3V5YA

Structure of fbxl5 hemerythrin domain, p2(1) cell
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
155
structure length
153
Chain Sequence
b'PEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 71
structure length 153
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5yA00
3CAXA 3U9MA 3V5YA 3V5XA 3U9JA 3V5ZA 2P0NA
chains in the Genus database with same CATH superfamily
4G78A 2CGEA 3L34A 5DQTA 1AEPA 3G4XA 2B0HA 3WG7C 1HW1A 3JZ0A 4CSAC 2OEVA 2XM0A 4CX9A 1TWCA 4EBBA 2KNHA 3IPMO 2B0JA 2E87A 1Q0FA 2PFDA 1QSPA 3ATPA 4MNDA 3SXZA 3US6A 1EQ1A 3FAJA 1YAUO 1MQVA 3N24A 3EHMA 1OR3A 4DRIB 2LFFA 4LDRA 1CGME 3U9JA 3W2VA 4MTOA 1HE1A 3RQFA 4CJGA 1YA7O 3HJCA 1V54C 4Q5SF 2HSQA 5DS5A 1TFKB 3C7JA 3Q6MA 4U5FE 3U2LA 2R7WA 4UDVA 3EFOB 5L0FA 5L3QA 1SR2A 3GWNA 5T1DB 2A6EF 2P61A 4AK9A 3UMIA 2AP3A 4BPMA 2Z15A 4CDAA 3POVA 3UMKA 4BJ6A 1BBHA 4ONSA 5T3TA 1MMGA 2R7SA 1NFOA 1YARO 1JR8A 2QLAA 2O9XA 3CAXA 2ZXOA 3NG1A 3UNGC 3JRMO 4ZLCA 2R7OA 5GPGB 4Q4ZF 1D1AA 1F1MA 4IRUA 4I3MA 1YLMA 2HV6A 3DE9A 4JW1A 4JJFA 3C8GB 3L1MA 5DLJA 3LEOA 3K33A 4YL3A 2RD9A 1QQ3A 2OOCA 3ZIBA 2H7VC 2YL0A 1C17M 4BJ6C 1T5OA 1DOVA 1AVOB 3B0PA 4D4XA 2P1AA 4Q7CA 2FFHA 3QVYA 1S05A 1NSGB 2XLOA 3GORA 3DAFA 3W8HA 4E0HA 5KYWB 1ZHWA 5A6BD 3EPVA 3IQCA 1T6IA 2W4MA 1WWPA 4QI0A 2P0NA 1ORYA 3QTHA 1TFOB 4AL1A 3U5SA 4BEMJ 4HFKB 5B3IA 4MW8A 3QMKA 4FAPB 4DJ9A 2NPUA 3KKBA 4EHPA 4CBEA 3RW0A 1PD0A 1ORJA 3IQTA 1EA8A 2L7AA 2CNWD 3U8VA 5B3SC 1OW7A 3CSKA 2VCBA 3JCUQ 4LDQA 1ZU4A 5JP7A 2PX3A 4CJOA 4E0IA 3DWWA 3IHUA 4PJJA 3BEHA 5L3VA 3J06A 1ZZPA 2GAQA 2J0WA 4O6YA 1JRAA 3AG1C 4WJ0A 1OCCC 4O6NA 4XWJA 1EI7A 3SXKA 3ZG1A 4OD4A 2WVQA 4I1MA 4A2NB 3M79A 1ZW2A 4K1OA 1FFTC 2YRFA 4WGZA 4PK4A 4G0HA 3NMJA 1WOLA 2HKVA 3C8GD 2LIGA 1FNTc 1YJGA 1Q0DA 1YVIA 5JVEA 2AWCA 3EFOA 3X2QC 3TOMA 1I4YA 2NG1A 3S29A 4BJTA 2Q7RA 3TK0A 1L3PA 2EPOA 1CGNA 4U5BE 2ZXPA 3FOOA 1RKEB 3AJMA 2OQMA 4KNWA 1YZAA 1UG7A 2R05A 4H54A 1XZQA 4CS8A 1V55C 5JT4A 2XLVA 2PP4A 1OXKA 5EK0A 1WASA 1LS4A 4BEJA 4JTCB 2MYSA 4MTGA 5EGYA 3JYYA 2DI3A 3ZTMA 5L0DA 3PMRA 4J7TA 2W4BA 3NKDA 3DZAA 4JJGA 4RD9A 3C8GA 2VCCA 2L9JA 4O79A 1U6HA 1D0YA 2W9YA 1UFBA 2R25A 3OEOA 5D92A 4EWCA 5JRAA 4OIQF 1HW2A 4I1OB 3LEVA 1ZYRF 5L0IA 3JSZA 4NTFA 4CS8C 1LM3B 3EHNA 3ABMC 3VYWA 3HNIA 4IGGA 1E84A 1Q0KA 2CW0F 2F22A 1M2VB 2OCCC 1MNDA 1TWAA 3EG9B 3UGPA 2EIJC 3O10A 3V5ZA 5JS5A 2J45A 3RH3A 3EGDB 4MVQA 2EPNA 1MMNA 1OQCA 2HJMA 1I4ZA 1CGOA 3MYIA 1A0BA 3O39A 4JEAA 4NY3A 4XQ1A 4DXWA 2XSEA 1OKKA 3KYIA 4JVSA 4P9FA 2EPKX 1A41A 1LE2A 2EILC 3CZ6A 3HLZA 5E3AA 1G4WR 3RYLA 2FGYA 1QZXA 5BQIA 3M1CB 4ANJA 1GQAA 1MNEA 1RJ9B 4DOZA 1BR4A 3PDMP 1FR0A 2J0XA 1LIHA 2NSFA 2Y3GA 4FESA 4N06A 3W8IA 4DRHB 4XLPF 1B68A 1WGWA 256BA 4N6HA 5IY5C 2A1DD 2DGJA 3ABLC 5B1BC 3FXHA 4MTFA 2OJED 2CYDA 2OKUA 2UUIA 3N2ZB 3QZCA 3VAYA 3ZVRA 1K04A 2X51A 2ZPAA 3E70C 1AUEA 4IARA 3HNLA 1NFNA 2KC3A 4DRJB 4C7OB 2QE9A 2Q9BA 1T6UA 4FX5A 2YLDA 4MVMA 1FTSA 1GM5A 3C8ZA 2KGOA 1Z63A 4MVOA 3R7CA 2AU5A 1JPJA 4JTDB 2NUTB 3OA1A 4JC7A 1M6TA 2I8BA 2KK1A 3A9CA 4HFFB 1FMVA 4JRZA 2V3CC 3K7DA 1KU2A 2Y69C 4CS7A 1LI5A 1MMDA 1TQGA 4PACA 2C04A 5FZTA 4PFOA 4QI2A 4J7YA 3NRHA 1PD1A 1PV3A 2A68F 5COGA 4G7OF 4IJJA 5KYUB 5HV9A 1Y4CA 2J7PD 3KPHA 1VLSA 1HMDA 2HJ3A 2L6GA 3B0UX 3GEHA 4E18A 3DM9B 4U5HA 1RKCA 4LACB 3NYJA 1S7ZA 5D91A 2Y3BA 1RMVA 4XEKA 3Q7GA 2IOQA 3K1HA 4JE9A 4GYTA 3DE8A 4KI2A 4EBKA 4U5EE 3E9VA 3ZDLA 1C02A 3Q7LA 1N1CA 3I4UA 3EG9A 3I5QA 3TJ6A 3S9OA 2ETSA 2VASA 3EGDA 4P6IC 1GS9A 2OU6A 2M4EA 2Q4FA 3NMKA 3MX3A 4NTBA 2W45A 4AL0A 4XPXA 2V26A 3EGXA 4IWBA 1Y6DA 4E7SA 3HKKA 4PFPA 1OCOC 2YZSA 2RSEB 3O6XA 1BDJB 4E7ZA 3H2VA 1VYIA 1D1CA 3LESA 4XEFA 5KYXB 2UUHA 2L6FA 3ZTZA 3FHDA 2J9VA 3B0VC 3FOPA 1BR1A 3KMIA 1RJ9A 3Q6NA 4ULVA 1QPUA 5K0IA 2G62A 1LVKA 4H4KC 4JEBA 1CPRA 1Z6AA 2XL8A 4KBLA 1ORSC 2ASRA 3ASOC 4HEAJ 3GEIA 4J30B 4N6CA 1J8MF 3RQGA 2XL4A 3JTLO 1BZ4A 1WTYA 4LLCA 4U5DE 2YEVA 3HNJA 3X1OA 2EIMC 3DD7A 5TJ5E 1LKXA 1SF8A 1A7EA 4JTAB 3UGOA 4MS2A 4W8KA 5A6BA 4HE8D 4OIRF 3I5PA 4OD5A 3S27A 3WHNA 4BJ1A 3AG4C 5KYNA 3U0CA 1LPEA 3ITFA 1H9GA 3FAPB 4CS9A 2EPMX 2XLMA 2VB6A 4IB4A 2WVNA 1ZHYA 2NUTA 1NBBA 2QNLA 3PCVA 3S84A 3EJNA 4OIPF 3GM1A 4IAOA 5A6AA 2KSFA 4WABA 4NC3A 2GA0A 1TKNA 2CNWA 3H65A 2R7XA 1D1BA 1JPNA 1R5ID 1L7CA 4F4BA 2XS1A 1LE4A 1NG1A 3LS0A 1FAPB 3K6BA 3MFNA 4R32A 2R7QA 4W8PA 1FFHA 2H7BA 3S28A 2A6HF 4G7ZF 4NTAA 3KYJA 1HE9A 4YL0A 4I44A 4WGYA 3L0IA 4XLNF 4CS9C 3JSEO 5KYUA 1U89A 4MVZA 5L0HA 2J8WA 3M4CA 4DBQA 2CDQA 1J8YF 3WAQA 1E83A 1IW7F 2D4UA 2LFDA 4O6MA 4YK5A 5L0CA 3UR3C 4E17A 1OW6A 4XTKA 3B71A 3AG3C 4YT8A 2KYHA 2YKZA 1VTMP 3KL4A 1SMYF 3FDQA 3QW0A 3U2MA 2XLDA 2XM4A 4U9EA 2HMQA 3MLGA 2Y3DA 3GWLA 1OCRC 3O55A 5F5FA 3F47A 1VYKA 5A6JA 1KNYA 1TWGA 4KC9A 5KYYB 2M64A 1FMWA 4RBNA 3PHF2 3NYMA 4DVYP 2ICWG 2A69F 4QDLA 3U9MA 2YHSA 5KYWA 2HUJA 1ZHZA 3ASNC 1D0XA 2EIKC 4JURI 5A69A 1H9TA 2QTVA 2PNOA 2MHRA 5KYXA 1NLXA 1VB5A 1Z7Qc 1RCPA 2J9UA 1HMOA 1WN0A 3SXYA 1T01A 4LERA 3EH2A 1E86A 1W2WA 1MMAA 1JOGA 2XXAB 1G5ZA 3IQ6A 3HTKC 3W4YA 3C63A 1Q0MA 1YDIA 1BR2A 2KW3C 2P6VA 2R03A 3CEXA 3EZHA 3LAYA 3DAGA 3DJNB 1H7IA 3WODF 1G4US 3TULA 2NUPB 1M56C 3S90A 3ECSA 3GANA 3L8JA 3C18A 5A6KA 4G7HF 2AVKA 5AC4A 4ZLDA 3GEEA 2IXPA 3SP1A 4CDVA 1ZW3A 1ZHXA 2LD6A 3SYNA 3G50A 2J9BA 4CDYA 2EPLX 1QLEC 3B9QA 3FMSA 5COFA 5AC5A 5BQGA 2GDCA 2Q9CA 4JCHA 3SEOA 4YL1A 2HV7A 1K40A 1O5HA 1VOMA 2TMVP 1NU7D 2GWWA 3AQCA 2R7RA 4Z9IA 5JLIA 2XLEA 2PX0A 1OR2A 3DJUB 4YWQA 5HSWA 3L8IA 1E2XA 1CPQA 2BL2A 4MQ9F 4XPWA 1A7DA 1V4AA 4GQHA 4LLEA 1I5NA 2LP4A 4D4NA 1RKEA 3DI5A 2QY9A 4BG0A 3RIPA 2H8AA 4ULWA 2IXMA 4YN0B 3JT1A 2X0CA 2HSBA 1V74B 5B1AC 3DXJF 2LCHA 4Z9HA 1Z5ZA 2JX0A 1WATA 3TQOA 2AWYA 3F46A 2EINC 2JPUA 2YVKA 1Z23A 5DVWA 2BC5A 2FAPB 2YQYA 1M2OA 2L6HA 5JUAA 2YLGA 2D5RB 3N0TA 4GEHA 1D0ZA 3NDBB 4U9DA 1NZEA 2OG2A 4LDKA 2XS8A 1HY5A 4EIYA 3DM5A 4CIHA 2XL6A 1RXQA 2XLHA 1M57C 4ER9A 2A0UA 1T6QA 2WL8A 4YJWA 3TOLA 2KJGA 5T3WA 1G8XA 3V5YA 1YYXA 3LNMB 2R02A 1M2VA 1JAFA 1Z3IX 3NYLA 5KYYA 1APCA 3ZWIA 1PCXA 3MBGA 2XLWA 4DBRA 3EQLF 1A7VA 3AQBA 3RKOF 4X0RA 1NU9C 2G3VA 2J7PA 3VM6A 2Q9AA 3TD7A 4AX2A 2I15A 3G4ZA 5E3CA 3VRCA 3C62A 2HMZA 3K66A 2DYRC 2R7UA 4NCQA 5E33A 4XEVA 2IBFA 3T6BA 4EKWA 2XXAA 2HFIA 3IEEA 4KNVA 3W2WA 4JZAA 1LI7A 5BUOA 3S0XA 1OXBA 3CQZA 3IQ5A 4CIPA 3SZRA 4OIOF 1O87A 2GFHA 2MWQA 3GODA 2Q3TA 4M63A 4C3DA 2NUPA 5CI8A 2A0BA 2KQ9A 1OCZC 1ZVZA 2P7VA 1DOWA 3JRTA 4C3EA 3AGTA 2DB4A 2L81A 5F5HA 3ZSUA 4B6IA 1SYQA 3LNRA 4EUKB 3AOUA 3FVYA 4AE4B 2NSGA 1XZPA 5DQZA 4A4AA 3BRJA 5L0JA 4C7OA 2Y3HA 2JD3A 3LS1A 3U8PA 2QUPA 2OJQA 5DS6A 4K7BA 4MVUA 3OWTA 4FWVA 2ZXWC 2R7TA 2Q00A 3DKAA 1TWHA 2LSEA 2R7VA 3T9OA 3A11A 4U5GA 3EH1A 3MYFA 3NMIA 2YWAA 2VC9A 1TR2A 1H6GA 3M15A 3B29A 3RVYA 3RQEA 3U3BA 2ZD9A 5JSLA 1ZHTA 2YL1A 5E2QA 4YT4A 2YL3A 3LUTB 3GM3A 4JIOA 4JCZA 2IYLD 1VK5A 2HS5A 4L6RA 4BJ5A 2DYSC 2LK4A 2BE5F 1SZIA 1KTMA 1OW8A 3RF3A 1VLTA 3V5XA 1Q0GA 2HZ8A 3ZC4A 2J46A 2WZLA 4MW3A 4JKVA 3LJBA 3SNHA 2IM8A 3AG2C 4C3BA 2WVOA 3AGUA 1VMAA 3NKEA 4MVSA 3U3FA 2CCYA 3JYHA 4J32B 5FCLA 5L0GA 2OEXA 5DS4A 3UMHA 1GGQA 4XPYA 4BJ5C 4PJMA 3ZQYA 2YLIA 1EKYA 1XWJA 1U0BB 3EZIA 4MVRA 3QW1A 2IXNA 1T9KA 1ST6A 2ZXRA 4PR9A 2IXOA 2J9WA 4U5CE 2Y39A 4YT5A 4Z9JA 4YT2A 1ZU5A 5AGFA 5CI9A 1OKKD 4EBJA 5BQHA 5EHHA 2VCAA 5F28E 4P9TA 3GM2A 1YZCA 4DVZA 3ABKC 2YL7A 5COMA 4O7GA 3V7OA 1R4TA 2VH3A 3VF0A 2WZGA 3DMDA 2XRHA 1IZMA 1K05A 1O3UA 1YA9A 2H7OA 2PBEA 3TJ5A 1YYJA 3RFYA 3K1IA 4OINF 2R9RB 4K0DA 3HNKA 4AE4A 1LS1A 3QVZA 2PF4E 3ZQVA 3H2UA 3KH2A 5CIVA 2LQGA 1E85A 1QKRA 3EGXB 1JMWA 2C03A 3LLIA 3R2PA 4CSAA 4NQFA 2WB7A 3T6GB 4RDAA 3LLKA 3RVZA 3K1IC 4PJLA 3SXMA 3T6JA 4N4WA 3M4BA 4PJNA 1C03A 2WZFA 2G3KA 3T4RA 4IAQA 1QVXA
chains in the Genus database with same CATH topology
3CAXA 3U9MA 3V5YA 3V5XA 3U9JA 3V5ZA 2P0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAX A;  3U9M A;  3V5Y A;  3V5X A;  3U9J A;  3V5Z A;  2P0N A; 
#chains in the Genus database with same CATH topology
 4G78 A;  2CGE A;  3L34 A;  5DQT A;  1AEP A;  3G4X A;  2B0H A;  3WG7 C;  1HW1 A;  3JZ0 A;  4CSA C;  2OEV A;  2XM0 A;  4CX9 A;  1TWC A;  4EBB A;  2KNH A;  3IPM O;  2B0J A;  2E87 A;  1Q0F A;  2PFD A;  1QSP A;  3ATP A;  4MND A;  3SXZ A;  3US6 A;  1EQ1 A;  3FAJ A;  1YAU O;  1MQV A;  3N24 A;  3EHM A;  1OR3 A;  4DRI B;  2LFF A;  4LDR A;  1CGM E;  3U9J A;  3W2V A;  4MTO A;  1HE1 A;  3RQF A;  4CJG A;  1YA7 O;  3HJC A;  1V54 C;  4Q5S F;  2HSQ A;  5DS5 A;  1TFK B;  3C7J A;  3Q6M A;  4U5F E;  3U2L A;  2R7W A;  4UDV A;  3EFO B;  5L0F A;  5L3Q A;  1SR2 A;  3GWN A;  5T1D B;  2A6E F;  2P61 A;  4AK9 A;  3UMI A;  2AP3 A;  4BPM A;  2Z15 A;  4CDA A;  3POV A;  3UMK A;  4BJ6 A;  1BBH A;  4ONS A;  5T3T A;  1MMG A;  2R7S A;  1NFO A;  1YAR O;  1JR8 A;  2QLA A;  2O9X A;  3CAX A;  2ZXO A;  3NG1 A;  3UNG C;  3JRM O;  4ZLC A;  2R7O A;  5GPG B;  4Q4Z F;  1D1A A;  1F1M A;  4IRU A;  4I3M A;  1YLM A;  2HV6 A;  3DE9 A;  4JW1 A;  4JJF A;  3C8G B;  3L1M A;  5DLJ A;  3LEO A;  3K33 A;  4YL3 A;  2RD9 A;  1QQ3 A;  2OOC A;  3ZIB A;  2H7V C;  2YL0 A;  1C17 M;  4BJ6 C;  1T5O A;  1DOV A;  1AVO B;  3B0P A;  4D4X A;  2P1A A;  4Q7C A;  2FFH A;  3QVY A;  1S05 A;  1NSG B;  2XLO A;  3GOR A;  3DAF A;  3W8H A;  4E0H A;  5KYW B;  1ZHW A;  5A6B D;  3EPV A;  3IQC A;  1T6I A;  2W4M A;  1WWP A;  4QI0 A;  2P0N A;  1ORY A;  3QTH A;  1TFO B;  4AL1 A;  3U5S A;  4BEM J;  4HFK B;  5B3I A;  4MW8 A;  3QMK A;  4FAP B;  4DJ9 A;  2NPU A;  3KKB A;  4EHP A;  4CBE A;  3RW0 A;  1PD0 A;  1ORJ A;  3IQT A;  1EA8 A;  2L7A A;  2CNW D;  3U8V A;  5B3S C;  1OW7 A;  3CSK A;  2VCB A;  3JCU Q;  4LDQ A;  1ZU4 A;  5JP7 A;  2PX3 A;  4CJO A;  4E0I A;  3DWW A;  3IHU A;  4PJJ A;  3BEH A;  5L3V A;  3J06 A;  1ZZP A;  2GAQ A;  2J0W A;  4O6Y A;  1JRA A;  3AG1 C;  4WJ0 A;  1OCC C;  4O6N A;  4XWJ A;  1EI7 A;  3SXK A;  3ZG1 A;  4OD4 A;  2WVQ A;  4I1M A;  4A2N B;  3M79 A;  1ZW2 A;  4K1O A;  1FFT C;  2YRF A;  4WGZ A;  4PK4 A;  4G0H A;  3NMJ A;  1WOL A;  2HKV A;  3C8G D;  2LIG A;  1FNT c;  1YJG A;  1Q0D A;  1YVI A;  5JVE A;  2AWC A;  3EFO A;  3X2Q C;  3TOM A;  1I4Y A;  2NG1 A;  3S29 A;  4BJT A;  2Q7R A;  3TK0 A;  1L3P A;  2EPO A;  1CGN A;  4U5B E;  2ZXP A;  3FOO A;  1RKE B;  3AJM A;  2OQM A;  4KNW A;  1YZA A;  1UG7 A;  2R05 A;  4H54 A;  1XZQ A;  4CS8 A;  1V55 C;  5JT4 A;  2XLV A;  2PP4 A;  1OXK A;  5EK0 A;  1WAS A;  1LS4 A;  4BEJ A;  4JTC B;  2MYS A;  4MTG A;  5EGY A;  3JYY A;  2DI3 A;  3ZTM A;  5L0D A;  3PMR A;  4J7T A;  2W4B A;  3NKD A;  3DZA A;  4JJG A;  4RD9 A;  3C8G A;  2VCC A;  2L9J A;  4O79 A;  1U6H A;  1D0Y A;  2W9Y A;  1UFB A;  2R25 A;  3OEO A;  5D92 A;  4EWC A;  5JRA A;  4OIQ F;  1HW2 A;  4I1O B;  3LEV A;  1ZYR F;  5L0I A;  3JSZ A;  4NTF A;  4CS8 C;  1LM3 B;  3EHN A;  3ABM C;  3VYW A;  3HNI A;  4IGG A;  1E84 A;  1Q0K A;  2CW0 F;  2F22 A;  1M2V B;  2OCC C;  1MND A;  1TWA A;  3EG9 B;  3UGP A;  2EIJ C;  3O10 A;  3V5Z A;  5JS5 A;  2J45 A;  3RH3 A;  3EGD B;  4MVQ A;  2EPN A;  1MMN A;  1OQC A;  2HJM A;  1I4Z A;  1CGO A;  3MYI A;  1A0B A;  3O39 A;  4JEA A;  4NY3 A;  4XQ1 A;  4DXW A;  2XSE A;  1OKK A;  3KYI A;  4JVS A;  4P9F A;  2EPK X;  1A41 A;  1LE2 A;  2EIL C;  3CZ6 A;  3HLZ A;  5E3A A;  1G4W R;  3RYL A;  2FGY A;  1QZX A;  5BQI A;  3M1C B;  4ANJ A;  1GQA A;  1MNE A;  1RJ9 B;  4DOZ A;  1BR4 A;  3PDM P;  1FR0 A;  2J0X A;  1LIH A;  2NSF A;  2Y3G A;  4FES A;  4N06 A;  3W8I A;  4DRH B;  4XLP F;  1B68 A;  1WGW A;  256B A;  4N6H A;  5IY5 C;  2A1D D;  2DGJ A;  3ABL C;  5B1B C;  3FXH A;  4MTF A;  2OJE D;  2CYD A;  2OKU A;  2UUI A;  3N2Z B;  3QZC A;  3VAY A;  3ZVR A;  1K04 A;  2X51 A;  2ZPA A;  3E70 C;  1AUE A;  4IAR A;  3HNL A;  1NFN A;  2KC3 A;  4DRJ B;  4C7O B;  2QE9 A;  2Q9B A;  1T6U A;  4FX5 A;  2YLD A;  4MVM A;  1FTS A;  1GM5 A;  3C8Z A;  2KGO A;  1Z63 A;  4MVO A;  3R7C A;  2AU5 A;  1JPJ A;  4JTD B;  2NUT B;  3OA1 A;  4JC7 A;  1M6T A;  2I8B A;  2KK1 A;  3A9C A;  4HFF B;  1FMV A;  4JRZ A;  2V3C C;  3K7D A;  1KU2 A;  2Y69 C;  4CS7 A;  1LI5 A;  1MMD A;  1TQG A;  4PAC A;  2C04 A;  5FZT A;  4PFO A;  4QI2 A;  4J7Y A;  3NRH A;  1PD1 A;  1PV3 A;  2A68 F;  5COG A;  4G7O F;  4IJJ A;  5KYU B;  5HV9 A;  1Y4C A;  2J7P D;  3KPH A;  1VLS A;  1HMD A;  2HJ3 A;  2L6G A;  3B0U X;  3GEH A;  4E18 A;  3DM9 B;  4U5H A;  1RKC A;  4LAC B;  3NYJ A;  1S7Z A;  5D91 A;  2Y3B A;  1RMV A;  4XEK A;  3Q7G A;  2IOQ A;  3K1H A;  4JE9 A;  4GYT A;  3DE8 A;  4KI2 A;  4EBK A;  4U5E E;  3E9V A;  3ZDL A;  1C02 A;  3Q7L A;  1N1C A;  3I4U A;  3EG9 A;  3I5Q A;  3TJ6 A;  3S9O A;  2ETS A;  2VAS A;  3EGD A;  4P6I C;  1GS9 A;  2OU6 A;  2M4E A;  2Q4F A;  3NMK A;  3MX3 A;  4NTB A;  2W45 A;  4AL0 A;  4XPX A;  2V26 A;  3EGX A;  4IWB A;  1Y6D A;  4E7S A;  3HKK A;  4PFP A;  1OCO C;  2YZS A;  2RSE B;  3O6X A;  1BDJ B;  4E7Z A;  3H2V A;  1VYI A;  1D1C A;  3LES A;  4XEF A;  5KYX B;  2UUH A;  2L6F A;  3ZTZ A;  3FHD A;  2J9V A;  3B0V C;  3FOP A;  1BR1 A;  3KMI A;  1RJ9 A;  3Q6N A;  4ULV A;  1QPU A;  5K0I A;  2G62 A;  1LVK A;  4H4K C;  4JEB A;  1CPR A;  1Z6A A;  2XL8 A;  4KBL A;  1ORS C;  2ASR A;  3ASO C;  4HEA J;  3GEI A;  4J30 B;  4N6C A;  1J8M F;  3RQG A;  2XL4 A;  3JTL O;  1BZ4 A;  1WTY A;  4LLC A;  4U5D E;  2YEV A;  3HNJ A;  3X1O A;  2EIM C;  3DD7 A;  5TJ5 E;  1LKX A;  1SF8 A;  1A7E A;  4JTA B;  3UGO A;  4MS2 A;  4W8K A;  5A6B A;  4HE8 D;  4OIR F;  3I5P A;  4OD5 A;  3S27 A;  3WHN A;  4BJ1 A;  3AG4 C;  5KYN A;  3U0C A;  1LPE A;  3ITF A;  1H9G A;  3FAP B;  4CS9 A;  2EPM X;  2XLM A;  2VB6 A;  4IB4 A;  2WVN A;  1ZHY A;  2NUT A;  1NBB A;  2QNL A;  3PCV A;  3S84 A;  3EJN A;  4OIP F;  3GM1 A;  4IAO A;  5A6A A;  2KSF A;  4WAB A;  4NC3 A;  2GA0 A;  1TKN A;  2CNW A;  3H65 A;  2R7X A;  1D1B A;  1JPN A;  1R5I D;  1L7C A;  4F4B A;  2XS1 A;  1LE4 A;  1NG1 A;  3LS0 A;  1FAP B;  3K6B A;  3MFN A;  4R32 A;  2R7Q A;  4W8P A;  1FFH A;  2H7B A;  3S28 A;  2A6H F;  4G7Z F;  4NTA A;  3KYJ A;  1HE9 A;  4YL0 A;  4I44 A;  4WGY A;  3L0I A;  4XLN F;  4CS9 C;  3JSE O;  5KYU A;  1U89 A;  4MVZ A;  5L0H A;  2J8W A;  3M4C A;  4DBQ A;  2CDQ A;  1J8Y F;  3WAQ A;  1E83 A;  1IW7 F;  2D4U A;  2LFD A;  4O6M A;  4YK5 A;  5L0C A;  3UR3 C;  4E17 A;  1OW6 A;  4XTK A;  3B71 A;  3AG3 C;  4YT8 A;  2KYH A;  2YKZ A;  1VTM P;  3KL4 A;  1SMY F;  3FDQ A;  3QW0 A;  3U2M A;  2XLD A;  2XM4 A;  4U9E A;  2HMQ A;  3MLG A;  2Y3D A;  3GWL A;  1OCR C;  3O55 A;  5F5F A;  3F47 A;  1VYK A;  5A6J A;  1KNY A;  1TWG A;  4KC9 A;  5KYY B;  2M64 A;  1FMW A;  4RBN A;  3PHF 2;  3NYM A;  4DVY P;  2ICW G;  2A69 F;  4QDL A;  3U9M A;  2YHS A;  5KYW A;  2HUJ A;  1ZHZ A;  3ASN C;  1D0X A;  2EIK C;  4JUR I;  5A69 A;  1H9T A;  2QTV A;  2PNO A;  2MHR A;  5KYX A;  1NLX A;  1VB5 A;  1Z7Q c;  1RCP A;  2J9U A;  1HMO A;  1WN0 A;  3SXY A;  1T01 A;  4LER A;  3EH2 A;  1E86 A;  1W2W A;  1MMA A;  1JOG A;  2XXA B;  1G5Z A;  3IQ6 A;  3HTK C;  3W4Y A;  3C63 A;  1Q0M A;  1YDI A;  1BR2 A;  2KW3 C;  2P6V A;  2R03 A;  3CEX A;  3EZH A;  3LAY A;  3DAG A;  3DJN B;  1H7I A;  3WOD F;  1G4U S;  3TUL A;  2NUP B;  1M56 C;  3S90 A;  3ECS A;  3GAN A;  3L8J A;  3C18 A;  5A6K A;  4G7H F;  2AVK A;  5AC4 A;  4ZLD A;  3GEE A;  2IXP A;  3SP1 A;  4CDV A;  1ZW3 A;  1ZHX A;  2LD6 A;  3SYN A;  3G50 A;  2J9B A;  4CDY A;  2EPL X;  1QLE C;  3B9Q A;  3FMS A;  5COF A;  5AC5 A;  5BQG A;  2GDC A;  2Q9C A;  4JCH A;  3SEO A;  4YL1 A;  2HV7 A;  1K40 A;  1O5H A;  1VOM A;  2TMV P;  1NU7 D;  2GWW A;  3AQC A;  2R7R A;  4Z9I A;  5JLI A;  2XLE A;  2PX0 A;  1OR2 A;  3DJU B;  4YWQ A;  5HSW A;  3L8I A;  1E2X A;  1CPQ A;  2BL2 A;  4MQ9 F;  4XPW A;  1A7D A;  1V4A A;  4GQH A;  4LLE A;  1I5N A;  2LP4 A;  4D4N A;  1RKE A;  3DI5 A;  2QY9 A;  4BG0 A;  3RIP A;  2H8A A;  4ULW A;  2IXM A;  4YN0 B;  3JT1 A;  2X0C A;  2HSB A;  1V74 B;  5B1A C;  3DXJ F;  2LCH A;  4Z9H A;  1Z5Z A;  2JX0 A;  1WAT A;  3TQO A;  2AWY A;  3F46 A;  2EIN C;  2JPU A;  2YVK A;  1Z23 A;  5DVW A;  2BC5 A;  2FAP B;  2YQY A;  1M2O A;  2L6H A;  5JUA A;  2YLG A;  2D5R B;  3N0T A;  4GEH A;  1D0Z A;  3NDB B;  4U9D A;  1NZE A;  2OG2 A;  4LDK A;  2XS8 A;  1HY5 A;  4EIY A;  3DM5 A;  4CIH A;  2XL6 A;  1RXQ A;  2XLH A;  1M57 C;  4ER9 A;  2A0U A;  1T6Q A;  2WL8 A;  4YJW A;  3TOL A;  2KJG A;  5T3W A;  1G8X A;  3V5Y A;  1YYX A;  3LNM B;  2R02 A;  1M2V A;  1JAF A;  1Z3I X;  3NYL A;  5KYY A;  1APC A;  3ZWI A;  1PCX A;  3MBG A;  2XLW A;  4DBR A;  3EQL F;  1A7V A;  3AQB A;  3RKO F;  4X0R A;  1NU9 C;  2G3V A;  2J7P A;  3VM6 A;  2Q9A A;  3TD7 A;  4AX2 A;  2I15 A;  3G4Z A;  5E3C A;  3VRC A;  3C62 A;  2HMZ A;  3K66 A;  2DYR C;  2R7U A;  4NCQ A;  5E33 A;  4XEV A;  2IBF A;  3T6B A;  4EKW A;  2XXA A;  2HFI A;  3IEE A;  4KNV A;  3W2W A;  4JZA A;  1LI7 A;  5BUO A;  3S0X A;  1OXB A;  3CQZ A;  3IQ5 A;  4CIP A;  3SZR A;  4OIO F;  1O87 A;  2GFH A;  2MWQ A;  3GOD A;  2Q3T A;  4M63 A;  4C3D A;  2NUP A;  5CI8 A;  2A0B A;  2KQ9 A;  1OCZ C;  1ZVZ A;  2P7V A;  1DOW A;  3JRT A;  4C3E A;  3AGT A;  2DB4 A;  2L81 A;  5F5H A;  3ZSU A;  4B6I A;  1SYQ A;  3LNR A;  4EUK B;  3AOU A;  3FVY A;  4AE4 B;  2NSG A;  1XZP A;  5DQZ A;  4A4A A;  3BRJ A;  5L0J A;  4C7O A;  2Y3H A;  2JD3 A;  3LS1 A;  3U8P A;  2QUP A;  2OJQ A;  5DS6 A;  4K7B A;  4MVU A;  3OWT A;  4FWV A;  2ZXW C;  2R7T A;  2Q00 A;  3DKA A;  1TWH A;  2LSE A;  2R7V A;  3T9O A;  3A11 A;  4U5G A;  3EH1 A;  3MYF A;  3NMI A;  2YWA A;  2VC9 A;  1TR2 A;  1H6G A;  3M15 A;  3B29 A;  3RVY A;  3RQE A;  3U3B A;  2ZD9 A;  5JSL A;  1ZHT A;  2YL1 A;  5E2Q A;  4YT4 A;  2YL3 A;  3LUT B;  3GM3 A;  4JIO A;  4JCZ A;  2IYL D;  1VK5 A;  2HS5 A;  4L6R A;  4BJ5 A;  2DYS C;  2LK4 A;  2BE5 F;  1SZI A;  1KTM A;  1OW8 A;  3RF3 A;  1VLT A;  3V5X A;  1Q0G A;  2HZ8 A;  3ZC4 A;  2J46 A;  2WZL A;  4MW3 A;  4JKV A;  3LJB A;  3SNH A;  2IM8 A;  3AG2 C;  4C3B A;  2WVO A;  3AGU A;  1VMA A;  3NKE A;  4MVS A;  3U3F A;  2CCY A;  3JYH A;  4J32 B;  5FCL A;  5L0G A;  2OEX A;  5DS4 A;  3UMH A;  1GGQ A;  4XPY A;  4BJ5 C;  4PJM A;  3ZQY A;  2YLI A;  1EKY A;  1XWJ A;  1U0B B;  3EZI A;  4MVR A;  3QW1 A;  2IXN A;  1T9K A;  1ST6 A;  2ZXR A;  4PR9 A;  2IXO A;  2J9W A;  4U5C E;  2Y39 A;  4YT5 A;  4Z9J A;  4YT2 A;  1ZU5 A;  5AGF A;  5CI9 A;  1OKK D;  4EBJ A;  5BQH A;  5EHH A;  2VCA A;  5F28 E;  4P9T A;  3GM2 A;  1YZC A;  4DVZ A;  3ABK C;  2YL7 A;  5COM A;  4O7G A;  3V7O A;  1R4T A;  2VH3 A;  3VF0 A;  2WZG A;  3DMD A;  2XRH A;  1IZM A;  1K05 A;  1O3U A;  1YA9 A;  2H7O A;  2PBE A;  3TJ5 A;  1YYJ A;  3RFY A;  3K1I A;  4OIN F;  2R9R B;  4K0D A;  3HNK A;  4AE4 A;  1LS1 A;  3QVZ A;  2PF4 E;  3ZQV A;  3H2U A;  3KH2 A;  5CIV A;  2LQG A;  1E85 A;  1QKR A;  3EGX B;  1JMW A;  2C03 A;  3LLI A;  3R2P A;  4CSA A;  4NQF A;  2WB7 A;  3T6G B;  4RDA A;  3LLK A;  3RVZ A;  3K1I C;  4PJL A;  3SXM A;  3T6J A;  4N4W A;  3M4B A;  4PJN A;  1C03 A;  2WZF A;  2G3K A;  3T4R A;  4IAQ A;  1QVX A; 
#chains in the Genus database with same CATH homology
 3CAX A;  3U9M A;  3V5Y A;  3V5X A;  3U9J A;  3V5Z A;  2P0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...