3V60A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
PETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v60A00
2BWES 2KTRA 3CMMB 2KWVB 3QA8A 3EC8A 1VD2A 3SD5A 3R66C 4NPNA 4GN1A 3M3JA 3VH4B 1H4RA 1EO6A 2J0KA 1RFAA 4HK2A 4W9CA 1KLVA 2PE6B 3PV1A 2ZJDA 3JW0X 3C0RB 2IY1B 2KMAA 1V80A 4LCDE 2LVQA 1TZ1A 3A4SC 4F7ZA 1VCBA 2N9EB 2M17A 5EDSA 2PE9A 1NI2A 1TGZB 3QK0A 1UBIA 2IO1B 3TL5A 4AJYB 3HM3A 4AWJA 3ZNHB 4W9KA 3VVWB 2Z0EB 3OJ4B 4BVUC 2IYDB 5GMVA 2LI5A 2EKEC 2LJ5A 4A3OA 2KTFA 1V5OA 1RAXA 4II2B 2L8JA 5D2MB 1WF9A 4OVVA 4ANUA 4BBNF 2CHZA 2YVCA 4BKGA 2MBQA 2KLGA 2LVOA 4I6LB 4TV3A 3ZKJC 2UYZB 5LXHA 4WWPA 3PREA 1EUVB 2CR5A 3RYTA 4PS7A 2KQSA 2K8BA 3ZUNA 2MW5A 1YIWA 1GNUA 1V49A 2AWTA 2K6QA 3OLMD 3DBSA 2GBRA 3RULA 3WALA 4CYEA 2O6VB 2O2VA 2LGYA 2GBMA 5TR5A 1RLFA 2KZRA 4F1SA 4NAWB 1ZKHA 4TQ0A 2YLMA 4MJSA 2FCQA 4XZ4A 2KC2A 2J7QB 4AP4C 2FCNA 2GBNA 5HKHA 2RD0A 3TIXA 3TCAA 4IW0A 4AJWA 2BWFA 4MGIE 3TMPB 1SIFA 5KHQA 2KHWB 2N4FA 4TQ1A 4RMAA 5CHVC 4G11A 4GIVA 5BO4B 2K1FA 1WZ3A 2KX0A 4FULA 4ZRJA 3UQAA 4GDLB 5AEKB 2XK5A 4KSLC 2R2QA 5CHWA 1A5RA 3M62B 5JZEB 4KIKA 3UQBA 2LVPA 2MRPA 3I3TB 3UINB 4CO7A 2KC1A 1E8ZA 1WMHB 3VDZA 4BKSD 1NDDA 1IPGA 2FCSA 2HJ8A 3N30A 2EMSA 2VRRB 3T8MA 3UIPB 3AI5A 3W1SC 4BKSA 2KFKA 3QWZB 4LJOB 1OGWA 3V6CB 5J2RA 2D07B 3KH0A 5JH5C 3ZNID 3NOBA 4MDKE 1I35A 2MBHA 2NBUA 4FJVB 1JRUA 2REXA 3PTFC 4WWNA 3PGEA 4E71A 1WX8A 2A4ZA 1YD8U 2CHWA 1E7UA 2JZ3B 2DZIA 3DVGX 3Q3FA 4GXBA 4IUMB 1UZXB 4KDLB 2M1MA 3H6NA 3WAPA 4DXAB 3ENEA 1Z2MA 4W9GA 1YX6B 5LXIB 1TTNA 3QX1A 1BT0A 3DOWA 4GDKB 4II3B 4M0WB 2FUHB 1H8CA 4PS8A 5AZHA 1LFDA 4TUUA 2KKCA 2KJHB 3H1UA 4LDTD 2KTRB 4A3PA 2MBBB 2ASQA 3LJ3A 3DCGA 2KWCA 2PJHA 3DVNU 2K25A 1OQYA 1WGDA 1WRDB 1WX7A 4JIOU 5L83A 4GB9A 4TKNA 2CKHB 1RRBA 4MSMB 3AU4A 5D6JB 3BINA 3CSFA 1E8WA 1WZ0A 4PS3A 2KANA 3ZO5B 5JHAA 2GOWA 2JF5A 2RSUA 3NS8A 3PPAA 4WJNA 1EF5A 3NZUA 4HPLB 1E5WA 1P0RA 2NPTB 5KHOA 3UF8A 1D3ZA 4GMVA 4DHZE 3N32A 1S1QB 2BYVE 4KVGB 1LXDA 4DHZB 1XQQA 4BOZB 1V9JA 2D11A 1R4NI 2MQJA 4NJ6A 3DBRI 4FA6A 2NBVB 4I6NB 1TBEA 3RCZA 1YX5B 3VHTC 2K8HA 1UBQA 2WYQA 4HDOA 2KJ6A 4IWQA 2DZMA 1WGHA 2PEAA 5E6PA 2KLCA 1GUAB 4W9FA 4WJQA 1YQBA 2KO3A 3IBEA 2BKRB 2IZVB 2LZ6A 2I1JA 3SU8X 2NS5A 5DPWA 3V6EB 1AARA 4X57B 4HXDA 3ALBA 2V4LA 4WAAA 2GMIC 1MG8A 2KMCA 2DZKA 2JVCA 3VUYA 1E8XA 2O6VA 2C5LC 4W9DA 4RM8A 2A5UA 2RPQA 2BPSA 3DDCB 3IG3A 1WXMA 1WXSA 2J0JA 4NAWA 2NBWB 3VFKA 4MJSB 3PRMB 2WX0A 2MX2A 4GOCA 1V86A 1XD3B 1M94A 4IM0A 4PYZA 3ZLZA 2MA9B 4BOSC 1V6EA 3EHVA 3ZVVA 2ZPYA 4J6IA 2RR9A 2LD9A 4AUQC 3ZTDA 3HHMA 2ZCBA 2CHXA 3M95A 3ONSA 3RD2A 3X23A 3ZIMA 1IYFA 4FLHA 5CTRC 4G3XB 4HVBA 4ANXA 3JSVB 3RZWC 3MJWA 3DVGY 2L3ZA 3ZDMC 2JPHA 4ANWA 3WIMA 4KIKB 4DWFA 4MM3A 2N1WA 4MGZE 1Z5SB 1Q0WB 2D2QA 4BFRA 1WMHA 3U8ZA 1Y8RC 2KFJA 4E3CA 3WAMA 4DHJB 2KDBA 2KNBA 3L10B 3ECIA 2KFKB 2AEHA 2WWZA 4IC7B 5DCNA 4EZKA 1OEYA 1T0YA 1WH3A 2LASA 2MCNB 2KK8A 2BGFA 1WJ6A 3B1LX 2ZCCA 2G45B 1F9JA 2KDFB 2Z59B 3BY4B 3RT3B 3KYDD 2C9WB 3KUZA 2JUOA 4KV2A 2NCNA 1P98A 1U4AA 3A1QA 1WGGA 3UGBB 3PHWB 3A9KB 2LXCA 2W9NA 2R2OA 2KVRA 3PLVA 1LQBA 2I1KA 3DQVA 4GDKA 2IBIB 1J19A 2DYMA 2C7NB 2K8CA 2LGDA 3APCA 2B3AA 3QJZA 4LDTB 3VTUA 2JRIB 4NQLB 3L17A 2LRWA 4IM3A 4HJKA 4DDGD 3H7PA 4K7WA 1WY8A 2C7HA 2IO0B 3EFUA 2KXJA 2KDIA 3WA0A 1S3SG 2LRUA 2L00B 3ZRFA 2G4DB 4IG7B 3TJPA 2K6DB 4B95A 4EEWA 4OVUA 4EUTA 3H7SA 4IM2A 1X1MA 3QC8B 2NPTA 4HLEA 2MLBA 2KX3A 3VUXA 1XT9B 1Q5WB 5AZFA 2ZEQA 1C3TA 4XX5A 1EF1A 3V61A 1WR1A 2DX5B 2KOXA 3JYUA 2D3GA 2BYEA 2RGFA 2AL6A 2N7DA 4ANVA 3QQ8B 4ZDVA 2FNJB 2N7EA 1GG3A 3QAQA 1CMXB 2M8SA 3SDLC 2HTHA 3HIZA 1WYWB 1V81A 1WFYA 2MP2B 3N3KB 4I6PA 4DHJD 3JVZX 4FHKA 2V3SA 3ZW3A 1E8YA 4N9F4 2N9XA 2G4SA 2AYOB 5J17A 2IY0B 4WJOA 2KJRA 2ZVNA 4MGYE 4DBGA 4W9IA 4FBJB 2CS4A 5DPTA 2DZJA 4K7SA 1OEYJ 3R3MA 4JGHB 1WX9A 2PPHA 2JWZA 3AU5A 3GOEA 3PVLA 2N1VA 3PSEB 5G2NA 3VTVA 2MSED 1K8RB 3KUCB 1SE9A 4KZCA 2AL3A 2MBEA 4HDQA 5IA7A 1WR6E 2KN5A 4WJPA 1V2YA 4HPMB 4NJ7A 2DYBA 2DYOA 2LXAA 3KW5B 3ZRCA 2NR2A 3K9PB 2QHOA 1G6JA 2DENB 2XEWA 3QARA 2ZPNA 2L05A 3JSVA 3W1YA 3RZFA 1ISNA 1WM2A 3GZNI 4FJYA 2Y5BB 3DBLI 2WDTB 2C60A 4JQWC 2V1YA 3LDZE 1C1YB 2L7RA 3A9JB 1J8CA 2FCMA 3KUDB 2GBJA 2JXXA 1WIAA 3O65B 4XC2A 1J0GA 2HE7A 5E6OA 3VTWA 4ZRIA 1L2NA 1WE7A 5G55A 3VXWA 4W9EA 3U7DA 3ZNZB 3ZTCA 2C7MB 2OOBB 3KVFB 4DDID 4BKTA 3RUIB 2FAZA 2JRHA 3PRZA 3OJ3A 3VH3B 5DPRA 3T9LA 2JZZA 3A1QB 2D10A 5DPSA 1P1AA 1QZEA 3MTNB 3A9KA 3M63B 3QHTA 2FIDA 2IO3B 3APDA 2BYFA 5JHBA 2KDEB 3MHSD 2MBOA 3VAWA 3R7QA 4G50A 3B0AA 1YJ1A 4GGQA 3L16A 1IP9A 3B08A 2K39A 3X0WA 2L0FA 4B9KA 4HWIB 3V62A 1WI0A 3H7PB 3PRPB 4BBNC 1WJNA 1UGMA 3A4RA 3DPDA 4EKUA 2FIFA 2N9PC 3H9DA 4MEMA 2J0MA 4K7UA 3KYCD 3VUWA 4ZRKA 3R7RA 2LUEA 3VQIA 1GJZA 2BF8B 4KSKC 1WJUA 2ZVOA 3S2AA 3ZDTA 3PZDA 4FHJA 4IWPA 2LWPA 4B6WA 1WJ4A 3ML8A 2ZZPB 3PS6A 4M8NA 2M0XA 4YL8A 4MELA 2JT4B 4ICUA 1UH6A 3DVNV 4NNJB 3HK0A 1I42A 1P9DU 2KD0A 1E90A 4NY0A 4RM9A 3IFWB 4ICVA 1WGYA 1WGRA 4JL9A 5IAAC 5E6NA 3L0WB 3NZSA 3P2BA 5CX3A 1OTRB 2MP2A 1NBFC 4FJZA 3HM6X 2WX1A 4M8MA 3ZNGC 4DK5A 3Q3JA 1UELA 4URKA 2L0TA 2KWUB 2O2VB 3PHXB 4IWOA 1UD7A 2G3QB 4MH0E 5L95C 2L76A 1KOTA 4FADA 2O6VD 4K1RB 3TBLD 4EZLA 1R4MI 3L54A 1E7VA 1ZW7A 3L13A 3AXCA 2KQ7A 4PYUA 2OJRA 4GSWA 2CU1A 1FXTB 1GC7A 4EOYA 1PQSA 3AULA 1SGHA 2IO2B 3WANA 2JY6A 4MGKE 2Z0DB 1L7YA 2LGXA 4GU2A 4K81A 4WQOB 4W9JA 5LLIA 5D7GA 3K9OB 1WXVA 5AZGA 4GDLA 1LM8B 2UWQA 2M4NA 3EECA 4ASWC 2XK5B 3D32A 1P3QU 5D94A 2ZNVB 5CHFA 4ZYNA 3U30A 5J18A 5C23A 1WE6A 1V5TA 3PT2B 5FR6A 4JLCA 4KDIC 1ZGUB 4CHKA 3APFA 3A9JA 4FN2A 3SHQA 1KJTA 4A20A 1HE8A 3CSTA 3IHPC 3IVFA 4P7IA 4NQKE 1KM7A 4EFOA 2BKFA 2ZNVC 3A33B 4HCPB 4W9HA 1GC6A 3CF6E 2DAFA 1Q1OA 4F8CB 2MWSB 2DAJA 3QIJA 4KZ0A 4E74A 2EMTA 1WM3A 4LJPB 3OAWA 3L08A 4G0NB 3PLUA 4WWOA 1WXAA 4W9LA 2GBKA 2XBBC 2DHZA 3DBHI 5C1ZA 3QCAA 4MSQB 2HD5B 4AOFA 3ML9A 3V60A 2NVUI 3NY5A 3NHEB 3WAOA 4HCNB 4EZJA 3W1SA 3UIOB
chains in the Genus database with same CATH superfamily
1FCCC 3CMMB 1ZPSA 1L5PA 3EC8A 3M3JA 1TYGB 1NEKB 1RFAA 1KLVA 3Q8BA 3AE1B 3C0RB 2KMAA 4LCDE 1TGZB 2H88B 3QK0A 3GP7A 2PTLA 3L4PA 2Q5WD 4II2B 1Q10A 1RAXA 1V5OA 2INDC 3GZNB 5D2MB 4ANUA 3KLSX 2BB6A 3R2TA 4WWPA 2WU5B 3RYTA 4PS7A 3BVZA 3Q14C 3ZUNA 1YIWA 2MW5A 3HUIA 2CJNA 2B76B 1RLFA 1BMLC 3EFCA 4MJSA 2J7QB 2IGGA 5D3DA 2GBNA 3TCAA 4AJWA 2BWFA 5TSSA 1GPXA 5KHQA 2JXTA 4RMAA 2WXJA 2K1FA 1WZ3A 2KX0A 4FULA 3NUHB 3ZJVA 2RDGA 3E9SA 4C7ZA 3P4PB 2XK5A 2R2QA 1C4PA 1IGDA 1E10A 3I3TB 1WMHB 4MT5A 2VRRB 3UIPB 3W1SC 1KRHA 2J42A 3V6CB 5J2RA 3PO0A 4HKQA 3NOBA 3UI3A 3PTFC 4E71A 2A4ZA 2BQQA 1YD8U 1HQRD 1YJJA 3DVGX 2DZIA 4NAMA 2OEDA 1Z2MA 5LXIB 2JZPA 3DOWA 4II3B 1XCTL 2FUHB 1H8CA 3EA6A 1F2RI 2KKCA 4RNAA 4LDTD 4A3PA 2W3RA 3U52E 2AQ1B 5HG2A 1WX7A 1UGJA 5D6JB 1WZ0A 4PS3A 2OHFA 2WLBA 2RSUA 3NS8A 4WJNA 2PMVA 3UF8A 1E5WA 1P0RA 5KHOA 3Q8CA 4KVGB 1LXDA 2WXHA 2D11A 2MQJA 2NBVB 4I6NB 5BMGA 3RCZA 2BBCA 1UBQA 4IWQA 2KJ6A 1TJEA 1UUPA 3AECB 2KLCA 1YQBA 2IZVB 5DPWA 1AARA 3AE9B 4ZOHC 1QKZA 3ZGZA 1XCQL 2O6VA 2C5LC 4W9DA 2RPQA 3DDCB 5G5HA 1E9MA 3NS1A 3PRMB 3AEFB 1AWDA 3I57A 2DNFA 4BOSC 1SB3C 2ZPYA 3AE6B 2LD9A 4AUQC 2ZCBA 2CHXA 4RGTA 3M95A 3ONSA 3RD2A 1DYQA 3ZIMA 3IAM1 3AEBB 1T0SC 4HVBA 2PKOA 3ZDMC 3WIMA 2N1WA 4B0EA 2D2QA 4ZHPA 2KDBA 4IDIA 1QOAA 2KFKB 2WWZA 5DCNA 4EZKA 1OEYA 2LASA 2MCNB 1WJ6A 3B1LX 2ZCCA 2G45B 4UDUC 1D4BA 3KYDD 3KUZA 2JUOA 2NCNA 3A1QA 1WGGA 3A9KB 1JALA 2KVRA 1LQBA 2I1KA 4F8CB 2IBIB 1J19A 4LDTB 4NQLB 3L17A 4IM3A 4HJKA 3ZQ4A 4DDGD 5C2TB 3WA0A 2V0GA 2WP9B 4YT0B 2LHDA 2WXIA 1V8CA 2G4DB 3TJPA 4B95A 4EEWA 4NJCA 4OVUA 3ZJUA 2WXPA 3RPFC 4P16A 3VUXA 1XT9B 3KWLA 1Q5WB 5AZFA 1EF1A 3V61A 1L4ZB 2D3GA 2AL6A 4ANVA 3P4QB 3QQ8B 2FNJB 1ZE3D 3RI7C 3QAQA 1CMXB 2CU3A 3SDLC 2HTHA 1WYWB 1V81A 1WFYA 3N3KB 1TS4A 4HJGE 1N61A 2N9XA 2G4SA 2AYOB 2IY0B 3MP9A 4MGYE 2CS4A 3WCQA 4JGHB 3R3MA 3AE2B 3GOEA 2JWZA 5G2NA 3PSEB 2MSED 1EWYC 1CJEA 2MBEA 2WNMA 1V1PA 4WJPA 2LXAA 1QT9A 2MH7A 3KW5B 1YNTE 2NR2A 3QARA 2ZPNA 3JSVA 1RFKA 1HEZE 4N58A 4N59A 4MM3B 1J8CA 2FCMA 2ONQA 1D5ZC 4XC2A 2DLBA 1IUEA 4MH8A 2WGSA 1FXAA 1WE7A 1L0XB 1RYJA 1TZOA 2LFIA 3VXWA 1N5XA 3ZTCA 2C7MB 4RF1A 3RUIB 2FAZA 3AE3B 3PRZA 4RGNA 3EUB2 3OJ3A 1M4VA 5FKAC 3T9LA 1A70A 1P1AA 3DHHC 3QHTA 5JHBA 4A90A 3VAWA 3R7QA 3U2SC 3L16A 3B08A 3AE5B 1NYQA 4B9KA 1WI0A 1WJNA 4US9A 5EE1A 3RMKC 4MEMA 3R7RA 3VQIA 3PZDA 1FMAD 4FHJA 3ML8A 2GLSA 2N9LA 1PDXA 2Y5CA 3SFEB 4PT5A 3DVNV 1YN5A 3HK0A 4NNJB 1I42A 1P9DU 3ETRA 2KT7A 1GOZA 1CQVA 3NZSA 1ACCA 5CX3A 1OTRB 2MP2A 3HM6X 2WX1A 4HEA1 2UU7A 2O2VB 1KOTA 3AE7B 1R4NB 1E7VA 2LJIA 1HZ6A 1TY0A 1FXTB 4P1CC 3BYTB 4K81A 1L7YA 2LGXA 2L1AA 1YN3A 4W9JA 1BXTA 1WXVA 2BS4B 2M4NA 5HHDG 3D32A 4M00A 1C9FA 5C23A 2E6XA 3AEGB 1JROA 4PK1A 3A9JA 4A20A 3IVFA 4L23A 4NQKE 2KDMA 1VR9A 2W3SA 1Q1OA 5EE3A 2DAJA 3QIJA 4E74A 4XWWA 4YSXB 3OAWA 3L08A 4WWOA 4W9LA 2JX5A 3NY5A 5LNK1 3UIOB 3SD5A 1P7FA 3R66C 4NPNA 1H4RA 2I38A 2J0KA 2WXRA 2PE6B 1V97A 4F7ZA 1TZ1A 3A4SC 1NENB 1HTOA 2PE9A 4C00A 4XGAB 1UBIA 1AN8A 4AS1A 4W9KA 3VVWB 2Z0EB 3OJ4B 2IYDB 3BZDB 1CK1A 2JQRB 2KTFA 4OVVA 4BBNF 2KLGA 4TV3A 2UYZB 1KF6B 1MI0A 3TEWA 1GNUA 1V49A 2JYTA 1YOVB 5TR5A 4YXDB 2RDBC 4NAWB 4TQ0A 3J9CA 1DOYA 2FCQA 2V9HA 5C3JB 1L6VA 4AP4C 2FCNA 4ZYSA 1UNSA 2RD0A 4IOIE 3TMPB 1BUIC 1SIFA 3AE4B 2GB1A 4GIVA 3UQAA 4GDLB 2J53A 3CWIA 5CHWA 4KIKA 4R3DA 4ACFA 2LVPA 3IT4B 4CO7A 2KC1A 1E8ZA 4BKSD 1NDDA 3MC9A 4XDDA 3N30A 5EE9A 2EMSA 4IKGA 3AI5A 2D07B 3ZNID 1HA5A 4MDKE 1IGCA 1JRUA 1T5XD 5HI1A 3PGEA 1T3QA 2CHWA 1E7UA 4DXAB 3Q3FA 4KDLB 3H6NA 3Q2AC 3WAPA 3ENEA 4LNNA 1WXQA 1YX6B 3QX1A 1TKGA 4GDKB 2WXQA 5AZHA 1LFDA 4TUUA 2MBBB 1XLNA 2ASQA 3LJ3A 2WXKA 1YQ4B 1WRIA 1WRDB 4JIOU 3FILB 2CKHB 4MSMB 1FXIA 3BINA 3NVVA 2NPTB 1D3ZA 4GMVA 4K3CA 3DWMA 1N6ZA 4OZAA 1GB1A 1V9JA 3ZXVA 3DBRI 4KKJA 2M56B 3VHTC 2AQ3B 2K8HA 4WAFA 2DZMA 1WGHA 1GUAB 2KN4A 3IBEA 1XLQA 2BKRB 2NS5A 3SEBA 4X57B 4HXDA 2V3PA 2V4LA 4WAAA 2KMCA 2JVCA 3U7ZA 3AEDB 4RM8A 1QQRA 5IP4D 1L4DB 3IG3A 1WXMA 1WXSA 3O13A 4MJSB 1LGRA 2INNE 2MX2A 3BK2A 4IM0A 4PYZA 3ZLZA 2MA9B 1V6EA 3ZVVA 4J6IA 3ZTDA 3HHMA 3X23A 1QF6A 4FLHA 1OFFA 4FXCA 1FD6A 3CIRB 2AQ2B 1B1ZA 2KMMA 2JPHA 4ARCA 2NMQA 4DWFA 1K53A 2PLPA 4BFRA 1FFVA 1WMHA 1SJHD 1JMLA 1SE3A 3U8ZA 1UWXA 1IBXB 4H2AA 3RNEC 4QAYA 3HVZA 3RT3B 1I4RA 4KV2A 1U4AA 2KACA 4OZBA 4AQ7A 2H89B 3PHWB 2PW9A 2LXCA 3RNCC 3PLVA 3APCA 2K8CA 3QJZA 2B3AA 3Q3OC 1V1OA 1WY8A 2C7HA 4LNOA 2KXJA 1WWTA 2L00B 3DBLB 2K6DB 3H7SA 4IM2A 1X1MA 3R8BA 2KX3A 2ZEQA 2DX5B 4ITKA 4WIPA 2PVGC 3HIZA 1VDVA 4DHJD 3Q8FA 3ZW3A 4N9F4 1PGXA 4DBGA 4FBJB 2PIAA 5DPTA 1F2RC 2DZJA 1GB4A 2PPHA 3NVWA 1TY2A 1K8RB 4XE0A 2KN5A 4HPMB 2D3BA 1J7CA 2DYBA 2DYOA 3ZRCA 3K9PB 2QHOA 2ZW0A 2DENB 2XEWA 1JWAD 1ISNA 1WM2A 1VZ8A 3GZNI 2C60A 3LDZE 1FPYA 1MFWA 3KUDB 1P7EA 2GBJA 2JXXA 3O65B 1STEA 5E6OA 4ZRIA 5G55A 4W9EA 4HROA 2Y3AA 2W54A 1JCKB 1YJIA 1E6EB 4KKIA 5T8IA 3VH3B 4JWUC 4WWMA 3A1QB 2D10A 5DPSA 1QZEA 3A9KA 3APDA 3MHSD 3AH7A 4G50A 3Q69A 4JE3B 3N1ZC 2K39A 2L0FA 3PRPB 3MJ5A 1FRDA 1UGMA 4EKUA 1XF5L 3VUWA 4ZRKA 3E56A 1F77A 2LUEA 1N60A 1GJZA 4KSKC 1WJUA 2ZVOA 3HVDA 2DBYA 4M8NA 1LO5D 3PS6A 3GE8C 4US8A 2V3NA 4JPSA 1I4XA 2QDFA 1E90A 4NY0A 4REZA 1JWBD 1MPEA 3MC0B 2HJ1A 5E6NA 1HZ5A 2BYTA 1NBFC 4DK5A 2Z8LA 3P42A 4YTMB 4LTUA 2MJEA 4XYCA 3NG0A 3TBLD 4EZLA 2LGSA 2BTEA 2OJRA 4GSWA 4C4VB 1NVID 4LK0M 1PQSA 2IO2B 1V1PB 4M01A 3WANA 2Z0DB 3MHZA 4GU2A 2JU6X 2KAJA 4WQOB 1SEBD 2L52A 1LM8B 5D94A 2WXMA 5EE0A 1WE6A 3PT2B 5FR6A 5JXVA 4CHKA 4RGMA 4YTNB 2MEKA 1HE8A 3RNGC 3CSTA 4P6VF 1KM7A 2BKFA 4W9HA 3CF6E 2DAFA 4KX6B 1QOGA 1TKEA 1JWUD 3PLUA 1WXAA 2GBKA 5D3IB 3LB8C 2TSSA 2XBBC 1D5XC 1N5WA 3V60A 3WAOA 4DHZE 2WQYB 3W1SA 2KTRA 4GN1A 3VH4B 2LEKA 1EO6A 1D5MC 1WSPA 4HK2A 3JW0X 2WXGA 1V80A 2LVQA 4A6QA 5EDSA 1NI2A 4AJYB 2IO1B 3BVGA 3HM3A 3ZNHB 4BVUC 2LI5A 4ZHOA 2EKEC 1WF9A 1ZUD2 1T0RC 1GAQB 1I4PA 5LXHA 3PREA 1EUVB 4OVZA 2WS3B 3P63A 2K8BA 1ZDXA 2AWTA 3OLMD 2K6QA 3RULA 3WALA 2GBRA 4CYEA 2O2VA 1JRPA 2LGYA 2GBMA 3AV8A 2EKIA 1N63A 2YLMA 2KC2A 3FAHA 2KQ4X 3BWUD 1C4AA 4KGTA 2W82A 3VR8B 3H8HA 3N9YC 2KHWB 4J3OD 1T6BX 2N4FA 4OZCA 4TQ1A 2ZW1A 5IKCM 2G1EA 4KSLC 2SEBD 2XN9C 2FUG1 3M62B 1ZOYB 3NRZA 2MRPA 4LNIA 1C79A 3VDZA 1IPGA 2FCSA 3T8MA 4BKSA 2K0PA 1OGWA 2D3AA 2NBUA 2REXA 2VZKB 3RFZB 1WX8A 2X8XX 2JZ3B 4ANWA 3TEYA 1PFDA 1UZXB 2M1MA 4W9GA 1FNWA 1BT0A 4M0WB 4PS8A 1YN4A 2RMMA 3BVMA 1ZDVA 1QOFA 3DCGA 2KWCA 1K50A 1OQYA 1WGDA 1SJED 2QILA 5L83A 4DXFA 4GB9A 4EE2A 4TKNA 1RRBA 5BMIA 3CSFA 4NZLB 5JHAA 2GOWA 2JF5A 3LXFA 1L0VB 3NZUA 1XXGA 4A8XC 3LYYA 4DHZB 1XQQA 4BOZB 1YX5B 3GB1A 5BYRA 3MC8A 2PEAA 2R61A 2KO3A 2I1JA 3SU8X 3ALBA 2CJOA 3VUYA 1E8XA 2K22A 3URYA 2A5UA 2KYWA 4NAWA 2M19A 3RNFC 3VFKA 2WX0A 1XD3B 1M94A 3B2FA 2RR9A 2NTSA 5BYQA 2IJ0A 1ET6A 1IYFA 3U4EG 1EM7A 3RZWC 3MJWA 2L3ZA 3NJTA 4KIKB 2KVZA 1FNVA 1Q0WB 3VRAB 1Y8RC 1J7BA 2KFJA 2X38A 4DHJB 1PUTA 2WHIA 3L10B 3ECIA 4N6EB 2AEHA 3OG5A 1WH3A 2KK8A 2BGFA 1R4MB 3MFGA 1F9JA 1XLPA 3BY4B 3Q3NC 2C9WB 2IGDA 1P98A 3N1XC 4C56C 3W5VB 4GDKA 2LGDA 1ZXIA 2JRIB 3I5JC 4RFBA 3H7PA 4K7WA 2IO0B 3AMZA 2WU2B 3EGRA 3FILA 2WDVB 3ZRFA 4IG7B 4EUTA 3QC8B 2NPTA 4HLEA 1Y56A 1C3TA 4XX5A 1WR1A 3JYUA 2BYEA 2RGFA 3B2GA 1JWSD 1B9RA 4ZDVA 2N7EA 3AEAB 1GG3A 4L1BA 2M8SA 2BVCA 3VR9B 4I6PA 1SE2A 4FHKA 1E8YA 2KJRA 4W9IA 2RDHA 1SSNA 3AEEB 3AE8B 4YSYB 1KTKA 3RNAC 2JSVX 3VTVA 5HFYA 3KUCB 1SE9A 1VRAB 4KZCA 4JX1C 1WR6E 3SFDB 1RM6C 1ENFA 1FO4A 1K52A 5FK9C 1SBBB 1JQ4A 1G6JA 1VJKA 2L05A 1TS2A 3RZFA 3FC4A 4FJYA 4LLGM 3DBLI 2WDTB 4JQWC 5BYSA 2V1YA 1C1YB 1J0GA 3VTWA 1IBXA 3ZXRA 2HDEA 2MJDA 3TUOA 4DDID 2OOBB 2ICIA 4BKTA 1C78A 2JRHA 2D3CA 1DOIA 1XO3A 4CQNA 3V05A 2JZZA 4WQMA 3M63B 2IO3B 2KDEB 3GS2A 1D6EC 4DQOC 3B0AA 1YJ1A 2LHEA 2WDQB 2BT6A 3A4RA 3DPDA 3NVZA 2QJLA 2LWPA 2ZZPB 5IO9A 2L32A 2M0XA 4HRSA 4JWSC 1L0YB 2HTME 2QC8A 3IFWB 4ICVA 4B0MA 1WGYA 4JL9A 5IAAC 3L0WB 2VH2A 4FJZA 4M8MA 3ZNGC 3ZYYX 3Q3JA 5L95C 4MH0E 1K51A 1UD7A 1SXTA 2L76A 4FADA 4P1BC 2O6VD 4RGOS 3L54A 1FFUA 1ZW7A 3L13A 3AXCA 4PYUA 2JYEA 3KWVA 2BS3B 4EOYA 2QIEB 1SGHA 2WXLA 1VZ6A 5FR3A 4MGKE 1F0ZA 3IAS1 4MACA 3N20C 5LLIA 1EU3A 1JW9D 2M0AA 3K9OB 5AZGA 1QLBB 3Q3MC 2UWQA 3EECA 2D5GA 2XK5B 3TEXA 3C19A 3V3XA 1P3QU 2ZNVB 5CHFA 3U30A 5J18A 4ARIA 1V5TA 4JLCA 1KLGD 1ZGUB 3APFA 4FN2A 1KJTA 1FRRA 3AM9A 3IHPC 3TSSA 4RCOA 1GC6A 3Q8EA 4C80A 2V4IB 1WM3A 4ZRPA 4M02A 1WYGA 4G0NB 4HPPA 1HTQA 3QCAA 1XLOA 2BW2A 4AOFA 4HCNB 2BWES 2G9HD 2KWVB 3QA8A 1VD2A 2N0SB 2DWQA 3B9JA 1MJDA 4W9CA 3PV1A 5AUIA 2ZJDA 2IY1B 2FE8A 1T0QC 1VCBA 2N9EB 2M17A 5BMHA 3TL5A 4AWJA 2WXFA 4XDCA 5GMVA 1QILA 1ZXHA 2LJ5A 2QMTA 4A3OA 1PGBA 2L8JA 4C7YA 4S0RA 2CHZA 2YVCA 4BKGA 2MBQA 2LVOA 4I6LB 2K3UA 3ZKJC 1EWCA 2K9XA 2CR5A 2LMCA 2KQSA 3DBSA 2O6VB 1F52A 1N62A 2KZRA 1J7AA 4F1SA 1ZKHA 4XZ4A 1KH0A 2ACZB 1OQRA 4O1NA 3RNBC 5HKHA 3TIXA 4C4VA 2K5PA 4IW0A 2WXOA 4MGIE 2Y5PA 2IPKD 4OW0A 4USAA 5CHVC 4G11A 5BO4B 3R2IA 5IN7A 4ZRJA 3W2DA 1FM0D 5AEKB 4KGSA 3OWEB 1A5RA 2QCZA 3DHGC 5JZEB 3UQBA 3UINB 4DXGA 1ESFA 1FCLA 2MJ3A 2HJ8A 1SF0A 1JWMD 2KFKA 3QWZB 4LJOB 3KH0A 1MVKA 5JH5C 1I35A 2MBHA 4FJVB 3T3NA 5H8YE 4WWNA 4GXBA 4IUMB 3VRBB 5I4DA 2NTTA 1TTNA 1NI3A 2PVOD 2KJHB 3H1UA 2KTRB 3DVNU 2PJHA 2K25A 1C4CA 1HXYD 1TIFA 4TMAB 3AU4A 1E8WA 3ZO5B 1I4HA 2KANA 3PPAA 1PYWD 1EF5A 2FBWB 4HPLB 2WXNA 3N32A 1S1QB 2BYVE 1R4NI 4NJ6A 4FA6A 1TBEA 1XEEA 2WYQA 4HDOA 2E3TA 5E6PA 4W9FA 4WJQA 2N9KA 2IGHA 2LZ6A 1ET9A 4YTPB 3V6EB 2GMIC 3SR6A 4L2YA 1MG8A 3DWGC 4GLSC 2DZKA 2VH1A 4BZAA 3IXSA 3P4SB 2BPSA 2J0JA 3C8YA 2GI9A 2INPE 2NBWB 4GOCA 1V86A 4K3BA 3EHVA 4A55A 5MPOA 5CTRC 4G3XB 1KLUD 4ANXA 3JSVB 1FNUA 3DVGY 3ABVB 4MM3A 1FIQA 3KQ4A 4MGZE 3ZJTA 1Z5SB 1MHHE 1RWSA 1C77A 4E3CA 3WAMA 2KNBA 4LNKA 4IC7B 1T0YA 5H92C 2GRIA 2KDFB 2Z59B 2QSDA 1MHXA 5GXGB 3UGBB 2W9NA 2R2OA 2BB5A 3DQVA 4M0WA 2DYMA 2C7NB 3VTUA 1CZPA 2LRWA 3EFUA 2KDIA 2KWDA 1OQQA 2LUMA 1E7PB 1S3SG 2LGIA 2LRUA 3W9CB 1YQ3B 5G5GA 3DBHB 1UWMA 4RH6A 2MLBA 4ZRQA 3PZ7A 3GE3C 3BIID 2KOXA 5AUKA 2N7DA 3I63C 4LNFA 4KGRA 2IDYA 1F1HA 2MP2B 3JVZX 2RPVA 2V3SA 5J17A 4WJOA 2ZVNA 1SIJA 4K7SA 1OEYJ 1WX9A 2XNAC 3Q8AA 3AU5A 3PVLA 2ON8A 2N1VA 2AL3A 4TSSA 2INCC 3AB5A 4HDQA 5IA7A 2AX5A 1V2YA 2J4XA 4NJ7A 4WURA 3W1YA 3BYYB 1FEHA 2Y5BB 2EELA 3RN9C 3A9JB 2L7RA 1WIAA 1L6UA 4HKZE 3T3OA 4Q2JA 2HE7A 4YSZB 1AYFA 1L2NA 1UF0A 3P1MA 3U7DA 3ZNZB 2JWUA 3KVFB 5DPRA 4A9AA 1VZ7A 3MTNB 2FIDA 1I4GA 2BYFA 1QOBA 2MBOA 2YEPF 4GGQA 3W5UB 1YMHE 1IP9A 2I2YA 1TS5A 3X0WA 4HWIB 3V62A 3H7PB 3DBRB 4BBNC 2FIFA 2N9PC 3H9DA 2WDRB 2J0MA 4K7UA 1MG4A 4S17A 3KYCD 1C76A 2BF8B 3ZDTA 3S2AA 2QEJC 2MHJA 4IWPA 4WH4A 1I7HA 4B6WA 1WJ4A 2SAKA 4YL8A 1TT5B 1DGJA 4MELA 2JT4B 4ICUA 1UH6A 4RF0A 2KD0A 5E6JA 4RM9A 1WGRA 1WGKA 3DHIC 3P2BA 3FKYA 1KFYB 1UELA 1ZP0B 4URKA 2L0TA 2KWUB 3PHXB 4IWOA 2G3QB 4K1RB 2BS2B 1R4MI 2W55A 1DOXA 3HRDD 2OJWA 2J52A 2KQ7A 4BAXA 1AW7A 1EU4A 2CU1A 1GC7A 3AULA 2JY6A 1I4QA 2YEPB 3BK1A 5D7GA 1R7SA 4GDLA 3TEZA 1TKYA 4ASWC 1SE4A 1TS3A 3P4RB 4XWTA 4ZYNA 3I9V1 3Q6BA 3AN1A 1E0ZA 4KDIC 3SHQA 1VLBA 4D2KA 4P7IA 4EFOA 2ZNVC 3A33B 4HCPB 3IT6B 4YWGG 1ROEA 2MWSB 4KZ0A 2EMTA 2VZKD 4LJPB 3PZ8A 2L83A 2N7JA 4OHJA 3N1YC 2DHZA 3DBHI 5IOIA 5C1ZA 3NVYA 4MSQB 2HD5B 3ML9A 3NZ3A 1PGAA 2NVUI 4EZJA 3NHEB 1NYRA
chains in the Genus database with same CATH topology
2BWES 2KTRA 3CMMB 2KWVB 3QA8A 3EC8A 1VD2A 3SD5A 3R66C 4NPNA 4GN1A 3M3JA 3VH4B 1H4RA 1EO6A 2J0KA 1RFAA 4HK2A 4W9CA 1KLVA 2PE6B 3PV1A 2ZJDA 3JW0X 3C0RB 2IY1B 2KMAA 1V80A 4LCDE 2LVQA 1TZ1A 3A4SC 4F7ZA 1VCBA 2N9EB 2M17A 5EDSA 2PE9A 1NI2A 1TGZB 3QK0A 1UBIA 2IO1B 3TL5A 4AJYB 3HM3A 4AWJA 3ZNHB 4W9KA 3VVWB 2Z0EB 3OJ4B 4BVUC 2IYDB 5GMVA 2LI5A 2EKEC 2LJ5A 4A3OA 2KTFA 1V5OA 1RAXA 4II2B 2L8JA 5D2MB 1WF9A 4OVVA 4ANUA 4BBNF 2CHZA 2YVCA 4BKGA 2MBQA 2KLGA 2LVOA 4I6LB 4TV3A 3ZKJC 2UYZB 5LXHA 4WWPA 3PREA 1EUVB 2CR5A 3RYTA 4PS7A 2KQSA 2K8BA 3ZUNA 2MW5A 1YIWA 1GNUA 1V49A 2AWTA 2K6QA 3OLMD 3DBSA 2GBRA 3RULA 3WALA 4CYEA 2O6VB 2O2VA 2LGYA 2GBMA 5TR5A 1RLFA 2KZRA 4F1SA 4NAWB 1ZKHA 4TQ0A 2YLMA 4MJSA 2FCQA 4XZ4A 2KC2A 2J7QB 4AP4C 2FCNA 2GBNA 5HKHA 2RD0A 3TIXA 3TCAA 4IW0A 4AJWA 2BWFA 4MGIE 3TMPB 1SIFA 5KHQA 2KHWB 2N4FA 4TQ1A 4RMAA 5CHVC 4G11A 4GIVA 5BO4B 2K1FA 1WZ3A 2KX0A 4FULA 4ZRJA 3UQAA 4GDLB 5AEKB 2XK5A 4KSLC 2R2QA 5CHWA 1A5RA 3M62B 5JZEB 4KIKA 3UQBA 2LVPA 2MRPA 3I3TB 3UINB 4CO7A 2KC1A 1E8ZA 1WMHB 3VDZA 4BKSD 1NDDA 1IPGA 2FCSA 2HJ8A 3N30A 2EMSA 2VRRB 3T8MA 3UIPB 3AI5A 3W1SC 4BKSA 2KFKA 3QWZB 4LJOB 1OGWA 3V6CB 5J2RA 2D07B 3KH0A 5JH5C 3ZNID 3NOBA 4MDKE 1I35A 2MBHA 2NBUA 4FJVB 1JRUA 2REXA 3PTFC 4WWNA 3PGEA 4E71A 1WX8A 2A4ZA 1YD8U 2CHWA 1E7UA 2JZ3B 2DZIA 3DVGX 3Q3FA 4GXBA 4IUMB 1UZXB 4KDLB 2M1MA 3H6NA 3WAPA 4DXAB 3ENEA 1Z2MA 4W9GA 1YX6B 5LXIB 1TTNA 3QX1A 1BT0A 3DOWA 4GDKB 4II3B 4M0WB 2FUHB 1H8CA 4PS8A 5AZHA 1LFDA 4TUUA 2KKCA 2KJHB 3H1UA 4LDTD 2KTRB 4A3PA 2MBBB 2ASQA 3LJ3A 3DCGA 2KWCA 2PJHA 3DVNU 2K25A 1OQYA 1WGDA 1WRDB 1WX7A 4JIOU 5L83A 4GB9A 4TKNA 2CKHB 1RRBA 4MSMB 3AU4A 5D6JB 3BINA 3CSFA 1E8WA 1WZ0A 4PS3A 2KANA 3ZO5B 5JHAA 2GOWA 2JF5A 2RSUA 3NS8A 3PPAA 4WJNA 1EF5A 3NZUA 4HPLB 1E5WA 1P0RA 2NPTB 5KHOA 3UF8A 1D3ZA 4GMVA 4DHZE 3N32A 1S1QB 2BYVE 4KVGB 1LXDA 4DHZB 1XQQA 4BOZB 1V9JA 2D11A 1R4NI 2MQJA 4NJ6A 3DBRI 4FA6A 2NBVB 4I6NB 1TBEA 3RCZA 1YX5B 3VHTC 2K8HA 1UBQA 2WYQA 4HDOA 2KJ6A 4IWQA 2DZMA 1WGHA 2PEAA 5E6PA 2KLCA 1GUAB 4W9FA 4WJQA 1YQBA 2KO3A 3IBEA 2BKRB 2IZVB 2LZ6A 2I1JA 3SU8X 2NS5A 5DPWA 3V6EB 1AARA 4X57B 4HXDA 3ALBA 2V4LA 4WAAA 2GMIC 1MG8A 2KMCA 2DZKA 2JVCA 3VUYA 1E8XA 2O6VA 2C5LC 4W9DA 4RM8A 2A5UA 2RPQA 2BPSA 3DDCB 3IG3A 1WXMA 1WXSA 2J0JA 4NAWA 2NBWB 3VFKA 4MJSB 3PRMB 2WX0A 2MX2A 4GOCA 1V86A 1XD3B 1M94A 4IM0A 4PYZA 3ZLZA 2MA9B 4BOSC 1V6EA 3EHVA 3ZVVA 2ZPYA 4J6IA 2RR9A 2LD9A 4AUQC 3ZTDA 3HHMA 2ZCBA 2CHXA 3M95A 3ONSA 3RD2A 3X23A 3ZIMA 1IYFA 4FLHA 5CTRC 4G3XB 4HVBA 4ANXA 3JSVB 3RZWC 3MJWA 3DVGY 2L3ZA 3ZDMC 2JPHA 4ANWA 3WIMA 4KIKB 4DWFA 4MM3A 2N1WA 4MGZE 1Z5SB 1Q0WB 2D2QA 4BFRA 1WMHA 3U8ZA 1Y8RC 2KFJA 4E3CA 3WAMA 4DHJB 2KDBA 2KNBA 3L10B 3ECIA 2KFKB 2AEHA 2WWZA 4IC7B 5DCNA 4EZKA 1OEYA 1T0YA 1WH3A 2LASA 2MCNB 2KK8A 2BGFA 1WJ6A 3B1LX 2ZCCA 2G45B 1F9JA 2KDFB 2Z59B 3BY4B 3RT3B 3KYDD 2C9WB 3KUZA 2JUOA 4KV2A 2NCNA 1P98A 1U4AA 3A1QA 1WGGA 3UGBB 3PHWB 3A9KB 2LXCA 2W9NA 2R2OA 2KVRA 3PLVA 1LQBA 2I1KA 3DQVA 4GDKA 2IBIB 1J19A 2DYMA 2C7NB 2K8CA 2LGDA 3APCA 2B3AA 3QJZA 4LDTB 3VTUA 2JRIB 4NQLB 3L17A 2LRWA 4IM3A 4HJKA 4DDGD 3H7PA 4K7WA 1WY8A 2C7HA 2IO0B 3EFUA 2KXJA 2KDIA 3WA0A 1S3SG 2LRUA 2L00B 3ZRFA 2G4DB 4IG7B 3TJPA 2K6DB 4B95A 4EEWA 4OVUA 4EUTA 3H7SA 4IM2A 1X1MA 3QC8B 2NPTA 4HLEA 2MLBA 2KX3A 3VUXA 1XT9B 1Q5WB 5AZFA 2ZEQA 1C3TA 4XX5A 1EF1A 3V61A 1WR1A 2DX5B 2KOXA 3JYUA 2D3GA 2BYEA 2RGFA 2AL6A 2N7DA 4ANVA 3QQ8B 4ZDVA 2FNJB 2N7EA 1GG3A 3QAQA 1CMXB 2M8SA 3SDLC 2HTHA 3HIZA 1WYWB 1V81A 1WFYA 2MP2B 3N3KB 4I6PA 4DHJD 3JVZX 4FHKA 2V3SA 3ZW3A 1E8YA 4N9F4 2N9XA 2G4SA 2AYOB 5J17A 2IY0B 4WJOA 2KJRA 2ZVNA 4MGYE 4DBGA 4W9IA 4FBJB 2CS4A 5DPTA 2DZJA 4K7SA 1OEYJ 3R3MA 4JGHB 1WX9A 2PPHA 2JWZA 3AU5A 3GOEA 3PVLA 2N1VA 3PSEB 5G2NA 3VTVA 2MSED 1K8RB 3KUCB 1SE9A 4KZCA 2AL3A 2MBEA 4HDQA 5IA7A 1WR6E 2KN5A 4WJPA 1V2YA 4HPMB 4NJ7A 2DYBA 2DYOA 2LXAA 3KW5B 3ZRCA 2NR2A 3K9PB 2QHOA 1G6JA 2DENB 2XEWA 3QARA 2ZPNA 2L05A 3JSVA 3W1YA 3RZFA 1ISNA 1WM2A 3GZNI 4FJYA 2Y5BB 3DBLI 2WDTB 2C60A 4JQWC 2V1YA 3LDZE 1C1YB 2L7RA 3A9JB 1J8CA 2FCMA 3KUDB 2GBJA 2JXXA 1WIAA 3O65B 4XC2A 1J0GA 2HE7A 5E6OA 3VTWA 4ZRIA 1L2NA 1WE7A 5G55A 3VXWA 4W9EA 3U7DA 3ZNZB 3ZTCA 2C7MB 2OOBB 3KVFB 4DDID 4BKTA 3RUIB 2FAZA 2JRHA 3PRZA 3OJ3A 3VH3B 5DPRA 3T9LA 2JZZA 3A1QB 2D10A 5DPSA 1P1AA 1QZEA 3MTNB 3A9KA 3M63B 3QHTA 2FIDA 2IO3B 3APDA 2BYFA 5JHBA 2KDEB 3MHSD 2MBOA 3VAWA 3R7QA 4G50A 3B0AA 1YJ1A 4GGQA 3L16A 1IP9A 3B08A 2K39A 3X0WA 2L0FA 4B9KA 4HWIB 3V62A 1WI0A 3H7PB 3PRPB 4BBNC 1WJNA 1UGMA 3A4RA 3DPDA 4EKUA 2FIFA 2N9PC 3H9DA 4MEMA 2J0MA 4K7UA 3KYCD 3VUWA 4ZRKA 3R7RA 2LUEA 3VQIA 1GJZA 2BF8B 4KSKC 1WJUA 2ZVOA 3S2AA 3ZDTA 3PZDA 4FHJA 4IWPA 2LWPA 4B6WA 1WJ4A 3ML8A 2ZZPB 3PS6A 4M8NA 2M0XA 4YL8A 4MELA 2JT4B 4ICUA 1UH6A 3DVNV 4NNJB 3HK0A 1I42A 1P9DU 2KD0A 1E90A 4NY0A 4RM9A 3IFWB 4ICVA 1WGYA 1WGRA 4JL9A 5IAAC 5E6NA 3L0WB 3NZSA 3P2BA 5CX3A 1OTRB 2MP2A 1NBFC 4FJZA 3HM6X 2WX1A 4M8MA 3ZNGC 4DK5A 3Q3JA 1UELA 4URKA 2L0TA 2KWUB 2O2VB 3PHXB 4IWOA 1UD7A 2G3QB 4MH0E 5L95C 2L76A 1KOTA 4FADA 2O6VD 4K1RB 3TBLD 4EZLA 1R4MI 3L54A 1E7VA 1ZW7A 3L13A 3AXCA 2KQ7A 4PYUA 2OJRA 4GSWA 2CU1A 1FXTB 1GC7A 4EOYA 1PQSA 3AULA 1SGHA 2IO2B 3WANA 2JY6A 4MGKE 2Z0DB 1L7YA 2LGXA 4GU2A 4K81A 4WQOB 4W9JA 5LLIA 5D7GA 3K9OB 1WXVA 5AZGA 4GDLA 1LM8B 2UWQA 2M4NA 3EECA 4ASWC 2XK5B 3D32A 1P3QU 5D94A 2ZNVB 5CHFA 4ZYNA 3U30A 5J18A 5C23A 1WE6A 1V5TA 3PT2B 5FR6A 4JLCA 4KDIC 1ZGUB 4CHKA 3APFA 3A9JA 4FN2A 3SHQA 1KJTA 4A20A 1HE8A 3CSTA 3IHPC 3IVFA 4P7IA 4NQKE 1KM7A 4EFOA 2BKFA 2ZNVC 3A33B 4HCPB 4W9HA 1GC6A 3CF6E 2DAFA 1Q1OA 4F8CB 2MWSB 2DAJA 3QIJA 4KZ0A 4E74A 2EMTA 1WM3A 4LJPB 3OAWA 3L08A 4G0NB 3PLUA 4WWOA 1WXAA 4W9LA 2GBKA 2XBBC 2DHZA 3DBHI 5C1ZA 3QCAA 4MSQB 2HD5B 4AOFA 3ML9A 3V60A 2NVUI 3NY5A 3NHEB 3WAOA 4HCNB 4EZJA 3W1SA 3UIOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWE S;  2KTR A;  3CMM B;  2KWV B;  3QA8 A;  3EC8 A;  1VD2 A;  3SD5 A;  3R66 C;  4NPN A;  4GN1 A;  3M3J A;  3VH4 B;  1H4R A;  1EO6 A;  2J0K A;  1RFA A;  4HK2 A;  4W9C A;  1KLV A;  2PE6 B;  3PV1 A;  2ZJD A;  3JW0 X;  3C0R B;  2IY1 B;  2KMA A;  1V80 A;  4LCD E;  2LVQ A;  1TZ1 A;  3A4S C;  4F7Z A;  1VCB A;  2N9E B;  2M17 A;  5EDS A;  2PE9 A;  1NI2 A;  1TGZ B;  3QK0 A;  1UBI A;  2IO1 B;  3TL5 A;  4AJY B;  3HM3 A;  4AWJ A;  3ZNH B;  4W9K A;  3VVW B;  2Z0E B;  3OJ4 B;  4BVU C;  2IYD B;  5GMV A;  2LI5 A;  2EKE C;  2LJ5 A;  4A3O A;  2KTF A;  1V5O A;  1RAX A;  4II2 B;  2L8J A;  5D2M B;  1WF9 A;  4OVV A;  4ANU A;  4BBN F;  2CHZ A;  2YVC A;  4BKG A;  2MBQ A;  2KLG A;  2LVO A;  4I6L B;  4TV3 A;  3ZKJ C;  2UYZ B;  5LXH A;  4WWP A;  3PRE A;  1EUV B;  2CR5 A;  3RYT A;  4PS7 A;  2KQS A;  2K8B A;  3ZUN A;  2MW5 A;  1YIW A;  1GNU A;  1V49 A;  2AWT A;  2K6Q A;  3OLM D;  3DBS A;  2GBR A;  3RUL A;  3WAL A;  4CYE A;  2O6V B;  2O2V A;  2LGY A;  2GBM A;  5TR5 A;  1RLF A;  2KZR A;  4F1S A;  4NAW B;  1ZKH A;  4TQ0 A;  2YLM A;  4MJS A;  2FCQ A;  4XZ4 A;  2KC2 A;  2J7Q B;  4AP4 C;  2FCN A;  2GBN A;  5HKH A;  2RD0 A;  3TIX A;  3TCA A;  4IW0 A;  4AJW A;  2BWF A;  4MGI E;  3TMP B;  1SIF A;  5KHQ A;  2KHW B;  2N4F A;  4TQ1 A;  4RMA A;  5CHV C;  4G11 A;  4GIV A;  5BO4 B;  2K1F A;  1WZ3 A;  2KX0 A;  4FUL A;  4ZRJ A;  3UQA A;  4GDL B;  5AEK B;  2XK5 A;  4KSL C;  2R2Q A;  5CHW A;  1A5R A;  3M62 B;  5JZE B;  4KIK A;  3UQB A;  2LVP A;  2MRP A;  3I3T B;  3UIN B;  4CO7 A;  2KC1 A;  1E8Z A;  1WMH B;  3VDZ A;  4BKS D;  1NDD A;  1IPG A;  2FCS A;  2HJ8 A;  3N30 A;  2EMS A;  2VRR B;  3T8M A;  3UIP B;  3AI5 A;  3W1S C;  4BKS A;  2KFK A;  3QWZ B;  4LJO B;  1OGW A;  3V6C B;  5J2R A;  2D07 B;  3KH0 A;  5JH5 C;  3ZNI D;  3NOB A;  4MDK E;  1I35 A;  2MBH A;  2NBU A;  4FJV B;  1JRU A;  2REX A;  3PTF C;  4WWN A;  3PGE A;  4E71 A;  1WX8 A;  2A4Z A;  1YD8 U;  2CHW A;  1E7U A;  2JZ3 B;  2DZI A;  3DVG X;  3Q3F A;  4GXB A;  4IUM B;  1UZX B;  4KDL B;  2M1M A;  3H6N A;  3WAP A;  4DXA B;  3ENE A;  1Z2M A;  4W9G A;  1YX6 B;  5LXI B;  1TTN A;  3QX1 A;  1BT0 A;  3DOW A;  4GDK B;  4II3 B;  4M0W B;  2FUH B;  1H8C A;  4PS8 A;  5AZH A;  1LFD A;  4TUU A;  2KKC A;  2KJH B;  3H1U A;  4LDT D;  2KTR B;  4A3P A;  2MBB B;  2ASQ A;  3LJ3 A;  3DCG A;  2KWC A;  2PJH A;  3DVN U;  2K25 A;  1OQY A;  1WGD A;  1WRD B;  1WX7 A;  4JIO U;  5L83 A;  4GB9 A;  4TKN A;  2CKH B;  1RRB A;  4MSM B;  3AU4 A;  5D6J B;  3BIN A;  3CSF A;  1E8W A;  1WZ0 A;  4PS3 A;  2KAN A;  3ZO5 B;  5JHA A;  2GOW A;  2JF5 A;  2RSU A;  3NS8 A;  3PPA A;  4WJN A;  1EF5 A;  3NZU A;  4HPL B;  1E5W A;  1P0R A;  2NPT B;  5KHO A;  3UF8 A;  1D3Z A;  4GMV A;  4DHZ E;  3N32 A;  1S1Q B;  2BYV E;  4KVG B;  1LXD A;  4DHZ B;  1XQQ A;  4BOZ B;  1V9J A;  2D11 A;  1R4N I;  2MQJ A;  4NJ6 A;  3DBR I;  4FA6 A;  2NBV B;  4I6N B;  1TBE A;  3RCZ A;  1YX5 B;  3VHT C;  2K8H A;  1UBQ A;  2WYQ A;  4HDO A;  2KJ6 A;  4IWQ A;  2DZM A;  1WGH A;  2PEA A;  5E6P A;  2KLC A;  1GUA B;  4W9F A;  4WJQ A;  1YQB A;  2KO3 A;  3IBE A;  2BKR B;  2IZV B;  2LZ6 A;  2I1J A;  3SU8 X;  2NS5 A;  5DPW A;  3V6E B;  1AAR A;  4X57 B;  4HXD A;  3ALB A;  2V4L A;  4WAA A;  2GMI C;  1MG8 A;  2KMC A;  2DZK A;  2JVC A;  3VUY A;  1E8X A;  2O6V A;  2C5L C;  4W9D A;  4RM8 A;  2A5U A;  2RPQ A;  2BPS A;  3DDC B;  3IG3 A;  1WXM A;  1WXS A;  2J0J A;  4NAW A;  2NBW B;  3VFK A;  4MJS B;  3PRM B;  2WX0 A;  2MX2 A;  4GOC A;  1V86 A;  1XD3 B;  1M94 A;  4IM0 A;  4PYZ A;  3ZLZ A;  2MA9 B;  4BOS C;  1V6E A;  3EHV A;  3ZVV A;  2ZPY A;  4J6I A;  2RR9 A;  2LD9 A;  4AUQ C;  3ZTD A;  3HHM A;  2ZCB A;  2CHX A;  3M95 A;  3ONS A;  3RD2 A;  3X23 A;  3ZIM A;  1IYF A;  4FLH A;  5CTR C;  4G3X B;  4HVB A;  4ANX A;  3JSV B;  3RZW C;  3MJW A;  3DVG Y;  2L3Z A;  3ZDM C;  2JPH A;  4ANW A;  3WIM A;  4KIK B;  4DWF A;  4MM3 A;  2N1W A;  4MGZ E;  1Z5S B;  1Q0W B;  2D2Q A;  4BFR A;  1WMH A;  3U8Z A;  1Y8R C;  2KFJ A;  4E3C A;  3WAM A;  4DHJ B;  2KDB A;  2KNB A;  3L10 B;  3ECI A;  2KFK B;  2AEH A;  2WWZ A;  4IC7 B;  5DCN A;  4EZK A;  1OEY A;  1T0Y A;  1WH3 A;  2LAS A;  2MCN B;  2KK8 A;  2BGF A;  1WJ6 A;  3B1L X;  2ZCC A;  2G45 B;  1F9J A;  2KDF B;  2Z59 B;  3BY4 B;  3RT3 B;  3KYD D;  2C9W B;  3KUZ A;  2JUO A;  4KV2 A;  2NCN A;  1P98 A;  1U4A A;  3A1Q A;  1WGG A;  3UGB B;  3PHW B;  3A9K B;  2LXC A;  2W9N A;  2R2O A;  2KVR A;  3PLV A;  1LQB A;  2I1K A;  3DQV A;  4GDK A;  2IBI B;  1J19 A;  2DYM A;  2C7N B;  2K8C A;  2LGD A;  3APC A;  2B3A A;  3QJZ A;  4LDT B;  3VTU A;  2JRI B;  4NQL B;  3L17 A;  2LRW A;  4IM3 A;  4HJK A;  4DDG D;  3H7P A;  4K7W A;  1WY8 A;  2C7H A;  2IO0 B;  3EFU A;  2KXJ A;  2KDI A;  3WA0 A;  1S3S G;  2LRU A;  2L00 B;  3ZRF A;  2G4D B;  4IG7 B;  3TJP A;  2K6D B;  4B95 A;  4EEW A;  4OVU A;  4EUT A;  3H7S A;  4IM2 A;  1X1M A;  3QC8 B;  2NPT A;  4HLE A;  2MLB A;  2KX3 A;  3VUX A;  1XT9 B;  1Q5W B;  5AZF A;  2ZEQ A;  1C3T A;  4XX5 A;  1EF1 A;  3V61 A;  1WR1 A;  2DX5 B;  2KOX A;  3JYU A;  2D3G A;  2BYE A;  2RGF A;  2AL6 A;  2N7D A;  4ANV A;  3QQ8 B;  4ZDV A;  2FNJ B;  2N7E A;  1GG3 A;  3QAQ A;  1CMX B;  2M8S A;  3SDL C;  2HTH A;  3HIZ A;  1WYW B;  1V81 A;  1WFY A;  2MP2 B;  3N3K B;  4I6P A;  4DHJ D;  3JVZ X;  4FHK A;  2V3S A;  3ZW3 A;  1E8Y A;  4N9F 4;  2N9X A;  2G4S A;  2AYO B;  5J17 A;  2IY0 B;  4WJO A;  2KJR A;  2ZVN A;  4MGY E;  4DBG A;  4W9I A;  4FBJ B;  2CS4 A;  5DPT A;  2DZJ A;  4K7S A;  1OEY J;  3R3M A;  4JGH B;  1WX9 A;  2PPH A;  2JWZ A;  3AU5 A;  3GOE A;  3PVL A;  2N1V A;  3PSE B;  5G2N A;  3VTV A;  2MSE D;  1K8R B;  3KUC B;  1SE9 A;  4KZC A;  2AL3 A;  2MBE A;  4HDQ A;  5IA7 A;  1WR6 E;  2KN5 A;  4WJP A;  1V2Y A;  4HPM B;  4NJ7 A;  2DYB A;  2DYO A;  2LXA A;  3KW5 B;  3ZRC A;  2NR2 A;  3K9P B;  2QHO A;  1G6J A;  2DEN B;  2XEW A;  3QAR A;  2ZPN A;  2L05 A;  3JSV A;  3W1Y A;  3RZF A;  1ISN A;  1WM2 A;  3GZN I;  4FJY A;  2Y5B B;  3DBL I;  2WDT B;  2C60 A;  4JQW C;  2V1Y A;  3LDZ E;  1C1Y B;  2L7R A;  3A9J B;  1J8C A;  2FCM A;  3KUD B;  2GBJ A;  2JXX A;  1WIA A;  3O65 B;  4XC2 A;  1J0G A;  2HE7 A;  5E6O A;  3VTW A;  4ZRI A;  1L2N A;  1WE7 A;  5G55 A;  3VXW A;  4W9E A;  3U7D A;  3ZNZ B;  3ZTC A;  2C7M B;  2OOB B;  3KVF B;  4DDI D;  4BKT A;  3RUI B;  2FAZ A;  2JRH A;  3PRZ A;  3OJ3 A;  3VH3 B;  5DPR A;  3T9L A;  2JZZ A;  3A1Q B;  2D10 A;  5DPS A;  1P1A A;  1QZE A;  3MTN B;  3A9K A;  3M63 B;  3QHT A;  2FID A;  2IO3 B;  3APD A;  2BYF A;  5JHB A;  2KDE B;  3MHS D;  2MBO A;  3VAW A;  3R7Q A;  4G50 A;  3B0A A;  1YJ1 A;  4GGQ A;  3L16 A;  1IP9 A;  3B08 A;  2K39 A;  3X0W A;  2L0F A;  4B9K A;  4HWI B;  3V62 A;  1WI0 A;  3H7P B;  3PRP B;  4BBN C;  1WJN A;  1UGM A;  3A4R A;  3DPD A;  4EKU A;  2FIF A;  2N9P C;  3H9D A;  4MEM A;  2J0M A;  4K7U A;  3KYC D;  3VUW A;  4ZRK A;  3R7R A;  2LUE A;  3VQI A;  1GJZ A;  2BF8 B;  4KSK C;  1WJU A;  2ZVO A;  3S2A A;  3ZDT A;  3PZD A;  4FHJ A;  4IWP A;  2LWP A;  4B6W A;  1WJ4 A;  3ML8 A;  2ZZP B;  3PS6 A;  4M8N A;  2M0X A;  4YL8 A;  4MEL A;  2JT4 B;  4ICU A;  1UH6 A;  3DVN V;  4NNJ B;  3HK0 A;  1I42 A;  1P9D U;  2KD0 A;  1E90 A;  4NY0 A;  4RM9 A;  3IFW B;  4ICV A;  1WGY A;  1WGR A;  4JL9 A;  5IAA C;  5E6N A;  3L0W B;  3NZS A;  3P2B A;  5CX3 A;  1OTR B;  2MP2 A;  1NBF C;  4FJZ A;  3HM6 X;  2WX1 A;  4M8M A;  3ZNG C;  4DK5 A;  3Q3J A;  1UEL A;  4URK A;  2L0T A;  2KWU B;  2O2V B;  3PHX B;  4IWO A;  1UD7 A;  2G3Q B;  4MH0 E;  5L95 C;  2L76 A;  1KOT A;  4FAD A;  2O6V D;  4K1R B;  3TBL D;  4EZL A;  1R4M I;  3L54 A;  1E7V A;  1ZW7 A;  3L13 A;  3AXC A;  2KQ7 A;  4PYU A;  2OJR A;  4GSW A;  2CU1 A;  1FXT B;  1GC7 A;  4EOY A;  1PQS A;  3AUL A;  1SGH A;  2IO2 B;  3WAN A;  2JY6 A;  4MGK E;  2Z0D B;  1L7Y A;  2LGX A;  4GU2 A;  4K81 A;  4WQO B;  4W9J A;  5LLI A;  5D7G A;  3K9O B;  1WXV A;  5AZG A;  4GDL A;  1LM8 B;  2UWQ A;  2M4N A;  3EEC A;  4ASW C;  2XK5 B;  3D32 A;  1P3Q U;  5D94 A;  2ZNV B;  5CHF A;  4ZYN A;  3U30 A;  5J18 A;  5C23 A;  1WE6 A;  1V5T A;  3PT2 B;  5FR6 A;  4JLC A;  4KDI C;  1ZGU B;  4CHK A;  3APF A;  3A9J A;  4FN2 A;  3SHQ A;  1KJT A;  4A20 A;  1HE8 A;  3CST A;  3IHP C;  3IVF A;  4P7I A;  4NQK E;  1KM7 A;  4EFO A;  2BKF A;  2ZNV C;  3A33 B;  4HCP B;  4W9H A;  1GC6 A;  3CF6 E;  2DAF A;  1Q1O A;  4F8C B;  2MWS B;  2DAJ A;  3QIJ A;  4KZ0 A;  4E74 A;  2EMT A;  1WM3 A;  4LJP B;  3OAW A;  3L08 A;  4G0N B;  3PLU A;  4WWO A;  1WXA A;  4W9L A;  2GBK A;  2XBB C;  2DHZ A;  3DBH I;  5C1Z A;  3QCA A;  4MSQ B;  2HD5 B;  4AOF A;  3ML9 A;  3V60 A;  2NVU I;  3NY5 A;  3NHE B;  3WAO A;  4HCN B;  4EZJ A;  3W1S A;  3UIO B; 
#chains in the Genus database with same CATH topology
 1FCC C;  3CMM B;  1ZPS A;  1L5P A;  3EC8 A;  3M3J A;  1TYG B;  1NEK B;  1RFA A;  1KLV A;  3Q8B A;  3AE1 B;  3C0R B;  2KMA A;  4LCD E;  1TGZ B;  2H88 B;  3QK0 A;  3GP7 A;  2PTL A;  3L4P A;  2Q5W D;  4II2 B;  1Q10 A;  1RAX A;  1V5O A;  2IND C;  3GZN B;  5D2M B;  4ANU A;  3KLS X;  2BB6 A;  3R2T A;  4WWP A;  2WU5 B;  3RYT A;  4PS7 A;  3BVZ A;  3Q14 C;  3ZUN A;  1YIW A;  2MW5 A;  3HUI A;  2CJN A;  2B76 B;  1RLF A;  1BML C;  3EFC A;  4MJS A;  2J7Q B;  2IGG A;  5D3D A;  2GBN A;  3TCA A;  4AJW A;  2BWF A;  5TSS A;  1GPX A;  5KHQ A;  2JXT A;  4RMA A;  2WXJ A;  2K1F A;  1WZ3 A;  2KX0 A;  4FUL A;  3NUH B;  3ZJV A;  2RDG A;  3E9S A;  4C7Z A;  3P4P B;  2XK5 A;  2R2Q A;  1C4P A;  1IGD A;  1E10 A;  3I3T B;  1WMH B;  4MT5 A;  2VRR B;  3UIP B;  3W1S C;  1KRH A;  2J42 A;  3V6C B;  5J2R A;  3PO0 A;  4HKQ A;  3NOB A;  3UI3 A;  3PTF C;  4E71 A;  2A4Z A;  2BQQ A;  1YD8 U;  1HQR D;  1YJJ A;  3DVG X;  2DZI A;  4NAM A;  2OED A;  1Z2M A;  5LXI B;  2JZP A;  3DOW A;  4II3 B;  1XCT L;  2FUH B;  1H8C A;  3EA6 A;  1F2R I;  2KKC A;  4RNA A;  4LDT D;  4A3P A;  2W3R A;  3U52 E;  2AQ1 B;  5HG2 A;  1WX7 A;  1UGJ A;  5D6J B;  1WZ0 A;  4PS3 A;  2OHF A;  2WLB A;  2RSU A;  3NS8 A;  4WJN A;  2PMV A;  3UF8 A;  1E5W A;  1P0R A;  5KHO A;  3Q8C A;  4KVG B;  1LXD A;  2WXH A;  2D11 A;  2MQJ A;  2NBV B;  4I6N B;  5BMG A;  3RCZ A;  2BBC A;  1UBQ A;  4IWQ A;  2KJ6 A;  1TJE A;  1UUP A;  3AEC B;  2KLC A;  1YQB A;  2IZV B;  5DPW A;  1AAR A;  3AE9 B;  4ZOH C;  1QKZ A;  3ZGZ A;  1XCQ L;  2O6V A;  2C5L C;  4W9D A;  2RPQ A;  3DDC B;  5G5H A;  1E9M A;  3NS1 A;  3PRM B;  3AEF B;  1AWD A;  3I57 A;  2DNF A;  4BOS C;  1SB3 C;  2ZPY A;  3AE6 B;  2LD9 A;  4AUQ C;  2ZCB A;  2CHX A;  4RGT A;  3M95 A;  3ONS A;  3RD2 A;  1DYQ A;  3ZIM A;  3IAM 1;  3AEB B;  1T0S C;  4HVB A;  2PKO A;  3ZDM C;  3WIM A;  2N1W A;  4B0E A;  2D2Q A;  4ZHP A;  2KDB A;  4IDI A;  1QOA A;  2KFK B;  2WWZ A;  5DCN A;  4EZK A;  1OEY A;  2LAS A;  2MCN B;  1WJ6 A;  3B1L X;  2ZCC A;  2G45 B;  4UDU C;  1D4B A;  3KYD D;  3KUZ A;  2JUO A;  2NCN A;  3A1Q A;  1WGG A;  3A9K B;  1JAL A;  2KVR A;  1LQB A;  2I1K A;  4F8C B;  2IBI B;  1J19 A;  4LDT B;  4NQL B;  3L17 A;  4IM3 A;  4HJK A;  3ZQ4 A;  4DDG D;  5C2T B;  3WA0 A;  2V0G A;  2WP9 B;  4YT0 B;  2LHD A;  2WXI A;  1V8C A;  2G4D B;  3TJP A;  4B95 A;  4EEW A;  4NJC A;  4OVU A;  3ZJU A;  2WXP A;  3RPF C;  4P16 A;  3VUX A;  1XT9 B;  3KWL A;  1Q5W B;  5AZF A;  1EF1 A;  3V61 A;  1L4Z B;  2D3G A;  2AL6 A;  4ANV A;  3P4Q B;  3QQ8 B;  2FNJ B;  1ZE3 D;  3RI7 C;  3QAQ A;  1CMX B;  2CU3 A;  3SDL C;  2HTH A;  1WYW B;  1V81 A;  1WFY A;  3N3K B;  1TS4 A;  4HJG E;  1N61 A;  2N9X A;  2G4S A;  2AYO B;  2IY0 B;  3MP9 A;  4MGY E;  2CS4 A;  3WCQ A;  4JGH B;  3R3M A;  3AE2 B;  3GOE A;  2JWZ A;  5G2N A;  3PSE B;  2MSE D;  1EWY C;  1CJE A;  2MBE A;  2WNM A;  1V1P A;  4WJP A;  2LXA A;  1QT9 A;  2MH7 A;  3KW5 B;  1YNT E;  2NR2 A;  3QAR A;  2ZPN A;  3JSV A;  1RFK A;  1HEZ E;  4N58 A;  4N59 A;  4MM3 B;  1J8C A;  2FCM A;  2ONQ A;  1D5Z C;  4XC2 A;  2DLB A;  1IUE A;  4MH8 A;  2WGS A;  1FXA A;  1WE7 A;  1L0X B;  1RYJ A;  1TZO A;  2LFI A;  3VXW A;  1N5X A;  3ZTC A;  2C7M B;  4RF1 A;  3RUI B;  2FAZ A;  3AE3 B;  3PRZ A;  4RGN A;  3EUB 2;  3OJ3 A;  1M4V A;  5FKA C;  3T9L A;  1A70 A;  1P1A A;  3DHH C;  3QHT A;  5JHB A;  4A90 A;  3VAW A;  3R7Q A;  3U2S C;  3L16 A;  3B08 A;  3AE5 B;  1NYQ A;  4B9K A;  1WI0 A;  1WJN A;  4US9 A;  5EE1 A;  3RMK C;  4MEM A;  3R7R A;  3VQI A;  3PZD A;  1FMA D;  4FHJ A;  3ML8 A;  2GLS A;  2N9L A;  1PDX A;  2Y5C A;  3SFE B;  4PT5 A;  3DVN V;  1YN5 A;  3HK0 A;  4NNJ B;  1I42 A;  1P9D U;  3ETR A;  2KT7 A;  1GOZ A;  1CQV A;  3NZS A;  1ACC A;  5CX3 A;  1OTR B;  2MP2 A;  3HM6 X;  2WX1 A;  4HEA 1;  2UU7 A;  2O2V B;  1KOT A;  3AE7 B;  1R4N B;  1E7V A;  2LJI A;  1HZ6 A;  1TY0 A;  1FXT B;  4P1C C;  3BYT B;  4K81 A;  1L7Y A;  2LGX A;  2L1A A;  1YN3 A;  4W9J A;  1BXT A;  1WXV A;  2BS4 B;  2M4N A;  5HHD G;  3D32 A;  4M00 A;  1C9F A;  5C23 A;  2E6X A;  3AEG B;  1JRO A;  4PK1 A;  3A9J A;  4A20 A;  3IVF A;  4L23 A;  4NQK E;  2KDM A;  1VR9 A;  2W3S A;  1Q1O A;  5EE3 A;  2DAJ A;  3QIJ A;  4E74 A;  4XWW A;  4YSX B;  3OAW A;  3L08 A;  4WWO A;  4W9L A;  2JX5 A;  3NY5 A;  5LNK 1;  3UIO B;  3SD5 A;  1P7F A;  3R66 C;  4NPN A;  1H4R A;  2I38 A;  2J0K A;  2WXR A;  2PE6 B;  1V97 A;  4F7Z A;  1TZ1 A;  3A4S C;  1NEN B;  1HTO A;  2PE9 A;  4C00 A;  4XGA B;  1UBI A;  1AN8 A;  4AS1 A;  4W9K A;  3VVW B;  2Z0E B;  3OJ4 B;  2IYD B;  3BZD B;  1CK1 A;  2JQR B;  2KTF A;  4OVV A;  4BBN F;  2KLG A;  4TV3 A;  2UYZ B;  1KF6 B;  1MI0 A;  3TEW A;  1GNU A;  1V49 A;  2JYT A;  1YOV B;  5TR5 A;  4YXD B;  2RDB C;  4NAW B;  4TQ0 A;  3J9C A;  1DOY A;  2FCQ A;  2V9H A;  5C3J B;  1L6V A;  4AP4 C;  2FCN A;  4ZYS A;  1UNS A;  2RD0 A;  4IOI E;  3TMP B;  1BUI C;  1SIF A;  3AE4 B;  2GB1 A;  4GIV A;  3UQA A;  4GDL B;  2J53 A;  3CWI A;  5CHW A;  4KIK A;  4R3D A;  4ACF A;  2LVP A;  3IT4 B;  4CO7 A;  2KC1 A;  1E8Z A;  4BKS D;  1NDD A;  3MC9 A;  4XDD A;  3N30 A;  5EE9 A;  2EMS A;  4IKG A;  3AI5 A;  2D07 B;  3ZNI D;  1HA5 A;  4MDK E;  1IGC A;  1JRU A;  1T5X D;  5HI1 A;  3PGE A;  1T3Q A;  2CHW A;  1E7U A;  4DXA B;  3Q3F A;  4KDL B;  3H6N A;  3Q2A C;  3WAP A;  3ENE A;  4LNN A;  1WXQ A;  1YX6 B;  3QX1 A;  1TKG A;  4GDK B;  2WXQ A;  5AZH A;  1LFD A;  4TUU A;  2MBB B;  1XLN A;  2ASQ A;  3LJ3 A;  2WXK A;  1YQ4 B;  1WRI A;  1WRD B;  4JIO U;  3FIL B;  2CKH B;  4MSM B;  1FXI A;  3BIN A;  3NVV A;  2NPT B;  1D3Z A;  4GMV A;  4K3C A;  3DWM A;  1N6Z A;  4OZA A;  1GB1 A;  1V9J A;  3ZXV A;  3DBR I;  4KKJ A;  2M56 B;  3VHT C;  2AQ3 B;  2K8H A;  4WAF A;  2DZM A;  1WGH A;  1GUA B;  2KN4 A;  3IBE A;  1XLQ A;  2BKR B;  2NS5 A;  3SEB A;  4X57 B;  4HXD A;  2V3P A;  2V4L A;  4WAA A;  2KMC A;  2JVC A;  3U7Z A;  3AED B;  4RM8 A;  1QQR A;  5IP4 D;  1L4D B;  3IG3 A;  1WXM A;  1WXS A;  3O13 A;  4MJS B;  1LGR A;  2INN E;  2MX2 A;  3BK2 A;  4IM0 A;  4PYZ A;  3ZLZ A;  2MA9 B;  1V6E A;  3ZVV A;  4J6I A;  3ZTD A;  3HHM A;  3X23 A;  1QF6 A;  4FLH A;  1OFF A;  4FXC A;  1FD6 A;  3CIR B;  2AQ2 B;  1B1Z A;  2KMM A;  2JPH A;  4ARC A;  2NMQ A;  4DWF A;  1K53 A;  2PLP A;  4BFR A;  1FFV A;  1WMH A;  1SJH D;  1JML A;  1SE3 A;  3U8Z A;  1UWX A;  1IBX B;  4H2A A;  3RNE C;  4QAY A;  3HVZ A;  3RT3 B;  1I4R A;  4KV2 A;  1U4A A;  2KAC A;  4OZB A;  4AQ7 A;  2H89 B;  3PHW B;  2PW9 A;  2LXC A;  3RNC C;  3PLV A;  3APC A;  2K8C A;  3QJZ A;  2B3A A;  3Q3O C;  1V1O A;  1WY8 A;  2C7H A;  4LNO A;  2KXJ A;  1WWT A;  2L00 B;  3DBL B;  2K6D B;  3H7S A;  4IM2 A;  1X1M A;  3R8B A;  2KX3 A;  2ZEQ A;  2DX5 B;  4ITK A;  4WIP A;  2PVG C;  3HIZ A;  1VDV A;  4DHJ D;  3Q8F A;  3ZW3 A;  4N9F 4;  1PGX A;  4DBG A;  4FBJ B;  2PIA A;  5DPT A;  1F2R C;  2DZJ A;  1GB4 A;  2PPH A;  3NVW A;  1TY2 A;  1K8R B;  4XE0 A;  2KN5 A;  4HPM B;  2D3B A;  1J7C A;  2DYB A;  2DYO A;  3ZRC A;  3K9P B;  2QHO A;  2ZW0 A;  2DEN B;  2XEW A;  1JWA D;  1ISN A;  1WM2 A;  1VZ8 A;  3GZN I;  2C60 A;  3LDZ E;  1FPY A;  1MFW A;  3KUD B;  1P7E A;  2GBJ A;  2JXX A;  3O65 B;  1STE A;  5E6O A;  4ZRI A;  5G55 A;  4W9E A;  4HRO A;  2Y3A A;  2W54 A;  1JCK B;  1YJI A;  1E6E B;  4KKI A;  5T8I A;  3VH3 B;  4JWU C;  4WWM A;  3A1Q B;  2D10 A;  5DPS A;  1QZE A;  3A9K A;  3APD A;  3MHS D;  3AH7 A;  4G50 A;  3Q69 A;  4JE3 B;  3N1Z C;  2K39 A;  2L0F A;  3PRP B;  3MJ5 A;  1FRD A;  1UGM A;  4EKU A;  1XF5 L;  3VUW A;  4ZRK A;  3E56 A;  1F77 A;  2LUE A;  1N60 A;  1GJZ A;  4KSK C;  1WJU A;  2ZVO A;  3HVD A;  2DBY A;  4M8N A;  1LO5 D;  3PS6 A;  3GE8 C;  4US8 A;  2V3N A;  4JPS A;  1I4X A;  2QDF A;  1E90 A;  4NY0 A;  4REZ A;  1JWB D;  1MPE A;  3MC0 B;  2HJ1 A;  5E6N A;  1HZ5 A;  2BYT A;  1NBF C;  4DK5 A;  2Z8L A;  3P42 A;  4YTM B;  4LTU A;  2MJE A;  4XYC A;  3NG0 A;  3TBL D;  4EZL A;  2LGS A;  2BTE A;  2OJR A;  4GSW A;  4C4V B;  1NVI D;  4LK0 M;  1PQS A;  2IO2 B;  1V1P B;  4M01 A;  3WAN A;  2Z0D B;  3MHZ A;  4GU2 A;  2JU6 X;  2KAJ A;  4WQO B;  1SEB D;  2L52 A;  1LM8 B;  5D94 A;  2WXM A;  5EE0 A;  1WE6 A;  3PT2 B;  5FR6 A;  5JXV A;  4CHK A;  4RGM A;  4YTN B;  2MEK A;  1HE8 A;  3RNG C;  3CST A;  4P6V F;  1KM7 A;  2BKF A;  4W9H A;  3CF6 E;  2DAF A;  4KX6 B;  1QOG A;  1TKE A;  1JWU D;  3PLU A;  1WXA A;  2GBK A;  5D3I B;  3LB8 C;  2TSS A;  2XBB C;  1D5X C;  1N5W A;  3V60 A;  3WAO A;  4DHZ E;  2WQY B;  3W1S A;  2KTR A;  4GN1 A;  3VH4 B;  2LEK A;  1EO6 A;  1D5M C;  1WSP A;  4HK2 A;  3JW0 X;  2WXG A;  1V80 A;  2LVQ A;  4A6Q A;  5EDS A;  1NI2 A;  4AJY B;  2IO1 B;  3BVG A;  3HM3 A;  3ZNH B;  4BVU C;  2LI5 A;  4ZHO A;  2EKE C;  1WF9 A;  1ZUD 2;  1T0R C;  1GAQ B;  1I4P A;  5LXH A;  3PRE A;  1EUV B;  4OVZ A;  2WS3 B;  3P63 A;  2K8B A;  1ZDX A;  2AWT A;  3OLM D;  2K6Q A;  3RUL A;  3WAL A;  2GBR A;  4CYE A;  2O2V A;  1JRP A;  2LGY A;  2GBM A;  3AV8 A;  2EKI A;  1N63 A;  2YLM A;  2KC2 A;  3FAH A;  2KQ4 X;  3BWU D;  1C4A A;  4KGT A;  2W82 A;  3VR8 B;  3H8H A;  3N9Y C;  2KHW B;  4J3O D;  1T6B X;  2N4F A;  4OZC A;  4TQ1 A;  2ZW1 A;  5IKC M;  2G1E A;  4KSL C;  2SEB D;  2XN9 C;  2FUG 1;  3M62 B;  1ZOY B;  3NRZ A;  2MRP A;  4LNI A;  1C79 A;  3VDZ A;  1IPG A;  2FCS A;  3T8M A;  4BKS A;  2K0P A;  1OGW A;  2D3A A;  2NBU A;  2REX A;  2VZK B;  3RFZ B;  1WX8 A;  2X8X X;  2JZ3 B;  4ANW A;  3TEY A;  1PFD A;  1UZX B;  2M1M A;  4W9G A;  1FNW A;  1BT0 A;  4M0W B;  4PS8 A;  1YN4 A;  2RMM A;  3BVM A;  1ZDV A;  1QOF A;  3DCG A;  2KWC A;  1K50 A;  1OQY A;  1WGD A;  1SJE D;  2QIL A;  5L83 A;  4DXF A;  4GB9 A;  4EE2 A;  4TKN A;  1RRB A;  5BMI A;  3CSF A;  4NZL B;  5JHA A;  2GOW A;  2JF5 A;  3LXF A;  1L0V B;  3NZU A;  1XXG A;  4A8X C;  3LYY A;  4DHZ B;  1XQQ A;  4BOZ B;  1YX5 B;  3GB1 A;  5BYR A;  3MC8 A;  2PEA A;  2R61 A;  2KO3 A;  2I1J A;  3SU8 X;  3ALB A;  2CJO A;  3VUY A;  1E8X A;  2K22 A;  3URY A;  2A5U A;  2KYW A;  4NAW A;  2M19 A;  3RNF C;  3VFK A;  2WX0 A;  1XD3 B;  1M94 A;  3B2F A;  2RR9 A;  2NTS A;  5BYQ A;  2IJ0 A;  1ET6 A;  1IYF A;  3U4E G;  1EM7 A;  3RZW C;  3MJW A;  2L3Z A;  3NJT A;  4KIK B;  2KVZ A;  1FNV A;  1Q0W B;  3VRA B;  1Y8R C;  1J7B A;  2KFJ A;  2X38 A;  4DHJ B;  1PUT A;  2WHI A;  3L10 B;  3ECI A;  4N6E B;  2AEH A;  3OG5 A;  1WH3 A;  2KK8 A;  2BGF A;  1R4M B;  3MFG A;  1F9J A;  1XLP A;  3BY4 B;  3Q3N C;  2C9W B;  2IGD A;  1P98 A;  3N1X C;  4C56 C;  3W5V B;  4GDK A;  2LGD A;  1ZXI A;  2JRI B;  3I5J C;  4RFB A;  3H7P A;  4K7W A;  2IO0 B;  3AMZ A;  2WU2 B;  3EGR A;  3FIL A;  2WDV B;  3ZRF A;  4IG7 B;  4EUT A;  3QC8 B;  2NPT A;  4HLE A;  1Y56 A;  1C3T A;  4XX5 A;  1WR1 A;  3JYU A;  2BYE A;  2RGF A;  3B2G A;  1JWS D;  1B9R A;  4ZDV A;  2N7E A;  3AEA B;  1GG3 A;  4L1B A;  2M8S A;  2BVC A;  3VR9 B;  4I6P A;  1SE2 A;  4FHK A;  1E8Y A;  2KJR A;  4W9I A;  2RDH A;  1SSN A;  3AEE B;  3AE8 B;  4YSY B;  1KTK A;  3RNA C;  2JSV X;  3VTV A;  5HFY A;  3KUC B;  1SE9 A;  1VRA B;  4KZC A;  4JX1 C;  1WR6 E;  3SFD B;  1RM6 C;  1ENF A;  1FO4 A;  1K52 A;  5FK9 C;  1SBB B;  1JQ4 A;  1G6J A;  1VJK A;  2L05 A;  1TS2 A;  3RZF A;  3FC4 A;  4FJY A;  4LLG M;  3DBL I;  2WDT B;  4JQW C;  5BYS A;  2V1Y A;  1C1Y B;  1J0G A;  3VTW A;  1IBX A;  3ZXR A;  2HDE A;  2MJD A;  3TUO A;  4DDI D;  2OOB B;  2ICI A;  4BKT A;  1C78 A;  2JRH A;  2D3C A;  1DOI A;  1XO3 A;  4CQN A;  3V05 A;  2JZZ A;  4WQM A;  3M63 B;  2IO3 B;  2KDE B;  3GS2 A;  1D6E C;  4DQO C;  3B0A A;  1YJ1 A;  2LHE A;  2WDQ B;  2BT6 A;  3A4R A;  3DPD A;  3NVZ A;  2QJL A;  2LWP A;  2ZZP B;  5IO9 A;  2L32 A;  2M0X A;  4HRS A;  4JWS C;  1L0Y B;  2HTM E;  2QC8 A;  3IFW B;  4ICV A;  4B0M A;  1WGY A;  4JL9 A;  5IAA C;  3L0W B;  2VH2 A;  4FJZ A;  4M8M A;  3ZNG C;  3ZYY X;  3Q3J A;  5L95 C;  4MH0 E;  1K51 A;  1UD7 A;  1SXT A;  2L76 A;  4FAD A;  4P1B C;  2O6V D;  4RGO S;  3L54 A;  1FFU A;  1ZW7 A;  3L13 A;  3AXC A;  4PYU A;  2JYE A;  3KWV A;  2BS3 B;  4EOY A;  2QIE B;  1SGH A;  2WXL A;  1VZ6 A;  5FR3 A;  4MGK E;  1F0Z A;  3IAS 1;  4MAC A;  3N20 C;  5LLI A;  1EU3 A;  1JW9 D;  2M0A A;  3K9O B;  5AZG A;  1QLB B;  3Q3M C;  2UWQ A;  3EEC A;  2D5G A;  2XK5 B;  3TEX A;  3C19 A;  3V3X A;  1P3Q U;  2ZNV B;  5CHF A;  3U30 A;  5J18 A;  4ARI A;  1V5T A;  4JLC A;  1KLG D;  1ZGU B;  3APF A;  4FN2 A;  1KJT A;  1FRR A;  3AM9 A;  3IHP C;  3TSS A;  4RCO A;  1GC6 A;  3Q8E A;  4C80 A;  2V4I B;  1WM3 A;  4ZRP A;  4M02 A;  1WYG A;  4G0N B;  4HPP A;  1HTQ A;  3QCA A;  1XLO A;  2BW2 A;  4AOF A;  4HCN B;  2BWE S;  2G9H D;  2KWV B;  3QA8 A;  1VD2 A;  2N0S B;  2DWQ A;  3B9J A;  1MJD A;  4W9C A;  3PV1 A;  5AUI A;  2ZJD A;  2IY1 B;  2FE8 A;  1T0Q C;  1VCB A;  2N9E B;  2M17 A;  5BMH A;  3TL5 A;  4AWJ A;  2WXF A;  4XDC A;  5GMV A;  1QIL A;  1ZXH A;  2LJ5 A;  2QMT A;  4A3O A;  1PGB A;  2L8J A;  4C7Y A;  4S0R A;  2CHZ A;  2YVC A;  4BKG A;  2MBQ A;  2LVO A;  4I6L B;  2K3U A;  3ZKJ C;  1EWC A;  2K9X A;  2CR5 A;  2LMC A;  2KQS A;  3DBS A;  2O6V B;  1F52 A;  1N62 A;  2KZR A;  1J7A A;  4F1S A;  1ZKH A;  4XZ4 A;  1KH0 A;  2ACZ B;  1OQR A;  4O1N A;  3RNB C;  5HKH A;  3TIX A;  4C4V A;  2K5P A;  4IW0 A;  2WXO A;  4MGI E;  2Y5P A;  2IPK D;  4OW0 A;  4USA A;  5CHV C;  4G11 A;  5BO4 B;  3R2I A;  5IN7 A;  4ZRJ A;  3W2D A;  1FM0 D;  5AEK B;  4KGS A;  3OWE B;  1A5R A;  2QCZ A;  3DHG C;  5JZE B;  3UQB A;  3UIN B;  4DXG A;  1ESF A;  1FCL A;  2MJ3 A;  2HJ8 A;  1SF0 A;  1JWM D;  2KFK A;  3QWZ B;  4LJO B;  3KH0 A;  1MVK A;  5JH5 C;  1I35 A;  2MBH A;  4FJV B;  3T3N A;  5H8Y E;  4WWN A;  4GXB A;  4IUM B;  3VRB B;  5I4D A;  2NTT A;  1TTN A;  1NI3 A;  2PVO D;  2KJH B;  3H1U A;  2KTR B;  3DVN U;  2PJH A;  2K25 A;  1C4C A;  1HXY D;  1TIF A;  4TMA B;  3AU4 A;  1E8W A;  3ZO5 B;  1I4H A;  2KAN A;  3PPA A;  1PYW D;  1EF5 A;  2FBW B;  4HPL B;  2WXN A;  3N32 A;  1S1Q B;  2BYV E;  1R4N I;  4NJ6 A;  4FA6 A;  1TBE A;  1XEE A;  2WYQ A;  4HDO A;  2E3T A;  5E6P A;  4W9F A;  4WJQ A;  2N9K A;  2IGH A;  2LZ6 A;  1ET9 A;  4YTP B;  3V6E B;  2GMI C;  3SR6 A;  4L2Y A;  1MG8 A;  3DWG C;  4GLS C;  2DZK A;  2VH1 A;  4BZA A;  3IXS A;  3P4S B;  2BPS A;  2J0J A;  3C8Y A;  2GI9 A;  2INP E;  2NBW B;  4GOC A;  1V86 A;  4K3B A;  3EHV A;  4A55 A;  5MPO A;  5CTR C;  4G3X B;  1KLU D;  4ANX A;  3JSV B;  1FNU A;  3DVG Y;  3ABV B;  4MM3 A;  1FIQ A;  3KQ4 A;  4MGZ E;  3ZJT A;  1Z5S B;  1MHH E;  1RWS A;  1C77 A;  4E3C A;  3WAM A;  2KNB A;  4LNK A;  4IC7 B;  1T0Y A;  5H92 C;  2GRI A;  2KDF B;  2Z59 B;  2QSD A;  1MHX A;  5GXG B;  3UGB B;  2W9N A;  2R2O A;  2BB5 A;  3DQV A;  4M0W A;  2DYM A;  2C7N B;  3VTU A;  1CZP A;  2LRW A;  3EFU A;  2KDI A;  2KWD A;  1OQQ A;  2LUM A;  1E7P B;  1S3S G;  2LGI A;  2LRU A;  3W9C B;  1YQ3 B;  5G5G A;  3DBH B;  1UWM A;  4RH6 A;  2MLB A;  4ZRQ A;  3PZ7 A;  3GE3 C;  3BII D;  2KOX A;  5AUK A;  2N7D A;  3I63 C;  4LNF A;  4KGR A;  2IDY A;  1F1H A;  2MP2 B;  3JVZ X;  2RPV A;  2V3S A;  5J17 A;  4WJO A;  2ZVN A;  1SIJ A;  4K7S A;  1OEY J;  1WX9 A;  2XNA C;  3Q8A A;  3AU5 A;  3PVL A;  2ON8 A;  2N1V A;  2AL3 A;  4TSS A;  2INC C;  3AB5 A;  4HDQ A;  5IA7 A;  2AX5 A;  1V2Y A;  2J4X A;  4NJ7 A;  4WUR A;  3W1Y A;  3BYY B;  1FEH A;  2Y5B B;  2EEL A;  3RN9 C;  3A9J B;  2L7R A;  1WIA A;  1L6U A;  4HKZ E;  3T3O A;  4Q2J A;  2HE7 A;  4YSZ B;  1AYF A;  1L2N A;  1UF0 A;  3P1M A;  3U7D A;  3ZNZ B;  2JWU A;  3KVF B;  5DPR A;  4A9A A;  1VZ7 A;  3MTN B;  2FID A;  1I4G A;  2BYF A;  1QOB A;  2MBO A;  2YEP F;  4GGQ A;  3W5U B;  1YMH E;  1IP9 A;  2I2Y A;  1TS5 A;  3X0W A;  4HWI B;  3V62 A;  3H7P B;  3DBR B;  4BBN C;  2FIF A;  2N9P C;  3H9D A;  2WDR B;  2J0M A;  4K7U A;  1MG4 A;  4S17 A;  3KYC D;  1C76 A;  2BF8 B;  3ZDT A;  3S2A A;  2QEJ C;  2MHJ A;  4IWP A;  4WH4 A;  1I7H A;  4B6W A;  1WJ4 A;  2SAK A;  4YL8 A;  1TT5 B;  1DGJ A;  4MEL A;  2JT4 B;  4ICU A;  1UH6 A;  4RF0 A;  2KD0 A;  5E6J A;  4RM9 A;  1WGR A;  1WGK A;  3DHI C;  3P2B A;  3FKY A;  1KFY B;  1UEL A;  1ZP0 B;  4URK A;  2L0T A;  2KWU B;  3PHX B;  4IWO A;  2G3Q B;  4K1R B;  2BS2 B;  1R4M I;  2W55 A;  1DOX A;  3HRD D;  2OJW A;  2J52 A;  2KQ7 A;  4BAX A;  1AW7 A;  1EU4 A;  2CU1 A;  1GC7 A;  3AUL A;  2JY6 A;  1I4Q A;  2YEP B;  3BK1 A;  5D7G A;  1R7S A;  4GDL A;  3TEZ A;  1TKY A;  4ASW C;  1SE4 A;  1TS3 A;  3P4R B;  4XWT A;  4ZYN A;  3I9V 1;  3Q6B A;  3AN1 A;  1E0Z A;  4KDI C;  3SHQ A;  1VLB A;  4D2K A;  4P7I A;  4EFO A;  2ZNV C;  3A33 B;  4HCP B;  3IT6 B;  4YWG G;  1ROE A;  2MWS B;  4KZ0 A;  2EMT A;  2VZK D;  4LJP B;  3PZ8 A;  2L83 A;  2N7J A;  4OHJ A;  3N1Y C;  2DHZ A;  3DBH I;  5IOI A;  5C1Z A;  3NVY A;  4MSQ B;  2HD5 B;  3ML9 A;  3NZ3 A;  1PGA A;  2NVU I;  4EZJ A;  3NHE B;  1NYR A; 
#chains in the Genus database with same CATH homology
 2BWE S;  2KTR A;  3CMM B;  2KWV B;  3QA8 A;  3EC8 A;  1VD2 A;  3SD5 A;  3R66 C;  4NPN A;  4GN1 A;  3M3J A;  3VH4 B;  1H4R A;  1EO6 A;  2J0K A;  1RFA A;  4HK2 A;  4W9C A;  1KLV A;  2PE6 B;  3PV1 A;  2ZJD A;  3JW0 X;  3C0R B;  2IY1 B;  2KMA A;  1V80 A;  4LCD E;  2LVQ A;  1TZ1 A;  3A4S C;  4F7Z A;  1VCB A;  2N9E B;  2M17 A;  5EDS A;  2PE9 A;  1NI2 A;  1TGZ B;  3QK0 A;  1UBI A;  2IO1 B;  3TL5 A;  4AJY B;  3HM3 A;  4AWJ A;  3ZNH B;  4W9K A;  3VVW B;  2Z0E B;  3OJ4 B;  4BVU C;  2IYD B;  5GMV A;  2LI5 A;  2EKE C;  2LJ5 A;  4A3O A;  2KTF A;  1V5O A;  1RAX A;  4II2 B;  2L8J A;  5D2M B;  1WF9 A;  4OVV A;  4ANU A;  4BBN F;  2CHZ A;  2YVC A;  4BKG A;  2MBQ A;  2KLG A;  2LVO A;  4I6L B;  4TV3 A;  3ZKJ C;  2UYZ B;  5LXH A;  4WWP A;  3PRE A;  1EUV B;  2CR5 A;  3RYT A;  4PS7 A;  2KQS A;  2K8B A;  3ZUN A;  2MW5 A;  1YIW A;  1GNU A;  1V49 A;  2AWT A;  2K6Q A;  3OLM D;  3DBS A;  2GBR A;  3RUL A;  3WAL A;  4CYE A;  2O6V B;  2O2V A;  2LGY A;  2GBM A;  5TR5 A;  1RLF A;  2KZR A;  4F1S A;  4NAW B;  1ZKH A;  4TQ0 A;  2YLM A;  4MJS A;  2FCQ A;  4XZ4 A;  2KC2 A;  2J7Q B;  4AP4 C;  2FCN A;  2GBN A;  5HKH A;  2RD0 A;  3TIX A;  3TCA A;  4IW0 A;  4AJW A;  2BWF A;  4MGI E;  3TMP B;  1SIF A;  5KHQ A;  2KHW B;  2N4F A;  4TQ1 A;  4RMA A;  5CHV C;  4G11 A;  4GIV A;  5BO4 B;  2K1F A;  1WZ3 A;  2KX0 A;  4FUL A;  4ZRJ A;  3UQA A;  4GDL B;  5AEK B;  2XK5 A;  4KSL C;  2R2Q A;  5CHW A;  1A5R A;  3M62 B;  5JZE B;  4KIK A;  3UQB A;  2LVP A;  2MRP A;  3I3T B;  3UIN B;  4CO7 A;  2KC1 A;  1E8Z A;  1WMH B;  3VDZ A;  4BKS D;  1NDD A;  1IPG A;  2FCS A;  2HJ8 A;  3N30 A;  2EMS A;  2VRR B;  3T8M A;  3UIP B;  3AI5 A;  3W1S C;  4BKS A;  2KFK A;  3QWZ B;  4LJO B;  1OGW A;  3V6C B;  5J2R A;  2D07 B;  3KH0 A;  5JH5 C;  3ZNI D;  3NOB A;  4MDK E;  1I35 A;  2MBH A;  2NBU A;  4FJV B;  1JRU A;  2REX A;  3PTF C;  4WWN A;  3PGE A;  4E71 A;  1WX8 A;  2A4Z A;  1YD8 U;  2CHW A;  1E7U A;  2JZ3 B;  2DZI A;  3DVG X;  3Q3F A;  4GXB A;  4IUM B;  1UZX B;  4KDL B;  2M1M A;  3H6N A;  3WAP A;  4DXA B;  3ENE A;  1Z2M A;  4W9G A;  1YX6 B;  5LXI B;  1TTN A;  3QX1 A;  1BT0 A;  3DOW A;  4GDK B;  4II3 B;  4M0W B;  2FUH B;  1H8C A;  4PS8 A;  5AZH A;  1LFD A;  4TUU A;  2KKC A;  2KJH B;  3H1U A;  4LDT D;  2KTR B;  4A3P A;  2MBB B;  2ASQ A;  3LJ3 A;  3DCG A;  2KWC A;  2PJH A;  3DVN U;  2K25 A;  1OQY A;  1WGD A;  1WRD B;  1WX7 A;  4JIO U;  5L83 A;  4GB9 A;  4TKN A;  2CKH B;  1RRB A;  4MSM B;  3AU4 A;  5D6J B;  3BIN A;  3CSF A;  1E8W A;  1WZ0 A;  4PS3 A;  2KAN A;  3ZO5 B;  5JHA A;  2GOW A;  2JF5 A;  2RSU A;  3NS8 A;  3PPA A;  4WJN A;  1EF5 A;  3NZU A;  4HPL B;  1E5W A;  1P0R A;  2NPT B;  5KHO A;  3UF8 A;  1D3Z A;  4GMV A;  4DHZ E;  3N32 A;  1S1Q B;  2BYV E;  4KVG B;  1LXD A;  4DHZ B;  1XQQ A;  4BOZ B;  1V9J A;  2D11 A;  1R4N I;  2MQJ A;  4NJ6 A;  3DBR I;  4FA6 A;  2NBV B;  4I6N B;  1TBE A;  3RCZ A;  1YX5 B;  3VHT C;  2K8H A;  1UBQ A;  2WYQ A;  4HDO A;  2KJ6 A;  4IWQ A;  2DZM A;  1WGH A;  2PEA A;  5E6P A;  2KLC A;  1GUA B;  4W9F A;  4WJQ A;  1YQB A;  2KO3 A;  3IBE A;  2BKR B;  2IZV B;  2LZ6 A;  2I1J A;  3SU8 X;  2NS5 A;  5DPW A;  3V6E B;  1AAR A;  4X57 B;  4HXD A;  3ALB A;  2V4L A;  4WAA A;  2GMI C;  1MG8 A;  2KMC A;  2DZK A;  2JVC A;  3VUY A;  1E8X A;  2O6V A;  2C5L C;  4W9D A;  4RM8 A;  2A5U A;  2RPQ A;  2BPS A;  3DDC B;  3IG3 A;  1WXM A;  1WXS A;  2J0J A;  4NAW A;  2NBW B;  3VFK A;  4MJS B;  3PRM B;  2WX0 A;  2MX2 A;  4GOC A;  1V86 A;  1XD3 B;  1M94 A;  4IM0 A;  4PYZ A;  3ZLZ A;  2MA9 B;  4BOS C;  1V6E A;  3EHV A;  3ZVV A;  2ZPY A;  4J6I A;  2RR9 A;  2LD9 A;  4AUQ C;  3ZTD A;  3HHM A;  2ZCB A;  2CHX A;  3M95 A;  3ONS A;  3RD2 A;  3X23 A;  3ZIM A;  1IYF A;  4FLH A;  5CTR C;  4G3X B;  4HVB A;  4ANX A;  3JSV B;  3RZW C;  3MJW A;  3DVG Y;  2L3Z A;  3ZDM C;  2JPH A;  4ANW A;  3WIM A;  4KIK B;  4DWF A;  4MM3 A;  2N1W A;  4MGZ E;  1Z5S B;  1Q0W B;  2D2Q A;  4BFR A;  1WMH A;  3U8Z A;  1Y8R C;  2KFJ A;  4E3C A;  3WAM A;  4DHJ B;  2KDB A;  2KNB A;  3L10 B;  3ECI A;  2KFK B;  2AEH A;  2WWZ A;  4IC7 B;  5DCN A;  4EZK A;  1OEY A;  1T0Y A;  1WH3 A;  2LAS A;  2MCN B;  2KK8 A;  2BGF A;  1WJ6 A;  3B1L X;  2ZCC A;  2G45 B;  1F9J A;  2KDF B;  2Z59 B;  3BY4 B;  3RT3 B;  3KYD D;  2C9W B;  3KUZ A;  2JUO A;  4KV2 A;  2NCN A;  1P98 A;  1U4A A;  3A1Q A;  1WGG A;  3UGB B;  3PHW B;  3A9K B;  2LXC A;  2W9N A;  2R2O A;  2KVR A;  3PLV A;  1LQB A;  2I1K A;  3DQV A;  4GDK A;  2IBI B;  1J19 A;  2DYM A;  2C7N B;  2K8C A;  2LGD A;  3APC A;  2B3A A;  3QJZ A;  4LDT B;  3VTU A;  2JRI B;  4NQL B;  3L17 A;  2LRW A;  4IM3 A;  4HJK A;  4DDG D;  3H7P A;  4K7W A;  1WY8 A;  2C7H A;  2IO0 B;  3EFU A;  2KXJ A;  2KDI A;  3WA0 A;  1S3S G;  2LRU A;  2L00 B;  3ZRF A;  2G4D B;  4IG7 B;  3TJP A;  2K6D B;  4B95 A;  4EEW A;  4OVU A;  4EUT A;  3H7S A;  4IM2 A;  1X1M A;  3QC8 B;  2NPT A;  4HLE A;  2MLB A;  2KX3 A;  3VUX A;  1XT9 B;  1Q5W B;  5AZF A;  2ZEQ A;  1C3T A;  4XX5 A;  1EF1 A;  3V61 A;  1WR1 A;  2DX5 B;  2KOX A;  3JYU A;  2D3G A;  2BYE A;  2RGF A;  2AL6 A;  2N7D A;  4ANV A;  3QQ8 B;  4ZDV A;  2FNJ B;  2N7E A;  1GG3 A;  3QAQ A;  1CMX B;  2M8S A;  3SDL C;  2HTH A;  3HIZ A;  1WYW B;  1V81 A;  1WFY A;  2MP2 B;  3N3K B;  4I6P A;  4DHJ D;  3JVZ X;  4FHK A;  2V3S A;  3ZW3 A;  1E8Y A;  4N9F 4;  2N9X A;  2G4S A;  2AYO B;  5J17 A;  2IY0 B;  4WJO A;  2KJR A;  2ZVN A;  4MGY E;  4DBG A;  4W9I A;  4FBJ B;  2CS4 A;  5DPT A;  2DZJ A;  4K7S A;  1OEY J;  3R3M A;  4JGH B;  1WX9 A;  2PPH A;  2JWZ A;  3AU5 A;  3GOE A;  3PVL A;  2N1V A;  3PSE B;  5G2N A;  3VTV A;  2MSE D;  1K8R B;  3KUC B;  1SE9 A;  4KZC A;  2AL3 A;  2MBE A;  4HDQ A;  5IA7 A;  1WR6 E;  2KN5 A;  4WJP A;  1V2Y A;  4HPM B;  4NJ7 A;  2DYB A;  2DYO A;  2LXA A;  3KW5 B;  3ZRC A;  2NR2 A;  3K9P B;  2QHO A;  1G6J A;  2DEN B;  2XEW A;  3QAR A;  2ZPN A;  2L05 A;  3JSV A;  3W1Y A;  3RZF A;  1ISN A;  1WM2 A;  3GZN I;  4FJY A;  2Y5B B;  3DBL I;  2WDT B;  2C60 A;  4JQW C;  2V1Y A;  3LDZ E;  1C1Y B;  2L7R A;  3A9J B;  1J8C A;  2FCM A;  3KUD B;  2GBJ A;  2JXX A;  1WIA A;  3O65 B;  4XC2 A;  1J0G A;  2HE7 A;  5E6O A;  3VTW A;  4ZRI A;  1L2N A;  1WE7 A;  5G55 A;  3VXW A;  4W9E A;  3U7D A;  3ZNZ B;  3ZTC A;  2C7M B;  2OOB B;  3KVF B;  4DDI D;  4BKT A;  3RUI B;  2FAZ A;  2JRH A;  3PRZ A;  3OJ3 A;  3VH3 B;  5DPR A;  3T9L A;  2JZZ A;  3A1Q B;  2D10 A;  5DPS A;  1P1A A;  1QZE A;  3MTN B;  3A9K A;  3M63 B;  3QHT A;  2FID A;  2IO3 B;  3APD A;  2BYF A;  5JHB A;  2KDE B;  3MHS D;  2MBO A;  3VAW A;  3R7Q A;  4G50 A;  3B0A A;  1YJ1 A;  4GGQ A;  3L16 A;  1IP9 A;  3B08 A;  2K39 A;  3X0W A;  2L0F A;  4B9K A;  4HWI B;  3V62 A;  1WI0 A;  3H7P B;  3PRP B;  4BBN C;  1WJN A;  1UGM A;  3A4R A;  3DPD A;  4EKU A;  2FIF A;  2N9P C;  3H9D A;  4MEM A;  2J0M A;  4K7U A;  3KYC D;  3VUW A;  4ZRK A;  3R7R A;  2LUE A;  3VQI A;  1GJZ A;  2BF8 B;  4KSK C;  1WJU A;  2ZVO A;  3S2A A;  3ZDT A;  3PZD A;  4FHJ A;  4IWP A;  2LWP A;  4B6W A;  1WJ4 A;  3ML8 A;  2ZZP B;  3PS6 A;  4M8N A;  2M0X A;  4YL8 A;  4MEL A;  2JT4 B;  4ICU A;  1UH6 A;  3DVN V;  4NNJ B;  3HK0 A;  1I42 A;  1P9D U;  2KD0 A;  1E90 A;  4NY0 A;  4RM9 A;  3IFW B;  4ICV A;  1WGY A;  1WGR A;  4JL9 A;  5IAA C;  5E6N A;  3L0W B;  3NZS A;  3P2B A;  5CX3 A;  1OTR B;  2MP2 A;  1NBF C;  4FJZ A;  3HM6 X;  2WX1 A;  4M8M A;  3ZNG C;  4DK5 A;  3Q3J A;  1UEL A;  4URK A;  2L0T A;  2KWU B;  2O2V B;  3PHX B;  4IWO A;  1UD7 A;  2G3Q B;  4MH0 E;  5L95 C;  2L76 A;  1KOT A;  4FAD A;  2O6V D;  4K1R B;  3TBL D;  4EZL A;  1R4M I;  3L54 A;  1E7V A;  1ZW7 A;  3L13 A;  3AXC A;  2KQ7 A;  4PYU A;  2OJR A;  4GSW A;  2CU1 A;  1FXT B;  1GC7 A;  4EOY A;  1PQS A;  3AUL A;  1SGH A;  2IO2 B;  3WAN A;  2JY6 A;  4MGK E;  2Z0D B;  1L7Y A;  2LGX A;  4GU2 A;  4K81 A;  4WQO B;  4W9J A;  5LLI A;  5D7G A;  3K9O B;  1WXV A;  5AZG A;  4GDL A;  1LM8 B;  2UWQ A;  2M4N A;  3EEC A;  4ASW C;  2XK5 B;  3D32 A;  1P3Q U;  5D94 A;  2ZNV B;  5CHF A;  4ZYN A;  3U30 A;  5J18 A;  5C23 A;  1WE6 A;  1V5T A;  3PT2 B;  5FR6 A;  4JLC A;  4KDI C;  1ZGU B;  4CHK A;  3APF A;  3A9J A;  4FN2 A;  3SHQ A;  1KJT A;  4A20 A;  1HE8 A;  3CST A;  3IHP C;  3IVF A;  4P7I A;  4NQK E;  1KM7 A;  4EFO A;  2BKF A;  2ZNV C;  3A33 B;  4HCP B;  4W9H A;  1GC6 A;  3CF6 E;  2DAF A;  1Q1O A;  4F8C B;  2MWS B;  2DAJ A;  3QIJ A;  4KZ0 A;  4E74 A;  2EMT A;  1WM3 A;  4LJP B;  3OAW A;  3L08 A;  4G0N B;  3PLU A;  4WWO A;  1WXA A;  4W9L A;  2GBK A;  2XBB C;  2DHZ A;  3DBH I;  5C1Z A;  3QCA A;  4MSQ B;  2HD5 B;  4AOF A;  3ML9 A;  3V60 A;  2NVU I;  3NY5 A;  3NHE B;  3WAO A;  4HCN B;  4EZJ A;  3W1S A;  3UIO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...