3V60A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
b'PETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v60A00
4M8MA 2GBJA 3ZRCA 1D3ZA 4BBNF 4FJVB 2D10A 3L10B 1YIWA 1UELA 1WMHB 4GIVA 2LI5A 2EMTA 3K9OB 5HKHA 1IPGA 2ZVOA 1E7VA 3QARA 4FHJA 4NNJB 5D94A 3RZFA 4LDTD 4CHKA 2KZRA 3QQ8B 4HLEA 2IO3B 4G50A 1WGHA 2L8JA 1E8YA 3CF6E 4JGHB 2JPHA 2KDBA 2LD9A 4EUTA 2UYZB 3DQVA 2K6DB 3ZVVA 3ZW3A 2C5LC 2MP2B 2O6VD 4MM3A 2DYBA 4AJWA 2FCSA 3IHPC 4MJSA 1WX7A 2MBBB 3NZSA 2OOBB 4IM2A 4BBNC 1GUAB 2V3SA 1SGHA 3ZTDA 1PQSA 1KLVA 4M8NA 2KN5A 3R7QA 2KMCA 3MHSD 1T0YA 4W9HA 1WGDA 3A9JA 4EZLA 3ML9A 3PVLA 3LJ3A 3VHTC 2MX2A 2IZVB 2ZEQA 1WX8A 2J0KA 2EKEC 3NY5A 1WY8A 2WWZA 3PGEA 3QJZA 5E6PA 3L16A 3I3TB 1WE7A 2KDEB 4FBJB 4W9IA 2JZ3B 3H1UA 3VFKA 1WFYA 5J18A 2CHZA 3R66C 2CHXA 5C23A 1GG3A 2KWUB 2KKCA 2KFKA 1UBQA 2C9WB 2LRUA 4ANWA 2N9EB 3AXCA 2FUHB 3W1SA 2GBKA 3UIPB 4B95A 1M94A 4IW0A 1EF1A 1CMXB 1WF9A 2AL6A 2XK5B 4I6PA 2J0MA 3V61A 3S2AA 2HJ8A 1F9JA 2GOWA 4G11A 4HXDA 4XC2A 4MDKE 2KFKB 3PS6A 3UQBA 3L17A 1QZEA 2W9NA 3RCZA 2AL3A 2L3ZA 2LXCA 3PSEB 1NI2A 2IYDB 4XZ4A 1WGGA 2DYMA 4HPLB 1H4RA 1GJZA 4W9KA 4TQ0A 4NQLB 1E5WA 2MBEA 1Y8RC 4FN2A 4K7SA 4NQKE 3NS8A 1OEYA 2ZPNA 3MJWA 2KO3A 2JF5A 3HM3A 2KQSA 2LUEA 5FR6A 1GC6A 2NPTA 2EMSA 2N7DA 4FULA 2N9PC 2K8BA 2JRHA 1YX5B 2CHWA 2BPSA 2RPQA 4BOSC 1TTNA 1WRDB 2D2QA 3N30A 3QX1A 4GMVA 3WALA 2KJRA 2IO0B 5DPWA 1J19A 2LVOA 3VXWA 4BKSD 3VTVA 2FNJB 3ONSA 1GC7A 5JZEB 2KLCA 2O2VA 3VVWB 4KIKA 3OJ3A 3R7RA 4BOZB 4WQOB 2AEHA 2KTRA 2V4LA 3PPAA 1UGMA 3X23A 4W9EA 2YLMA 2D11A 4DDGD 1XT9B 5EDSA 3JSVB 5D7GA 4MGIE 1Z5SB 2A4ZA 2FAZA 4FA6A 3PZDA 1VD2A 2DX5B 2KX0A 3H7PA 2JRIB 4MGYE 2WX0A 3X0WA 3ZO5B 2YVCA 1UBIA 2N4FA 2ZNVB 5G55A 5L95C 3QA8A 2MA9B 3TJPA 2PEAA 4RMAA 3UINB 5KHQA 2LWPA 4ICVA 2K8CA 2LVQA 3MTNB 4IG7B 2K1FA 1WE6A 2BKRB 4W9GA 3KVFB 3M3JA 3UGBB 3GOEA 3KUDB 3R3MA 4GB9A 2Z59B 3A4SC 2KDIA 2DZIA 2REXA 3H6NA 4HK2A 4PS8A 2BYFA 4ZRIA 2PPHA 2KTFA 2OJRA 2DHZA 3A33B 3PRPB 2RD0A 4BKTA 1LFDA 1U4AA 2MLBA 5CX3A 1V86A 4W9LA 3TBLD 1V80A 2RGFA 3K9PB 4GSWA 3P2BA 1R4NI 1XD3B 2M0XA 5DPRA 3ZNHB 4EFOA 2PJHA 2NS5A 4PS7A 3VH4B 4OVUA 3H7SA 4MEMA 2KJ6A 4GGQA 4NAWA 1RFAA 2Y5BB 3WAPA 2L76A 4ZRKA 1WJ6A 2MQJA 2IO1B 3JW0X 3RZWC 4KSLC 2PE9A 4LJPB 3VUWA 1J0GA 4DK5A 2LGDA 3T9LA 2ZZPB 2N9XA 2JXXA 4G3XB 3V6EB 4WWOA 3JVZX 2N1WA 4GOCA 1WXVA 3DBRI 4HPMB 4ANUA 4DHJB 2BWFA 2Z0DB 4PS3A 1S1QB 3ZDMC 4IC7B 3PRZA 3EFUA 2J7QB 3ZNZB 1P1AA 4HDOA 2BKFA 3L08A 4KDIC 1NDDA 1V9JA 4MJSB 4BVUC 3HK0A 4FADA 5LXIB 4LJOB 2NCNA 4GDKA 3A1QA 2CR5A 2NR2A 4URKA 2O6VA 3KYDD 3DOWA 1TBEA 3A9JB 3QWZB 2KMAA 4II3B 2MBQA 2BYVE 2B3AA 2NVUI 3DVNU 3IFWB 2KQ7A 3N3KB 4ANVA 4ASWC 4AJYB 1KJTA 2AWTA 5CHVC 3HIZA 4K81A 2G4SA 2N1VA 2G45B 1V5TA 3DVGY 4DHZE 3H9DA 3L0WB 1I35A 1P3QU 1WJUA 3PV1A 4HJKA 2GBNA 4N9F4 5DCNA 3SDLC 3VUXA 4DWFA 5LXHA 3BY4B 2C7HA 2G3QB 3ZDTA 1WGRA 5LLIA 4IM3A 4EZJA 2IBIB 3EECA 1OTRB 3PT2B 4MH0E 4JIOU 1EF5A 1YJ1A 2ASQA 4NJ6A 2M8SA 3NOBA 4YL8A 1H8CA 2ZVNA 1P0RA 2C7MB 4KVGB 3NHEB 2KC1A 2KVRA 2MBOA 3QHTA 2DZMA 3EC8A 4CYEA 4W9FA 1WM3A 2BYEA 4MSMB 3PTFC 4MGZE 2D07B 2BGFA 4JQWC 2WDTB 4FLHA 2PE6B 4GU2A 5TR5A 4E3CA 1G6JA 4K1RB 1Q1OA 3ZNID 3IBEA 1TGZB 3TCAA 3TL5A 4JL9A 3V60A 2QHOA 4NPNA 2DYOA 1WXSA 2L00B 2Z0EB 3D32A 2A5UA 4HCNB 4K7WA 4KSKC 1X1MA 4HDQA 5BO4B 2LVPA 2KX3A 3B0AA 3HM6X 3N32A 4WAAA 4B9KA 4F8CB 3QCAA 2ZNVC 2L0FA 2L0TA 5J17A 2KJHB 2NPTB 2ZCBA 3KUZA 2M4NA 3QAQA 3ZIMA 2D3GA 2K6QA 3C0RB 3B1LX 3M62B 1A5RA 5JH5C 5CTRC 1XQQA 1ZW7A 3ALBA 3U30A 3IVFA 4MSQB 1V49A 1KOTA 3PLVA 1LXDA 1ISNA 1TZ1A 3VUYA 4A3OA 4EKUA 2O2VB 4KIKB 1Q5WB 2VRRB 4TUUA 4ANXA 2KTRB 1NBFC 1V5OA 2FIFA 3KUCB 1SE9A 4IWPA 2CU1A 2L7RA 1S3SG 1RLFA 4PYUA 4BKSA 4HVBA 2DAFA 1LM8B 1ZGUB 3PRMB 4JLCA 4KDLB 4XX5A 2HD5B 2RR9A 5C1ZA 3H7PB 3ZKJC 3OLMD 4TV3A 4WJQA 1WXMA 3UIOB 3WAOA 4EOYA 5JHAA 5J2RA 4X57B 4GDLA 4WJPA 1C3TA 4OVVA 1WMHA 1YQBA 2CKHB 3L13A 3GZNI 4NJ7A 5DPSA 4DHJD 5IA7A 1IP9A 1V81A 3U7DA 4DBGA 4EZKA 4AUQC 1WH3A 1WJ4A 1WZ3A 3AU4A 2KXJA 3CMMB 3DPDA 2KD0A 1GNUA 1E90A 1V2YA 3CSFA 4GDLB 2DENB 4IWOA 4AP4C 2MP2A 2ZCCA 3HHMA 4WJNA 3APCA 5AZGA 3SHQA 1KM7A 3VTUA 3PHXB 3DBSA 4NAWB 1WIAA 5E6OA 1E8ZA 3AI5A 3IG3A 2C60A 4GXBA 3V62A 3CSTA 4WJOA 4B6WA 3KW5B 1RAXA 1UD7A 2MRPA 2FIDA 2KC2A 1E8XA 5E6NA 2KWCA 4PYZA 1J8CA 2KLGA 2K39A 2JUOA 4DDID 2L05A 1WYWB 1E8WA 1WZ0A 2JVCA 1WJNA 4KZCA 1WGYA 3QIJA 1SIFA 2NBWB 3VAWA 4TKNA 5AZFA 2HTHA 4GN1A 1V6EA 2LZ6A 4W9CA 3LDZE 3RULA 4HWIB 1P98A 4W9JA 4WWNA 3L54A 4LDTB 3W1SC 5KHOA 4IM0A 2LGXA 3DBLI 5CHWA 2R2QA 3NZUA 2BF8B 4DHZB 5AZHA 4EEWA 3VH3B 3AULA 4GDKB 1OEYJ 3A1QB 4AWJA 1JRUA 2O6VB 3SU8X 5IAAC 3ZRFA 2XK5A 4KV2A 2IO2B 3WA0A 2MBHA 1EO6A 3Q3FA 2GBMA 1YD8U 3B08A 1WR6E 3AU5A 2KNBA 2DZKA 3RD2A 4I6NB 2IY0B 4FJYA 3KYCD 2LRWA 3V6CB 3VQIA 1IYFA 4WWPA 1OQYA 2JY6A 2LJ5A 3W1YA 3UQAA 1P9DU 3SD5A 1LQBA 3VDZA 2WYQA 2XBBC 4MGKE 1WM2A 3OJ4B 2MWSB 5D6JB 3APDA 3BINA 1C1YB 2N7EA 4M0WB 3ZTCA 1RRBA 2MCNB 4ZDVA 3KH0A 4FHKA 4A20A 3DCGA 2LXAA 2JZZA 3ML8A 2R2OA 3DVGX 4J6IA 4KZ0A 1UH6A 2AYOB 3M63B 4MELA 4E71A 3PLUA 2C7NB 4TQ1A 1WR1A 3Q3JA 4RM9A 1L2NA 2KHWB 4NY0A 3DDCB 4HCPB 2KOXA 2M1MA 3ECIA 2KWVB 3APFA 4BFRA 3ZUNA 2LASA 1OGWA 3PREA 3T8MA 4CO7A 2FCMA 5CHFA 1Z2MA 5DPTA 3A4RA 2CS4A 2M17A 1Q0WB 1UZXB 4A3PA 2I1JA 2KFJA 4I6LB 3VTWA 2FCNA 1R4MI 3QC8B 2MSED 4AOFA 4G0NB 2WX1A 3ZLZA 2UWQA 3JSVA 2JWZA 1WI0A 2GMIC 2MW5A 1WXAA 1FXTB 3PHWB 2KANA 1YX6B 4BKGA 2GBRA 3RUIB 4K7UA 2KDFB 3RYTA 1AARA 5AEKB 2BWES 3WANA 3A9KA 4FJZA 1I42A 1MG8A 2V1YA 3ZNGC 4F7ZA 3EHVA 1L7YA 1ZKHA 2ZPYA 4IUMB 4W9DA 1HE8A 4ZRJA 5G2NA 3WAMA 4E74A 5JHBA 3U8ZA 3ENEA 2IY1B 3TIXA 2DAJA 2K8HA 2RSUA 3DVNV 4ICUA 4II2B 3DBHI 3TMPB 1K8RB 3RT3B 2G4DB 3O65B 4P7IA 2K25A 1BT0A 1E7UA 2KK8A 2JT4B 3M95A 1WX9A 5GMVA 2XEWA 2HE7A 2ZJDA 3A9KB 3OAWA 3QK0A 2FCQA 4F1SA 4DXAB 4ZYNA 3WIMA 3UF8A 2LGYA 5L83A 2J0JA 4IWQA 4RM8A 2DZJA 1EUVB 1VCBA 2NBVB 3JYUA 4LCDE 5D2MB 2NBUA 2I1KA
chains in the Genus database with same CATH superfamily
3WCQA 1D3ZA 4BBNF 3L10B 1SSNA 1F52A 1UELA 2BB6A 1WMHB 2LI5A 1E7VA 1YN4A 3AECB 5D94A 1B1ZA 3QQ8B 2J52A 2RPVA 3DQVA 4MM3A 2DYBA 1FXIA 2OEDA 4MJSA 3DWGC 4BBNC 1GUAB 2V3SA 1PQSA 3Q8CA 2SEBD 1T0YA 3A9JA 3VR9B 1SEBD 3PVLA 1WY8A 3PGEA 4LTUA 1FD6A 2BB5A 1WFYA 3R66C 2CHXA 2BW2A 1J7CA 1ENFA 2C9WB 2JWUA 3AXCA 2KQ4X 1JMLA 1L0XB 3AN1A 4C00A 1QF6A 1WF9A 1D6EC 3RI7C 1QZEA 2L3ZA 3PSEB 5T8IA 4XZ4A 1N61A 1QOGA 4TQ0A 1ZDVA 2MBEA 1ZXIA 2KDMA 3MJWA 3NRZA 3ZXRA 4RGMA 4FULA 2BPSA 1TTNA 1GAQB 3N30A 1J7AA 4XDCA 2FNJB 4N58A 2BT6A 3OJ3A 3HUIA 3R7RA 4WAFA 2LEKA 2WU5B 1XT9B 4MGIE 2JU6X 2M0AA 3PZDA 3ZO5B 2RDHA 4ARCA 3ETRA 1JWSD 2MA9B 4RMAA 4YWGG 2LWPA 4ICVA 4P1BC 2L32A 4IG7B 2MEKA 1WE6A 2ACZB 4W9GA 2D5GA 3R3MA 3OWEB 3ZJVA 2PPHA 1D5ZC 2Y5PA 2DHZA 4BKTA 2MLBA 1F2RI 2LUMA 1F2RC 1FNUA 3GE8C 3P2BA 4GSWA 5DPRA 4PS7A 3B2FA 4C56C 3AE8B 2WGSA 4ZRKA 3PZ8A 3RZWC 2PE9A 5EE1A 2N9XA 2JXXA 2N1WA 2AX5A 4HPMB 4DHJB 2Z0DB 1S1QB 2BVCA 4OZCA 1C78A 4PT5A 1JWUD 1P1AA 4FADA 1OFFA 4DXFA 1I4QA 2KN4A 2NCNA 3A1QA 5HHDG 1D5XC 2O6VA 2N9LA 3DOWA 3KYDD 3FAHA 1TBEA 4A9AA 1AWDA 1HTOA 2AWTA 3HIZA 1TS4A 2G45B 3N1ZC 2NTSA 4HJKA 2GBNA 2WXJA 1JCKB 4DWFA 3NG0A 2C7HA 1WGRA 4Q2JA 1PGAA 2IBIB 3PT2B 4HPPA 2K5PA 2M8SA 4YL8A 2ZVNA 3NUHB 1P0RA 3IXSA 2C7MB 2MHJA 1L6UA 2BYEA 4MGZE 4YXDB 2SAKA 2VZKD 5HG2A 2WP9B 4A55A 3E9SA 4E3CA 5TR5A 3NZ3A 2KVZA 4K1RB 4M02A 1Q1OA 3TL5A 3V60A 2DYOA 1WXSA 1I4PA 3D32A 4HCNB 5IO9A 4LLGM 2KX3A 3B0AA 3N32A 4WAAA 4ZHOA 2WU2B 3MP9A 3QCAA 2L0FA 4USAA 2ZCBA 2M4NA 3QAQA 3C0RB 2EELA 3ZYYX 3FILB 1XQQA 1ZW7A 2INCC 1LXDA 2FE8A 1E7PB 5E6JA 4YTPB 2KTRB 4KKJA 1PGBA 3KUCB 1S3SG 1RLFA 3MC0B 4BKSA 1R4MB 1FRRA 3PRMB 5C1ZA 3UIOB 1XLNA 4C80A 1HA5A 1TY2A 1WMHA 2CKHB 4NJ7A 4IKGA 1N6ZA 3I5JC 1YQ4B 4AUQC 2YEPB 2KXJA 3CMMB 3DPDA 5AUIA 4ITKA 1N5WA 1JROA 1NENB 1HZ5A 3GS2A 3EUB2 2JYTA 4REZA 4IWOA 4AP4C 2XN9C 3HHMA 4WJNA 3APCA 3IAS1 2DBYA 2V9HA 1E8ZA 1LO5D 3V62A 1KRHA 1RAXA 1E8XA 2Q5WD 1J8CA 2L05A 2BS4B 3ZXVA 2LGSA 3QIJA 3VAWA 2LZ6A 3NS1A 1WGKA 4LK0M 1P98A 1KLUD 5KHOA 4OHJA 5CHWA 3NZUA 3VH3B 4GDKB 5AUKA 4L2YA 4AWJA 3BVGA 1RFKA 2L83A 3ZRFA 3SEBA 2WXOA 2IO2B 3WA0A 2GRIA 2G9HD 4BZAA 3DBRB 3RD2A 4I6NB 3U4EG 4HRSA 3VQIA 4WWPA 3SD5A 3RNBC 3T3OA 2WYQA 2QMTA 1BUIC 3BINA 3Q8FA 2N7EA 3ZTCA 2LXAA 2JZZA 3FKYA 2HJ1A 4J6IA 4KZ0A 1WWTA 1WR1A 3Q3JA 2V4IB 5MPOA 3MC8A 1L2NA 2KHWB 4NY0A 1T0SC 3APFA 1KFYB 3ZUNA 2LASA 1C79A 5CHFA 1Z2MA 3A4RA 3Q3OC 2VH1A 1UZXB 2KFJA 4I6LB 4JWSC 3VTWA 1R4MI 2J42A 3QC8B 4G0NB 4RH6A 2UWQA 2MW5A 3AB5A 1FXTB 2H88B 2KANA 5AEKB 3WANA 3A9KA 1E10A 4F7ZA 4E74A 3EGRA 2IY1B 2DAJA 4OZAA 1NYRA 5GMVA 2HE7A 2B76B 4F1SA 3Q3MC 3UF8A 2IJ0A 2J0JA 1CJEA 4RM8A 1RYJA 2WDQB 1VCBA 2J53A 2QILA 2GBJA 4RGTA 3K9OB 3VRBB 3ZQ4A 4P1CC 2ZVOA 2AQ1B 4LDTD 3SR6A 3Q8AA 4HLEA 2IO3B 4G50A 1QKZA 3CF6E 1TS2A 2RDBC 4EUTA 2UYZB 3ZVVA 4CQNA 2C5LC 3ABVB 3IHPC 4OVZA 1WX7A 3NZSA 3R8BA 2OOBB 4IM2A 3GZNB 2INDC 4ZOHC 1KLVA 3R7QA 2KMCA 4JE3B 4W9HA 1WGDA 1EWCA 4EZLA 3BWUD 3ML9A 2PTLA 2IZVB 2IGDA 1WX8A 2J0KA 2EKEC 3L16A 3RFZB 3ZJTA 1ACCA 3VFKA 5J18A 2KKCA 2KFKA 1UBQA 1WSPA 4UDUC 1FM0D 3MC9A 2GBKA 1EF1A 2AL6A 1IGCA 1D4BA 4HXDA 2PKOA 4XC2A 4MDKE 3PS6A 4JPSA 3UQBA 2PMVA 2W9NA 4S0RA 3RCZA 4RGOS 2AL3A 3BK1A 2LFIA 3BYTB 1NI2A 1N5XA 1PFDA 2DYMA 2ICIA 4HPLB 1GJZA 3W5UB 1CK1A 4NQLB 2GI9A 1E5WA 5IN7A 2W82A 4NQKE 2ZPNA 2KO3A 3HM3A 1K51A 2N9PC 2K8BA 2JSVX 1GPXA 3BIID 1C4AA 1XO3A 2D2QA 3FILA 2K0PA 2IO0B 1J19A 3VXWA 2I38A 3NVYA 2WXQA 3I9V1 1FFUA 5JZEB 2KLCA 3HRDD 2KTRA 3PPAA 3X23A 1UGMA 4W9EA 2YLMA 5H92C 5FKAC 1EWYC 2A4ZA 1ZPSA 2FAZA 1FMAD 3GB1A 4FA6A 3ZJUA 1VD2A 4MGYE 2YVCA 1UBIA 2ZNVB 1MHHE 3UINB 3MTNB 3KVFB 3M3JA 3KUDB 1N63A 2Z59B 2V3PA 4ZRIA 1DGJA 3H6NA 1K53A 4HK2A 4PS8A 2KTFA 2OJRA 3PRPB 1U4AA 5CX3A 4W9LA 4XGAB 2JX5A 1R4NI 1VDVA 2M0XA 3ZNHB 1L5PA 2PJHA 2NS5A 3H7SA 4C7ZA 4GGQA 1RFAA 2Y5BB 3WAPA 1YN3A 3RNGC 2MQJA 2IO1B 3VUWA 2L52A 5BMGA 3V6EB 4G3XB 2K3UA 3JVZX 4GOCA 4ANUA 1SF0A 2PVGC 2JYEA 3N1YC 1PGXA 3EFUA 3PO0A 4HDOA 2BKFA 3L08A 1NDDA 2UU7A 3HK0A 4GDKA 2CR5A 4JWUC 2NR2A 5IOIA 4II3B 2WDVB 4NJCA 2MBQA 5BYSA 2BYVE 1HEZE 2NVUI 1QQRA 2RDGA 2KQ7A 1KJTA 1UF0A 2BS2B 4J3OD 2M56B 4K81A 4RFBA 2DWQA 4K3BA 2WHIA 3DVGY 1DOXA 1WJUA 4B0EA 1VZ8A 3PV1A 4N9F4 3BY4B 2NTTA 4EZJA 4KGRA 1OTRB 1V1OA 4MH0E 3NOBA 1V8CA 3LYYA 4KVGB 1P7EA 2KC1A 3QHTA 2MBOA 4CYEA 1ZOYB 1B9RA 2D07B 2WDTB 3KWVA 2PE6B 4GU2A 1G6JA 2WXLA 4ZHPA 3CIRB 1JWBD 4NPNA 1T0QC 2Z0EB 2ZNVC 2L0TA 2NPTB 4IOIE 3KUZA 2M19A 2WXRA 2D3GA 3M62B 4S17A 3U30A 3W5VB 3IVFA 4MSQB 1DOIA 4KIKB 4ANXA 4N6EB 1NBFC 1JALA 3MJ5A 4PYUA 4HVBA 3UI3A 2X38A 1FFVA 3E56A 1ZGUB 4KKIA 1KF6B 2HD5B 2RR9A 3ZKJC 4TV3A 4X57B 4WJPA 3L13A 5IA7A 4MACA 5EE0A 1V81A 1L4ZB 1FCCC 1WH3A 3V3XA 1XXGA 1PDXA 1E90A 1JQ4A 2V3NA 1VRAB 3CSFA 4GDLB 3AE1B 4KGSA 5HFYA 2N0SB 3VTUA 3PHXB 3DBSA 4NAWB 2WQYB 3AI5A 4KGTA 2KMMA 3CSTA 4B6WA 4ARIA 2FIDA 2KC2A 3AE9B 4PYZA 1TYGB 2K39A 1E8WA 1RWSA 1ROEA 1WGYA 2NBWB 2HTHA 4GN1A 3AE3B 4RF0A 4WWNA 3L54A 3V05A 3W1SC 4C4VB 2HTME 5BMHA 5AZHA 3I63C 2N9KA 2MBHA 1EO6A 3Q3FA 5EE9A 3B08A 1WR6E 3B9JA 1EU3A 1TS3A 3V6CB 1PUTA 2WXPA 5LNK1 2LGIA 1IYFA 1OQYA 2WDRB 3C19A 2JY6A 1V97A 1A70A 4ACFA 1HXYD 5D6JB 3OJ4B 4P16A 3RNAC 2MCNB 4ZDVA 4A20A 2R2OA 1ZUD2 3PLUA 3RPFC 2AQ2B 3DDCB 2KOXA 3ECIA 1JW9D 1VZ7A 1XEEA 1BMLC 3U52E 3BVZA 2M17A 2I1JA 4YSXB 1J7BA 4A90A 2MSED 2BBCA 1UGJA 2WX1A 3L4PA 1TS5A 2JWZA 3PHWB 2GMIC 1WXAA 3RUIB 4K7UA 2KDFB 2D3BA 2BWES 2PLPA 4YT0B 4FJZA 3ZNGC 1L7YA 3N9YC 4IUMB 5G2NA 1HZ6A 3IT6B 3U8ZA 3ENEA 4HKZE 5G5HA 3TIXA 2K8HA 4ICUA 2RSUA 1EM7A 3RT3B 2K25A 2KK8A 1E7UA 1SB3C 1T3QA 4PK1A 1MHXA 1TZOA 2ZJDA 3QK0A 2FCQA 1XLPA 2LGYA 1K50A 2MJEA 1JWAD 2DZJA 5D2MB 1Q10A 2I1KA 2FBWB 4M8MA 2QDFA 3N20C 2D10A 3AMZA 4BAXA 1E9MA 1K52A 1R7SA 1FRDA 4FHJA 2CJOA 3RZFA 4CHKA 2KZRA 1SE4A 1WGHA 2LMCA 2JPHA 2WS3B 3CWIA 1C4CA 2MP2B 2O6VD 4AJWA 2FCSA 2MBBB 3ZTDA 4L1BA 1UWXA 2ZW1A 3MHSD 2QCZA 4L23A 3NY5A 1SE3A 1ET9A 3QJZA 1I4HA 1WE7A 2KDEB 3H1UA 2CHZA 1PYWD 1FCLA 2LRUA 4WH4A 2FUHB 3W1SA 4WQMA 1CMXB 3GP7A 3V61A 2QJLA 1E6EB 1F9JA 2GOWA 1N62A 4JX1C 2QEJC 1WGGA 3DBLB 1QILA 1TIFA 1Y8RC 4K7SA 1GOZA 2MJ3A 2YEPF 3MFGA 5D3IB 3W9CB 2LUEA 1N60A 1GC6A 2NPTA 2N7DA 4XWTA 2JRHA 1YX5B 4BOSC 2RPQA 5IP4D 1WRDB 3QX1A 4TSSA 3SFEB 2KJRA 3HVDA 2XNAC 2LVOA 4BKSD 4B0MA 3ONSA 1RM6C 5C2TB 3P4QB 2WXFA 2JQRB 4KIKA 4WQOB 2AEHA 2DNFA 4DDGD 1NI3A 2VZKB 5EDSA 1Z5SB 4KX6B 3R2TA 2DX5B 2KX0A 5G55A 4QAYA 1WRIA 3QA8A 3TJPA 1UWMA 5KHQA 2K8CA 4D2KA 2BKRB 4NZLB 3AM9A 1WXQA 1SE2A 2KDIA 2REXA 2BYFA 4RNAA 3Q6BA 2OJWA 3AE5B 2RD0A 1LFDA 1V86A 1V80A 4EFOA 1XD3B 4XYCA 4OVUA 1TKYA 4MEMA 2KJ6A 2PW9A 3O13A 4NAWA 3VR8B 2L76A 3DBHB 4ZRPA 1WJ6A 1KH0A 1STEA 1UUPA 4KSLC 4DK5A 1MFWA 3NJTA 2ZZPB 3R2IA 2LJIA 1WXVA 3DBRI 3ZDMC 3NVWA 2J7QB 4K3CA 4KDIC 4NAMA 4YTNB 1CZPA 2BS3B 4C4VA 1Y56A 4LJOB 1SXTA 5IKCM 3QWZB 1TJEA 1XLQA 2LHEA 1ZE3D 3N3KB 4ANVA 4ASWC 1XCTL 1I35A 3L0WB 5DCNA 3VUXA 5LXHA 2G3QB 5LLIA 4IM3A 2PVOD 3EECA 4JIOU 1EF5A 1YJ1A 2ASQA 4NJ6A 1T0RC 2HDEA 1C77A 3TUOA 4WURA 2D3AA 4JQWC 4FLHA 1QOBA 3KLSX 1ESFA 3IBEA 3TCAA 4K7WA 2V0GA 2A5UA 3AE6B 2MJDA 3Q3NC 4HDQA 1T6BX 2KJHB 2ZW0A 1YOVB 2ON8A 2NMQA 3ZIMA 3B1LX 2WNMA 5JH5C 5CTRC 3ALBA 1SJHD 1V49A 3AH7A 1ISNA 1TZ1A 3VUYA 1QT9A 2O2VB 2IDYA 1Q5WB 1C4PA 1V5OA 1OQRA 4IWPA 2CU1A 2AQ3B 2L7RA 3RNCC 3GE3C 3RNEC 1I4GA 1LM8B 4XX5A 1TKEA 3H7PB 3OLMD 4EOYA 1MPEA 5J2RA 1YN5A 3LXFA 1C3TA 1YQBA 4DHJD 3GZNI 5DPSA 3AV8A 3B2GA 1FXAA 2CJNA 1MI0A 3U7DA 2I2YA 2W54A 3KWLA 1F77A 3AU4A 1F1HA 1GNUA 2ONQA 2WLBA 3TEWA 2MP2A 2ZCCA 4WWMA 5GXGB 4AQ7A 1KM7A 4A8XC 2MH7A 4ZRQA 1HTQA 1WIAA 5E6OA 2WXHA 3IG3A 2C60A 4WJOA 3LB8C 1UD7A 2MRPA 5E6NA 2KWCA 1AN8A 2JUOA 2FUG1 4TKNA 5AZFA 1V6EA 4W9CA 3RULA 1VLBA 4HWIB 1KTKA 4LDTB 2LGXA 4YTMB 2BF8B 1MVKA 1BXTA 4LNFA 3AULA 1OEYJ 2TSSA 1JRUA 2KAJA 3SU8X 3AE2B 1YJJA 2X8XX 3P4SB 2GBMA 2KWDA 3AU5A 1NVID 1FEHA 2VH2A 2KNBA 2DZKA 2IY0B 3KYCD 2LRWA 1VR9A 2L1AA 1ZP0B 3UQAA 1P9DU 1LQBA 2XBBC 4LNOA 2MWSB 1C1YB 4M0WB 3TSSA 3KH0A 4FHKA 4MELA 4E71A 4DXGA 2BYTA 4TQ1A 2N7JA 3Q14C 2Y3AA 3PREA 4CO7A 1C76A 2FCMA 5DPTA 4ZYSA 3DHHC 1Q0WB 2WXNA 4HEA1 4A3PA 3ZLZA 1KLGD 3Q8EA 1TKGA 3W2DA 1WI0A 4BKGA 4WIPA 1FNWA 1I42A 1MG8A 2ZPYA 1ZKHA 4N59A 5JHBA 3P4PB 5FR3A 2Y5CA 3DVNV 4II2B 1IBXB 3TMPB 1M4VA 1QOFA 2G4DB 4P7IA 4RGNA 2JT4B 3HVZA 3M95A 3EFCA 3A9KB 4YSYB 3WIMA 3Q2AC 1IUEA 1I4RA 2KT7A 3JYUA 4LCDE 2NBVB 2Z8LA 2NBUA 3ZRCA 1SJED 4FJVB 1YIWA 4GIVA 2EMTA 5HKHA 1IPGA 4XDDA 3QARA 4NNJB 2L8JA 3P42A 1E8YA 4JGHB 2KDBA 2LD9A 2K6DB 3ZW3A 1OQQA 2GLSA 4HJGE 2E3TA 4O1NA 1SGHA 4M8NA 2KN5A 4MH8A 3LJ3A 1WYGA 3VHTC 2MX2A 5G5GA 1MG4A 2K22A 2ZEQA 5D3DA 5EE3A 3RNFC 3J9CA 2WWZA 5BMIA 5E6PA 2INNE 2R61A 3I3TB 4FBJB 2LHDA 4W9IA 2JZ3B 2QSDA 3IAM1 5C23A 1GG3A 2IGGA 2KWUB 3DWMA 3DHIC 1CQVA 1UNSA 4ANWA 2N9EB 4GLSC 4FXCA 3UIPB 1M94A 4B95A 4IW0A 1DOYA 2XK5B 4I6PA 2CU3A 2J0MA 3S2AA 1VZ6A 2HJ8A 3U7ZA 1P7FA 3P4RB 4G11A 1EU4A 2KFKB 3L17A 2LXCA 2EKIA 2IYDB 1YQ3B 3NVVA 1H4RA 4W9KA 4RF1A 4FN2A 3NS8A 3Q69A 1OEYA 1QOAA 3AEEB 2BTEA 2JF5A 2KQSA 2W3RA 5FR6A 3NVZA 4MT5A 2EMSA 4M00A 2CHWA 4GMVA 4RCOA 3WALA 1YJIA 5DPWA 1F0ZA 3VTVA 3AEGB 1GC7A 1SIJA 2O2VA 3VVWB 3EA6A 4BOZB 2V4LA 2PIAA 2D11A 3JSVB 5D7GA 3X0WA 3H7PA 2JRIB 2WX0A 2N4FA 5L95C 3N1XC 2DLBA 4OZBA 1JRPA 2PEAA 2LVQA 2K1FA 4YSZB 1TY0A 3UGBB 3GOEA 4GB9A 2WXKA 3A4SC 2DZIA 3Q8BA 1XCQL 2H89B 1ET6A 3A33B 4DQOC 1V1PB 3TBLD 5TSSA 2RGFA 3K9PB 1FIQA 3C8YA 3AEFB 3VH4B 1MJDA 4US8A 2WXIA 2KYWA 3JW0X 3BYYB 4LJPB 2J4XA 1J0GA 2LGDA 3T9LA 5JXVA 1IGDA 4WWOA 2BWFA 4PS3A 3AEBB 1FPYA 4IC7B 3PRZA 4MM3B 4C7YA 3ZNZB 4HROA 4MJSB 1V9JA 4BVUC 2WXGA 5LXIB 4IDIA 3AEDB 1SBBB 1C9FA 4URKA 2BQQA 3A9JB 3TEXA 2KMAA 3RN9C 3P63A 1GB4A 3AE4B 2B3AA 1I7HA 3DVNU 3IFWB 3AEAB 4AJYB 5BYRA 5CHVC 2G4SA 1T5XD 2N1VA 4DHZE 1V5TA 3H9DA 1P3QU 4OW0A 1FO4A 3OG5A 4M0WA 3SDLC 1YNTE 3ZDTA 3URYA 4H2AA 1H8CA 1LGRA 1QLBB 3NHEB 2KVRA 4M01A 2DZMA 3EC8A 4W9FA 1WM3A 4MSMB 2OHFA 3PTFC 3I57A 2BGFA 1NEKB 5I4DA 1VJKA 3ZNID 4XWWA 2G1EA 1TGZB 4JL9A 3AE7B 2QHOA 2QC8A 4TMAB 2L00B 1XLOA 4EE2A 4KSKC 1X1MA 5BO4B 2KACA 2LVPA 3HM6X 4B9KA 4F8CB 5J17A 3MHZA 2IGHA 2K6QA 1A5RA 1KOTA 3PLVA 1IBXA 4A3OA 4EKUA 2VRRB 3BZDB 4TUUA 2FIFA 1SE9A 5BYQA 2DAFA 4KDLB 4JLCA 3IT4B 4WJQA 1WXMA 3WAOA 5JHAA 4GDLA 2JZPA 4OVVA 1IP9A 2E6XA 4EZKA 4DBGA 3BK2A 5H8YE 1WJ4A 1WZ3A 2KD0A 2W3SA 3KQ4A 1V2YA 3TEYA 2DENB 5FK9C 3BVMA 5AZGA 3SHQA 1FNVA 2GB1A 1E0ZA 3RMKC 4HKQA 4GXBA 4LNNA 1AYFA 4R3DA 2KLGA 4DDID 1WYWB 2JVCA 1WZ0A 3U2SC 1WJNA 4KZCA 1SIFA 2D3CA 5HI1A 1R4NB 2QIEB 1JWMD 1XF5L 3LDZE 4W9JA 4IM0A 3DBLI 2R2QA 4DHZB 4EEWA 3A1QB 3SFDB 2O6VB 5IAAC 2XK5A 4KV2A 4AS1A 1TT5B 3VRAB 1YD8U 1L0VB 3H8HA 4P6VF 1L0YB 4FJYA 2LJ5A 3W1YA 1AW7A 3VDZA 4MGKE 1WM2A 3APDA 1DYQA 1RRBA 1ZDXA 4A6QA 3P1MA 1I4XA 2INPE 3DCGA 3ML8A 3DVGX 1UH6A 2AYOB 3M63B 3DHGC 2C7NB 4US9A 1HQRD 4RM9A 4HCPB 1D5MC 2JXTA 2M1MA 2KWVB 4BFRA 1OGWA 3T8MA 3FC4A 1YMHE 1NYQA 1ZXHA 2CS4A 4LNKA 2K9XA 2FCNA 1L6VA 5C3JB 4AOFA 3TEZA 2W55A 3JSVA 4XE0A 1YX6B 2GBRA 3RYTA 3PZ7A 1GB1A 1AARA 2V1YA 3EHVA 3WAMA 4W9DA 4ZRJA 1HE8A 3ZGZA 3DBHI 1K8RB 3O65B 1BT0A 1WX9A 2XEWA 3OAWA 3T3NA 4DXAB 4ZYNA 4LNIA 5L83A 1V1PA 2WXMA 4IWQA 1EUVB 2IPKD 2RMMA 3KW5B 1L4DB
chains in the Genus database with same CATH topology
4M8MA 2GBJA 3ZRCA 1D3ZA 4BBNF 4FJVB 2D10A 3L10B 1YIWA 1UELA 1WMHB 4GIVA 2LI5A 2EMTA 3K9OB 5HKHA 1IPGA 2ZVOA 1E7VA 3QARA 4FHJA 4NNJB 5D94A 3RZFA 4LDTD 4CHKA 2KZRA 3QQ8B 4HLEA 2IO3B 4G50A 1WGHA 2L8JA 1E8YA 3CF6E 4JGHB 2JPHA 2KDBA 2LD9A 4EUTA 2UYZB 3DQVA 2K6DB 3ZVVA 3ZW3A 2C5LC 2MP2B 2O6VD 4MM3A 2DYBA 4AJWA 2FCSA 3IHPC 4MJSA 1WX7A 2MBBB 3NZSA 2OOBB 4IM2A 4BBNC 1GUAB 2V3SA 1SGHA 3ZTDA 1PQSA 1KLVA 4M8NA 2KN5A 3R7QA 2KMCA 3MHSD 1T0YA 4W9HA 1WGDA 3A9JA 4EZLA 3ML9A 3PVLA 3LJ3A 3VHTC 2MX2A 2IZVB 2ZEQA 1WX8A 2J0KA 2EKEC 3NY5A 1WY8A 2WWZA 3PGEA 3QJZA 5E6PA 3L16A 3I3TB 1WE7A 2KDEB 4FBJB 4W9IA 2JZ3B 3H1UA 3VFKA 1WFYA 5J18A 2CHZA 3R66C 2CHXA 5C23A 1GG3A 2KWUB 2KKCA 2KFKA 1UBQA 2C9WB 2LRUA 4ANWA 2N9EB 3AXCA 2FUHB 3W1SA 2GBKA 3UIPB 4B95A 1M94A 4IW0A 1EF1A 1CMXB 1WF9A 2AL6A 2XK5B 4I6PA 2J0MA 3V61A 3S2AA 2HJ8A 1F9JA 2GOWA 4G11A 4HXDA 4XC2A 4MDKE 2KFKB 3PS6A 3UQBA 3L17A 1QZEA 2W9NA 3RCZA 2AL3A 2L3ZA 2LXCA 3PSEB 1NI2A 2IYDB 4XZ4A 1WGGA 2DYMA 4HPLB 1H4RA 1GJZA 4W9KA 4TQ0A 4NQLB 1E5WA 2MBEA 1Y8RC 4FN2A 4K7SA 4NQKE 3NS8A 1OEYA 2ZPNA 3MJWA 2KO3A 2JF5A 3HM3A 2KQSA 2LUEA 5FR6A 1GC6A 2NPTA 2EMSA 2N7DA 4FULA 2N9PC 2K8BA 2JRHA 1YX5B 2CHWA 2BPSA 2RPQA 4BOSC 1TTNA 1WRDB 2D2QA 3N30A 3QX1A 4GMVA 3WALA 2KJRA 2IO0B 5DPWA 1J19A 2LVOA 3VXWA 4BKSD 3VTVA 2FNJB 3ONSA 1GC7A 5JZEB 2KLCA 2O2VA 3VVWB 4KIKA 3OJ3A 3R7RA 4BOZB 4WQOB 2AEHA 2KTRA 2V4LA 3PPAA 1UGMA 3X23A 4W9EA 2YLMA 2D11A 4DDGD 1XT9B 5EDSA 3JSVB 5D7GA 4MGIE 1Z5SB 2A4ZA 2FAZA 4FA6A 3PZDA 1VD2A 2DX5B 2KX0A 3H7PA 2JRIB 4MGYE 2WX0A 3X0WA 3ZO5B 2YVCA 1UBIA 2N4FA 2ZNVB 5G55A 5L95C 3QA8A 2MA9B 3TJPA 2PEAA 4RMAA 3UINB 5KHQA 2LWPA 4ICVA 2K8CA 2LVQA 3MTNB 4IG7B 2K1FA 1WE6A 2BKRB 4W9GA 3KVFB 3M3JA 3UGBB 3GOEA 3KUDB 3R3MA 4GB9A 2Z59B 3A4SC 2KDIA 2DZIA 2REXA 3H6NA 4HK2A 4PS8A 2BYFA 4ZRIA 2PPHA 2KTFA 2OJRA 2DHZA 3A33B 3PRPB 2RD0A 4BKTA 1LFDA 1U4AA 2MLBA 5CX3A 1V86A 4W9LA 3TBLD 1V80A 2RGFA 3K9PB 4GSWA 3P2BA 1R4NI 1XD3B 2M0XA 5DPRA 3ZNHB 4EFOA 2PJHA 2NS5A 4PS7A 3VH4B 4OVUA 3H7SA 4MEMA 2KJ6A 4GGQA 4NAWA 1RFAA 2Y5BB 3WAPA 2L76A 4ZRKA 1WJ6A 2MQJA 2IO1B 3JW0X 3RZWC 4KSLC 2PE9A 4LJPB 3VUWA 1J0GA 4DK5A 2LGDA 3T9LA 2ZZPB 2N9XA 2JXXA 4G3XB 3V6EB 4WWOA 3JVZX 2N1WA 4GOCA 1WXVA 3DBRI 4HPMB 4ANUA 4DHJB 2BWFA 2Z0DB 4PS3A 1S1QB 3ZDMC 4IC7B 3PRZA 3EFUA 2J7QB 3ZNZB 1P1AA 4HDOA 2BKFA 3L08A 4KDIC 1NDDA 1V9JA 4MJSB 4BVUC 3HK0A 4FADA 5LXIB 4LJOB 2NCNA 4GDKA 3A1QA 2CR5A 2NR2A 4URKA 2O6VA 3KYDD 3DOWA 1TBEA 3A9JB 3QWZB 2KMAA 4II3B 2MBQA 2BYVE 2B3AA 2NVUI 3DVNU 3IFWB 2KQ7A 3N3KB 4ANVA 4ASWC 4AJYB 1KJTA 2AWTA 5CHVC 3HIZA 4K81A 2G4SA 2N1VA 2G45B 1V5TA 3DVGY 4DHZE 3H9DA 3L0WB 1I35A 1P3QU 1WJUA 3PV1A 4HJKA 2GBNA 4N9F4 5DCNA 3SDLC 3VUXA 4DWFA 5LXHA 3BY4B 2C7HA 2G3QB 3ZDTA 1WGRA 5LLIA 4IM3A 4EZJA 2IBIB 3EECA 1OTRB 3PT2B 4MH0E 4JIOU 1EF5A 1YJ1A 2ASQA 4NJ6A 2M8SA 3NOBA 4YL8A 1H8CA 2ZVNA 1P0RA 2C7MB 4KVGB 3NHEB 2KC1A 2KVRA 2MBOA 3QHTA 2DZMA 3EC8A 4CYEA 4W9FA 1WM3A 2BYEA 4MSMB 3PTFC 4MGZE 2D07B 2BGFA 4JQWC 2WDTB 4FLHA 2PE6B 4GU2A 5TR5A 4E3CA 1G6JA 4K1RB 1Q1OA 3ZNID 3IBEA 1TGZB 3TCAA 3TL5A 4JL9A 3V60A 2QHOA 4NPNA 2DYOA 1WXSA 2L00B 2Z0EB 3D32A 2A5UA 4HCNB 4K7WA 4KSKC 1X1MA 4HDQA 5BO4B 2LVPA 2KX3A 3B0AA 3HM6X 3N32A 4WAAA 4B9KA 4F8CB 3QCAA 2ZNVC 2L0FA 2L0TA 5J17A 2KJHB 2NPTB 2ZCBA 3KUZA 2M4NA 3QAQA 3ZIMA 2D3GA 2K6QA 3C0RB 3B1LX 3M62B 1A5RA 5JH5C 5CTRC 1XQQA 1ZW7A 3ALBA 3U30A 3IVFA 4MSQB 1V49A 1KOTA 3PLVA 1LXDA 1ISNA 1TZ1A 3VUYA 4A3OA 4EKUA 2O2VB 4KIKB 1Q5WB 2VRRB 4TUUA 4ANXA 2KTRB 1NBFC 1V5OA 2FIFA 3KUCB 1SE9A 4IWPA 2CU1A 2L7RA 1S3SG 1RLFA 4PYUA 4BKSA 4HVBA 2DAFA 1LM8B 1ZGUB 3PRMB 4JLCA 4KDLB 4XX5A 2HD5B 2RR9A 5C1ZA 3H7PB 3ZKJC 3OLMD 4TV3A 4WJQA 1WXMA 3UIOB 3WAOA 4EOYA 5JHAA 5J2RA 4X57B 4GDLA 4WJPA 1C3TA 4OVVA 1WMHA 1YQBA 2CKHB 3L13A 3GZNI 4NJ7A 5DPSA 4DHJD 5IA7A 1IP9A 1V81A 3U7DA 4DBGA 4EZKA 4AUQC 1WH3A 1WJ4A 1WZ3A 3AU4A 2KXJA 3CMMB 3DPDA 2KD0A 1GNUA 1E90A 1V2YA 3CSFA 4GDLB 2DENB 4IWOA 4AP4C 2MP2A 2ZCCA 3HHMA 4WJNA 3APCA 5AZGA 3SHQA 1KM7A 3VTUA 3PHXB 3DBSA 4NAWB 1WIAA 5E6OA 1E8ZA 3AI5A 3IG3A 2C60A 4GXBA 3V62A 3CSTA 4WJOA 4B6WA 3KW5B 1RAXA 1UD7A 2MRPA 2FIDA 2KC2A 1E8XA 5E6NA 2KWCA 4PYZA 1J8CA 2KLGA 2K39A 2JUOA 4DDID 2L05A 1WYWB 1E8WA 1WZ0A 2JVCA 1WJNA 4KZCA 1WGYA 3QIJA 1SIFA 2NBWB 3VAWA 4TKNA 5AZFA 2HTHA 4GN1A 1V6EA 2LZ6A 4W9CA 3LDZE 3RULA 4HWIB 1P98A 4W9JA 4WWNA 3L54A 4LDTB 3W1SC 5KHOA 4IM0A 2LGXA 3DBLI 5CHWA 2R2QA 3NZUA 2BF8B 4DHZB 5AZHA 4EEWA 3VH3B 3AULA 4GDKB 1OEYJ 3A1QB 4AWJA 1JRUA 2O6VB 3SU8X 5IAAC 3ZRFA 2XK5A 4KV2A 2IO2B 3WA0A 2MBHA 1EO6A 3Q3FA 2GBMA 1YD8U 3B08A 1WR6E 3AU5A 2KNBA 2DZKA 3RD2A 4I6NB 2IY0B 4FJYA 3KYCD 2LRWA 3V6CB 3VQIA 1IYFA 4WWPA 1OQYA 2JY6A 2LJ5A 3W1YA 3UQAA 1P9DU 3SD5A 1LQBA 3VDZA 2WYQA 2XBBC 4MGKE 1WM2A 3OJ4B 2MWSB 5D6JB 3APDA 3BINA 1C1YB 2N7EA 4M0WB 3ZTCA 1RRBA 2MCNB 4ZDVA 3KH0A 4FHKA 4A20A 3DCGA 2LXAA 2JZZA 3ML8A 2R2OA 3DVGX 4J6IA 4KZ0A 1UH6A 2AYOB 3M63B 4MELA 4E71A 3PLUA 2C7NB 4TQ1A 1WR1A 3Q3JA 4RM9A 1L2NA 2KHWB 4NY0A 3DDCB 4HCPB 2KOXA 2M1MA 3ECIA 2KWVB 3APFA 4BFRA 3ZUNA 2LASA 1OGWA 3PREA 3T8MA 4CO7A 2FCMA 5CHFA 1Z2MA 5DPTA 3A4RA 2CS4A 2M17A 1Q0WB 1UZXB 4A3PA 2I1JA 2KFJA 4I6LB 3VTWA 2FCNA 1R4MI 3QC8B 2MSED 4AOFA 4G0NB 2WX1A 3ZLZA 2UWQA 3JSVA 2JWZA 1WI0A 2GMIC 2MW5A 1WXAA 1FXTB 3PHWB 2KANA 1YX6B 4BKGA 2GBRA 3RUIB 4K7UA 2KDFB 3RYTA 1AARA 5AEKB 2BWES 3WANA 3A9KA 4FJZA 1I42A 1MG8A 2V1YA 3ZNGC 4F7ZA 3EHVA 1L7YA 1ZKHA 2ZPYA 4IUMB 4W9DA 1HE8A 4ZRJA 5G2NA 3WAMA 4E74A 5JHBA 3U8ZA 3ENEA 2IY1B 3TIXA 2DAJA 2K8HA 2RSUA 3DVNV 4ICUA 4II2B 3DBHI 3TMPB 1K8RB 3RT3B 2G4DB 3O65B 4P7IA 2K25A 1BT0A 1E7UA 2KK8A 2JT4B 3M95A 1WX9A 5GMVA 2XEWA 2HE7A 2ZJDA 3A9KB 3OAWA 3QK0A 2FCQA 4F1SA 4DXAB 4ZYNA 3WIMA 3UF8A 2LGYA 5L83A 2J0JA 4IWQA 4RM8A 2DZJA 1EUVB 1VCBA 2NBVB 3JYUA 4LCDE 5D2MB 2NBUA 2I1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M8M A;  2GBJ A;  3ZRC A;  1D3Z A;  4BBN F;  4FJV B;  2D10 A;  3L10 B;  1YIW A;  1UEL A;  1WMH B;  4GIV A;  2LI5 A;  2EMT A;  3K9O B;  5HKH A;  1IPG A;  2ZVO A;  1E7V A;  3QAR A;  4FHJ A;  4NNJ B;  5D94 A;  3RZF A;  4LDT D;  4CHK A;  2KZR A;  3QQ8 B;  4HLE A;  2IO3 B;  4G50 A;  1WGH A;  2L8J A;  1E8Y A;  3CF6 E;  4JGH B;  2JPH A;  2KDB A;  2LD9 A;  4EUT A;  2UYZ B;  3DQV A;  2K6D B;  3ZVV A;  3ZW3 A;  2C5L C;  2MP2 B;  2O6V D;  4MM3 A;  2DYB A;  4AJW A;  2FCS A;  3IHP C;  4MJS A;  1WX7 A;  2MBB B;  3NZS A;  2OOB B;  4IM2 A;  4BBN C;  1GUA B;  2V3S A;  1SGH A;  3ZTD A;  1PQS A;  1KLV A;  4M8N A;  2KN5 A;  3R7Q A;  2KMC A;  3MHS D;  1T0Y A;  4W9H A;  1WGD A;  3A9J A;  4EZL A;  3ML9 A;  3PVL A;  3LJ3 A;  3VHT C;  2MX2 A;  2IZV B;  2ZEQ A;  1WX8 A;  2J0K A;  2EKE C;  3NY5 A;  1WY8 A;  2WWZ A;  3PGE A;  3QJZ A;  5E6P A;  3L16 A;  3I3T B;  1WE7 A;  2KDE B;  4FBJ B;  4W9I A;  2JZ3 B;  3H1U A;  3VFK A;  1WFY A;  5J18 A;  2CHZ A;  3R66 C;  2CHX A;  5C23 A;  1GG3 A;  2KWU B;  2KKC A;  2KFK A;  1UBQ A;  2C9W B;  2LRU A;  4ANW A;  2N9E B;  3AXC A;  2FUH B;  3W1S A;  2GBK A;  3UIP B;  4B95 A;  1M94 A;  4IW0 A;  1EF1 A;  1CMX B;  1WF9 A;  2AL6 A;  2XK5 B;  4I6P A;  2J0M A;  3V61 A;  3S2A A;  2HJ8 A;  1F9J A;  2GOW A;  4G11 A;  4HXD A;  4XC2 A;  4MDK E;  2KFK B;  3PS6 A;  3UQB A;  3L17 A;  1QZE A;  2W9N A;  3RCZ A;  2AL3 A;  2L3Z A;  2LXC A;  3PSE B;  1NI2 A;  2IYD B;  4XZ4 A;  1WGG A;  2DYM A;  4HPL B;  1H4R A;  1GJZ A;  4W9K A;  4TQ0 A;  4NQL B;  1E5W A;  2MBE A;  1Y8R C;  4FN2 A;  4K7S A;  4NQK E;  3NS8 A;  1OEY A;  2ZPN A;  3MJW A;  2KO3 A;  2JF5 A;  3HM3 A;  2KQS A;  2LUE A;  5FR6 A;  1GC6 A;  2NPT A;  2EMS A;  2N7D A;  4FUL A;  2N9P C;  2K8B A;  2JRH A;  1YX5 B;  2CHW A;  2BPS A;  2RPQ A;  4BOS C;  1TTN A;  1WRD B;  2D2Q A;  3N30 A;  3QX1 A;  4GMV A;  3WAL A;  2KJR A;  2IO0 B;  5DPW A;  1J19 A;  2LVO A;  3VXW A;  4BKS D;  3VTV A;  2FNJ B;  3ONS A;  1GC7 A;  5JZE B;  2KLC A;  2O2V A;  3VVW B;  4KIK A;  3OJ3 A;  3R7R A;  4BOZ B;  4WQO B;  2AEH A;  2KTR A;  2V4L A;  3PPA A;  1UGM A;  3X23 A;  4W9E A;  2YLM A;  2D11 A;  4DDG D;  1XT9 B;  5EDS A;  3JSV B;  5D7G A;  4MGI E;  1Z5S B;  2A4Z A;  2FAZ A;  4FA6 A;  3PZD A;  1VD2 A;  2DX5 B;  2KX0 A;  3H7P A;  2JRI B;  4MGY E;  2WX0 A;  3X0W A;  3ZO5 B;  2YVC A;  1UBI A;  2N4F A;  2ZNV B;  5G55 A;  5L95 C;  3QA8 A;  2MA9 B;  3TJP A;  2PEA A;  4RMA A;  3UIN B;  5KHQ A;  2LWP A;  4ICV A;  2K8C A;  2LVQ A;  3MTN B;  4IG7 B;  2K1F A;  1WE6 A;  2BKR B;  4W9G A;  3KVF B;  3M3J A;  3UGB B;  3GOE A;  3KUD B;  3R3M A;  4GB9 A;  2Z59 B;  3A4S C;  2KDI A;  2DZI A;  2REX A;  3H6N A;  4HK2 A;  4PS8 A;  2BYF A;  4ZRI A;  2PPH A;  2KTF A;  2OJR A;  2DHZ A;  3A33 B;  3PRP B;  2RD0 A;  4BKT A;  1LFD A;  1U4A A;  2MLB A;  5CX3 A;  1V86 A;  4W9L A;  3TBL D;  1V80 A;  2RGF A;  3K9P B;  4GSW A;  3P2B A;  1R4N I;  1XD3 B;  2M0X A;  5DPR A;  3ZNH B;  4EFO A;  2PJH A;  2NS5 A;  4PS7 A;  3VH4 B;  4OVU A;  3H7S A;  4MEM A;  2KJ6 A;  4GGQ A;  4NAW A;  1RFA A;  2Y5B B;  3WAP A;  2L76 A;  4ZRK A;  1WJ6 A;  2MQJ A;  2IO1 B;  3JW0 X;  3RZW C;  4KSL C;  2PE9 A;  4LJP B;  3VUW A;  1J0G A;  4DK5 A;  2LGD A;  3T9L A;  2ZZP B;  2N9X A;  2JXX A;  4G3X B;  3V6E B;  4WWO A;  3JVZ X;  2N1W A;  4GOC A;  1WXV A;  3DBR I;  4HPM B;  4ANU A;  4DHJ B;  2BWF A;  2Z0D B;  4PS3 A;  1S1Q B;  3ZDM C;  4IC7 B;  3PRZ A;  3EFU A;  2J7Q B;  3ZNZ B;  1P1A A;  4HDO A;  2BKF A;  3L08 A;  4KDI C;  1NDD A;  1V9J A;  4MJS B;  4BVU C;  3HK0 A;  4FAD A;  5LXI B;  4LJO B;  2NCN A;  4GDK A;  3A1Q A;  2CR5 A;  2NR2 A;  4URK A;  2O6V A;  3KYD D;  3DOW A;  1TBE A;  3A9J B;  3QWZ B;  2KMA A;  4II3 B;  2MBQ A;  2BYV E;  2B3A A;  2NVU I;  3DVN U;  3IFW B;  2KQ7 A;  3N3K B;  4ANV A;  4ASW C;  4AJY B;  1KJT A;  2AWT A;  5CHV C;  3HIZ A;  4K81 A;  2G4S A;  2N1V A;  2G45 B;  1V5T A;  3DVG Y;  4DHZ E;  3H9D A;  3L0W B;  1I35 A;  1P3Q U;  1WJU A;  3PV1 A;  4HJK A;  2GBN A;  4N9F 4;  5DCN A;  3SDL C;  3VUX A;  4DWF A;  5LXH A;  3BY4 B;  2C7H A;  2G3Q B;  3ZDT A;  1WGR A;  5LLI A;  4IM3 A;  4EZJ A;  2IBI B;  3EEC A;  1OTR B;  3PT2 B;  4MH0 E;  4JIO U;  1EF5 A;  1YJ1 A;  2ASQ A;  4NJ6 A;  2M8S A;  3NOB A;  4YL8 A;  1H8C A;  2ZVN A;  1P0R A;  2C7M B;  4KVG B;  3NHE B;  2KC1 A;  2KVR A;  2MBO A;  3QHT A;  2DZM A;  3EC8 A;  4CYE A;  4W9F A;  1WM3 A;  2BYE A;  4MSM B;  3PTF C;  4MGZ E;  2D07 B;  2BGF A;  4JQW C;  2WDT B;  4FLH A;  2PE6 B;  4GU2 A;  5TR5 A;  4E3C A;  1G6J A;  4K1R B;  1Q1O A;  3ZNI D;  3IBE A;  1TGZ B;  3TCA A;  3TL5 A;  4JL9 A;  3V60 A;  2QHO A;  4NPN A;  2DYO A;  1WXS A;  2L00 B;  2Z0E B;  3D32 A;  2A5U A;  4HCN B;  4K7W A;  4KSK C;  1X1M A;  4HDQ A;  5BO4 B;  2LVP A;  2KX3 A;  3B0A A;  3HM6 X;  3N32 A;  4WAA A;  4B9K A;  4F8C B;  3QCA A;  2ZNV C;  2L0F A;  2L0T A;  5J17 A;  2KJH B;  2NPT B;  2ZCB A;  3KUZ A;  2M4N A;  3QAQ A;  3ZIM A;  2D3G A;  2K6Q A;  3C0R B;  3B1L X;  3M62 B;  1A5R A;  5JH5 C;  5CTR C;  1XQQ A;  1ZW7 A;  3ALB A;  3U30 A;  3IVF A;  4MSQ B;  1V49 A;  1KOT A;  3PLV A;  1LXD A;  1ISN A;  1TZ1 A;  3VUY A;  4A3O A;  4EKU A;  2O2V B;  4KIK B;  1Q5W B;  2VRR B;  4TUU A;  4ANX A;  2KTR B;  1NBF C;  1V5O A;  2FIF A;  3KUC B;  1SE9 A;  4IWP A;  2CU1 A;  2L7R A;  1S3S G;  1RLF A;  4PYU A;  4BKS A;  4HVB A;  2DAF A;  1LM8 B;  1ZGU B;  3PRM B;  4JLC A;  4KDL B;  4XX5 A;  2HD5 B;  2RR9 A;  5C1Z A;  3H7P B;  3ZKJ C;  3OLM D;  4TV3 A;  4WJQ A;  1WXM A;  3UIO B;  3WAO A;  4EOY A;  5JHA A;  5J2R A;  4X57 B;  4GDL A;  4WJP A;  1C3T A;  4OVV A;  1WMH A;  1YQB A;  2CKH B;  3L13 A;  3GZN I;  4NJ7 A;  5DPS A;  4DHJ D;  5IA7 A;  1IP9 A;  1V81 A;  3U7D A;  4DBG A;  4EZK A;  4AUQ C;  1WH3 A;  1WJ4 A;  1WZ3 A;  3AU4 A;  2KXJ A;  3CMM B;  3DPD A;  2KD0 A;  1GNU A;  1E90 A;  1V2Y A;  3CSF A;  4GDL B;  2DEN B;  4IWO A;  4AP4 C;  2MP2 A;  2ZCC A;  3HHM A;  4WJN A;  3APC A;  5AZG A;  3SHQ A;  1KM7 A;  3VTU A;  3PHX B;  3DBS A;  4NAW B;  1WIA A;  5E6O A;  1E8Z A;  3AI5 A;  3IG3 A;  2C60 A;  4GXB A;  3V62 A;  3CST A;  4WJO A;  4B6W A;  3KW5 B;  1RAX A;  1UD7 A;  2MRP A;  2FID A;  2KC2 A;  1E8X A;  5E6N A;  2KWC A;  4PYZ A;  1J8C A;  2KLG A;  2K39 A;  2JUO A;  4DDI D;  2L05 A;  1WYW B;  1E8W A;  1WZ0 A;  2JVC A;  1WJN A;  4KZC A;  1WGY A;  3QIJ A;  1SIF A;  2NBW B;  3VAW A;  4TKN A;  5AZF A;  2HTH A;  4GN1 A;  1V6E A;  2LZ6 A;  4W9C A;  3LDZ E;  3RUL A;  4HWI B;  1P98 A;  4W9J A;  4WWN A;  3L54 A;  4LDT B;  3W1S C;  5KHO A;  4IM0 A;  2LGX A;  3DBL I;  5CHW A;  2R2Q A;  3NZU A;  2BF8 B;  4DHZ B;  5AZH A;  4EEW A;  3VH3 B;  3AUL A;  4GDK B;  1OEY J;  3A1Q B;  4AWJ A;  1JRU A;  2O6V B;  3SU8 X;  5IAA C;  3ZRF A;  2XK5 A;  4KV2 A;  2IO2 B;  3WA0 A;  2MBH A;  1EO6 A;  3Q3F A;  2GBM A;  1YD8 U;  3B08 A;  1WR6 E;  3AU5 A;  2KNB A;  2DZK A;  3RD2 A;  4I6N B;  2IY0 B;  4FJY A;  3KYC D;  2LRW A;  3V6C B;  3VQI A;  1IYF A;  4WWP A;  1OQY A;  2JY6 A;  2LJ5 A;  3W1Y A;  3UQA A;  1P9D U;  3SD5 A;  1LQB A;  3VDZ A;  2WYQ A;  2XBB C;  4MGK E;  1WM2 A;  3OJ4 B;  2MWS B;  5D6J B;  3APD A;  3BIN A;  1C1Y B;  2N7E A;  4M0W B;  3ZTC A;  1RRB A;  2MCN B;  4ZDV A;  3KH0 A;  4FHK A;  4A20 A;  3DCG A;  2LXA A;  2JZZ A;  3ML8 A;  2R2O A;  3DVG X;  4J6I A;  4KZ0 A;  1UH6 A;  2AYO B;  3M63 B;  4MEL A;  4E71 A;  3PLU A;  2C7N B;  4TQ1 A;  1WR1 A;  3Q3J A;  4RM9 A;  1L2N A;  2KHW B;  4NY0 A;  3DDC B;  4HCP B;  2KOX A;  2M1M A;  3ECI A;  2KWV B;  3APF A;  4BFR A;  3ZUN A;  2LAS A;  1OGW A;  3PRE A;  3T8M A;  4CO7 A;  2FCM A;  5CHF A;  1Z2M A;  5DPT A;  3A4R A;  2CS4 A;  2M17 A;  1Q0W B;  1UZX B;  4A3P A;  2I1J A;  2KFJ A;  4I6L B;  3VTW A;  2FCN A;  1R4M I;  3QC8 B;  2MSE D;  4AOF A;  4G0N B;  2WX1 A;  3ZLZ A;  2UWQ A;  3JSV A;  2JWZ A;  1WI0 A;  2GMI C;  2MW5 A;  1WXA A;  1FXT B;  3PHW B;  2KAN A;  1YX6 B;  4BKG A;  2GBR A;  3RUI B;  4K7U A;  2KDF B;  3RYT A;  1AAR A;  5AEK B;  2BWE S;  3WAN A;  3A9K A;  4FJZ A;  1I42 A;  1MG8 A;  2V1Y A;  3ZNG C;  4F7Z A;  3EHV A;  1L7Y A;  1ZKH A;  2ZPY A;  4IUM B;  4W9D A;  1HE8 A;  4ZRJ A;  5G2N A;  3WAM A;  4E74 A;  5JHB A;  3U8Z A;  3ENE A;  2IY1 B;  3TIX A;  2DAJ A;  2K8H A;  2RSU A;  3DVN V;  4ICU A;  4II2 B;  3DBH I;  3TMP B;  1K8R B;  3RT3 B;  2G4D B;  3O65 B;  4P7I A;  2K25 A;  1BT0 A;  1E7U A;  2KK8 A;  2JT4 B;  3M95 A;  1WX9 A;  5GMV A;  2XEW A;  2HE7 A;  2ZJD A;  3A9K B;  3OAW A;  3QK0 A;  2FCQ A;  4F1S A;  4DXA B;  4ZYN A;  3WIM A;  3UF8 A;  2LGY A;  5L83 A;  2J0J A;  4IWQ A;  4RM8 A;  2DZJ A;  1EUV B;  1VCB A;  2NBV B;  3JYU A;  4LCD E;  5D2M B;  2NBU A;  2I1K A; 
#chains in the Genus database with same CATH topology
 3WCQ A;  1D3Z A;  4BBN F;  3L10 B;  1SSN A;  1F52 A;  1UEL A;  2BB6 A;  1WMH B;  2LI5 A;  1E7V A;  1YN4 A;  3AEC B;  5D94 A;  1B1Z A;  3QQ8 B;  2J52 A;  2RPV A;  3DQV A;  4MM3 A;  2DYB A;  1FXI A;  2OED A;  4MJS A;  3DWG C;  4BBN C;  1GUA B;  2V3S A;  1PQS A;  3Q8C A;  2SEB D;  1T0Y A;  3A9J A;  3VR9 B;  1SEB D;  3PVL A;  1WY8 A;  3PGE A;  4LTU A;  1FD6 A;  2BB5 A;  1WFY A;  3R66 C;  2CHX A;  2BW2 A;  1J7C A;  1ENF A;  2C9W B;  2JWU A;  3AXC A;  2KQ4 X;  1JML A;  1L0X B;  3AN1 A;  4C00 A;  1QF6 A;  1WF9 A;  1D6E C;  3RI7 C;  1QZE A;  2L3Z A;  3PSE B;  5T8I A;  4XZ4 A;  1N61 A;  1QOG A;  4TQ0 A;  1ZDV A;  2MBE A;  1ZXI A;  2KDM A;  3MJW A;  3NRZ A;  3ZXR A;  4RGM A;  4FUL A;  2BPS A;  1TTN A;  1GAQ B;  3N30 A;  1J7A A;  4XDC A;  2FNJ B;  4N58 A;  2BT6 A;  3OJ3 A;  3HUI A;  3R7R A;  4WAF A;  2LEK A;  2WU5 B;  1XT9 B;  4MGI E;  2JU6 X;  2M0A A;  3PZD A;  3ZO5 B;  2RDH A;  4ARC A;  3ETR A;  1JWS D;  2MA9 B;  4RMA A;  4YWG G;  2LWP A;  4ICV A;  4P1B C;  2L32 A;  4IG7 B;  2MEK A;  1WE6 A;  2ACZ B;  4W9G A;  2D5G A;  3R3M A;  3OWE B;  3ZJV A;  2PPH A;  1D5Z C;  2Y5P A;  2DHZ A;  4BKT A;  2MLB A;  1F2R I;  2LUM A;  1F2R C;  1FNU A;  3GE8 C;  3P2B A;  4GSW A;  5DPR A;  4PS7 A;  3B2F A;  4C56 C;  3AE8 B;  2WGS A;  4ZRK A;  3PZ8 A;  3RZW C;  2PE9 A;  5EE1 A;  2N9X A;  2JXX A;  2N1W A;  2AX5 A;  4HPM B;  4DHJ B;  2Z0D B;  1S1Q B;  2BVC A;  4OZC A;  1C78 A;  4PT5 A;  1JWU D;  1P1A A;  4FAD A;  1OFF A;  4DXF A;  1I4Q A;  2KN4 A;  2NCN A;  3A1Q A;  5HHD G;  1D5X C;  2O6V A;  2N9L A;  3DOW A;  3KYD D;  3FAH A;  1TBE A;  4A9A A;  1AWD A;  1HTO A;  2AWT A;  3HIZ A;  1TS4 A;  2G45 B;  3N1Z C;  2NTS A;  4HJK A;  2GBN A;  2WXJ A;  1JCK B;  4DWF A;  3NG0 A;  2C7H A;  1WGR A;  4Q2J A;  1PGA A;  2IBI B;  3PT2 B;  4HPP A;  2K5P A;  2M8S A;  4YL8 A;  2ZVN A;  3NUH B;  1P0R A;  3IXS A;  2C7M B;  2MHJ A;  1L6U A;  2BYE A;  4MGZ E;  4YXD B;  2SAK A;  2VZK D;  5HG2 A;  2WP9 B;  4A55 A;  3E9S A;  4E3C A;  5TR5 A;  3NZ3 A;  2KVZ A;  4K1R B;  4M02 A;  1Q1O A;  3TL5 A;  3V60 A;  2DYO A;  1WXS A;  1I4P A;  3D32 A;  4HCN B;  5IO9 A;  4LLG M;  2KX3 A;  3B0A A;  3N32 A;  4WAA A;  4ZHO A;  2WU2 B;  3MP9 A;  3QCA A;  2L0F A;  4USA A;  2ZCB A;  2M4N A;  3QAQ A;  3C0R B;  2EEL A;  3ZYY X;  3FIL B;  1XQQ A;  1ZW7 A;  2INC C;  1LXD A;  2FE8 A;  1E7P B;  5E6J A;  4YTP B;  2KTR B;  4KKJ A;  1PGB A;  3KUC B;  1S3S G;  1RLF A;  3MC0 B;  4BKS A;  1R4M B;  1FRR A;  3PRM B;  5C1Z A;  3UIO B;  1XLN A;  4C80 A;  1HA5 A;  1TY2 A;  1WMH A;  2CKH B;  4NJ7 A;  4IKG A;  1N6Z A;  3I5J C;  1YQ4 B;  4AUQ C;  2YEP B;  2KXJ A;  3CMM B;  3DPD A;  5AUI A;  4ITK A;  1N5W A;  1JRO A;  1NEN B;  1HZ5 A;  3GS2 A;  3EUB 2;  2JYT A;  4REZ A;  4IWO A;  4AP4 C;  2XN9 C;  3HHM A;  4WJN A;  3APC A;  3IAS 1;  2DBY A;  2V9H A;  1E8Z A;  1LO5 D;  3V62 A;  1KRH A;  1RAX A;  1E8X A;  2Q5W D;  1J8C A;  2L05 A;  2BS4 B;  3ZXV A;  2LGS A;  3QIJ A;  3VAW A;  2LZ6 A;  3NS1 A;  1WGK A;  4LK0 M;  1P98 A;  1KLU D;  5KHO A;  4OHJ A;  5CHW A;  3NZU A;  3VH3 B;  4GDK B;  5AUK A;  4L2Y A;  4AWJ A;  3BVG A;  1RFK A;  2L83 A;  3ZRF A;  3SEB A;  2WXO A;  2IO2 B;  3WA0 A;  2GRI A;  2G9H D;  4BZA A;  3DBR B;  3RD2 A;  4I6N B;  3U4E G;  4HRS A;  3VQI A;  4WWP A;  3SD5 A;  3RNB C;  3T3O A;  2WYQ A;  2QMT A;  1BUI C;  3BIN A;  3Q8F A;  2N7E A;  3ZTC A;  2LXA A;  2JZZ A;  3FKY A;  2HJ1 A;  4J6I A;  4KZ0 A;  1WWT A;  1WR1 A;  3Q3J A;  2V4I B;  5MPO A;  3MC8 A;  1L2N A;  2KHW B;  4NY0 A;  1T0S C;  3APF A;  1KFY B;  3ZUN A;  2LAS A;  1C79 A;  5CHF A;  1Z2M A;  3A4R A;  3Q3O C;  2VH1 A;  1UZX B;  2KFJ A;  4I6L B;  4JWS C;  3VTW A;  1R4M I;  2J42 A;  3QC8 B;  4G0N B;  4RH6 A;  2UWQ A;  2MW5 A;  3AB5 A;  1FXT B;  2H88 B;  2KAN A;  5AEK B;  3WAN A;  3A9K A;  1E10 A;  4F7Z A;  4E74 A;  3EGR A;  2IY1 B;  2DAJ A;  4OZA A;  1NYR A;  5GMV A;  2HE7 A;  2B76 B;  4F1S A;  3Q3M C;  3UF8 A;  2IJ0 A;  2J0J A;  1CJE A;  4RM8 A;  1RYJ A;  2WDQ B;  1VCB A;  2J53 A;  2QIL A;  2GBJ A;  4RGT A;  3K9O B;  3VRB B;  3ZQ4 A;  4P1C C;  2ZVO A;  2AQ1 B;  4LDT D;  3SR6 A;  3Q8A A;  4HLE A;  2IO3 B;  4G50 A;  1QKZ A;  3CF6 E;  1TS2 A;  2RDB C;  4EUT A;  2UYZ B;  3ZVV A;  4CQN A;  2C5L C;  3ABV B;  3IHP C;  4OVZ A;  1WX7 A;  3NZS A;  3R8B A;  2OOB B;  4IM2 A;  3GZN B;  2IND C;  4ZOH C;  1KLV A;  3R7Q A;  2KMC A;  4JE3 B;  4W9H A;  1WGD A;  1EWC A;  4EZL A;  3BWU D;  3ML9 A;  2PTL A;  2IZV B;  2IGD A;  1WX8 A;  2J0K A;  2EKE C;  3L16 A;  3RFZ B;  3ZJT A;  1ACC A;  3VFK A;  5J18 A;  2KKC A;  2KFK A;  1UBQ A;  1WSP A;  4UDU C;  1FM0 D;  3MC9 A;  2GBK A;  1EF1 A;  2AL6 A;  1IGC A;  1D4B A;  4HXD A;  2PKO A;  4XC2 A;  4MDK E;  3PS6 A;  4JPS A;  3UQB A;  2PMV A;  2W9N A;  4S0R A;  3RCZ A;  4RGO S;  2AL3 A;  3BK1 A;  2LFI A;  3BYT B;  1NI2 A;  1N5X A;  1PFD A;  2DYM A;  2ICI A;  4HPL B;  1GJZ A;  3W5U B;  1CK1 A;  4NQL B;  2GI9 A;  1E5W A;  5IN7 A;  2W82 A;  4NQK E;  2ZPN A;  2KO3 A;  3HM3 A;  1K51 A;  2N9P C;  2K8B A;  2JSV X;  1GPX A;  3BII D;  1C4A A;  1XO3 A;  2D2Q A;  3FIL A;  2K0P A;  2IO0 B;  1J19 A;  3VXW A;  2I38 A;  3NVY A;  2WXQ A;  3I9V 1;  1FFU A;  5JZE B;  2KLC A;  3HRD D;  2KTR A;  3PPA A;  3X23 A;  1UGM A;  4W9E A;  2YLM A;  5H92 C;  5FKA C;  1EWY C;  2A4Z A;  1ZPS A;  2FAZ A;  1FMA D;  3GB1 A;  4FA6 A;  3ZJU A;  1VD2 A;  4MGY E;  2YVC A;  1UBI A;  2ZNV B;  1MHH E;  3UIN B;  3MTN B;  3KVF B;  3M3J A;  3KUD B;  1N63 A;  2Z59 B;  2V3P A;  4ZRI A;  1DGJ A;  3H6N A;  1K53 A;  4HK2 A;  4PS8 A;  2KTF A;  2OJR A;  3PRP B;  1U4A A;  5CX3 A;  4W9L A;  4XGA B;  2JX5 A;  1R4N I;  1VDV A;  2M0X A;  3ZNH B;  1L5P A;  2PJH A;  2NS5 A;  3H7S A;  4C7Z A;  4GGQ A;  1RFA A;  2Y5B B;  3WAP A;  1YN3 A;  3RNG C;  2MQJ A;  2IO1 B;  3VUW A;  2L52 A;  5BMG A;  3V6E B;  4G3X B;  2K3U A;  3JVZ X;  4GOC A;  4ANU A;  1SF0 A;  2PVG C;  2JYE A;  3N1Y C;  1PGX A;  3EFU A;  3PO0 A;  4HDO A;  2BKF A;  3L08 A;  1NDD A;  2UU7 A;  3HK0 A;  4GDK A;  2CR5 A;  4JWU C;  2NR2 A;  5IOI A;  4II3 B;  2WDV B;  4NJC A;  2MBQ A;  5BYS A;  2BYV E;  1HEZ E;  2NVU I;  1QQR A;  2RDG A;  2KQ7 A;  1KJT A;  1UF0 A;  2BS2 B;  4J3O D;  2M56 B;  4K81 A;  4RFB A;  2DWQ A;  4K3B A;  2WHI A;  3DVG Y;  1DOX A;  1WJU A;  4B0E A;  1VZ8 A;  3PV1 A;  4N9F 4;  3BY4 B;  2NTT A;  4EZJ A;  4KGR A;  1OTR B;  1V1O A;  4MH0 E;  3NOB A;  1V8C A;  3LYY A;  4KVG B;  1P7E A;  2KC1 A;  3QHT A;  2MBO A;  4CYE A;  1ZOY B;  1B9R A;  2D07 B;  2WDT B;  3KWV A;  2PE6 B;  4GU2 A;  1G6J A;  2WXL A;  4ZHP A;  3CIR B;  1JWB D;  4NPN A;  1T0Q C;  2Z0E B;  2ZNV C;  2L0T A;  2NPT B;  4IOI E;  3KUZ A;  2M19 A;  2WXR A;  2D3G A;  3M62 B;  4S17 A;  3U30 A;  3W5V B;  3IVF A;  4MSQ B;  1DOI A;  4KIK B;  4ANX A;  4N6E B;  1NBF C;  1JAL A;  3MJ5 A;  4PYU A;  4HVB A;  3UI3 A;  2X38 A;  1FFV A;  3E56 A;  1ZGU B;  4KKI A;  1KF6 B;  2HD5 B;  2RR9 A;  3ZKJ C;  4TV3 A;  4X57 B;  4WJP A;  3L13 A;  5IA7 A;  4MAC A;  5EE0 A;  1V81 A;  1L4Z B;  1FCC C;  1WH3 A;  3V3X A;  1XXG A;  1PDX A;  1E90 A;  1JQ4 A;  2V3N A;  1VRA B;  3CSF A;  4GDL B;  3AE1 B;  4KGS A;  5HFY A;  2N0S B;  3VTU A;  3PHX B;  3DBS A;  4NAW B;  2WQY B;  3AI5 A;  4KGT A;  2KMM A;  3CST A;  4B6W A;  4ARI A;  2FID A;  2KC2 A;  3AE9 B;  4PYZ A;  1TYG B;  2K39 A;  1E8W A;  1RWS A;  1ROE A;  1WGY A;  2NBW B;  2HTH A;  4GN1 A;  3AE3 B;  4RF0 A;  4WWN A;  3L54 A;  3V05 A;  3W1S C;  4C4V B;  2HTM E;  5BMH A;  5AZH A;  3I63 C;  2N9K A;  2MBH A;  1EO6 A;  3Q3F A;  5EE9 A;  3B08 A;  1WR6 E;  3B9J A;  1EU3 A;  1TS3 A;  3V6C B;  1PUT A;  2WXP A;  5LNK 1;  2LGI A;  1IYF A;  1OQY A;  2WDR B;  3C19 A;  2JY6 A;  1V97 A;  1A70 A;  4ACF A;  1HXY D;  5D6J B;  3OJ4 B;  4P16 A;  3RNA C;  2MCN B;  4ZDV A;  4A20 A;  2R2O A;  1ZUD 2;  3PLU A;  3RPF C;  2AQ2 B;  3DDC B;  2KOX A;  3ECI A;  1JW9 D;  1VZ7 A;  1XEE A;  1BML C;  3U52 E;  3BVZ A;  2M17 A;  2I1J A;  4YSX B;  1J7B A;  4A90 A;  2MSE D;  2BBC A;  1UGJ A;  2WX1 A;  3L4P A;  1TS5 A;  2JWZ A;  3PHW B;  2GMI C;  1WXA A;  3RUI B;  4K7U A;  2KDF B;  2D3B A;  2BWE S;  2PLP A;  4YT0 B;  4FJZ A;  3ZNG C;  1L7Y A;  3N9Y C;  4IUM B;  5G2N A;  1HZ6 A;  3IT6 B;  3U8Z A;  3ENE A;  4HKZ E;  5G5H A;  3TIX A;  2K8H A;  4ICU A;  2RSU A;  1EM7 A;  3RT3 B;  2K25 A;  2KK8 A;  1E7U A;  1SB3 C;  1T3Q A;  4PK1 A;  1MHX A;  1TZO A;  2ZJD A;  3QK0 A;  2FCQ A;  1XLP A;  2LGY A;  1K50 A;  2MJE A;  1JWA D;  2DZJ A;  5D2M B;  1Q10 A;  2I1K A;  2FBW B;  4M8M A;  2QDF A;  3N20 C;  2D10 A;  3AMZ A;  4BAX A;  1E9M A;  1K52 A;  1R7S A;  1FRD A;  4FHJ A;  2CJO A;  3RZF A;  4CHK A;  2KZR A;  1SE4 A;  1WGH A;  2LMC A;  2JPH A;  2WS3 B;  3CWI A;  1C4C A;  2MP2 B;  2O6V D;  4AJW A;  2FCS A;  2MBB B;  3ZTD A;  4L1B A;  1UWX A;  2ZW1 A;  3MHS D;  2QCZ A;  4L23 A;  3NY5 A;  1SE3 A;  1ET9 A;  3QJZ A;  1I4H A;  1WE7 A;  2KDE B;  3H1U A;  2CHZ A;  1PYW D;  1FCL A;  2LRU A;  4WH4 A;  2FUH B;  3W1S A;  4WQM A;  1CMX B;  3GP7 A;  3V61 A;  2QJL A;  1E6E B;  1F9J A;  2GOW A;  1N62 A;  4JX1 C;  2QEJ C;  1WGG A;  3DBL B;  1QIL A;  1TIF A;  1Y8R C;  4K7S A;  1GOZ A;  2MJ3 A;  2YEP F;  3MFG A;  5D3I B;  3W9C B;  2LUE A;  1N60 A;  1GC6 A;  2NPT A;  2N7D A;  4XWT A;  2JRH A;  1YX5 B;  4BOS C;  2RPQ A;  5IP4 D;  1WRD B;  3QX1 A;  4TSS A;  3SFE B;  2KJR A;  3HVD A;  2XNA C;  2LVO A;  4BKS D;  4B0M A;  3ONS A;  1RM6 C;  5C2T B;  3P4Q B;  2WXF A;  2JQR B;  4KIK A;  4WQO B;  2AEH A;  2DNF A;  4DDG D;  1NI3 A;  2VZK B;  5EDS A;  1Z5S B;  4KX6 B;  3R2T A;  2DX5 B;  2KX0 A;  5G55 A;  4QAY A;  1WRI A;  3QA8 A;  3TJP A;  1UWM A;  5KHQ A;  2K8C A;  4D2K A;  2BKR B;  4NZL B;  3AM9 A;  1WXQ A;  1SE2 A;  2KDI A;  2REX A;  2BYF A;  4RNA A;  3Q6B A;  2OJW A;  3AE5 B;  2RD0 A;  1LFD A;  1V86 A;  1V80 A;  4EFO A;  1XD3 B;  4XYC A;  4OVU A;  1TKY A;  4MEM A;  2KJ6 A;  2PW9 A;  3O13 A;  4NAW A;  3VR8 B;  2L76 A;  3DBH B;  4ZRP A;  1WJ6 A;  1KH0 A;  1STE A;  1UUP A;  4KSL C;  4DK5 A;  1MFW A;  3NJT A;  2ZZP B;  3R2I A;  2LJI A;  1WXV A;  3DBR I;  3ZDM C;  3NVW A;  2J7Q B;  4K3C A;  4KDI C;  4NAM A;  4YTN B;  1CZP A;  2BS3 B;  4C4V A;  1Y56 A;  4LJO B;  1SXT A;  5IKC M;  3QWZ B;  1TJE A;  1XLQ A;  2LHE A;  1ZE3 D;  3N3K B;  4ANV A;  4ASW C;  1XCT L;  1I35 A;  3L0W B;  5DCN A;  3VUX A;  5LXH A;  2G3Q B;  5LLI A;  4IM3 A;  2PVO D;  3EEC A;  4JIO U;  1EF5 A;  1YJ1 A;  2ASQ A;  4NJ6 A;  1T0R C;  2HDE A;  1C77 A;  3TUO A;  4WUR A;  2D3A A;  4JQW C;  4FLH A;  1QOB A;  3KLS X;  1ESF A;  3IBE A;  3TCA A;  4K7W A;  2V0G A;  2A5U A;  3AE6 B;  2MJD A;  3Q3N C;  4HDQ A;  1T6B X;  2KJH B;  2ZW0 A;  1YOV B;  2ON8 A;  2NMQ A;  3ZIM A;  3B1L X;  2WNM A;  5JH5 C;  5CTR C;  3ALB A;  1SJH D;  1V49 A;  3AH7 A;  1ISN A;  1TZ1 A;  3VUY A;  1QT9 A;  2O2V B;  2IDY A;  1Q5W B;  1C4P A;  1V5O A;  1OQR A;  4IWP A;  2CU1 A;  2AQ3 B;  2L7R A;  3RNC C;  3GE3 C;  3RNE C;  1I4G A;  1LM8 B;  4XX5 A;  1TKE A;  3H7P B;  3OLM D;  4EOY A;  1MPE A;  5J2R A;  1YN5 A;  3LXF A;  1C3T A;  1YQB A;  4DHJ D;  3GZN I;  5DPS A;  3AV8 A;  3B2G A;  1FXA A;  2CJN A;  1MI0 A;  3U7D A;  2I2Y A;  2W54 A;  3KWL A;  1F77 A;  3AU4 A;  1F1H A;  1GNU A;  2ONQ A;  2WLB A;  3TEW A;  2MP2 A;  2ZCC A;  4WWM A;  5GXG B;  4AQ7 A;  1KM7 A;  4A8X C;  2MH7 A;  4ZRQ A;  1HTQ A;  1WIA A;  5E6O A;  2WXH A;  3IG3 A;  2C60 A;  4WJO A;  3LB8 C;  1UD7 A;  2MRP A;  5E6N A;  2KWC A;  1AN8 A;  2JUO A;  2FUG 1;  4TKN A;  5AZF A;  1V6E A;  4W9C A;  3RUL A;  1VLB A;  4HWI B;  1KTK A;  4LDT B;  2LGX A;  4YTM B;  2BF8 B;  1MVK A;  1BXT A;  4LNF A;  3AUL A;  1OEY J;  2TSS A;  1JRU A;  2KAJ A;  3SU8 X;  3AE2 B;  1YJJ A;  2X8X X;  3P4S B;  2GBM A;  2KWD A;  3AU5 A;  1NVI D;  1FEH A;  2VH2 A;  2KNB A;  2DZK A;  2IY0 B;  3KYC D;  2LRW A;  1VR9 A;  2L1A A;  1ZP0 B;  3UQA A;  1P9D U;  1LQB A;  2XBB C;  4LNO A;  2MWS B;  1C1Y B;  4M0W B;  3TSS A;  3KH0 A;  4FHK A;  4MEL A;  4E71 A;  4DXG A;  2BYT A;  4TQ1 A;  2N7J A;  3Q14 C;  2Y3A A;  3PRE A;  4CO7 A;  1C76 A;  2FCM A;  5DPT A;  4ZYS A;  3DHH C;  1Q0W B;  2WXN A;  4HEA 1;  4A3P A;  3ZLZ A;  1KLG D;  3Q8E A;  1TKG A;  3W2D A;  1WI0 A;  4BKG A;  4WIP A;  1FNW A;  1I42 A;  1MG8 A;  2ZPY A;  1ZKH A;  4N59 A;  5JHB A;  3P4P B;  5FR3 A;  2Y5C A;  3DVN V;  4II2 B;  1IBX B;  3TMP B;  1M4V A;  1QOF A;  2G4D B;  4P7I A;  4RGN A;  2JT4 B;  3HVZ A;  3M95 A;  3EFC A;  3A9K B;  4YSY B;  3WIM A;  3Q2A C;  1IUE A;  1I4R A;  2KT7 A;  3JYU A;  4LCD E;  2NBV B;  2Z8L A;  2NBU A;  3ZRC A;  1SJE D;  4FJV B;  1YIW A;  4GIV A;  2EMT A;  5HKH A;  1IPG A;  4XDD A;  3QAR A;  4NNJ B;  2L8J A;  3P42 A;  1E8Y A;  4JGH B;  2KDB A;  2LD9 A;  2K6D B;  3ZW3 A;  1OQQ A;  2GLS A;  4HJG E;  2E3T A;  4O1N A;  1SGH A;  4M8N A;  2KN5 A;  4MH8 A;  3LJ3 A;  1WYG A;  3VHT C;  2MX2 A;  5G5G A;  1MG4 A;  2K22 A;  2ZEQ A;  5D3D A;  5EE3 A;  3RNF C;  3J9C A;  2WWZ A;  5BMI A;  5E6P A;  2INN E;  2R61 A;  3I3T B;  4FBJ B;  2LHD A;  4W9I A;  2JZ3 B;  2QSD A;  3IAM 1;  5C23 A;  1GG3 A;  2IGG A;  2KWU B;  3DWM A;  3DHI C;  1CQV A;  1UNS A;  4ANW A;  2N9E B;  4GLS C;  4FXC A;  3UIP B;  1M94 A;  4B95 A;  4IW0 A;  1DOY A;  2XK5 B;  4I6P A;  2CU3 A;  2J0M A;  3S2A A;  1VZ6 A;  2HJ8 A;  3U7Z A;  1P7F A;  3P4R B;  4G11 A;  1EU4 A;  2KFK B;  3L17 A;  2LXC A;  2EKI A;  2IYD B;  1YQ3 B;  3NVV A;  1H4R A;  4W9K A;  4RF1 A;  4FN2 A;  3NS8 A;  3Q69 A;  1OEY A;  1QOA A;  3AEE B;  2BTE A;  2JF5 A;  2KQS A;  2W3R A;  5FR6 A;  3NVZ A;  4MT5 A;  2EMS A;  4M00 A;  2CHW A;  4GMV A;  4RCO A;  3WAL A;  1YJI A;  5DPW A;  1F0Z A;  3VTV A;  3AEG B;  1GC7 A;  1SIJ A;  2O2V A;  3VVW B;  3EA6 A;  4BOZ B;  2V4L A;  2PIA A;  2D11 A;  3JSV B;  5D7G A;  3X0W A;  3H7P A;  2JRI B;  2WX0 A;  2N4F A;  5L95 C;  3N1X C;  2DLB A;  4OZB A;  1JRP A;  2PEA A;  2LVQ A;  2K1F A;  4YSZ B;  1TY0 A;  3UGB B;  3GOE A;  4GB9 A;  2WXK A;  3A4S C;  2DZI A;  3Q8B A;  1XCQ L;  2H89 B;  1ET6 A;  3A33 B;  4DQO C;  1V1P B;  3TBL D;  5TSS A;  2RGF A;  3K9P B;  1FIQ A;  3C8Y A;  3AEF B;  3VH4 B;  1MJD A;  4US8 A;  2WXI A;  2KYW A;  3JW0 X;  3BYY B;  4LJP B;  2J4X A;  1J0G A;  2LGD A;  3T9L A;  5JXV A;  1IGD A;  4WWO A;  2BWF A;  4PS3 A;  3AEB B;  1FPY A;  4IC7 B;  3PRZ A;  4MM3 B;  4C7Y A;  3ZNZ B;  4HRO A;  4MJS B;  1V9J A;  4BVU C;  2WXG A;  5LXI B;  4IDI A;  3AED B;  1SBB B;  1C9F A;  4URK A;  2BQQ A;  3A9J B;  3TEX A;  2KMA A;  3RN9 C;  3P63 A;  1GB4 A;  3AE4 B;  2B3A A;  1I7H A;  3DVN U;  3IFW B;  3AEA B;  4AJY B;  5BYR A;  5CHV C;  2G4S A;  1T5X D;  2N1V A;  4DHZ E;  1V5T A;  3H9D A;  1P3Q U;  4OW0 A;  1FO4 A;  3OG5 A;  4M0W A;  3SDL C;  1YNT E;  3ZDT A;  3URY A;  4H2A A;  1H8C A;  1LGR A;  1QLB B;  3NHE B;  2KVR A;  4M01 A;  2DZM A;  3EC8 A;  4W9F A;  1WM3 A;  4MSM B;  2OHF A;  3PTF C;  3I57 A;  2BGF A;  1NEK B;  5I4D A;  1VJK A;  3ZNI D;  4XWW A;  2G1E A;  1TGZ B;  4JL9 A;  3AE7 B;  2QHO A;  2QC8 A;  4TMA B;  2L00 B;  1XLO A;  4EE2 A;  4KSK C;  1X1M A;  5BO4 B;  2KAC A;  2LVP A;  3HM6 X;  4B9K A;  4F8C B;  5J17 A;  3MHZ A;  2IGH A;  2K6Q A;  1A5R A;  1KOT A;  3PLV A;  1IBX A;  4A3O A;  4EKU A;  2VRR B;  3BZD B;  4TUU A;  2FIF A;  1SE9 A;  5BYQ A;  2DAF A;  4KDL B;  4JLC A;  3IT4 B;  4WJQ A;  1WXM A;  3WAO A;  5JHA A;  4GDL A;  2JZP A;  4OVV A;  1IP9 A;  2E6X A;  4EZK A;  4DBG A;  3BK2 A;  5H8Y E;  1WJ4 A;  1WZ3 A;  2KD0 A;  2W3S A;  3KQ4 A;  1V2Y A;  3TEY A;  2DEN B;  5FK9 C;  3BVM A;  5AZG A;  3SHQ A;  1FNV A;  2GB1 A;  1E0Z A;  3RMK C;  4HKQ A;  4GXB A;  4LNN A;  1AYF A;  4R3D A;  2KLG A;  4DDI D;  1WYW B;  2JVC A;  1WZ0 A;  3U2S C;  1WJN A;  4KZC A;  1SIF A;  2D3C A;  5HI1 A;  1R4N B;  2QIE B;  1JWM D;  1XF5 L;  3LDZ E;  4W9J A;  4IM0 A;  3DBL I;  2R2Q A;  4DHZ B;  4EEW A;  3A1Q B;  3SFD B;  2O6V B;  5IAA C;  2XK5 A;  4KV2 A;  4AS1 A;  1TT5 B;  3VRA B;  1YD8 U;  1L0V B;  3H8H A;  4P6V F;  1L0Y B;  4FJY A;  2LJ5 A;  3W1Y A;  1AW7 A;  3VDZ A;  4MGK E;  1WM2 A;  3APD A;  1DYQ A;  1RRB A;  1ZDX A;  4A6Q A;  3P1M A;  1I4X A;  2INP E;  3DCG A;  3ML8 A;  3DVG X;  1UH6 A;  2AYO B;  3M63 B;  3DHG C;  2C7N B;  4US9 A;  1HQR D;  4RM9 A;  4HCP B;  1D5M C;  2JXT A;  2M1M A;  2KWV B;  4BFR A;  1OGW A;  3T8M A;  3FC4 A;  1YMH E;  1NYQ A;  1ZXH A;  2CS4 A;  4LNK A;  2K9X A;  2FCN A;  1L6V A;  5C3J B;  4AOF A;  3TEZ A;  2W55 A;  3JSV A;  4XE0 A;  1YX6 B;  2GBR A;  3RYT A;  3PZ7 A;  1GB1 A;  1AAR A;  2V1Y A;  3EHV A;  3WAM A;  4W9D A;  4ZRJ A;  1HE8 A;  3ZGZ A;  3DBH I;  1K8R B;  3O65 B;  1BT0 A;  1WX9 A;  2XEW A;  3OAW A;  3T3N A;  4DXA B;  4ZYN A;  4LNI A;  5L83 A;  1V1P A;  2WXM A;  4IWQ A;  1EUV B;  2IPK D;  2RMM A;  3KW5 B;  1L4D B; 
#chains in the Genus database with same CATH homology
 4M8M A;  2GBJ A;  3ZRC A;  1D3Z A;  4BBN F;  4FJV B;  2D10 A;  3L10 B;  1YIW A;  1UEL A;  1WMH B;  4GIV A;  2LI5 A;  2EMT A;  3K9O B;  5HKH A;  1IPG A;  2ZVO A;  1E7V A;  3QAR A;  4FHJ A;  4NNJ B;  5D94 A;  3RZF A;  4LDT D;  4CHK A;  2KZR A;  3QQ8 B;  4HLE A;  2IO3 B;  4G50 A;  1WGH A;  2L8J A;  1E8Y A;  3CF6 E;  4JGH B;  2JPH A;  2KDB A;  2LD9 A;  4EUT A;  2UYZ B;  3DQV A;  2K6D B;  3ZVV A;  3ZW3 A;  2C5L C;  2MP2 B;  2O6V D;  4MM3 A;  2DYB A;  4AJW A;  2FCS A;  3IHP C;  4MJS A;  1WX7 A;  2MBB B;  3NZS A;  2OOB B;  4IM2 A;  4BBN C;  1GUA B;  2V3S A;  1SGH A;  3ZTD A;  1PQS A;  1KLV A;  4M8N A;  2KN5 A;  3R7Q A;  2KMC A;  3MHS D;  1T0Y A;  4W9H A;  1WGD A;  3A9J A;  4EZL A;  3ML9 A;  3PVL A;  3LJ3 A;  3VHT C;  2MX2 A;  2IZV B;  2ZEQ A;  1WX8 A;  2J0K A;  2EKE C;  3NY5 A;  1WY8 A;  2WWZ A;  3PGE A;  3QJZ A;  5E6P A;  3L16 A;  3I3T B;  1WE7 A;  2KDE B;  4FBJ B;  4W9I A;  2JZ3 B;  3H1U A;  3VFK A;  1WFY A;  5J18 A;  2CHZ A;  3R66 C;  2CHX A;  5C23 A;  1GG3 A;  2KWU B;  2KKC A;  2KFK A;  1UBQ A;  2C9W B;  2LRU A;  4ANW A;  2N9E B;  3AXC A;  2FUH B;  3W1S A;  2GBK A;  3UIP B;  4B95 A;  1M94 A;  4IW0 A;  1EF1 A;  1CMX B;  1WF9 A;  2AL6 A;  2XK5 B;  4I6P A;  2J0M A;  3V61 A;  3S2A A;  2HJ8 A;  1F9J A;  2GOW A;  4G11 A;  4HXD A;  4XC2 A;  4MDK E;  2KFK B;  3PS6 A;  3UQB A;  3L17 A;  1QZE A;  2W9N A;  3RCZ A;  2AL3 A;  2L3Z A;  2LXC A;  3PSE B;  1NI2 A;  2IYD B;  4XZ4 A;  1WGG A;  2DYM A;  4HPL B;  1H4R A;  1GJZ A;  4W9K A;  4TQ0 A;  4NQL B;  1E5W A;  2MBE A;  1Y8R C;  4FN2 A;  4K7S A;  4NQK E;  3NS8 A;  1OEY A;  2ZPN A;  3MJW A;  2KO3 A;  2JF5 A;  3HM3 A;  2KQS A;  2LUE A;  5FR6 A;  1GC6 A;  2NPT A;  2EMS A;  2N7D A;  4FUL A;  2N9P C;  2K8B A;  2JRH A;  1YX5 B;  2CHW A;  2BPS A;  2RPQ A;  4BOS C;  1TTN A;  1WRD B;  2D2Q A;  3N30 A;  3QX1 A;  4GMV A;  3WAL A;  2KJR A;  2IO0 B;  5DPW A;  1J19 A;  2LVO A;  3VXW A;  4BKS D;  3VTV A;  2FNJ B;  3ONS A;  1GC7 A;  5JZE B;  2KLC A;  2O2V A;  3VVW B;  4KIK A;  3OJ3 A;  3R7R A;  4BOZ B;  4WQO B;  2AEH A;  2KTR A;  2V4L A;  3PPA A;  1UGM A;  3X23 A;  4W9E A;  2YLM A;  2D11 A;  4DDG D;  1XT9 B;  5EDS A;  3JSV B;  5D7G A;  4MGI E;  1Z5S B;  2A4Z A;  2FAZ A;  4FA6 A;  3PZD A;  1VD2 A;  2DX5 B;  2KX0 A;  3H7P A;  2JRI B;  4MGY E;  2WX0 A;  3X0W A;  3ZO5 B;  2YVC A;  1UBI A;  2N4F A;  2ZNV B;  5G55 A;  5L95 C;  3QA8 A;  2MA9 B;  3TJP A;  2PEA A;  4RMA A;  3UIN B;  5KHQ A;  2LWP A;  4ICV A;  2K8C A;  2LVQ A;  3MTN B;  4IG7 B;  2K1F A;  1WE6 A;  2BKR B;  4W9G A;  3KVF B;  3M3J A;  3UGB B;  3GOE A;  3KUD B;  3R3M A;  4GB9 A;  2Z59 B;  3A4S C;  2KDI A;  2DZI A;  2REX A;  3H6N A;  4HK2 A;  4PS8 A;  2BYF A;  4ZRI A;  2PPH A;  2KTF A;  2OJR A;  2DHZ A;  3A33 B;  3PRP B;  2RD0 A;  4BKT A;  1LFD A;  1U4A A;  2MLB A;  5CX3 A;  1V86 A;  4W9L A;  3TBL D;  1V80 A;  2RGF A;  3K9P B;  4GSW A;  3P2B A;  1R4N I;  1XD3 B;  2M0X A;  5DPR A;  3ZNH B;  4EFO A;  2PJH A;  2NS5 A;  4PS7 A;  3VH4 B;  4OVU A;  3H7S A;  4MEM A;  2KJ6 A;  4GGQ A;  4NAW A;  1RFA A;  2Y5B B;  3WAP A;  2L76 A;  4ZRK A;  1WJ6 A;  2MQJ A;  2IO1 B;  3JW0 X;  3RZW C;  4KSL C;  2PE9 A;  4LJP B;  3VUW A;  1J0G A;  4DK5 A;  2LGD A;  3T9L A;  2ZZP B;  2N9X A;  2JXX A;  4G3X B;  3V6E B;  4WWO A;  3JVZ X;  2N1W A;  4GOC A;  1WXV A;  3DBR I;  4HPM B;  4ANU A;  4DHJ B;  2BWF A;  2Z0D B;  4PS3 A;  1S1Q B;  3ZDM C;  4IC7 B;  3PRZ A;  3EFU A;  2J7Q B;  3ZNZ B;  1P1A A;  4HDO A;  2BKF A;  3L08 A;  4KDI C;  1NDD A;  1V9J A;  4MJS B;  4BVU C;  3HK0 A;  4FAD A;  5LXI B;  4LJO B;  2NCN A;  4GDK A;  3A1Q A;  2CR5 A;  2NR2 A;  4URK A;  2O6V A;  3KYD D;  3DOW A;  1TBE A;  3A9J B;  3QWZ B;  2KMA A;  4II3 B;  2MBQ A;  2BYV E;  2B3A A;  2NVU I;  3DVN U;  3IFW B;  2KQ7 A;  3N3K B;  4ANV A;  4ASW C;  4AJY B;  1KJT A;  2AWT A;  5CHV C;  3HIZ A;  4K81 A;  2G4S A;  2N1V A;  2G45 B;  1V5T A;  3DVG Y;  4DHZ E;  3H9D A;  3L0W B;  1I35 A;  1P3Q U;  1WJU A;  3PV1 A;  4HJK A;  2GBN A;  4N9F 4;  5DCN A;  3SDL C;  3VUX A;  4DWF A;  5LXH A;  3BY4 B;  2C7H A;  2G3Q B;  3ZDT A;  1WGR A;  5LLI A;  4IM3 A;  4EZJ A;  2IBI B;  3EEC A;  1OTR B;  3PT2 B;  4MH0 E;  4JIO U;  1EF5 A;  1YJ1 A;  2ASQ A;  4NJ6 A;  2M8S A;  3NOB A;  4YL8 A;  1H8C A;  2ZVN A;  1P0R A;  2C7M B;  4KVG B;  3NHE B;  2KC1 A;  2KVR A;  2MBO A;  3QHT A;  2DZM A;  3EC8 A;  4CYE A;  4W9F A;  1WM3 A;  2BYE A;  4MSM B;  3PTF C;  4MGZ E;  2D07 B;  2BGF A;  4JQW C;  2WDT B;  4FLH A;  2PE6 B;  4GU2 A;  5TR5 A;  4E3C A;  1G6J A;  4K1R B;  1Q1O A;  3ZNI D;  3IBE A;  1TGZ B;  3TCA A;  3TL5 A;  4JL9 A;  3V60 A;  2QHO A;  4NPN A;  2DYO A;  1WXS A;  2L00 B;  2Z0E B;  3D32 A;  2A5U A;  4HCN B;  4K7W A;  4KSK C;  1X1M A;  4HDQ A;  5BO4 B;  2LVP A;  2KX3 A;  3B0A A;  3HM6 X;  3N32 A;  4WAA A;  4B9K A;  4F8C B;  3QCA A;  2ZNV C;  2L0F A;  2L0T A;  5J17 A;  2KJH B;  2NPT B;  2ZCB A;  3KUZ A;  2M4N A;  3QAQ A;  3ZIM A;  2D3G A;  2K6Q A;  3C0R B;  3B1L X;  3M62 B;  1A5R A;  5JH5 C;  5CTR C;  1XQQ A;  1ZW7 A;  3ALB A;  3U30 A;  3IVF A;  4MSQ B;  1V49 A;  1KOT A;  3PLV A;  1LXD A;  1ISN A;  1TZ1 A;  3VUY A;  4A3O A;  4EKU A;  2O2V B;  4KIK B;  1Q5W B;  2VRR B;  4TUU A;  4ANX A;  2KTR B;  1NBF C;  1V5O A;  2FIF A;  3KUC B;  1SE9 A;  4IWP A;  2CU1 A;  2L7R A;  1S3S G;  1RLF A;  4PYU A;  4BKS A;  4HVB A;  2DAF A;  1LM8 B;  1ZGU B;  3PRM B;  4JLC A;  4KDL B;  4XX5 A;  2HD5 B;  2RR9 A;  5C1Z A;  3H7P B;  3ZKJ C;  3OLM D;  4TV3 A;  4WJQ A;  1WXM A;  3UIO B;  3WAO A;  4EOY A;  5JHA A;  5J2R A;  4X57 B;  4GDL A;  4WJP A;  1C3T A;  4OVV A;  1WMH A;  1YQB A;  2CKH B;  3L13 A;  3GZN I;  4NJ7 A;  5DPS A;  4DHJ D;  5IA7 A;  1IP9 A;  1V81 A;  3U7D A;  4DBG A;  4EZK A;  4AUQ C;  1WH3 A;  1WJ4 A;  1WZ3 A;  3AU4 A;  2KXJ A;  3CMM B;  3DPD A;  2KD0 A;  1GNU A;  1E90 A;  1V2Y A;  3CSF A;  4GDL B;  2DEN B;  4IWO A;  4AP4 C;  2MP2 A;  2ZCC A;  3HHM A;  4WJN A;  3APC A;  5AZG A;  3SHQ A;  1KM7 A;  3VTU A;  3PHX B;  3DBS A;  4NAW B;  1WIA A;  5E6O A;  1E8Z A;  3AI5 A;  3IG3 A;  2C60 A;  4GXB A;  3V62 A;  3CST A;  4WJO A;  4B6W A;  3KW5 B;  1RAX A;  1UD7 A;  2MRP A;  2FID A;  2KC2 A;  1E8X A;  5E6N A;  2KWC A;  4PYZ A;  1J8C A;  2KLG A;  2K39 A;  2JUO A;  4DDI D;  2L05 A;  1WYW B;  1E8W A;  1WZ0 A;  2JVC A;  1WJN A;  4KZC A;  1WGY A;  3QIJ A;  1SIF A;  2NBW B;  3VAW A;  4TKN A;  5AZF A;  2HTH A;  4GN1 A;  1V6E A;  2LZ6 A;  4W9C A;  3LDZ E;  3RUL A;  4HWI B;  1P98 A;  4W9J A;  4WWN A;  3L54 A;  4LDT B;  3W1S C;  5KHO A;  4IM0 A;  2LGX A;  3DBL I;  5CHW A;  2R2Q A;  3NZU A;  2BF8 B;  4DHZ B;  5AZH A;  4EEW A;  3VH3 B;  3AUL A;  4GDK B;  1OEY J;  3A1Q B;  4AWJ A;  1JRU A;  2O6V B;  3SU8 X;  5IAA C;  3ZRF A;  2XK5 A;  4KV2 A;  2IO2 B;  3WA0 A;  2MBH A;  1EO6 A;  3Q3F A;  2GBM A;  1YD8 U;  3B08 A;  1WR6 E;  3AU5 A;  2KNB A;  2DZK A;  3RD2 A;  4I6N B;  2IY0 B;  4FJY A;  3KYC D;  2LRW A;  3V6C B;  3VQI A;  1IYF A;  4WWP A;  1OQY A;  2JY6 A;  2LJ5 A;  3W1Y A;  3UQA A;  1P9D U;  3SD5 A;  1LQB A;  3VDZ A;  2WYQ A;  2XBB C;  4MGK E;  1WM2 A;  3OJ4 B;  2MWS B;  5D6J B;  3APD A;  3BIN A;  1C1Y B;  2N7E A;  4M0W B;  3ZTC A;  1RRB A;  2MCN B;  4ZDV A;  3KH0 A;  4FHK A;  4A20 A;  3DCG A;  2LXA A;  2JZZ A;  3ML8 A;  2R2O A;  3DVG X;  4J6I A;  4KZ0 A;  1UH6 A;  2AYO B;  3M63 B;  4MEL A;  4E71 A;  3PLU A;  2C7N B;  4TQ1 A;  1WR1 A;  3Q3J A;  4RM9 A;  1L2N A;  2KHW B;  4NY0 A;  3DDC B;  4HCP B;  2KOX A;  2M1M A;  3ECI A;  2KWV B;  3APF A;  4BFR A;  3ZUN A;  2LAS A;  1OGW A;  3PRE A;  3T8M A;  4CO7 A;  2FCM A;  5CHF A;  1Z2M A;  5DPT A;  3A4R A;  2CS4 A;  2M17 A;  1Q0W B;  1UZX B;  4A3P A;  2I1J A;  2KFJ A;  4I6L B;  3VTW A;  2FCN A;  1R4M I;  3QC8 B;  2MSE D;  4AOF A;  4G0N B;  2WX1 A;  3ZLZ A;  2UWQ A;  3JSV A;  2JWZ A;  1WI0 A;  2GMI C;  2MW5 A;  1WXA A;  1FXT B;  3PHW B;  2KAN A;  1YX6 B;  4BKG A;  2GBR A;  3RUI B;  4K7U A;  2KDF B;  3RYT A;  1AAR A;  5AEK B;  2BWE S;  3WAN A;  3A9K A;  4FJZ A;  1I42 A;  1MG8 A;  2V1Y A;  3ZNG C;  4F7Z A;  3EHV A;  1L7Y A;  1ZKH A;  2ZPY A;  4IUM B;  4W9D A;  1HE8 A;  4ZRJ A;  5G2N A;  3WAM A;  4E74 A;  5JHB A;  3U8Z A;  3ENE A;  2IY1 B;  3TIX A;  2DAJ A;  2K8H A;  2RSU A;  3DVN V;  4ICU A;  4II2 B;  3DBH I;  3TMP B;  1K8R B;  3RT3 B;  2G4D B;  3O65 B;  4P7I A;  2K25 A;  1BT0 A;  1E7U A;  2KK8 A;  2JT4 B;  3M95 A;  1WX9 A;  5GMV A;  2XEW A;  2HE7 A;  2ZJD A;  3A9K B;  3OAW A;  3QK0 A;  2FCQ A;  4F1S A;  4DXA B;  4ZYN A;  3WIM A;  3UF8 A;  2LGY A;  5L83 A;  2J0J A;  4IWQ A;  4RM8 A;  2DZJ A;  1EUV B;  1VCB A;  2NBV B;  3JYU A;  4LCD E;  5D2M B;  2NBU A;  2I1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...