3V5XA

Structure of fbxl5 hemerythrin domain, c2 cell
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
151
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQYNVHKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 68
structure length 151
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5xA00
3U9MA 3V5YA 3V5ZA 3CAXA 3V5XA 3U9JA 2P0NA
chains in the Genus database with same CATH superfamily
2XLWA 1LI5A 1M56C 1Q0GA 1I4YA 1Y4CA 4DRJB 5T3TA 3EG9B 1PD1A 3PDMP 5L0GA 1NFOA 2XLVA 2J0XA 1YA7O 2OOCA 3F46A 4OD5A 4E18A 4JVSA 2R7OA 3L8JA 4NTAA 3DM9B 1NZEA 1U6HA 5BQGA 2CGEA 1ZZPA 1F1MA 2IXPA 3GM3A 5GPGB 3S90A 4PJLA 4XWJA 3HJCA 3U8VA 4E0HA 3LUTB 5L0IA 4CIPA 4XPYA 3EGXA 2HV6A 3HNIA 1A0BA 1M2OA 1V54C 3B29A 4U9DA 1T6IA 3UMKA 2XLOA 4BJ5A 2YVKA 3PHF2 4XQ1A 4XPWA 3U9MA 4CBEA 4CJOA 4K7BA 1BBHA 2ZXOA 3O39A 4A4AA 2B0HA 3SXKA 1NU9C 1A7EA 5AGFA 3W8IA 4RDAA 2H8AA 1YAUO 4C3BA 1D0XA 4MVZA 2Q3TA 1QQ3A 2EIKC 3B71A 3MLGA 4O6NA 2B0JA 3N2ZB 4MQ9F 4D4XA 3UMHA 5JRAA 3NDBB 4P9FA 4F4BA 1OR2A 2H7VC 1YYJA 2HKVA 3AGTA 4JTCB 1ZVZA 1AEPA 2YLIA 1OCZC 4OIOF 2OJQA 5E3AA 2L7AA 2YHSA 1Y6DA 4NCQA 4U5BE 2LFFA 2XS8A 3ZQYA 1MNEA 4CS9C 4G7OF 2J8WA 3I5PA 1FTSA 2DB4A 2GFHA 3M15A 3IHUA 3TULA 3N0TA 4J7YA 1E83A 1T9KA 4Q4ZF 3KPHA 1Q0MA 1VLTA 4C7OB 2PX3A 3MFNA 3Q6NA 4DOZA 3AG4C 4WGYA 4Z9HA 3RQEA 3ABMC 1CGOA 2J9UA 2XM4A 3DXJF 3K1IC 2FFHA 2Z15A 256BA 2A68F 3PCVA 3ZTMA 2CW0F 3AJMA 3SZRA 4YN0B 1AVOB 1ORJA 2RSEB 4KC9A 3CSKA 3UGOA 4EWCA 3EJNA 1Z23A 1C02A 2KW3C 1BDJB 4HFFB 1OW6A 1T01A 3ITFA 4MVUA 4LDKA 3S9OA 3ZG1A 2A69F 1HY5A 3LESA 3HTKC 3JT1A 1OXKA 1GM5A 3BEHA 3UGPA 1G8XA 3RVYA 3OWTA 3AG1C 4IB4A 4U5GA 3B9QA 3U2LA 3OA1A 2P1AA 1TKNA 5F28E 3S29A 4CIHA 1EA8A 1NG1A 1C03A 3M79A 3AOUA 2YWAA 4WGZA 2MHRA 2VCCA 1GQAA 3CZ6A 4MW3A 4O6MA 2KQ9A 4RD9A 4BJ1A 5BUOA 2EPMX 3KL4A 1HE9A 2L6FA 2FAPB 3JYHA 4I44A 5KYYB 3C8GA 5CI8A 5DQTA 2ZXPA 1SMYF 1VYKA 4J7TA 1BR2A 2EIJC 2Q9CA 2QTVA 3LLIA 2YZSA 1D0YA 1Q0KA 3FMSA 3UMIA 1KTMA 2VCAA 1LM3B 4ER9A 2D5RB 3IPMO 4R32A 4BJ6C 4MVOA 2OCCC 1FFTC 2EPNA 2CNWA 2XLHA 3C63A 3QW0A 1U89A 1LVKA 3C8GD 5DS5A 3S0XA 4PACA 2BE5F 1TFOB 1HW1A 2VCBA 3M4CA 1BZ4A 1IZMA 3KYJA 2R7RA 1MNDA 1YZCA 4P6IC 3X2QC 4YT4A 3RKOF 1Q0FA 1LIHA 1LI7A 1ORSC 2Q9BA 3C8ZA 3HNKA 4G0HA 4U5DE 4AX2A 1J8YF 3NKEA 2CNWD 5K0IA 2C03A 2HSQA 2QY9A 3C62A 3JZ0A 3DE9A 4I3MA 4JURI 4N4WA 4DVZA 3IQ5A 3EGDA 2XL8A 3A9CA 4PFPA 1LE2A 3EPVA 3SNHA 1U0BB 1A7VA 4Z9JA 3RW0A 5KYUA 4N6HA 2JD3A 2LK4A 3IQTA 2IYLD 3QVZA 3IQ6A 4LERA 4NQFA 2JPUA 4XEKA 3T6GB 1Z6AA 1OR3A 3AGUA 2HJ3A 2ZD9A 2XL4A 4PJNA 5JP7A 2GA0A 4IARA 3RVZA 3RYLA 1MMNA 3M1CB 1KU2A 4WJ0A 1YZAA 3MX3A 2KYHA 2J9BA 5L0DA 2WZFA 1E2XA 1V4AA 3QMKA 3T9OA 4M63A 3G50A 5B1AC 1NSGB 1ORYA 2ZXWC 5B1BC 1LE4A 4XEVA 3TQOA 3V5YA 4EUKB 2WZLA 4AL1A 5T1DB 2I8BA 1ZU5A 5E2QA 4YT8A 2HMZA 3EFOA 2NUPA 4HFKB 5L0HA 4G78A 4H4KC 3QW1A 2XL6A 3TK0A 5KYUB 1ZHTA 2GWWA 2ZXRA 1HW2A 4NY3A 3LNRA 3RQGA 5HV9A 1E85A 1O3UA 1E84A 1SF8A 3SEOA 3KH2A 2HMQA 3TOMA 1JR8A 4HEAJ 2A6HF 1T6QA 2X51A 1HMOA 2XLEA 3Q7GA 1FMWA 5FCLA 3ZC4A 5DS4A 4MVQA 1R5ID 4MS2A 1OW8A 3T6BA 2P61A 2XRHA 4IAOA 3ABKC 2KNHA 4XEFA 5KYXA 5JSLA 3RQFA 1T5OA 4JJFA 3JSEO 2XXAA 3V7OA 2W4MA 1YVIA 2W9YA 5A6BA 2NUTA 3EFOB 1L7CA 2NUPB 4GYTA 3S27A 3K6BA 3MYIA 2VASA 4CDAA 2R7TA 3GORA 3S28A 5BQIA 2HZ8A 3JCUQ 1NLXA 1CPQA 1A7DA 2NPUA 4O6YA 3EGXB 3LS1A 2OQMA 3NMIA 4U9EA 4CDVA 1OW7A 1QKRA 4C3EA 2EPLX 1N1CA 2KJGA 1VB5A 2YL3A 3EH1A 2R02A 5DLJA 5A6JA 1WGWA 5A6BD 4JIOA 2IBFA 4OINF 4U5HA 3GM1A 4FWVA 2LQGA 2Q9AA 2J7PA 4OIRF 3VF0A 1JPNA 1XZPA 5KYXB 3QZCA 5IY5C 1ZW3A 1TFKB 4MNDA 2DGJA 1JOGA 2WB7A 4RBNA 1RKEA 3GWNA 1O87A 1C17M 3RH3A 4EIYA 1T6UA 2GDCA 5L3VA 3HLZA 3UR3C 3FAJA 2A1DD 2IXOA 4B6IA 1RJ9A 4PK4A 1VMAA 3CEXA 4PFOA 4XPXA 2OJED 1M2VA 1SR2A 2R05A 3QTHA 1YLMA 4O7GA 2E87A 4E0IA 4KI2A 1YYXA 1YDIA 3NKDA 4QDLA 3L34A 3FVYA 1O5HA 3AQBA 3CQZA 3IQCA 4KBLA 2CDQA 3PMRA 1Z7Qc 3R2PA 4AE4A 1VTMP 1BR1A 2EINC 4CS9A 1EI7A 2YQYA 3U3FA 1R4TA 4YWQA 1QZXA 2OG2A 2R25A 4KNWA 4JZAA 4YL0A 2Q4FA 1CPRA 3U3BA 2QLAA 4IWBA 5JUAA 2OEVA 2PF4E 4BPMA 2YKZA 4YT5A 5D92A 4CS8C 4D4NA 1D1AA 3Q6MA 3MYFA 3K7DA 1H9TA 1RJ9B 3DAFA 1WN0A 1E86A 1H7IA 3K1IA 4IGGA 2Q7RA 5E3CA 3EHMA 4BEJA 5JVEA 3W2WA 2IOQA 2A0BA 4FX5A 4YK5A 5CIVA 1V74B 2YEVA 4J30B 3AG3C 2J9WA 4CSAA 4AE4B 4CDYA 5A6AA 1DOWA 4CS7A 2VB6A 4K0DA 2R7VA 1ZHYA 1XWJA 2BL2A 4GEHA 4AL0A 2LCHA 2RD9A 4ANJA 1I5NA 2LSEA 3EZIA 3L8IA 2P7VA 2Y3DA 4EKWA 2AWCA 1AUEA 3V5ZA 5L0FA 4MVSA 4OIQF 1OCOC 3TD7A 4E7ZA 1I4ZA 1OKKA 3LS0A 3W8HA 4A2NB 2H7OA 4Z9IA 2YL7A 1WWPA 3KMIA 3LLKA 4DRIB 4I1MA 4BJTA 2R7XA 4JCZA 3ZWIA 3B0PA 4BEMJ 1VYIA 4OD4A 3ZDLA 3GEEA 4JKVA 4W8KA 2WZGA 2M64A 2PP4A 3ECSA 1IW7F 1YJGA 3C8GB 4U5CE 2HUJA 3X1OA 4DRHB 5KYWA 3TOLA 4DXWA 3GANA 5JT4A 3UNGC 2HV7A 1MQVA 2AVKA 3DAGA 1MMAA 3OEOA 3DKAA 1APCA 3FOPA 3SXZA 3MBGA 3SYNA 4E17A 1CGNA 5JS5A 1YARO 3SXMA 2Q00A 2XLMA 3DZAA 2QUPA 4IRUA 1D0ZA 4LLEA 2Y3GA 2L6HA 1MMDA 4BJ6A 4YT2A 4MVRA 1RKCA 2KGOA 3NYMA 3U9JA 3E70C 3ATPA 5EHHA 1Q0DA 3DWWA 4JJGA 1HMDA 1FAPB 4XTKA 5T3WA 4FAPB 3S84A 1V55C 3EG9A 2ICWG 2J46A 2VC9A 2ETSA 2C04A 4Q7CA 4ONSA 4H54A 4W8PA 2ZPAA 2G3VA 3EGDB 5B3SC 3B0UX 3DJNB 4IAQA 2NSGA 3F47A 4EHPA 2DI3A 2OKUA 3RIPA 2GAQA 4BJ5C 4JEBA 1HE1A 1VK5A 3CAXA 3NYLA 2W4BA 4WABA 5B3IA 4N6CA 3HKKA 1OCCC 2EPKX 5A6KA 2MWQA 2WVQA 4N06A 1QVXA 4I1OB 5F5FA 5TJ5E 3O6XA 1G5ZA 3GWLA 1RXQA 1NU7D 2G62A 3DE8A 4MTGA 2XM0A 4JE9A 3LEVA 3JRTA 4CX9A 2EIMC 4EBJA 4XLPF 2YRFA 3G4XA 2DYSC 1JRAA 3K1HA 1ZW2A 1TQGA 2YLDA 5L0JA 2CCYA 3R7CA 3JRMO 3TJ6A 3JYYA 3US6A 2HJMA 4MTOA 4YL1A 2A0UA 4CJGA 1D1BA 2J9VA 3LNMB 4G7ZF 1G4US 3SXYA 4IJJA 1B68A 1LPEA 2IM8A 1ZHXA 4EBBA 1RCPA 3VRCA 1JAFA 1GGQA 3Q7LA 4EBKA 3JSZA 4BG0A 2XS1A 2V26A 3ZQVA 1FMVA 4LACB 2IXMA 3IEEA 4GQHA 3WHNA 3W2VA 1H6GA 2HS5A 2TMVP 2NSFA 2L9JA 5DS6A 3WODF 2PNOA 2R7QA 2FGYA 4YJWA 1FFHA 4UDVA 4C7OA 2J0WA 2R7WA 2EILC 3RF3A 1XZQA 3T4RA 2DYRC 3W4YA 2R7UA 1S05A 3G4ZA 3NG1A 1H9GA 3C7JA 5D91A 2XXAB 4Q5SF 3T6JA 4NTBA 2NUTB 3I5QA 2PX0A 3K33A 1VOMA 1A41A 3FOOA 5KYNA 4G7HF 2NG1A 1NFNA 3LJBA 2YL1A 5L3QA 1EKYA 3KYIA 3TJ5A 3O55A 1FNTc 4OIPF 3ASOC 5E33A 1G4WR 2R7SA 2J7PD 1K40A 2M4EA 3H2UA 2Y39A 1RMVA 2BC5A 4LDRA 3B0VC 3A11A 4J32B 5BQHA 2JX0A 3DM5A 3DJUB 1PCXA 4ULVA 4FESA 5COGA 5FZTA 4DBQA 5F5HA 1UFBA 1K04A 1WATA 4ZLCA 4U5EE 3FAPB 2HSBA 3V5XA 3L1MA 1LS4A 2UUIA 4U5FE 3NMKA 1LS1A 1NBBA 3GEHA 4P9TA 1WASA 3VYWA 3ZSUA 2VH3A 1RKEB 2MYSA 2X0CA 5CI9A 2OEXA 4DBRA 2F22A 3KKBA 1Z3IX 3HNJA 2W45A 3SP1A 1QLEC 5AC4A 1PD0A 1TWGA 3I4UA 2YL0A 3L0IA 2LP4A 2D4UA 2PFDA 1M2VB 2G3KA 3U5SA 3DMDA 1SZIA 1W2WA 2KSFA 4CSAC 4JRZA 2AP3A 1TWHA 4PJMA 3WAQA 2R9RB 3U2MA 5KYYA 1DOVA 4PJJA 1OQCA 4JTDB 1K05A 4KNVA 1ZHZA 4MVMA 3HNLA 2UUHA 2HFIA 2A6EF 4JW1A 4DJ9A 5EGYA 4NC3A 2LFDA 3NYJA 4LDQA 3VAYA 3J06A 2Y3HA 4X0RA 3ZTZA 3U8PA 4C3DA 4E7SA 1VLSA 3K66A 3DI5A 4QI0A 4DVYP 1M6TA 3FXHA 4L6RA 5A69A 1BR4A 1LKXA 3EZHA 3EHNA 1QPUA 4JEAA 4YL3A 2IXNA 5AC5A 1TWAA 5COFA 2AU5A 1JPJA 4CS8A 1ZU4A 5JLIA 1J8MF 2XSEA 1WTYA 3NRHA 3FDQA 2XLDA 2YLGA 3AG2C 1JMWA 1WOLA 1SYQA 4AK9A 2WVOA 2J45A 3E9VA 1OKKD 1KNYA 2CYDA 3POVA 2KC3A 1Z5ZA 1ZHWA 3H65A 4O79A 1S7ZA 2Y3BA 1TR2A 2L6GA 4MTFA 3EH2A 5COMA 1UG7A 1FR0A 3N24A 3C18A 2QNLA 3ASNC 4ULWA 1ZYRF 3EQLF 1MMGA 1L3PA 3FHDA 4JCHA 1QSPA 2R03A 4K1OA 5DVWA 3M4BA 4QI2A 1EQ1A 3H2VA 1Z63A 2LIGA 4XLNF 1PV3A 2WL8A 3DD7A 4MW8A 5DQZA 3U0CA 1M57C 4PR9A 2QE9A 2OU6A 1YA9A 3LAYA 2ASRA 1OXBA 3NMJA 2Y69C 4HE8D 4JC7A 3WG7C 3GODA 5HSWA 2H7BA 1TWCA 5KYWB 3ABLC 3ZIBA 3RFYA 1CGME 1ST6A 3JTLO 1OCRC 3LEOA 4JTAB 4LLCA 1D1CA 3GEIA 2P6VA 2P0NA 3VM6A 3O10A 3GM2A 2O9XA 3ZVRA 2KK1A 2L81A 5L0CA 2I15A 3AQCA 2V3CC 2AWYA 4ZLDA 3BRJA 3QVYA 4NTFA 2PBEA 2EPOA 5EK0A 2WVNA 2LD6A 1GS9A
chains in the Genus database with same CATH topology
3U9MA 3V5YA 3V5ZA 3CAXA 3V5XA 3U9JA 2P0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9M A;  3V5Y A;  3V5Z A;  3CAX A;  3V5X A;  3U9J A;  2P0N A; 
#chains in the Genus database with same CATH topology
 2XLW A;  1LI5 A;  1M56 C;  1Q0G A;  1I4Y A;  1Y4C A;  4DRJ B;  5T3T A;  3EG9 B;  1PD1 A;  3PDM P;  5L0G A;  1NFO A;  2XLV A;  2J0X A;  1YA7 O;  2OOC A;  3F46 A;  4OD5 A;  4E18 A;  4JVS A;  2R7O A;  3L8J A;  4NTA A;  3DM9 B;  1NZE A;  1U6H A;  5BQG A;  2CGE A;  1ZZP A;  1F1M A;  2IXP A;  3GM3 A;  5GPG B;  3S90 A;  4PJL A;  4XWJ A;  3HJC A;  3U8V A;  4E0H A;  3LUT B;  5L0I A;  4CIP A;  4XPY A;  3EGX A;  2HV6 A;  3HNI A;  1A0B A;  1M2O A;  1V54 C;  3B29 A;  4U9D A;  1T6I A;  3UMK A;  2XLO A;  4BJ5 A;  2YVK A;  3PHF 2;  4XQ1 A;  4XPW A;  3U9M A;  4CBE A;  4CJO A;  4K7B A;  1BBH A;  2ZXO A;  3O39 A;  4A4A A;  2B0H A;  3SXK A;  1NU9 C;  1A7E A;  5AGF A;  3W8I A;  4RDA A;  2H8A A;  1YAU O;  4C3B A;  1D0X A;  4MVZ A;  2Q3T A;  1QQ3 A;  2EIK C;  3B71 A;  3MLG A;  4O6N A;  2B0J A;  3N2Z B;  4MQ9 F;  4D4X A;  3UMH A;  5JRA A;  3NDB B;  4P9F A;  4F4B A;  1OR2 A;  2H7V C;  1YYJ A;  2HKV A;  3AGT A;  4JTC B;  1ZVZ A;  1AEP A;  2YLI A;  1OCZ C;  4OIO F;  2OJQ A;  5E3A A;  2L7A A;  2YHS A;  1Y6D A;  4NCQ A;  4U5B E;  2LFF A;  2XS8 A;  3ZQY A;  1MNE A;  4CS9 C;  4G7O F;  2J8W A;  3I5P A;  1FTS A;  2DB4 A;  2GFH A;  3M15 A;  3IHU A;  3TUL A;  3N0T A;  4J7Y A;  1E83 A;  1T9K A;  4Q4Z F;  3KPH A;  1Q0M A;  1VLT A;  4C7O B;  2PX3 A;  3MFN A;  3Q6N A;  4DOZ A;  3AG4 C;  4WGY A;  4Z9H A;  3RQE A;  3ABM C;  1CGO A;  2J9U A;  2XM4 A;  3DXJ F;  3K1I C;  2FFH A;  2Z15 A;  256B A;  2A68 F;  3PCV A;  3ZTM A;  2CW0 F;  3AJM A;  3SZR A;  4YN0 B;  1AVO B;  1ORJ A;  2RSE B;  4KC9 A;  3CSK A;  3UGO A;  4EWC A;  3EJN A;  1Z23 A;  1C02 A;  2KW3 C;  1BDJ B;  4HFF B;  1OW6 A;  1T01 A;  3ITF A;  4MVU A;  4LDK A;  3S9O A;  3ZG1 A;  2A69 F;  1HY5 A;  3LES A;  3HTK C;  3JT1 A;  1OXK A;  1GM5 A;  3BEH A;  3UGP A;  1G8X A;  3RVY A;  3OWT A;  3AG1 C;  4IB4 A;  4U5G A;  3B9Q A;  3U2L A;  3OA1 A;  2P1A A;  1TKN A;  5F28 E;  3S29 A;  4CIH A;  1EA8 A;  1NG1 A;  1C03 A;  3M79 A;  3AOU A;  2YWA A;  4WGZ A;  2MHR A;  2VCC A;  1GQA A;  3CZ6 A;  4MW3 A;  4O6M A;  2KQ9 A;  4RD9 A;  4BJ1 A;  5BUO A;  2EPM X;  3KL4 A;  1HE9 A;  2L6F A;  2FAP B;  3JYH A;  4I44 A;  5KYY B;  3C8G A;  5CI8 A;  5DQT A;  2ZXP A;  1SMY F;  1VYK A;  4J7T A;  1BR2 A;  2EIJ C;  2Q9C A;  2QTV A;  3LLI A;  2YZS A;  1D0Y A;  1Q0K A;  3FMS A;  3UMI A;  1KTM A;  2VCA A;  1LM3 B;  4ER9 A;  2D5R B;  3IPM O;  4R32 A;  4BJ6 C;  4MVO A;  2OCC C;  1FFT C;  2EPN A;  2CNW A;  2XLH A;  3C63 A;  3QW0 A;  1U89 A;  1LVK A;  3C8G D;  5DS5 A;  3S0X A;  4PAC A;  2BE5 F;  1TFO B;  1HW1 A;  2VCB A;  3M4C A;  1BZ4 A;  1IZM A;  3KYJ A;  2R7R A;  1MND A;  1YZC A;  4P6I C;  3X2Q C;  4YT4 A;  3RKO F;  1Q0F A;  1LIH A;  1LI7 A;  1ORS C;  2Q9B A;  3C8Z A;  3HNK A;  4G0H A;  4U5D E;  4AX2 A;  1J8Y F;  3NKE A;  2CNW D;  5K0I A;  2C03 A;  2HSQ A;  2QY9 A;  3C62 A;  3JZ0 A;  3DE9 A;  4I3M A;  4JUR I;  4N4W A;  4DVZ A;  3IQ5 A;  3EGD A;  2XL8 A;  3A9C A;  4PFP A;  1LE2 A;  3EPV A;  3SNH A;  1U0B B;  1A7V A;  4Z9J A;  3RW0 A;  5KYU A;  4N6H A;  2JD3 A;  2LK4 A;  3IQT A;  2IYL D;  3QVZ A;  3IQ6 A;  4LER A;  4NQF A;  2JPU A;  4XEK A;  3T6G B;  1Z6A A;  1OR3 A;  3AGU A;  2HJ3 A;  2ZD9 A;  2XL4 A;  4PJN A;  5JP7 A;  2GA0 A;  4IAR A;  3RVZ A;  3RYL A;  1MMN A;  3M1C B;  1KU2 A;  4WJ0 A;  1YZA A;  3MX3 A;  2KYH A;  2J9B A;  5L0D A;  2WZF A;  1E2X A;  1V4A A;  3QMK A;  3T9O A;  4M63 A;  3G50 A;  5B1A C;  1NSG B;  1ORY A;  2ZXW C;  5B1B C;  1LE4 A;  4XEV A;  3TQO A;  3V5Y A;  4EUK B;  2WZL A;  4AL1 A;  5T1D B;  2I8B A;  1ZU5 A;  5E2Q A;  4YT8 A;  2HMZ A;  3EFO A;  2NUP A;  4HFK B;  5L0H A;  4G78 A;  4H4K C;  3QW1 A;  2XL6 A;  3TK0 A;  5KYU B;  1ZHT A;  2GWW A;  2ZXR A;  1HW2 A;  4NY3 A;  3LNR A;  3RQG A;  5HV9 A;  1E85 A;  1O3U A;  1E84 A;  1SF8 A;  3SEO A;  3KH2 A;  2HMQ A;  3TOM A;  1JR8 A;  4HEA J;  2A6H F;  1T6Q A;  2X51 A;  1HMO A;  2XLE A;  3Q7G A;  1FMW A;  5FCL A;  3ZC4 A;  5DS4 A;  4MVQ A;  1R5I D;  4MS2 A;  1OW8 A;  3T6B A;  2P61 A;  2XRH A;  4IAO A;  3ABK C;  2KNH A;  4XEF A;  5KYX A;  5JSL A;  3RQF A;  1T5O A;  4JJF A;  3JSE O;  2XXA A;  3V7O A;  2W4M A;  1YVI A;  2W9Y A;  5A6B A;  2NUT A;  3EFO B;  1L7C A;  2NUP B;  4GYT A;  3S27 A;  3K6B A;  3MYI A;  2VAS A;  4CDA A;  2R7T A;  3GOR A;  3S28 A;  5BQI A;  2HZ8 A;  3JCU Q;  1NLX A;  1CPQ A;  1A7D A;  2NPU A;  4O6Y A;  3EGX B;  3LS1 A;  2OQM A;  3NMI A;  4U9E A;  4CDV A;  1OW7 A;  1QKR A;  4C3E A;  2EPL X;  1N1C A;  2KJG A;  1VB5 A;  2YL3 A;  3EH1 A;  2R02 A;  5DLJ A;  5A6J A;  1WGW A;  5A6B D;  4JIO A;  2IBF A;  4OIN F;  4U5H A;  3GM1 A;  4FWV A;  2LQG A;  2Q9A A;  2J7P A;  4OIR F;  3VF0 A;  1JPN A;  1XZP A;  5KYX B;  3QZC A;  5IY5 C;  1ZW3 A;  1TFK B;  4MND A;  2DGJ A;  1JOG A;  2WB7 A;  4RBN A;  1RKE A;  3GWN A;  1O87 A;  1C17 M;  3RH3 A;  4EIY A;  1T6U A;  2GDC A;  5L3V A;  3HLZ A;  3UR3 C;  3FAJ A;  2A1D D;  2IXO A;  4B6I A;  1RJ9 A;  4PK4 A;  1VMA A;  3CEX A;  4PFO A;  4XPX A;  2OJE D;  1M2V A;  1SR2 A;  2R05 A;  3QTH A;  1YLM A;  4O7G A;  2E87 A;  4E0I A;  4KI2 A;  1YYX A;  1YDI A;  3NKD A;  4QDL A;  3L34 A;  3FVY A;  1O5H A;  3AQB A;  3CQZ A;  3IQC A;  4KBL A;  2CDQ A;  3PMR A;  1Z7Q c;  3R2P A;  4AE4 A;  1VTM P;  1BR1 A;  2EIN C;  4CS9 A;  1EI7 A;  2YQY A;  3U3F A;  1R4T A;  4YWQ A;  1QZX A;  2OG2 A;  2R25 A;  4KNW A;  4JZA A;  4YL0 A;  2Q4F A;  1CPR A;  3U3B A;  2QLA A;  4IWB A;  5JUA A;  2OEV A;  2PF4 E;  4BPM A;  2YKZ A;  4YT5 A;  5D92 A;  4CS8 C;  4D4N A;  1D1A A;  3Q6M A;  3MYF A;  3K7D A;  1H9T A;  1RJ9 B;  3DAF A;  1WN0 A;  1E86 A;  1H7I A;  3K1I A;  4IGG A;  2Q7R A;  5E3C A;  3EHM A;  4BEJ A;  5JVE A;  3W2W A;  2IOQ A;  2A0B A;  4FX5 A;  4YK5 A;  5CIV A;  1V74 B;  2YEV A;  4J30 B;  3AG3 C;  2J9W A;  4CSA A;  4AE4 B;  4CDY A;  5A6A A;  1DOW A;  4CS7 A;  2VB6 A;  4K0D A;  2R7V A;  1ZHY A;  1XWJ A;  2BL2 A;  4GEH A;  4AL0 A;  2LCH A;  2RD9 A;  4ANJ A;  1I5N A;  2LSE A;  3EZI A;  3L8I A;  2P7V A;  2Y3D A;  4EKW A;  2AWC A;  1AUE A;  3V5Z A;  5L0F A;  4MVS A;  4OIQ F;  1OCO C;  3TD7 A;  4E7Z A;  1I4Z A;  1OKK A;  3LS0 A;  3W8H A;  4A2N B;  2H7O A;  4Z9I A;  2YL7 A;  1WWP A;  3KMI A;  3LLK A;  4DRI B;  4I1M A;  4BJT A;  2R7X A;  4JCZ A;  3ZWI A;  3B0P A;  4BEM J;  1VYI A;  4OD4 A;  3ZDL A;  3GEE A;  4JKV A;  4W8K A;  2WZG A;  2M64 A;  2PP4 A;  3ECS A;  1IW7 F;  1YJG A;  3C8G B;  4U5C E;  2HUJ A;  3X1O A;  4DRH B;  5KYW A;  3TOL A;  4DXW A;  3GAN A;  5JT4 A;  3UNG C;  2HV7 A;  1MQV A;  2AVK A;  3DAG A;  1MMA A;  3OEO A;  3DKA A;  1APC A;  3FOP A;  3SXZ A;  3MBG A;  3SYN A;  4E17 A;  1CGN A;  5JS5 A;  1YAR O;  3SXM A;  2Q00 A;  2XLM A;  3DZA A;  2QUP A;  4IRU A;  1D0Z A;  4LLE A;  2Y3G A;  2L6H A;  1MMD A;  4BJ6 A;  4YT2 A;  4MVR A;  1RKC A;  2KGO A;  3NYM A;  3U9J A;  3E70 C;  3ATP A;  5EHH A;  1Q0D A;  3DWW A;  4JJG A;  1HMD A;  1FAP B;  4XTK A;  5T3W A;  4FAP B;  3S84 A;  1V55 C;  3EG9 A;  2ICW G;  2J46 A;  2VC9 A;  2ETS A;  2C04 A;  4Q7C A;  4ONS A;  4H54 A;  4W8P A;  2ZPA A;  2G3V A;  3EGD B;  5B3S C;  3B0U X;  3DJN B;  4IAQ A;  2NSG A;  3F47 A;  4EHP A;  2DI3 A;  2OKU A;  3RIP A;  2GAQ A;  4BJ5 C;  4JEB A;  1HE1 A;  1VK5 A;  3CAX A;  3NYL A;  2W4B A;  4WAB A;  5B3I A;  4N6C A;  3HKK A;  1OCC C;  2EPK X;  5A6K A;  2MWQ A;  2WVQ A;  4N06 A;  1QVX A;  4I1O B;  5F5F A;  5TJ5 E;  3O6X A;  1G5Z A;  3GWL A;  1RXQ A;  1NU7 D;  2G62 A;  3DE8 A;  4MTG A;  2XM0 A;  4JE9 A;  3LEV A;  3JRT A;  4CX9 A;  2EIM C;  4EBJ A;  4XLP F;  2YRF A;  3G4X A;  2DYS C;  1JRA A;  3K1H A;  1ZW2 A;  1TQG A;  2YLD A;  5L0J A;  2CCY A;  3R7C A;  3JRM O;  3TJ6 A;  3JYY A;  3US6 A;  2HJM A;  4MTO A;  4YL1 A;  2A0U A;  4CJG A;  1D1B A;  2J9V A;  3LNM B;  4G7Z F;  1G4U S;  3SXY A;  4IJJ A;  1B68 A;  1LPE A;  2IM8 A;  1ZHX A;  4EBB A;  1RCP A;  3VRC A;  1JAF A;  1GGQ A;  3Q7L A;  4EBK A;  3JSZ A;  4BG0 A;  2XS1 A;  2V26 A;  3ZQV A;  1FMV A;  4LAC B;  2IXM A;  3IEE A;  4GQH A;  3WHN A;  3W2V A;  1H6G A;  2HS5 A;  2TMV P;  2NSF A;  2L9J A;  5DS6 A;  3WOD F;  2PNO A;  2R7Q A;  2FGY A;  4YJW A;  1FFH A;  4UDV A;  4C7O A;  2J0W A;  2R7W A;  2EIL C;  3RF3 A;  1XZQ A;  3T4R A;  2DYR C;  3W4Y A;  2R7U A;  1S05 A;  3G4Z A;  3NG1 A;  1H9G A;  3C7J A;  5D91 A;  2XXA B;  4Q5S F;  3T6J A;  4NTB A;  2NUT B;  3I5Q A;  2PX0 A;  3K33 A;  1VOM A;  1A41 A;  3FOO A;  5KYN A;  4G7H F;  2NG1 A;  1NFN A;  3LJB A;  2YL1 A;  5L3Q A;  1EKY A;  3KYI A;  3TJ5 A;  3O55 A;  1FNT c;  4OIP F;  3ASO C;  5E33 A;  1G4W R;  2R7S A;  2J7P D;  1K40 A;  2M4E A;  3H2U A;  2Y39 A;  1RMV A;  2BC5 A;  4LDR A;  3B0V C;  3A11 A;  4J32 B;  5BQH A;  2JX0 A;  3DM5 A;  3DJU B;  1PCX A;  4ULV A;  4FES A;  5COG A;  5FZT A;  4DBQ A;  5F5H A;  1UFB A;  1K04 A;  1WAT A;  4ZLC A;  4U5E E;  3FAP B;  2HSB A;  3V5X A;  3L1M A;  1LS4 A;  2UUI A;  4U5F E;  3NMK A;  1LS1 A;  1NBB A;  3GEH A;  4P9T A;  1WAS A;  3VYW A;  3ZSU A;  2VH3 A;  1RKE B;  2MYS A;  2X0C A;  5CI9 A;  2OEX A;  4DBR A;  2F22 A;  3KKB A;  1Z3I X;  3HNJ A;  2W45 A;  3SP1 A;  1QLE C;  5AC4 A;  1PD0 A;  1TWG A;  3I4U A;  2YL0 A;  3L0I A;  2LP4 A;  2D4U A;  2PFD A;  1M2V B;  2G3K A;  3U5S A;  3DMD A;  1SZI A;  1W2W A;  2KSF A;  4CSA C;  4JRZ A;  2AP3 A;  1TWH A;  4PJM A;  3WAQ A;  2R9R B;  3U2M A;  5KYY A;  1DOV A;  4PJJ A;  1OQC A;  4JTD B;  1K05 A;  4KNV A;  1ZHZ A;  4MVM A;  3HNL A;  2UUH A;  2HFI A;  2A6E F;  4JW1 A;  4DJ9 A;  5EGY A;  4NC3 A;  2LFD A;  3NYJ A;  4LDQ A;  3VAY A;  3J06 A;  2Y3H A;  4X0R A;  3ZTZ A;  3U8P A;  4C3D A;  4E7S A;  1VLS A;  3K66 A;  3DI5 A;  4QI0 A;  4DVY P;  1M6T A;  3FXH A;  4L6R A;  5A69 A;  1BR4 A;  1LKX A;  3EZH A;  3EHN A;  1QPU A;  4JEA A;  4YL3 A;  2IXN A;  5AC5 A;  1TWA A;  5COF A;  2AU5 A;  1JPJ A;  4CS8 A;  1ZU4 A;  5JLI A;  1J8M F;  2XSE A;  1WTY A;  3NRH A;  3FDQ A;  2XLD A;  2YLG A;  3AG2 C;  1JMW A;  1WOL A;  1SYQ A;  4AK9 A;  2WVO A;  2J45 A;  3E9V A;  1OKK D;  1KNY A;  2CYD A;  3POV A;  2KC3 A;  1Z5Z A;  1ZHW A;  3H65 A;  4O79 A;  1S7Z A;  2Y3B A;  1TR2 A;  2L6G A;  4MTF A;  3EH2 A;  5COM A;  1UG7 A;  1FR0 A;  3N24 A;  3C18 A;  2QNL A;  3ASN C;  4ULW A;  1ZYR F;  3EQL F;  1MMG A;  1L3P A;  3FHD A;  4JCH A;  1QSP A;  2R03 A;  4K1O A;  5DVW A;  3M4B A;  4QI2 A;  1EQ1 A;  3H2V A;  1Z63 A;  2LIG A;  4XLN F;  1PV3 A;  2WL8 A;  3DD7 A;  4MW8 A;  5DQZ A;  3U0C A;  1M57 C;  4PR9 A;  2QE9 A;  2OU6 A;  1YA9 A;  3LAY A;  2ASR A;  1OXB A;  3NMJ A;  2Y69 C;  4HE8 D;  4JC7 A;  3WG7 C;  3GOD A;  5HSW A;  2H7B A;  1TWC A;  5KYW B;  3ABL C;  3ZIB A;  3RFY A;  1CGM E;  1ST6 A;  3JTL O;  1OCR C;  3LEO A;  4JTA B;  4LLC A;  1D1C A;  3GEI A;  2P6V A;  2P0N A;  3VM6 A;  3O10 A;  3GM2 A;  2O9X A;  3ZVR A;  2KK1 A;  2L81 A;  5L0C A;  2I15 A;  3AQC A;  2V3C C;  2AWY A;  4ZLD A;  3BRJ A;  3QVY A;  4NTF A;  2PBE A;  2EPO A;  5EK0 A;  2WVN A;  2LD6 A;  1GS9 A; 
#chains in the Genus database with same CATH homology
 3U9M A;  3V5Y A;  3V5Z A;  3CAX A;  3V5X A;  3U9J A;  2P0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...