3V5YA

Structure of fbxl5 hemerythrin domain, p2(1) cell
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
155
structure length
153
Chain Sequence
PEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 71
structure length 153
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5yA00
3V5ZA 3V5YA 3U9MA 3CAXA 2P0NA 3V5XA 3U9JA
chains in the Genus database with same CATH superfamily
2XL6A 1QZXA 3SP1A 2EPLX 4U5GA 1RXQA 3U2MA 3S90A 2R7OA 2XRHA 4R32A 2R7TA 2CNWD 1EKYA 4PJNA 1FMVA 1Q0FA 1GS9A 1Z23A 1YZCA 2PX3A 1OKKD 1FFHA 1QSPA 3C63A 4BEMJ 1GM5A 1I5NA 2GAQA 4U5CE 3NMJA 4MTFA 2R05A 2YL7A 1CPQA 2KK1A 3FXHA 3ITFA 1ZU4A 4W8KA 5A6BD 1U0BB 3AQBA 4CBEA 1M57C 5D92A 3SZRA 4YT5A 1N1CA 2ETSA 2YL1A 3FAPB 4IAQA 3Q7LA 4EUKB 1YJGA 1TQGA 2NG1A 1OCOC 2DB4A 2YZSA 2L6HA 4IJJA 3T4RA 4CIPA 3SNHA 2UUIA 3TULA 2Y39A 2HSBA 4KC9A 4PJJA 4E0HA 1KU2A 4YT4A 1UG7A 3M15A 3N24A 5DVWA 3WG7C 4X0RA 3NDBB 3JYYA 4JEBA 3VM6A 3GWLA 5CIVA 3LNMB 3FOOA 1WATA 3MYIA 3M4BA 4DBQA 4IWBA 2XLVA 3TQOA 2H7BA 2IXOA 3GANA 4ZLDA 3DD7A 1RJ9A 1YA9A 4DXWA 2EPKX 2XXAA 3F47A 5T1DB 5DS6A 2J7PA 1ORSC 2YWAA 1S05A 4N4WA 1OQCA 1YZAA 3EPVA 4IARA 1B68A 3C8GA 3DZAA 3X2QC 4NCQA 2KNHA 1PD1A 1A7EA 5DS4A 2QE9A 2YLGA 3RYLA 2Q9BA 5T3WA 4YT2A 3LUTB 5A6KA 4HFFB 3RFYA 3UNGC 4UDVA 2PX0A 1H7IA 2XL4A 3QVYA 1BBHA 1U6HA 2NUPA 1T9KA 3H2VA 2HZ8A 2EINC 2M64A 2OJED 4MVMA 5K0IA 4NQFA 1MMGA 3IQTA 1PD0A 1E84A 3LEOA 2XS1A 1A41A 2KJGA 4OINF 5L0JA 3ZTMA 2V26A 1SZIA 4N6CA 3A9CA 4XPWA 2L9JA 4OD4A 2PBEA 2ZXPA 4MVZA 1PV3A 2KSFA 2PF4E 3DI5A 4LDQA 1IW7F 1LE2A 4Z9IA 1I4YA 1O5HA 3X1OA 2QNLA 2Q4FA 3DAGA 1L7CA 3IPMO 1ORYA 2H7VC 5L0HA 2Y69C 2H7OA 4IB4A 3AQCA 2BE5F 5A6AA 4DRJB 1MMNA 4BG0A 2J0XA 3TK0A 3CAXA 1YYJA 3IEEA 4YT8A 1XWJA 1KTMA 1TWCA 1OW7A 1HY5A 3S29A 2NPUA 2C04A 4RBNA 1YA7O 3S27A 5F5FA 1G4WR 3EG9B 3I5PA 1TKNA 3QZCA 2EPNA 4C7OA 2GDCA 1ZW2A 2ICWG 1V54C 3MLGA 1DOVA 4HE8D 5B1BC 3RQFA 3T6GB 3ASOC 1OR2A 3EHNA 3JYHA 2HUJA 1E86A 2VB6A 3RF3A 2IYLD 4DVZA 2MYSA 1E83A 1YLMA 3R7CA 2R7VA 4AE4A 4CS7A 3HNLA 4Q5SF 1WGWA 4MVSA 5L3VA 5KYWB 2R7RA 3B0UX 2EIKC 4OIQF 2G3KA 3H65A 5B3SC 4IRUA 3VYWA 2WVOA 1QVXA 2P61A 1D0ZA 2CNWA 2Q3TA 3QMKA 5COMA 3PCVA 4I1OB 1OW6A 3ASNC 1AEPA 1V74B 1J8YF 4AL0A 1OKKA 2IXPA 2R7XA 1D1BA 4CS8A 3F46A 3KYIA 2UUHA 1Z6AA 3GM2A 4OD5A 1H9GA 2B0JA 5A6BA 4YWQA 3NYMA 2D4UA 2LFDA 2XM0A 4MVUA 4U5BE 2XLDA 3O10A 3TJ5A 3K1IA 2VCBA 4FESA 1M56C 2JD3A 1AUEA 2Z15A 2RSEB 4LLEA 4XEVA 4EBKA 3EGDA 1HW2A 3B0PA 3S0XA 3I4UA 5AGFA 5L0FA 2YLDA 1Z7Qc 2LSEA 1NG1A 2H8AA 1HMDA 3EFOB 3K66A 4YL3A 3E70C 3SXYA 3V5ZA 4KBLA 1H9TA 4CJOA 3GM3A 3PDMP 3M4CA 1LI5A 3LEVA 5JSLA 3ZTZA 1SMYF 2CCYA 2WVNA 3DAFA 1JAFA 4U9DA 1Z3IX 2FFHA 4CDVA 1APCA 1C03A 2W9YA 3Q6MA 4YK5A 3UMIA 4AK9A 2G3VA 2XLOA 3C7JA 3T6JA 5EHHA 4G7ZF 3T6BA 2W4BA 3A11A 3LNRA 3EH2A 4NTFA 4PFOA 1LKXA 5TJ5E 4MVOA 4D4XA 1YAUO 2L6FA 4CIHA 1JPNA 3DMDA 1D0YA 4NTAA 3SXKA 3U3BA 4YL0A 1VB5A 1VLTA 2G62A 2O9XA 3FHDA 3HKKA 4FWVA 3VAYA 4WGYA 1JRAA 3CQZA 3L1MA 5JUAA 2AVKA 2OJQA 4GYTA 1C17M 5B3IA 1XZQA 2HV6A 1T6UA 2W45A 3AG4C 3RW0A 3S84A 3J06A 2DGJA 3K1HA 3NRHA 2XS8A 1VYIA 2VC9A 1R5ID 1W2WA 3U2LA 3DWWA 1E2XA 1YARO 5HV9A 3RH3A 2YEVA 3PHF2 1FNTc 1M2VA 1O3UA 2D5RB 1RMVA 1YVIA 4MVRA 2L81A 3AG3C 2Y3HA 3EHMA 3U8VA 2EIMC 3B71A 4FAPB 3C62A 2V3CC 3RKOF 3OWTA 3K6BA 3NG1A 2XLWA 2TMVP 1CGNA 3U8PA 1OW8A 2F22A 1TFKB 5E2QA 3EZHA 3TOLA 3UGPA 2A68F 2AP3A 3ABMC 4JC7A 2IBFA 2A6EF 1HW1A 256BA 1NU7D 1O87A 1ZVZA 2A6HF 3EH1A 5COFA 5B1AC 1T6QA 4ONSA 2YHSA 4G78A 5T3TA 5BQGA 3QW1A 1OCZC 2ZXRA 2B0HA 2PP4A 4BPMA 2OCCC 1ZHTA 4PACA 2WZFA 3V5YA 1FTSA 1QQ3A 4Z9HA 3DM9B 4H54A 3W8HA 2KC3A 3VRCA 4U5FE 1YDIA 3NYJA 3WHNA 3M79A 4C3DA 5BQIA 1ZHXA 5L0CA 2J45A 1XZPA 4BJ6A 2J9VA 3DE8A 2MHRA 4ER9A 1NFNA 1ZZPA 2HJ3A 4JTAB 3CZ6A 4OIOF 3ECSA 2VCAA 2EPMX 3EGXB 4MTOA 2MWQA 3TOMA 5KYYB 3S9OA 1NBBA 3FVYA 3CSKA 1K40A 3LS0A 1EI7A 2XLHA 2EIJC 4YJWA 3RVZA 3S28A 3UMKA 2I8BA 1TFOB 2BL2A 1GGQA 3NMIA 5DS5A 2YVKA 4I3MA 4JTDB 3BRJA 3MFNA 2QUPA 3JZ0A 2LD6A 5E33A 2EILC 4KNWA 3JRTA 1L3PA 3W8IA 4CS8C 1H6GA 2WZLA 4K0DA 5KYXA 2NUPB 3IQ5A 4DRIB 4BJ1A 1T01A 1MQVA 4I1MA 2DYSC 2HSQA 1MMDA 1A7VA 1ORJA 2KW3C 3K1IC 4JVSA 3T9OA 3NKEA 3JRMO 1Y4CA 1ZYRF 5KYUB 1NLXA 2J9BA 4XWJA 4Q4ZF 1VYKA 1ZHWA 4ZLCA 3O6XA 2P1AA 4PJMA 2J9UA 3SXMA 1TWHA 3EG9A 4EWCA 2VH3A 1NU9C 3DE9A 4CSAA 4PFPA 3CEXA 5EK0A 1QPUA 5FZTA 3US6A 1V55C 2YL0A 1C02A 1JOGA 1Z5ZA 3R2PA 3HLZA 4RD9A 4WABA 1SR2A 4P9TA 2FAPB 5GPGB 3N0TA 3W4YA 4M63A 4WJ0A 2JX0A 3DJNB 3Q6NA 4P6IC 2R02A 2Q7RA 2J7PD 3K33A 3HTKC 1LPEA 3ZQYA 4E17A 3O39A 3EJNA 3U9MA 2DYRC 4BEJA 4O6MA 4OIRF 3PMRA 2LP4A 1MNDA 4AE4B 3GEHA 1NZEA 1FFTC 2NUTB 3LLKA 4P9FA 3RQGA 4KI2A 1Q0MA 4G0HA 1HE9A 2YQYA 5JLIA 4PK4A 4K1OA 2A1DD 4CDYA 3ATPA 3ZG1A 1VTMP 3L0IA 3O55A 3U3FA 1NSGB 3ZDLA 4PJLA 3DM5A 2ZXWC 2XM4A 2HKVA 2Y3GA 4DVYP 2ZPAA 2LQGA 4CDAA 1LE4A 4JURI 1RKCA 2AU5A 3OA1A 3IHUA 4I44A 1G8XA 3ABLC 2OU6A 3L8IA 4AX2A 2ZXOA 3V5XA 2A0BA 4A2NB 5AC4A 2XSEA 2QTVA 3L34A 5JVEA 2YKZA 2IOQA 4EKWA 4G7OF 3GWNA 3W2VA 3FDQA 4ANJA 2XLMA 5F28E 1VMAA 3MYFA 4PR9A 2OQMA 2P6VA 2CGEA 4CJGA 4F4BA 2GA0A 2I15A 4JEAA 4JCHA 2X0CA 4BJ5A 5JT4A 3L8JA 5F5HA 2ASRA 3AG2C 3AGUA 3AJMA 1TWAA 1RKEB 3GORA 1S7ZA 2IM8A 2X51A 4GEHA 4JJGA 5FCLA 2XL8A 4QDLA 5D91A 4K7BA 1ZU5A 1WWPA 1LS4A 3ZSUA 5L3QA 2NSFA 2AWYA 5COGA 4Q7CA 1D0XA 1Z63A 1LM3B 1VLSA 4KNVA 1NFOA 2QY9A 3GEEA 2E87A 4NTBA 1OR3A 4L6RA 1UFBA 5CI9A 1FR0A 2EPOA 3AGTA 4EBJA 1WN0A 3ZQVA 2R7SA 4WGZA 2LFFA 2YRFA 1LI7A 2WZGA 1TWGA 2Q9AA 4RDAA 1BDJB 1R4TA 4YN0B 1HMOA 1BR2A 4HFKB 2M4EA 3G4XA 4N6HA 1RCPA 3K7DA 2PNOA 2JPUA 4MS2A 4XEFA 2P0NA 1V4AA 1Y6DA 3EQLF 3RIPA 1OCCC 4MNDA 3M1CB 3SYNA 2OEVA 2R7UA 3SXZA 4MTGA 5DLJA 4JE9A 4C3EA 4JRZA 2QLAA 3U5SA 1VK5A 2J8WA 4J7YA 1M2VB 5JS5A 2ZD9A 2J9WA 4E18A 3MX3A 4QI2A 3H2UA 3KYJA 3ZC4A 3QW0A 4CS9A 4EIYA 2R9RB 3U0CA 2R03A 2AWCA 2HJMA 2HMQA 1Q0KA 4LDRA 4NY3A 3JT1A 2KQ9A 4LACB 1CPRA 1HE1A 2L6GA 3V7OA 1JR8A 4BJTA 2HFIA 2W4MA 1EA8A 3B9QA 4EBBA 1JPJA 5A69A 4CSAC 3EGXA 4JCZA 2LK4A 5KYYA 1F1MA 5HSWA 1LIHA 5IY5C 1RJ9B 3GM1A 3JCUQ 1FMWA 5A6JA 2XXAB 1CGME 4LLCA 1K04A 1ZHZA 4N06A 5E3CA 4XLPF 4U5HA 4JJFA 1K05A 3C8GB 3IQ6A 4ULWA 3BEHA 4J32B 4E7ZA 3GEIA 1MMAA 2C03A 4XTKA 1D1CA 1CGOA 3C18A 1LS1A 4MVQA 3SEOA 5L0IA 3C8ZA 3KKBA 3WODF 1Q0DA 1J8MF 2R7WA 1BZ4A 3DKAA 1T6IA 3Q7GA 2HV7A 3UGOA 2PFDA 2Y3BA 3TD7A 2FGYA 2GFHA 5DQTA 5KYUA 3LESA 1JMWA 2GWWA 4JW1A 1I4ZA 4QI0A 4U9EA 2WB7A 4ULVA 4HEAJ 2KYHA 3ABKC 4XQ1A 1BR1A 4G7HF 2CDQA 2YLIA 3WAQA 1A0BA 2P7VA 5KYXB 4JKVA 4A4AA 4Z9JA 4GQHA 3E9VA 3AG1C 4H4KC 5BUOA 3N2ZB 4O6YA 2Q00A 2WL8A 2YL3A 4EHPA 3ZIBA 4U5EE 5KYWA 3I5QA 4NC3A 2DI3A 4O7GA 1ST6A 4D4NA 1OXBA 3RQEA 3JTLO 3NKDA 2CW0F 3HJCA 4OIPF 3EZIA 4C7OB 4IAOA 1MNEA 3C8GD 1QKRA 3FOPA 2VASA 2A0UA 2LCHA 3LLIA 5E3AA 3W2WA 4BJ5C 1WASA 4XPXA 3JSEO 2HS5A 2WVQA 2RD9A 3G4ZA 2VCCA 3VF0A 3ZWIA 4LERA 1KNYA 3TJ6A 1QLEC 1YYXA 3MBGA 4XEKA 4J7TA 2NUTA 4JIOA 3KL4A 3HNJA 4E0IA 3ZVRA 4B6IA 5BQHA 4MW8A 2IXNA 2Q9CA 1M6TA 3FAJA 5JP7A 4MW3A 1ZHYA 3DJUB 1TR2A 4YL1A 4FX5A 2R7QA 3EFOA 4U5DE 3QVZA 3U9JA 5L0GA 1OCRC 3LJBA 4DOZA 1EQ1A 1G5ZA 1U89A 5L0DA 2OG2A 3POVA 2A69F 4JTCB 4W8PA 1VOMA 1WTYA 3HNIA 1AVOB 1PCXA 1BR4A 1T5OA 5KYNA 2LIGA 4C3BA 4DBRA 1SF8A 2CYDA 3AOUA 3LAYA 4O6NA 5CI8A 5JRAA 1SYQA 1Q0GA 3KH2A 3EGDB 4LDKA 4IGGA 1D1AA 1DOWA 3QTHA 4DRHB 1FAPB 3GODA 1IZMA 2XLEA 2IXMA 2HMZA 4JZAA 2NSGA 4J30B 3KMIA 2KGOA 2L7AA 2Y3DA 3KPHA 4AL1A 4CS9C 3HNKA 3B0VC 1G4US 1WOLA 3UMHA 1A7DA 2BC5A 3JSZA 4BJ6C 1LVKA 4DJ9A 4E7SA 1M2OA 2R25A 3RVYA 3OEOA 3B29A 1OXKA 1RKEA 2OKUA 3UR3C 3DXJF 4XPYA 5AC5A 2OEXA 3NYLA 1GQAA 3LS1A 3G50A 4CX9A 2J0WA 4O79A 3NMKA 1E85A 1ZW3A 4XLNF 4MQ9F 2J46A 5DQZA 3FMSA 2OOCA 5EGYA 3IQCA
chains in the Genus database with same CATH topology
3V5ZA 3V5YA 3U9MA 3CAXA 2P0NA 3V5XA 3U9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5Z A;  3V5Y A;  3U9M A;  3CAX A;  2P0N A;  3V5X A;  3U9J A; 
#chains in the Genus database with same CATH topology
 2XL6 A;  1QZX A;  3SP1 A;  2EPL X;  4U5G A;  1RXQ A;  3U2M A;  3S90 A;  2R7O A;  2XRH A;  4R32 A;  2R7T A;  2CNW D;  1EKY A;  4PJN A;  1FMV A;  1Q0F A;  1GS9 A;  1Z23 A;  1YZC A;  2PX3 A;  1OKK D;  1FFH A;  1QSP A;  3C63 A;  4BEM J;  1GM5 A;  1I5N A;  2GAQ A;  4U5C E;  3NMJ A;  4MTF A;  2R05 A;  2YL7 A;  1CPQ A;  2KK1 A;  3FXH A;  3ITF A;  1ZU4 A;  4W8K A;  5A6B D;  1U0B B;  3AQB A;  4CBE A;  1M57 C;  5D92 A;  3SZR A;  4YT5 A;  1N1C A;  2ETS A;  2YL1 A;  3FAP B;  4IAQ A;  3Q7L A;  4EUK B;  1YJG A;  1TQG A;  2NG1 A;  1OCO C;  2DB4 A;  2YZS A;  2L6H A;  4IJJ A;  3T4R A;  4CIP A;  3SNH A;  2UUI A;  3TUL A;  2Y39 A;  2HSB A;  4KC9 A;  4PJJ A;  4E0H A;  1KU2 A;  4YT4 A;  1UG7 A;  3M15 A;  3N24 A;  5DVW A;  3WG7 C;  4X0R A;  3NDB B;  3JYY A;  4JEB A;  3VM6 A;  3GWL A;  5CIV A;  3LNM B;  3FOO A;  1WAT A;  3MYI A;  3M4B A;  4DBQ A;  4IWB A;  2XLV A;  3TQO A;  2H7B A;  2IXO A;  3GAN A;  4ZLD A;  3DD7 A;  1RJ9 A;  1YA9 A;  4DXW A;  2EPK X;  2XXA A;  3F47 A;  5T1D B;  5DS6 A;  2J7P A;  1ORS C;  2YWA A;  1S05 A;  4N4W A;  1OQC A;  1YZA A;  3EPV A;  4IAR A;  1B68 A;  3C8G A;  3DZA A;  3X2Q C;  4NCQ A;  2KNH A;  1PD1 A;  1A7E A;  5DS4 A;  2QE9 A;  2YLG A;  3RYL A;  2Q9B A;  5T3W A;  4YT2 A;  3LUT B;  5A6K A;  4HFF B;  3RFY A;  3UNG C;  4UDV A;  2PX0 A;  1H7I A;  2XL4 A;  3QVY A;  1BBH A;  1U6H A;  2NUP A;  1T9K A;  3H2V A;  2HZ8 A;  2EIN C;  2M64 A;  2OJE D;  4MVM A;  5K0I A;  4NQF A;  1MMG A;  3IQT A;  1PD0 A;  1E84 A;  3LEO A;  2XS1 A;  1A41 A;  2KJG A;  4OIN F;  5L0J A;  3ZTM A;  2V26 A;  1SZI A;  4N6C A;  3A9C A;  4XPW A;  2L9J A;  4OD4 A;  2PBE A;  2ZXP A;  4MVZ A;  1PV3 A;  2KSF A;  2PF4 E;  3DI5 A;  4LDQ A;  1IW7 F;  1LE2 A;  4Z9I A;  1I4Y A;  1O5H A;  3X1O A;  2QNL A;  2Q4F A;  3DAG A;  1L7C A;  3IPM O;  1ORY A;  2H7V C;  5L0H A;  2Y69 C;  2H7O A;  4IB4 A;  3AQC A;  2BE5 F;  5A6A A;  4DRJ B;  1MMN A;  4BG0 A;  2J0X A;  3TK0 A;  3CAX A;  1YYJ A;  3IEE A;  4YT8 A;  1XWJ A;  1KTM A;  1TWC A;  1OW7 A;  1HY5 A;  3S29 A;  2NPU A;  2C04 A;  4RBN A;  1YA7 O;  3S27 A;  5F5F A;  1G4W R;  3EG9 B;  3I5P A;  1TKN A;  3QZC A;  2EPN A;  4C7O A;  2GDC A;  1ZW2 A;  2ICW G;  1V54 C;  3MLG A;  1DOV A;  4HE8 D;  5B1B C;  3RQF A;  3T6G B;  3ASO C;  1OR2 A;  3EHN A;  3JYH A;  2HUJ A;  1E86 A;  2VB6 A;  3RF3 A;  2IYL D;  4DVZ A;  2MYS A;  1E83 A;  1YLM A;  3R7C A;  2R7V A;  4AE4 A;  4CS7 A;  3HNL A;  4Q5S F;  1WGW A;  4MVS A;  5L3V A;  5KYW B;  2R7R A;  3B0U X;  2EIK C;  4OIQ F;  2G3K A;  3H65 A;  5B3S C;  4IRU A;  3VYW A;  2WVO A;  1QVX A;  2P61 A;  1D0Z A;  2CNW A;  2Q3T A;  3QMK A;  5COM A;  3PCV A;  4I1O B;  1OW6 A;  3ASN C;  1AEP A;  1V74 B;  1J8Y F;  4AL0 A;  1OKK A;  2IXP A;  2R7X A;  1D1B A;  4CS8 A;  3F46 A;  3KYI A;  2UUH A;  1Z6A A;  3GM2 A;  4OD5 A;  1H9G A;  2B0J A;  5A6B A;  4YWQ A;  3NYM A;  2D4U A;  2LFD A;  2XM0 A;  4MVU A;  4U5B E;  2XLD A;  3O10 A;  3TJ5 A;  3K1I A;  2VCB A;  4FES A;  1M56 C;  2JD3 A;  1AUE A;  2Z15 A;  2RSE B;  4LLE A;  4XEV A;  4EBK A;  3EGD A;  1HW2 A;  3B0P A;  3S0X A;  3I4U A;  5AGF A;  5L0F A;  2YLD A;  1Z7Q c;  2LSE A;  1NG1 A;  2H8A A;  1HMD A;  3EFO B;  3K66 A;  4YL3 A;  3E70 C;  3SXY A;  3V5Z A;  4KBL A;  1H9T A;  4CJO A;  3GM3 A;  3PDM P;  3M4C A;  1LI5 A;  3LEV A;  5JSL A;  3ZTZ A;  1SMY F;  2CCY A;  2WVN A;  3DAF A;  1JAF A;  4U9D A;  1Z3I X;  2FFH A;  4CDV A;  1APC A;  1C03 A;  2W9Y A;  3Q6M A;  4YK5 A;  3UMI A;  4AK9 A;  2G3V A;  2XLO A;  3C7J A;  3T6J A;  5EHH A;  4G7Z F;  3T6B A;  2W4B A;  3A11 A;  3LNR A;  3EH2 A;  4NTF A;  4PFO A;  1LKX A;  5TJ5 E;  4MVO A;  4D4X A;  1YAU O;  2L6F A;  4CIH A;  1JPN A;  3DMD A;  1D0Y A;  4NTA A;  3SXK A;  3U3B A;  4YL0 A;  1VB5 A;  1VLT A;  2G62 A;  2O9X A;  3FHD A;  3HKK A;  4FWV A;  3VAY A;  4WGY A;  1JRA A;  3CQZ A;  3L1M A;  5JUA A;  2AVK A;  2OJQ A;  4GYT A;  1C17 M;  5B3I A;  1XZQ A;  2HV6 A;  1T6U A;  2W45 A;  3AG4 C;  3RW0 A;  3S84 A;  3J06 A;  2DGJ A;  3K1H A;  3NRH A;  2XS8 A;  1VYI A;  2VC9 A;  1R5I D;  1W2W A;  3U2L A;  3DWW A;  1E2X A;  1YAR O;  5HV9 A;  3RH3 A;  2YEV A;  3PHF 2;  1FNT c;  1M2V A;  1O3U A;  2D5R B;  1RMV A;  1YVI A;  4MVR A;  2L81 A;  3AG3 C;  2Y3H A;  3EHM A;  3U8V A;  2EIM C;  3B71 A;  4FAP B;  3C62 A;  2V3C C;  3RKO F;  3OWT A;  3K6B A;  3NG1 A;  2XLW A;  2TMV P;  1CGN A;  3U8P A;  1OW8 A;  2F22 A;  1TFK B;  5E2Q A;  3EZH A;  3TOL A;  3UGP A;  2A68 F;  2AP3 A;  3ABM C;  4JC7 A;  2IBF A;  2A6E F;  1HW1 A;  256B A;  1NU7 D;  1O87 A;  1ZVZ A;  2A6H F;  3EH1 A;  5COF A;  5B1A C;  1T6Q A;  4ONS A;  2YHS A;  4G78 A;  5T3T A;  5BQG A;  3QW1 A;  1OCZ C;  2ZXR A;  2B0H A;  2PP4 A;  4BPM A;  2OCC C;  1ZHT A;  4PAC A;  2WZF A;  3V5Y A;  1FTS A;  1QQ3 A;  4Z9H A;  3DM9 B;  4H54 A;  3W8H A;  2KC3 A;  3VRC A;  4U5F E;  1YDI A;  3NYJ A;  3WHN A;  3M79 A;  4C3D A;  5BQI A;  1ZHX A;  5L0C A;  2J45 A;  1XZP A;  4BJ6 A;  2J9V A;  3DE8 A;  2MHR A;  4ER9 A;  1NFN A;  1ZZP A;  2HJ3 A;  4JTA B;  3CZ6 A;  4OIO F;  3ECS A;  2VCA A;  2EPM X;  3EGX B;  4MTO A;  2MWQ A;  3TOM A;  5KYY B;  3S9O A;  1NBB A;  3FVY A;  3CSK A;  1K40 A;  3LS0 A;  1EI7 A;  2XLH A;  2EIJ C;  4YJW A;  3RVZ A;  3S28 A;  3UMK A;  2I8B A;  1TFO B;  2BL2 A;  1GGQ A;  3NMI A;  5DS5 A;  2YVK A;  4I3M A;  4JTD B;  3BRJ A;  3MFN A;  2QUP A;  3JZ0 A;  2LD6 A;  5E33 A;  2EIL C;  4KNW A;  3JRT A;  1L3P A;  3W8I A;  4CS8 C;  1H6G A;  2WZL A;  4K0D A;  5KYX A;  2NUP B;  3IQ5 A;  4DRI B;  4BJ1 A;  1T01 A;  1MQV A;  4I1M A;  2DYS C;  2HSQ A;  1MMD A;  1A7V A;  1ORJ A;  2KW3 C;  3K1I C;  4JVS A;  3T9O A;  3NKE A;  3JRM O;  1Y4C A;  1ZYR F;  5KYU B;  1NLX A;  2J9B A;  4XWJ A;  4Q4Z F;  1VYK A;  1ZHW A;  4ZLC A;  3O6X A;  2P1A A;  4PJM A;  2J9U A;  3SXM A;  1TWH A;  3EG9 A;  4EWC A;  2VH3 A;  1NU9 C;  3DE9 A;  4CSA A;  4PFP A;  3CEX A;  5EK0 A;  1QPU A;  5FZT A;  3US6 A;  1V55 C;  2YL0 A;  1C02 A;  1JOG A;  1Z5Z A;  3R2P A;  3HLZ A;  4RD9 A;  4WAB A;  1SR2 A;  4P9T A;  2FAP B;  5GPG B;  3N0T A;  3W4Y A;  4M63 A;  4WJ0 A;  2JX0 A;  3DJN B;  3Q6N A;  4P6I C;  2R02 A;  2Q7R A;  2J7P D;  3K33 A;  3HTK C;  1LPE A;  3ZQY A;  4E17 A;  3O39 A;  3EJN A;  3U9M A;  2DYR C;  4BEJ A;  4O6M A;  4OIR F;  3PMR A;  2LP4 A;  1MND A;  4AE4 B;  3GEH A;  1NZE A;  1FFT C;  2NUT B;  3LLK A;  4P9F A;  3RQG A;  4KI2 A;  1Q0M A;  4G0H A;  1HE9 A;  2YQY A;  5JLI A;  4PK4 A;  4K1O A;  2A1D D;  4CDY A;  3ATP A;  3ZG1 A;  1VTM P;  3L0I A;  3O55 A;  3U3F A;  1NSG B;  3ZDL A;  4PJL A;  3DM5 A;  2ZXW C;  2XM4 A;  2HKV A;  2Y3G A;  4DVY P;  2ZPA A;  2LQG A;  4CDA A;  1LE4 A;  4JUR I;  1RKC A;  2AU5 A;  3OA1 A;  3IHU A;  4I44 A;  1G8X A;  3ABL C;  2OU6 A;  3L8I A;  4AX2 A;  2ZXO A;  3V5X A;  2A0B A;  4A2N B;  5AC4 A;  2XSE A;  2QTV A;  3L34 A;  5JVE A;  2YKZ A;  2IOQ A;  4EKW A;  4G7O F;  3GWN A;  3W2V A;  3FDQ A;  4ANJ A;  2XLM A;  5F28 E;  1VMA A;  3MYF A;  4PR9 A;  2OQM A;  2P6V A;  2CGE A;  4CJG A;  4F4B A;  2GA0 A;  2I15 A;  4JEA A;  4JCH A;  2X0C A;  4BJ5 A;  5JT4 A;  3L8J A;  5F5H A;  2ASR A;  3AG2 C;  3AGU A;  3AJM A;  1TWA A;  1RKE B;  3GOR A;  1S7Z A;  2IM8 A;  2X51 A;  4GEH A;  4JJG A;  5FCL A;  2XL8 A;  4QDL A;  5D91 A;  4K7B A;  1ZU5 A;  1WWP A;  1LS4 A;  3ZSU A;  5L3Q A;  2NSF A;  2AWY A;  5COG A;  4Q7C A;  1D0X A;  1Z63 A;  1LM3 B;  1VLS A;  4KNV A;  1NFO A;  2QY9 A;  3GEE A;  2E87 A;  4NTB A;  1OR3 A;  4L6R A;  1UFB A;  5CI9 A;  1FR0 A;  2EPO A;  3AGT A;  4EBJ A;  1WN0 A;  3ZQV A;  2R7S A;  4WGZ A;  2LFF A;  2YRF A;  1LI7 A;  2WZG A;  1TWG A;  2Q9A A;  4RDA A;  1BDJ B;  1R4T A;  4YN0 B;  1HMO A;  1BR2 A;  4HFK B;  2M4E A;  3G4X A;  4N6H A;  1RCP A;  3K7D A;  2PNO A;  2JPU A;  4MS2 A;  4XEF A;  2P0N A;  1V4A A;  1Y6D A;  3EQL F;  3RIP A;  1OCC C;  4MND A;  3M1C B;  3SYN A;  2OEV A;  2R7U A;  3SXZ A;  4MTG A;  5DLJ A;  4JE9 A;  4C3E A;  4JRZ A;  2QLA A;  3U5S A;  1VK5 A;  2J8W A;  4J7Y A;  1M2V B;  5JS5 A;  2ZD9 A;  2J9W A;  4E18 A;  3MX3 A;  4QI2 A;  3H2U A;  3KYJ A;  3ZC4 A;  3QW0 A;  4CS9 A;  4EIY A;  2R9R B;  3U0C A;  2R03 A;  2AWC A;  2HJM A;  2HMQ A;  1Q0K A;  4LDR A;  4NY3 A;  3JT1 A;  2KQ9 A;  4LAC B;  1CPR A;  1HE1 A;  2L6G A;  3V7O A;  1JR8 A;  4BJT A;  2HFI A;  2W4M A;  1EA8 A;  3B9Q A;  4EBB A;  1JPJ A;  5A69 A;  4CSA C;  3EGX A;  4JCZ A;  2LK4 A;  5KYY A;  1F1M A;  5HSW A;  1LIH A;  5IY5 C;  1RJ9 B;  3GM1 A;  3JCU Q;  1FMW A;  5A6J A;  2XXA B;  1CGM E;  4LLC A;  1K04 A;  1ZHZ A;  4N06 A;  5E3C A;  4XLP F;  4U5H A;  4JJF A;  1K05 A;  3C8G B;  3IQ6 A;  4ULW A;  3BEH A;  4J32 B;  4E7Z A;  3GEI A;  1MMA A;  2C03 A;  4XTK A;  1D1C A;  1CGO A;  3C18 A;  1LS1 A;  4MVQ A;  3SEO A;  5L0I A;  3C8Z A;  3KKB A;  3WOD F;  1Q0D A;  1J8M F;  2R7W A;  1BZ4 A;  3DKA A;  1T6I A;  3Q7G A;  2HV7 A;  3UGO A;  2PFD A;  2Y3B A;  3TD7 A;  2FGY A;  2GFH A;  5DQT A;  5KYU A;  3LES A;  1JMW A;  2GWW A;  4JW1 A;  1I4Z A;  4QI0 A;  4U9E A;  2WB7 A;  4ULV A;  4HEA J;  2KYH A;  3ABK C;  4XQ1 A;  1BR1 A;  4G7H F;  2CDQ A;  2YLI A;  3WAQ A;  1A0B A;  2P7V A;  5KYX B;  4JKV A;  4A4A A;  4Z9J A;  4GQH A;  3E9V A;  3AG1 C;  4H4K C;  5BUO A;  3N2Z B;  4O6Y A;  2Q00 A;  2WL8 A;  2YL3 A;  4EHP A;  3ZIB A;  4U5E E;  5KYW A;  3I5Q A;  4NC3 A;  2DI3 A;  4O7G A;  1ST6 A;  4D4N A;  1OXB A;  3RQE A;  3JTL O;  3NKD A;  2CW0 F;  3HJC A;  4OIP F;  3EZI A;  4C7O B;  4IAO A;  1MNE A;  3C8G D;  1QKR A;  3FOP A;  2VAS A;  2A0U A;  2LCH A;  3LLI A;  5E3A A;  3W2W A;  4BJ5 C;  1WAS A;  4XPX A;  3JSE O;  2HS5 A;  2WVQ A;  2RD9 A;  3G4Z A;  2VCC A;  3VF0 A;  3ZWI A;  4LER A;  1KNY A;  3TJ6 A;  1QLE C;  1YYX A;  3MBG A;  4XEK A;  4J7T A;  2NUT A;  4JIO A;  3KL4 A;  3HNJ A;  4E0I A;  3ZVR A;  4B6I A;  5BQH A;  4MW8 A;  2IXN A;  2Q9C A;  1M6T A;  3FAJ A;  5JP7 A;  4MW3 A;  1ZHY A;  3DJU B;  1TR2 A;  4YL1 A;  4FX5 A;  2R7Q A;  3EFO A;  4U5D E;  3QVZ A;  3U9J A;  5L0G A;  1OCR C;  3LJB A;  4DOZ A;  1EQ1 A;  1G5Z A;  1U89 A;  5L0D A;  2OG2 A;  3POV A;  2A69 F;  4JTC B;  4W8P A;  1VOM A;  1WTY A;  3HNI A;  1AVO B;  1PCX A;  1BR4 A;  1T5O A;  5KYN A;  2LIG A;  4C3B A;  4DBR A;  1SF8 A;  2CYD A;  3AOU A;  3LAY A;  4O6N A;  5CI8 A;  5JRA A;  1SYQ A;  1Q0G A;  3KH2 A;  3EGD B;  4LDK A;  4IGG A;  1D1A A;  1DOW A;  3QTH A;  4DRH B;  1FAP B;  3GOD A;  1IZM A;  2XLE A;  2IXM A;  2HMZ A;  4JZA A;  2NSG A;  4J30 B;  3KMI A;  2KGO A;  2L7A A;  2Y3D A;  3KPH A;  4AL1 A;  4CS9 C;  3HNK A;  3B0V C;  1G4U S;  1WOL A;  3UMH A;  1A7D A;  2BC5 A;  3JSZ A;  4BJ6 C;  1LVK A;  4DJ9 A;  4E7S A;  1M2O A;  2R25 A;  3RVY A;  3OEO A;  3B29 A;  1OXK A;  1RKE A;  2OKU A;  3UR3 C;  3DXJ F;  4XPY A;  5AC5 A;  2OEX A;  3NYL A;  1GQA A;  3LS1 A;  3G50 A;  4CX9 A;  2J0W A;  4O79 A;  3NMK A;  1E85 A;  1ZW3 A;  4XLN F;  4MQ9 F;  2J46 A;  5DQZ A;  3FMS A;  2OOC A;  5EGY A;  3IQC A; 
#chains in the Genus database with same CATH homology
 3V5Z A;  3V5Y A;  3U9M A;  3CAX A;  2P0N A;  3V5X A;  3U9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...