 4J30B 1HE1A 2R9RB 3DAFA 3JT1A 1VMAA 3JTLO 1I4ZA 2UUHA 2LFDA 2FFHA 1D1CA 4OD4A 4PACA 2ZPAA 2Y3GA 3NKEA 4U5FE 1QQ3A 1MMAA 1BZ4A 2M64A 3H2UA 5COMA 5BQIA 4ZLDA 2EIJC 3M15A 1V55C 4BPMA 4OD5A 1PV3A 4IJJA 1OW7A 2G3VA 3FVYA 3U8VA 4DVZA 3PHF2 2R25A 2WVNA 3U9MA 1LI5A 1U6HA 1ST6A 1U89A 3L8JA 2L9JA 4OIRF 2MHRA 2YL1A 2KGOA 2QUPA 4YT8A 1ORYA 4G7HF 3GODA 4IAQA 3JCUQ 3K6BA 4Q7CA 3W2VA 1IZMA 1OQCA 3GEIA 3SNHA 2J45A 3EGXB 1BR2A 1TWAA 3AG1C 3CQZA 3EJNA 4FX5A 2YLGA 2P1AA 4EKWA 5JUAA 3EQLF 4HFFB 1T9KA 1FTSA 1YYJA 5FCLA 1SYQA 4C7OB 1HY5A 4MVRA 2HV6A 3Q7LA 4JEAA 1C03A 2I15A 4C3DA 5EHHA 1LPEA 3O10A 2DGJA 3KYJA 1LS4A 1WGWA 4Z9JA 2NUPA 4CJOA 1B68A 1RCPA 2D4UA 4DRJB 1K04A 3EZIA 1ZU5A 1S7ZA 2YHSA 1H7IA 4DXWA 1VTMP 2GFHA 4O6YA 2VB6A 2LD6A 4IB4A 2IM8A 5B1AC 4CDYA 2HS5A 2PBEA 3V5XA 3ZG1A 1TFOB 2A0UA 2Q9AA 2CGEA 1I4YA 2WZFA 1OKKD 3GWLA 4CIHA 1CPQA 2XL4A 2HFIA 3JYHA 3ZDLA 3SXMA 5KYXA 4O6NA 4XEKA 4PJJA 5D91A 3L1MA 2XL8A 3AG2C 3T6JA 2NPUA 3FAJA 4WGZA 3DXJF 4N06A 4U5CE 5L3QA 1FFHA 3FMSA 5CI8A 2UUIA 2R7XA 2AWYA 2OKUA 4LDQA 1CGME 2M4EA 3LS0A 3PMRA 4UDVA 1OCOC 1SF8A 2WZLA 2R7TA 4AK9A 4B6IA 1RKCA 4HFKB 2D5RB 4U5BE 4FAPB 1QPUA 5JS5A 3B29A 5E3AA 4CIPA 4JTCB 3NMJA 3EZHA 3SXYA 4CS9C 2VCCA 2Q3TA 5B3SC 2NUPB 4KI2A 3ZTMA 3U5SA 1L7CA 1BR4A 2P6VA 4MTFA 1YARO 4YL1A 2HZ8A 2KJGA 3DKAA 3LLKA 1A7VA 3MYIA 3SXZA 4Q4ZF 3AQBA 3EH1A 1T6UA 3N24A 5FZTA 2WVOA 4MVMA 5A6KA 1BDJB 3H65A 4XPWA 5F5FA 3U3FA 3QZCA 5KYWA 3HNIA 1L3PA 4P9FA 4KNVA 1MMDA 4CDAA 1U0BB 2XLMA 4NCQA 1WN0A 1XZQA 1E84A 2P7VA 1K05A 1J8YF 2EPKX 5KYXB 3POVA 1ZHZA 2YL7A 5A6BD 1QZXA 3QW1A 3CSKA 2XRHA 4WJ0A 1G4US 4O6MA 5DS4A 5L0GA 1RMVA 4JEBA 2KQ9A 2V26A 3FOOA 5JVEA 3RFYA 2P0NA 3HJCA 4MTGA 4N4WA 1FFTC 1TQGA 3I5PA 3J06A 4IGGA 3JRMO 2EINC 1VB5A 1ZHWA 4YN0B 3MYFA 1OW6A 2J0WA 1NBBA 3S9OA 5DLJA 1FMWA 1E86A 4LLCA 3UMKA 2R7QA 2Q9CA 4U5DE 3R2PA 1ZYRF 3EG9A 3S0XA 3T6BA 1T01A 2LK4A 3TK0A 5COFA 2HSBA 2QE9A 2HSQA 2H7BA 4O7GA 3AGUA 4PFPA 4DRHB 2VH3A 5K0IA 1YDIA 1Q0KA 3GANA 4CSAA 1ZHXA 1KNYA 1H9TA 2R7VA 1JPNA 5JLIA 1ZW3A 2XM0A 4EBBA 4XEFA 4BJ1A 4I44A 3WODF 2Y3BA 2LQGA 5KYWB 4U5GA 5DS5A 3LLIA 2VC9A 4NC3A 5DVWA 1VYIA 2XLWA 5L0DA 1WOLA 1TWGA 1WASA 2YVKA 3KL4A 3AQCA 1LM3B 4G7OF 2WVQA 4YT5A 4U9DA 2Q4FA 3G50A 4H54A 5T1DB 4OIPF 3IQCA 1AVOB 3IQ5A 4MVZA 4CS8A 1NLXA 2H7VC 1YAUO 2IXMA 4N6CA 1EA8A 2XXAA 3SP1A 1J8MF 5CIVA 256BA 2A0BA 3VRCA 3DE9A 3G4XA 3RQEA 4DRIB 4ZLCA 5KYYA 3NYMA 1V74B 1CPRA 5L0CA 4LERA 1IW7F 3UR3C 2XM4A 3QMKA 1E2XA 3QVZA 2GAQA 4R32A 1TFKB 1XZPA 1OR3A 3EG9B 3TOMA 1YLMA 3JRTA 2E87A 3UMHA 1Q0DA 3MLGA 3K66A 4DBRA 2ASRA 2F22A 4JZAA 4L6RA 3O6XA 3DI5A 4JC7A 3HTKC 1TR2A 3U9JA 1JAFA 4XWJA 2EPOA 2QLAA 3ECSA 1VK5A 4E0IA 3S90A 1UG7A 3I5QA 4PK4A 4C3BA 1VLTA 2HUJA 2AWCA 3NMKA 3SXKA 2YRFA 3S28A 3TOLA 1EKYA 1GS9A 4J32B 5HV9A 5A69A 3EFOA 1D0ZA 4BJ5C 1JRAA 2X0CA 1OXKA 3Q7GA 3JSZA 1T6IA 2W4MA 4DJ9A 4H4KC 1YZCA 3LNRA 4XLNF 3K1HA 4A4AA 3FHDA 3GWNA 3LS1A 4BG0A 2KYHA 2XXAB 1KU2A 3CAXA 4JKVA 4RBNA 2OEVA 4ONSA 3T9OA 3SYNA 2A1DD 2KC3A 2WB7A 5KYYB 3RIPA 1WTYA 4IAOA 2ETSA 1M56C 3KYIA 4JJFA 4EIYA 4XPXA 2ZXOA 1OCZC 4U5HA 1Y4CA 1AUEA 3GORA 3ZQVA 1Z23A 3TJ5A 3OWTA 4AL1A 1Z3IX 4BJTA 5JT4A 1ZHYA 1FAPB 2IXNA 2L6FA 3AOUA 1C02A 1JR8A 4NTBA 1TKNA 3ZSUA 4CS7A 5TJ5E 2IXOA 3LEOA 1A0BA 4K7BA 1GQAA 3AGTA 1E85A 3RH3A 1MNDA 3C62A 1PD0A 4ULWA 4AL0A 2YKZA 2BC5A 3RVZA 4OIOF 3EFOB 3TQOA 1D1AA 4GQHA 2FGYA 4PJMA 3GEEA 3LEVA 2R7RA 4K1OA 1Z6AA 3L0IA 2KK1A 4ER9A 1YA7O 5E33A 2C04A 2GDCA 3A11A 4P6IC 1YYXA 2J7PD 5L0FA 2EIKC 5AC4A 1VLSA 3AJMA 3DM5A 4LACB 4X0RA 5JRAA 3RW0A 4NTAA 1M2VA 4LLEA 3ASOC 4E18A 4E7SA 4J7TA 3DM9B 1JMWA 3ABMC 1M57C 4JVSA 1LE2A 3BEHA 3GEHA 3KMIA 4BEMJ 2YQYA 3FDQA 2GA0A 2IYLD 3EGDA 1SR2A 2IOQA 4EBKA 4NQFA 5E3CA 3T6GB 4E0HA 1ZVZA 3C18A 3HLZA 4W8PA 1EQ1A 3QVYA 2QTVA 2JX0A 2J9UA 3KPHA 3SZRA 1RJ9A 3M1CB 4LDRA 1Z5ZA 1D0YA 2I8BA 1OW8A 3ABKC 1SMYF 4NY3A 4BJ6C 2R7WA 4CSAC 4MVOA 4G78A 2MYSA 3NYLA 4RD9A 3S29A 3EH2A 3IEEA 1V54C 2H8AA 3NRHA 3K1IA 2OU6A 1OR2A 2Y39A 3DWWA 3V5YA 5AC5A 1WATA 3MFNA 3RKOF 4PJLA 5JSLA 2A69F 2B0HA 5L0IA 2YLIA 5CI9A 5F5HA 2J7PA 1OXBA 1A7DA 3PCVA 4O79A 5L3VA 5F28E 1M2VB 2CDQA 3B0UX 2PFDA 2NUTA 3U2LA 2QNLA 4MVUA 2W9YA 4MVSA 5L0JA 1MMNA 2CYDA 3EGDB 2L6GA 4DVYP 2OJED 4YK5A 4IWBA 2C03A 3Q6MA 5T3WA 1BR1A 1OCRC 4PJNA 1R5ID 3LNMB 3W8HA 1ORJA 1D0XA 1HMDA 3H2VA 3U3BA 1Z7Qc 2HKVA 1NZEA 1ZHTA 2BL2A 2W45A 3F47A 1RJ9B 3HNKA 3L34A 4MTOA 4Z9IA 3W2WA 4AX2A 2CCYA 3RQFA 1YA9A 2EPMX 3NKDA 3VF0A 2H7OA 1XWJA 1YVIA 2O9XA 2VCBA 4YL3A 4G0HA 4WGYA 2G62A 2BE5F 4PFOA 2XS8A 3X1OA 2J9WA 3ZTZA 4KNWA 1HMOA 5L0HA 3ITFA 3B71A 2OEXA 1PD1A 3GM2A 2XSEA 3UNGC 3HKKA 2KW3C 1F1MA 1SZIA 3GM3A 2Z15A 2GWWA 2RD9A 2X51A 1ZW2A 2DYSC 1NU7D 4PR9A 2V3CC 4JE9A 4CBEA 4U9EA 1NFOA 3DZAA 1A41A 3K7DA 3WG7C 2J9VA 5B3IA 1Y6DA 2J8WA 5KYUA 1KTMA 3B0VC 1R4TA 3M4CA 2J9BA 2NUTB 3LJBA 3VM6A 3X2QC 1T5OA 4E7ZA 5A6AA 1AEPA
chains in the Genus database with same CATH topology
3V5ZA 3U9JA 3CAXA 3U9MA 2P0NA 3V5XA 3V5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5Z A;  3U9J A;  3CAX A;  3U9M A;  2P0N A;  3V5X A;  3V5Y A; 
#chains in the Genus database with same CATH topology
 3TJ6 A;  4D4X A;  3JZ0 A;  2AP3 A;  1LI7 A;  2YLD A;  4D4N A;  3FOP A;  4IRU A;  2YEV A;  2Q9B A;  3M4B A;  4J7Y A;  3U0C A;  2JD3 A;  4LDK A;  3DE8 A;  3HNL A;  2RSE B;  1O87 A;  2AVK A;  2OG2 A;  1QKR A;  2HJM A;  2R7U A;  4OIN F;  3QW0 A;  3US6 A;  1NFN A;  4JCH A;  1CGO A;  5KYN A;  4Q5S F;  5D92 A;  2NG1 A;  3SEO A;  4MQ9 F;  2EPL X;  2OOC A;  5AGF A;  2ZXP A;  3N0T A;  3JYY A;  2DYR C;  5BQG A;  3MBG A;  4YJW A;  4GYT A;  3ZC4 A;  2YL3 A;  2A68 F;  2W4B A;  3AG3 C;  2XLO A;  4XPY A;  1Q0F A;  3LUT B;  2DB4 A;  2YWA A;  1DOW A;  3DAG A;  4QDL A;  4CDV A;  4JTD B;  2XL6 A;  4WAB A;  1T6Q A;  1VYK A;  1PCX A;  2J46 A;  2L6H A;  2Y69 C;  2Y3D A;  1BBH A;  4JCZ A;  2LFF A;  2YL0 A;  5KYU B;  4FWV A;  4G7Z F;  2OJQ A;  2PP4 A;  1HE9 A;  1I5N A;  2QY9 A;  1GGQ A;  4AE4 A;  3C8G A;  3BRJ A;  4ANJ A;  4EBJ A;  1NU9 C;  1VOM A;  3U8P A;  1NSG B;  2WZG A;  2XLV A;  1EI7 A;  4YT2 A;  3W8I A;  2OQM A;  1S05 A;  2YZS A;  3S27 A;  5BUO A;  3B0P A;  1K40 A;  4MW3 A;  1E83 A;  2EIM C;  2L81 A;  5COG A;  4KBL A;  1RKE A;  2CW0 F;  4DBQ A;  2ZD9 A;  2HJ3 A;  1V4A A;  1APC A;  3NYJ A;  1N1C A;  1LIH A;  4Z9H A;  1YJG A;  1LS1 A;  3G4Z A;  1YZA A;  4MVQ A;  3W4Y A;  2LSE A;  2PF4 E;  4BJ5 A;  2ZXR A;  3R7C A;  4CX9 A;  1M6T A;  3A9C A;  3K1I C;  3LES A;  2XS1 A;  2KNH A;  3L8I A;  1MNE A;  3V7O A;  3S84 A;  2Y3H A;  4IAR A;  4N6H A;  3CZ6 A;  4C3E A;  5IY5 C;  2B0J A;  3VAY A;  4EHP A;  3NG1 A;  2DI3 A;  2HMZ A;  2R05 A;  3ABL C;  4KC9 A;  2R7O A;  4BEJ A;  1UFB A;  4DOZ A;  5HSW A;  2IXP A;  4FES A;  3ZVR A;  2ICW G;  3KKB A;  1ZZP A;  3O39 A;  4M63 A;  1LKX A;  2WL8 A;  3ZQY A;  5EK0 A;  3CEX A;  2MWQ A;  4HE8 D;  4AE4 B;  2VCA A;  3C8G B;  3OA1 A;  1FMV A;  4MND A;  3V5Z A;  3FXH A;  2LCH A;  2PX0 A;  1MMG A;  1ORS C;  3DJN B;  4HEA J;  1O5H A;  4JJG A;  3RF3 A;  3WAQ A;  3B9Q A;  2JPU A;  1C17 M;  4QI2 A;  1Q0M A;  4K0D A;  1LE4 A;  1Q0G A;  2XLD A;  3IQ6 A;  5GPG B;  3U2M A;  3UGO A;  1CGN A;  1JPJ A;  1RKE B;  2G3K A;  1QVX A;  3MX3 A;  4JRZ A;  4CJG A;  2AU5 A;  4YL0 A;  5B1B C;  1H9G A;  3C7J A;  3RYL A;  4JIO A;  1LVK A;  1OCC C;  3RVY A;  2XLE A;  4E17 A;  4YWQ A;  3T4R A;  3VYW A;  1HW2 A;  2EIL C;  4CS8 C;  5T3T A;  2HMQ A;  2Q7R A;  4JW1 A;  2NSF A;  5DQZ A;  5DS6 A;  4P9T A;  1G8X A;  1QLE C;  3DD7 A;  3Q6N A;  1OKK A;  1DOV A;  2LP4 A;  2PX3 A;  3IQT A;  3N2Z B;  2NSG A;  4EUK B;  3OEO A;  4I1M A;  3UGP A;  1D1B A;  4GEH A;  2CNW D;  1GM5 A;  2J0X A;  2R7S A;  2A6H F;  4XQ1 A;  4YT4 A;  4EWC A;  3C8Z A;  3JSE O;  1JOG A;  1W2W A;  2R02 A;  4CS9 A;  3EHN A;  2A6E F;  3DMD A;  3E9V A;  3NMI A;  4XEV A;  3AG4 C;  5EGY A;  4XLP F;  3TD7 A;  2ZXW C;  1QSP A;  2R03 A;  3WHN A;  2XLH A;  1O3U A;  1TWH A;  4OIQ F;  1H6G A;  1A7E A;  4MW8 A;  1TWC A;  3I4U A;  4MS2 A;  4W8K A;  2P61 A;  3NDB B;  2LIG A;  1NG1 A;  3GM1 A;  3IHU A;  4I1O B;  3ZWI A;  3LAY A;  3C63 A;  1FNT c;  3O55 A;  1FR0 A;  2EPN A;  3DJU B;  3M79 A;  4XTK A;  1M2O A;  2IBF A;  3KH2 A;  3PDM P;  1G4W R;  3F46 A;  2PNO A;  2VAS A;  4U5E E;  1ZU4 A;  3UMI A;  4BJ6 A;  3ASN C;  3TUL A;  1MQV A;  3QTH A;  4ULV A;  2HV7 A;  2L7A A;  3IPM O;  1G5Z A;  3EHM A;  3EPV A;  1WWP A;  3EGX A;  4A2N B;  3C8G D;  4NTF A;  4F4B A;  3FAP B;  3RQG A;  4QI0 A;  5BQH A;  3ATP A;  5A6J A;  4JUR I;  4I3M A;  1Z63 A;  2TMV P;  3K33 A;  4C7O A;  2KSF A;  2FAP B;  4JTA B;  3ZIB A;  2OCC C;  5E2Q A;  2Q00 A;  1HW1 A;  5JP7 A;  4RDA A;  5DQT A;  5A6B A;  3HNJ A;  1RXQ A;  3E70 C;  2CNW A;  4J30 B;  1HE1 A;  2R9R B;  3DAF A;  3JT1 A;  1VMA A;  3JTL O;  1I4Z A;  2UUH A;  2LFD A;  2FFH A;  1D1C A;  4OD4 A;  4PAC A;  2ZPA A;  2Y3G A;  3NKE A;  4U5F E;  1QQ3 A;  1MMA A;  1BZ4 A;  2M64 A;  3H2U A;  5COM A;  5BQI A;  4ZLD A;  2EIJ C;  3M15 A;  1V55 C;  4BPM A;  4OD5 A;  1PV3 A;  4IJJ A;  1OW7 A;  2G3V A;  3FVY A;  3U8V A;  4DVZ A;  3PHF 2;  2R25 A;  2WVN A;  3U9M A;  1LI5 A;  1U6H A;  1ST6 A;  1U89 A;  3L8J A;  2L9J A;  4OIR F;  2MHR A;  2YL1 A;  2KGO A;  2QUP A;  4YT8 A;  1ORY A;  4G7H F;  3GOD A;  4IAQ A;  3JCU Q;  3K6B A;  4Q7C A;  3W2V A;  1IZM A;  1OQC A;  3GEI A;  3SNH A;  2J45 A;  3EGX B;  1BR2 A;  1TWA A;  3AG1 C;  3CQZ A;  3EJN A;  4FX5 A;  2YLG A;  2P1A A;  4EKW A;  5JUA A;  3EQL F;  4HFF B;  1T9K A;  1FTS A;  1YYJ A;  5FCL A;  1SYQ A;  4C7O B;  1HY5 A;  4MVR A;  2HV6 A;  3Q7L A;  4JEA A;  1C03 A;  2I15 A;  4C3D A;  5EHH A;  1LPE A;  3O10 A;  2DGJ A;  3KYJ A;  1LS4 A;  1WGW A;  4Z9J A;  2NUP A;  4CJO A;  1B68 A;  1RCP A;  2D4U A;  4DRJ B;  1K04 A;  3EZI A;  1ZU5 A;  1S7Z A;  2YHS A;  1H7I A;  4DXW A;  1VTM P;  2GFH A;  4O6Y A;  2VB6 A;  2LD6 A;  4IB4 A;  2IM8 A;  5B1A C;  4CDY A;  2HS5 A;  2PBE A;  3V5X A;  3ZG1 A;  1TFO B;  2A0U A;  2Q9A A;  2CGE A;  1I4Y A;  2WZF A;  1OKK D;  3GWL A;  4CIH A;  1CPQ A;  2XL4 A;  2HFI A;  3JYH A;  3ZDL A;  3SXM A;  5KYX A;  4O6N A;  4XEK A;  4PJJ A;  5D91 A;  3L1M A;  2XL8 A;  3AG2 C;  3T6J A;  2NPU A;  3FAJ A;  4WGZ A;  3DXJ F;  4N06 A;  4U5C E;  5L3Q A;  1FFH A;  3FMS A;  5CI8 A;  2UUI A;  2R7X A;  2AWY A;  2OKU A;  4LDQ A;  1CGM E;  2M4E A;  3LS0 A;  3PMR A;  4UDV A;  1OCO C;  1SF8 A;  2WZL A;  2R7T A;  4AK9 A;  4B6I A;  1RKC A;  4HFK B;  2D5R B;  4U5B E;  4FAP B;  1QPU A;  5JS5 A;  3B29 A;  5E3A A;  4CIP A;  4JTC B;  3NMJ A;  3EZH A;  3SXY A;  4CS9 C;  2VCC A;  2Q3T A;  5B3S C;  2NUP B;  4KI2 A;  3ZTM A;  3U5S A;  1L7C A;  1BR4 A;  2P6V A;  4MTF A;  1YAR O;  4YL1 A;  2HZ8 A;  2KJG A;  3DKA A;  3LLK A;  1A7V A;  3MYI A;  3SXZ A;  4Q4Z F;  3AQB A;  3EH1 A;  1T6U A;  3N24 A;  5FZT A;  2WVO A;  4MVM A;  5A6K A;  1BDJ B;  3H65 A;  4XPW A;  5F5F A;  3U3F A;  3QZC A;  5KYW A;  3HNI A;  1L3P A;  4P9F A;  4KNV A;  1MMD A;  4CDA A;  1U0B B;  2XLM A;  4NCQ A;  1WN0 A;  1XZQ A;  1E84 A;  2P7V A;  1K05 A;  1J8Y F;  2EPK X;  5KYX B;  3POV A;  1ZHZ A;  2YL7 A;  5A6B D;  1QZX A;  3QW1 A;  3CSK A;  2XRH A;  4WJ0 A;  1G4U S;  4O6M A;  5DS4 A;  5L0G A;  1RMV A;  4JEB A;  2KQ9 A;  2V26 A;  3FOO A;  5JVE A;  3RFY A;  2P0N A;  3HJC A;  4MTG A;  4N4W A;  1FFT C;  1TQG A;  3I5P A;  3J06 A;  4IGG A;  3JRM O;  2EIN C;  1VB5 A;  1ZHW A;  4YN0 B;  3MYF A;  1OW6 A;  2J0W A;  1NBB A;  3S9O A;  5DLJ A;  1FMW A;  1E86 A;  4LLC A;  3UMK A;  2R7Q A;  2Q9C A;  4U5D E;  3R2P A;  1ZYR F;  3EG9 A;  3S0X A;  3T6B A;  1T01 A;  2LK4 A;  3TK0 A;  5COF A;  2HSB A;  2QE9 A;  2HSQ A;  2H7B A;  4O7G A;  3AGU A;  4PFP A;  4DRH B;  2VH3 A;  5K0I A;  1YDI A;  1Q0K A;  3GAN A;  4CSA A;  1ZHX A;  1KNY A;  1H9T A;  2R7V A;  1JPN A;  5JLI A;  1ZW3 A;  2XM0 A;  4EBB A;  4XEF A;  4BJ1 A;  4I44 A;  3WOD F;  2Y3B A;  2LQG A;  5KYW B;  4U5G A;  5DS5 A;  3LLI A;  2VC9 A;  4NC3 A;  5DVW A;  1VYI A;  2XLW A;  5L0D A;  1WOL A;  1TWG A;  1WAS A;  2YVK A;  3KL4 A;  3AQC A;  1LM3 B;  4G7O F;  2WVQ A;  4YT5 A;  4U9D A;  2Q4F A;  3G50 A;  4H54 A;  5T1D B;  4OIP F;  3IQC A;  1AVO B;  3IQ5 A;  4MVZ A;  4CS8 A;  1NLX A;  2H7V C;  1YAU O;  2IXM A;  4N6C A;  1EA8 A;  2XXA A;  3SP1 A;  1J8M F;  5CIV A;  256B A;  2A0B A;  3VRC A;  3DE9 A;  3G4X A;  3RQE A;  4DRI B;  4ZLC A;  5KYY A;  3NYM A;  1V74 B;  1CPR A;  5L0C A;  4LER A;  1IW7 F;  3UR3 C;  2XM4 A;  3QMK A;  1E2X A;  3QVZ A;  2GAQ A;  4R32 A;  1TFK B;  1XZP A;  1OR3 A;  3EG9 B;  3TOM A;  1YLM A;  3JRT A;  2E87 A;  3UMH A;  1Q0D A;  3MLG A;  3K66 A;  4DBR A;  2ASR A;  2F22 A;  4JZA A;  4L6R A;  3O6X A;  3DI5 A;  4JC7 A;  3HTK C;  1TR2 A;  3U9J A;  1JAF A;  4XWJ A;  2EPO A;  2QLA A;  3ECS A;  1VK5 A;  4E0I A;  3S90 A;  1UG7 A;  3I5Q A;  4PK4 A;  4C3B A;  1VLT A;  2HUJ A;  2AWC A;  3NMK A;  3SXK A;  2YRF A;  3S28 A;  3TOL A;  1EKY A;  1GS9 A;  4J32 B;  5HV9 A;  5A69 A;  3EFO A;  1D0Z A;  4BJ5 C;  1JRA A;  2X0C A;  1OXK A;  3Q7G A;  3JSZ A;  1T6I A;  2W4M A;  4DJ9 A;  4H4K C;  1YZC A;  3LNR A;  4XLN F;  3K1H A;  4A4A A;  3FHD A;  3GWN A;  3LS1 A;  4BG0 A;  2KYH A;  2XXA B;  1KU2 A;  3CAX A;  4JKV A;  4RBN A;  2OEV A;  4ONS A;  3T9O A;  3SYN A;  2A1D D;  2KC3 A;  2WB7 A;  5KYY B;  3RIP A;  1WTY A;  4IAO A;  2ETS A;  1M56 C;  3KYI A;  4JJF A;  4EIY A;  4XPX A;  2ZXO A;  1OCZ C;  4U5H A;  1Y4C A;  1AUE A;  3GOR A;  3ZQV A;  1Z23 A;  3TJ5 A;  3OWT A;  4AL1 A;  1Z3I X;  4BJT A;  5JT4 A;  1ZHY A;  1FAP B;  2IXN A;  2L6F A;  3AOU A;  1C02 A;  1JR8 A;  4NTB A;  1TKN A;  3ZSU A;  4CS7 A;  5TJ5 E;  2IXO A;  3LEO A;  1A0B A;  4K7B A;  1GQA A;  3AGT A;  1E85 A;  3RH3 A;  1MND A;  3C62 A;  1PD0 A;  4ULW A;  4AL0 A;  2YKZ A;  2BC5 A;  3RVZ A;  4OIO F;  3EFO B;  3TQO A;  1D1A A;  4GQH A;  2FGY A;  4PJM A;  3GEE A;  3LEV A;  2R7R A;  4K1O A;  1Z6A A;  3L0I A;  2KK1 A;  4ER9 A;  1YA7 O;  5E33 A;  2C04 A;  2GDC A;  3A11 A;  4P6I C;  1YYX A;  2J7P D;  5L0F A;  2EIK C;  5AC4 A;  1VLS A;  3AJM A;  3DM5 A;  4LAC B;  4X0R A;  5JRA A;  3RW0 A;  4NTA A;  1M2V A;  4LLE A;  3ASO C;  4E18 A;  4E7S A;  4J7T A;  3DM9 B;  1JMW A;  3ABM C;  1M57 C;  4JVS A;  1LE2 A;  3BEH A;  3GEH A;  3KMI A;  4BEM J;  2YQY A;  3FDQ A;  2GA0 A;  2IYL D;  3EGD A;  1SR2 A;  2IOQ A;  4EBK A;  4NQF A;  5E3C A;  3T6G B;  4E0H A;  1ZVZ A;  3C18 A;  3HLZ A;  4W8P A;  1EQ1 A;  3QVY A;  2QTV A;  2JX0 A;  2J9U A;  3KPH A;  3SZR A;  1RJ9 A;  3M1C B;  4LDR A;  1Z5Z A;  1D0Y A;  2I8B A;  1OW8 A;  3ABK C;  1SMY F;  4NY3 A;  4BJ6 C;  2R7W A;  4CSA C;  4MVO A;  4G78 A;  2MYS A;  3NYL A;  4RD9 A;  3S29 A;  3EH2 A;  3IEE A;  1V54 C;  2H8A A;  3NRH A;  3K1I A;  2OU6 A;  1OR2 A;  2Y39 A;  3DWW A;  3V5Y A;  5AC5 A;  1WAT A;  3MFN A;  3RKO F;  4PJL A;  5JSL A;  2A69 F;  2B0H A;  5L0I A;  2YLI A;  5CI9 A;  5F5H A;  2J7P A;  1OXB A;  1A7D A;  3PCV A;  4O79 A;  5L3V A;  5F28 E;  1M2V B;  2CDQ A;  3B0U X;  2PFD A;  2NUT A;  3U2L A;  2QNL A;  4MVU A;  2W9Y A;  4MVS A;  5L0J A;  1MMN A;  2CYD A;  3EGD B;  2L6G A;  4DVY P;  2OJE D;  4YK5 A;  4IWB A;  2C03 A;  3Q6M A;  5T3W A;  1BR1 A;  1OCR C;  4PJN A;  1R5I D;  3LNM B;  3W8H A;  1ORJ A;  1D0X A;  1HMD A;  3H2V A;  3U3B A;  1Z7Q c;  2HKV A;  1NZE A;  1ZHT A;  2BL2 A;  2W45 A;  3F47 A;  1RJ9 B;  3HNK A;  3L34 A;  4MTO A;  4Z9I A;  3W2W A;  4AX2 A;  2CCY A;  3RQF A;  1YA9 A;  2EPM X;  3NKD A;  3VF0 A;  2H7O A;  1XWJ A;  1YVI A;  2O9X A;  2VCB A;  4YL3 A;  4G0H A;  4WGY A;  2G62 A;  2BE5 F;  4PFO A;  2XS8 A;  3X1O A;  2J9W A;  3ZTZ A;  4KNW A;  1HMO A;  5L0H A;  3ITF A;  3B71 A;  2OEX A;  1PD1 A;  3GM2 A;  2XSE A;  3UNG C;  3HKK A;  2KW3 C;  1F1M A;  1SZI A;  3GM3 A;  2Z15 A;  2GWW A;  2RD9 A;  2X51 A;  1ZW2 A;  2DYS C;  1NU7 D;  4PR9 A;  2V3C C;  4JE9 A;  4CBE A;  4U9E A;  1NFO A;  3DZA A;  1A41 A;  3K7D A;  3WG7 C;  2J9V A;  5B3I A;  1Y6D A;  2J8W A;  5KYU A;  1KTM A;  3B0V C;  1R4T A;  3M4C A;  2J9B A;  2NUT B;  3LJB A;  3VM6 A;  3X2Q C;  1T5O A;  4E7Z A;  5A6A A;  1AEP A; 
#chains in the Genus database with same CATH homology
 3V5Z A;  3U9J A;  3CAX A;  3U9M A;  2P0N A;  3V5X A;  3V5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...