3V60A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
PETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v60A00
3M63B 5LXHA 2FUHB 2KFKA 1WH3A 1MG8A 2KQSA 2K8HA 3N32A 4OVUA 5C1ZA 4WJQA 1KLVA 1YJ1A 1S3SG 1QZEA 1XD3B 1RLFA 3EECA 4ZRJA 4KIKA 1KJTA 2JY6A 3S2AA 2LGYA 2HTHA 2IY0B 3UF8A 2C7HA 2KWVB 2KFKB 2AEHA 4GN1A 4ZRIA 5G55A 4WWOA 3L54A 3DOWA 3N3KB 3CF6E 3CSFA 2BF8B 1WY8A 2ZPYA 3PSEB 3ZDMC 4WAAA 4X57B 2DZJA 3U30A 5J2RA 3DBLI 2N4FA 3VTVA 4E3CA 5KHOA 3DBHI 2CR5A 3SHQA 3VUYA 1SGHA 3WIMA 2KVRA 2ZVOA 4XZ4A 3UIOB 1GC6A 3PRMB 3H1UA 5D94A 3WAMA 3W1SC 3H7PB 4MM3A 1WX8A 4BBNC 4MJSB 1P3QU 3NZSA 1UD7A 1KOTA 3AU4A 2KOXA 2KHWB 3R66C 4GSWA 3PGEA 3Q3JA 3RCZA 3VVWB 4EZJA 1I42A 4LJPB 3AI5A 2N9XA 2W9NA 2A4ZA 2DAJA 2MA9B 3QC8B 2BPSA 3V62A 2FCSA 2KN5A 3QX1A 2FNJB 1V6EA 4RMAA 4DWFA 2L05A 4GU2A 2C5LC 2C7NB 2KMAA 3OJ3A 5CHFA 1NBFC 4WQOB 1OEYJ 3DQVA 2KQ7A 4AJWA 2KX3A 2L76A 3ZNID 2DHZA 4DDID 2BKRB 2ASQA 4IM0A 2KXJA 2XK5B 1YD8U 2YLMA 2LRUA 4GGQA 5JH5C 2G4DB 4CYEA 2M4NA 2N1VA 5KHQA 1YX5B 1J0GA 3RUIB 4M8NA 2ZJDA 1UH6A 2WWZA 4EKUA 1GC7A 5C23A 4HVBA 3A33B 3PREA 4RM9A 2NBUA 3JSVA 4FHKA 2IYDB 2JPHA 4HXDA 4W9KA 4WWNA 4TQ0A 3UIPB 1UBIA 4W9CA 2KD0A 3WAOA 3JVZX 1A5RA 3NS8A 2JWZA 2ZNVB 2LVQA 2JZ3B 2KDEB 2J0KA 4LDTB 5G2NA 1D3ZA 2CKHB 4FBJB 4F8CB 1ZGUB 1RAXA 2BKFA 2KWUB 4W9DA 4HCPB 5JHBA 4EFOA 2V1YA 2V4LA 2NBVB 2QHOA 2A5UA 2KZRA 1X1MA 4GDLA 2N7EA 3IG3A 4WWPA 4ZRKA 5AZHA 5LXIB 3IFWB 3ZO5B 3SD5A 2LGXA 2O6VA 1E90A 1WE7A 4GIVA 3ML8A 2KX0A 1J19A 2RD0A 1R4MI 1YQBA 3L13A 3KH0A 2L3ZA 3EC8A 2KO3A 2MBHA 1V81A 1NDDA 4KDIC 3ZRFA 2KTRB 4OVVA 2GBJA 4NQKE 2EMSA 1XQQA 2JVCA 4LDTD 3R7QA 2KFJA 2D2QA 4HDQA 3PLVA 2N1WA 1WJUA 3TJPA 3UINB 3GOEA 2WX0A 4EZLA 2DYMA 3GZNI 1P1AA 4KIKB 4F1SA 1WGHA 1Y8RC 2GBRA 3X0WA 4XX5A 3R3MA 3PT2B 1G6JA 4HCNB 1OEYA 3ZRCA 3HM3A 4ANVA 4FLHA 2MP2A 3ZDTA 4FJYA 1P98A 3EHVA 2MCNB 1E7VA 2KKCA 2KTFA 3A1QA 3PV1A 1H8CA 1LXDA 2AL3A 3DBRI 3PLUA 5LLIA 4NQLB 2KK8A 2D3GA 3KYCD 3PHWB 5JZEB 3PTFC 2BYEA 3AXCA 1R4NI 1EUVB 1WR1A 2K25A 2Z59B 3VUWA 1IPGA 1UELA 1TZ1A 2RGFA 3NOBA 4JIOU 3IBEA 4IUMB 1IYFA 4DDGD 2DZIA 3LJ3A 5GMVA 4E71A 5HKHA 3ECIA 2NPTB 5D7GA 4HLEA 2IBIB 3KUCB 4BOSC 4IM2A 3ZIMA 1WZ0A 3A9JB 3DBSA 4TUUA 2WDTB 5CTRC 4I6LB 2UYZB 2MW5A 2LD9A 1V80A 2I1JA 3IHPC 3RT3B 2N9EB 2DZKA 2L00B 2KC1A 3I3TB 2JRHA 2LZ6A 2MLBA 3VTWA 2PPHA 3ML9A 4W9FA 3QWZB 2KJHB 3Q3FA 3P2BA 2ZZPB 1RRBA 2GBNA 2KWCA 1LFDA 2FAZA 2D10A 1WFYA 2G45B 4K7UA 3A1QB 4DBGA 2O6VD 4IWQA 3ZNHB 3ZTCA 4A3PA 3UQAA 3PPAA 5J18A 2RSUA 5D6JB 3QIJA 4M8MA 4MSQB 4ZYNA 2KJ6A 1WM3A 4BKSD 3PRPB 4BKTA 1I35A 3KYDD 4FULA 3JW0X 4KVGB 3QHTA 4B9KA 2KLCA 2OJRA 3SDLC 2ZCCA 1IP9A 5L83A 4MSMB 3A9KA 2KTRA 2LVOA 2KDBA 2R2QA 3KVFB 2XBBC 2CHZA 3OJ4B 4HJKA 3NHEB 3V61A 3VQIA 2CHWA 3DPDA 2O6VB 3UQBA 4HDOA 2LJ5A 5DCNA 1T0YA 1TTNA 2L0FA 4A3OA 1KM7A 1CMXB 1L7YA 4F7ZA 1FXTB 2L0TA 4TQ1A 4BBNF 2PEAA 3EFUA 4FADA 1WF9A 3APCA 4WJOA 2MRPA 3QJZA 3OAWA 3VUXA 3T9LA 5EDSA 4FHJA 1WZ3A 4JGHB 2D07B 1S1QB 2C60A 2KC2A 4DHZE 2M17A 2ZVNA 4HWIB 1E8XA 3IVFA 3VXWA 4KSLC 3RULA 3QA8A 4K7SA 3TBLD 2NS5A 4GDKB 4HK2A 3BINA 3RZWC 1PQSA 1UZXB 3ZTDA 4DHZB 1E8YA 3QK0A 1WMHA 2DYBA 5DPSA 2ZNVC 4LCDE 4AWJA 4I6PA 3H9DA 1WGGA 5J17A 2FCQA 3NY5A 3QARA 2WX1A 4AUQC 3MTNB 4NNJB 1WJNA 2XK5A 4XC2A 1WXAA 4PS8A 1WMHB 4PS3A 4WJPA 1UGMA 2K8BA 3X23A 1E8WA 3VFKA 2JF5A 4G50A 3U8ZA 1GG3A 4NAWA 4FN2A 4II3B 5AEKB 3PVLA 4G11A 3WALA 3L16A 2JZZA 2MBOA 4LJOB 2DZMA 2RR9A 4KZCA 3BY4B 2CU1A 3VAWA 1E8ZA 5DPWA 3DVNV 1V2YA 2C9WB 2M0XA 4ANUA 1TGZB 5IAAC 2RPQA 4ANXA 2JXXA 4ICVA 1WI0A 2AL6A 5CHVC 2KMCA 1K8RB 3RYTA 4AJYB 1V9JA 4URKA 1C3TA 1WRDB 4B6WA 4IWPA 3DVGX 1V5TA 2MBQA 1YIWA 4B95A 1SE9A 4K81A 4NY0A 4FA6A 2MQJA 2DYOA 2O2VA 4IG7B 4IWOA 4EOYA 2AYOB 5L95C 4IM3A 3ZNZB 4W9EA 3A4SC 5E6PA 2CS4A 1JRUA 2BWFA 2G3QB 3W1SA 3ZVVA 3B1LX 4JQWC 4GB9A 4KZ0A 2L8JA 2MSED 1TBEA 2GBKA 5BO4B 2ZEQA 3KUDB 4BVUC 1LM8B 2FIFA 4CO7A 2HD5B 3VTUA 2NVUI 5JHAA 2BWES 5AZFA 2M8SA 4EUTA 2FIDA 4NJ6A 5D2MB 1EO6A 3VH4B 4M0WB 1E5WA 3TMPB 1WJ6A 2REXA 3KW5B 3CMMB 1ZKHA 5E6OA 4CHKA 2LUEA 1V86A 4YL8A 2JT4B 1ISNA 1WGYA 4BFRA 4PYUA 3K9OB 2LRWA 2R2OA 2YVCA 4WJNA 4E74A 2KANA 3ZUNA 1V49A 1WXSA 3ZKJC 2JUOA 2KLGA 4PS7A 3A9JA 2PE9A 1OGWA 1WXMA 1E7UA 4NJ7A 4MGIE 4MGZE 2J7QB 2Y5BB 2Z0EB 2BYVE 2I1KA 1OQYA 2GBMA 4MELA 3HK0A 2LXAA 2Z0DB 2HJ8A 3OLMD 2B3AA 4TV3A 2HE7A 2L7RA 3B08A 4TKNA 2K6DB 1NI2A 1AARA 1H4RA 1WGRA 1WJ4A 4MH0E 4ZDVA 4JL9A 2MP2B 3HHMA 5IA7A 1Q5WB 2IO3B 1XT9B 4IC7B 4ASWC 2GMIC 3T8MA 1EF5A 3ALBA 4W9HA 2LWPA 2DX5B 1WX7A 3DVNU 2V3SA 3LDZE 3AULA 4MGYE 3R7RA 3H7SA 4AP4C 4DHJB 3VH3B 2OOBB 2XEWA 3C0RB 3K9PB 3MHSD 3TIXA 4HPMB 2FCNA 2C7MB 1Z5SB 4I6NB 3VDZA 3CSTA 5DPTA 4BKGA 3WANA 1Q1OA 3D32A 2ZPNA 3L0WB 3QCAA 3HM6X 3RZFA 2J0JA 3APFA 2EKEC 5AZGA 2J0MA 3WA0A 1HE8A 2IO1B 3ZW3A 2FCMA 1OTRB 1WYWB 2LASA 3APDA 3U7DA 2O2VB 4FJVB 2ZCBA 3RD2A 1WXVA 3TCAA 1WM2A 4DHJD 4HPLB 4DXAB 1SIFA 4K7WA 2M1MA 4GMVA 4G0NB 2BGFA 2WYQA 3MJWA 3ONSA 3L10B 4MDKE 2IY1B 2K6QA 2K8CA 3PHXB 4GDLB 1LQBA 4AOFA 4A20A 2LI5A 3QQ8B 2MBBB 2NBWB 1GNUA 1C1YB 3KUZA 3H6NA 4N9F4 1Q0WB 2MBEA 3L17A 1WE6A 1P0RA 3TL5A 4IW0A 1VD2A 4GOCA 3JSVB 2GOWA 2N9PC 3A9KB 3N30A 4EEWA 3O65B 1WR6E 2IZVB 2AWTA 4MEMA 3DVGY 4GXBA 4KV2A 4NAWB 4W9LA 1M94A 2D11A 2VRRB 4EZKA 2IO2B 2CHXA 1J8CA 2BYFA 3SU8X 3JYUA 5E6NA 1YX6B 2G4SA 4PYZA 1UBQA 2MWSB 4FJZA 2KJRA 4II2B 2MX2A 3VHTC 4P7IA 3ZNGC 2PE6B 5DPRA 2LXCA 4J6IA 4ICUA 3UGBB 4G3XB 3L08A 2LGDA 2K1FA 2KNBA 4GDKA 3NZUA 1P9DU 4KSKC 1L2NA 1F9JA 1VCBA 2NR2A 3HIZA 3M95A 2EMTA 3W1YA 4JLCA 4W9IA 5CHWA 1BT0A 2DENB 2IO0B 2JRIB 3V6CB 3V6EB 4MJSA 3DCGA 1GUAB 1Z2MA 2KDFB 5FR6A 3PS6A 1GJZA 2NPTA 1RFAA 1U4AA 3V60A 4MGKE 4BOZB 4K1RB 3H7PA 3DDCB 4BKSA 3B0AA 3M62B 3QAQA 3ENEA 4W9GA 2KDIA 3ZLZA 4DK5A 1ZW7A 1V5OA 2PJHA 4ANWA 5CX3A 1EF1A 2N7DA 3AU5A 2UWQA 3M3JA 2NCNA 5TR5A 4W9JA 1WIAA 4NPNA 2DAFA 3PRZA 4KDLB 3A4RA 4RM8A 3WAPA 2K39A 1WGDA 3PZDA 1WX9A 2LVPA
chains in the Genus database with same CATH superfamily
3M63B 3DBRB 4HJGE 2KFKA 1WH3A 4TSSA 4MT5A 1LGRA 2K8HA 1B9RA 2KACA 1YJ1A 2WU2B 2HJ1A 3NVVA 5EE0A 4ZRJA 3AECB 4KIKA 5T8IA 1KJTA 1YOVB 3S2AA 2IY0B 2K0PA 2AEHA 1T3QA 2KQ4X 1V1PB 2ZPYA 1UGJA 3ZDMC 4WAAA 4E3CA 3MC0B 5FK9C 5KHOA 3VUYA 1SGHA 1WRIA 3UIOB 3PRMB 1T6BX 5D94A 1IGDA 2K22A 2JX5A 4MJSB 3W5VB 3OG5A 4GSWA 3AI5A 3QC8B 1T0RC 2KN5A 1V6EA 5C2TB 1C78A 1OEYJ 2TSSA 1ZXHA 4DDID 3UI3A 1RM6C 2ASQA 1R7SA 2KXJA 1TJEA 1YD8U 2XK5B 2YLMA 4GGQA 2G4DB 4CYEA 2M4NA 5KHQA 4HKQA 2ZJDA 2KWDA 2KN4A 5C23A 1FRDA 4RM9A 2WXMA 3JSVA 1UBIA 2FUG1 4LDTB 1D3ZA 4FBJB 1HZ6A 2BKFA 4EFOA 1TS2A 2LGIA 2QSDA 2O6VA 1E90A 3RNEC 1J19A 3RNBC 3WCQA 1R4NB 3ZRFA 2KTRB 1KLGD 2GBJA 4HRSA 2D2QA 2N1WA 1WJUA 2D3AA 1SIJA 3GOEA 1R4MB 4IDIA 2DYMA 2WXGA 1SE3A 5G5GA 4XX5A 3X0WA 2AQ2B 3HM3A 4FLHA 2MP2A 1OQQA 1D5ZC 1GOZA 1XLQA 1H8CA 1LXDA 3DBRI 4ZRQA 1IPGA 2RGFA 2DZIA 4LLGM 2AQ3B 3RI7C 2IBIB 1FPYA 4TUUA 3DBSA 4I6LB 2MW5A 3BVZA 3I3TB 3P2BA 1E9MA 2FAZA 1QT9A 2G45B 3A1QB 4IWQA 4A3PA 4HROA 3BK1A 3SR6A 1C9FA 3QIJA 4M8MA 4MSQB 5BYRA 2DLBA 4S0RA 1FNVA 1VLBA 4AQ7A 3QHTA 2W55A 3E56A 2LUMA 3Q8EA 2OJWA 3A9KA 1MFWA 3DBHB 4NZLB 4ZRPA 1RWSA 3NHEB 3Q8CA 1K53A 3DPDA 3Q8FA 1VZ6A 3UQBA 1J7CA 3BYTB 2AQ1B 1FXTB 3P4PB 4KGRA 3Q6BA 3VUXA 3P4SB 2FE8A 1WZ3A 2KC2A 1S1QB 4ARIA 4HWIB 2QMTA 2HDEA 3VXWA 3RULA 4K7SA 4HK2A 4GDKB 1AN8A 4DHZB 1WMHA 1TS3A 5DPSA 4AWJA 3H9DA 1FNUA 3NY5A 1RFKA 2WX1A 4AUQC 3TUOA 4C56C 1WJNA 4XC2A 2JF5A 3U8ZA 4G11A 2JZZA 4H2AA 5BMHA 1IUEA 1TKYA 2CU1A 1V97A 3RN9C 1V2YA 4XWTA 4ANXA 4JWSC 1XCQL 2AL6A 2PTLA 2KMCA 1K8RB 3RYTA 2Y5CA 2L52A 1ENFA 3P42A 4NY0A 2D5GA 5E6PA 4DXGA 1TKEA 3RMKC 1ESFA 3ZVVA 5BYSA 2J53A 3NG0A 1ZXIA 3KUDB 1LM8B 4M00A 1I7HA 2JSVX 4P1CC 4BZAA 2REXA 3CMMB 1YMHE 5E6OA 2LUEA 2G1EA 2JT4B 1ISNA 4RGOS 1SEBD 2G9HD 3NS1A 1WXSA 4NAMA 4HEA1 3ZKJC 2PE9A 1OGWA 1I4XA 2Z0EB 2I1KA 4USAA 4GLSC 4S17A 3DWGC 4PT5A 4TV3A 2HE7A 5C3JB 1WJ4A 1WGRA 3W9CB 4JL9A 2JU6X 4RF1A 4IC7B 1DGJA 2OHFA 4YSXB 3H7SA 4N59A 4HPMB 1KF6B 1SBBB 1FEHA 5DPTA 1SJHD 3WANA 1XF5L 1F52A 3ETRA 3GE8C 3HM6X 4M01A 2EKEC 2J0MA 3WA0A 1HE8A 1I4GA 3ZW3A 1OTRB 1WYWB 3APDA 1PGXA 2ZCBA 3RD2A 2NTSA 4DHJD 4HPLB 4DXAB 1I4HA 4GMVA 1SJED 4GDLB 1T0SC 2K8CA 4AOFA 3MP9A 2H89B 1MVKA 3TEXA 4XE0A 2VZKD 1WE6A 1P0RA 4GOCA 2LHEA 4MEMA 4L23A 3MHZA 1QKZA 4NAWB 2CHXA 1YX6B 4PYZA 4FJZA 4II2B 5DPRA 2CU3A 4DXFA 1ET6A 3AE8B 1IBXB 2KNBA 3Q3MC 1L2NA 3HIZA 4JLCA 3ZJVA 1TT5B 5CHWA 1BT0A 3U4EG 3V6EB 1GUAB 2KDFB 1TY0A 3PS6A 1N5XA 4BOZB 3ENEA 4YTPB 1V5OA 2MHJA 2NCNA 5TR5A 4W9JA 4KDLB 3EGRA 4RM8A 3WAPA 2K39A 1YN5A 3DHGC 1MHXA 2V9HA 3FC4A 3RNFC 4RCOA 3AMZA 3Q8BA 1MG8A 2KQSA 3N32A 4OVUA 4WJQA 2WLBA 4OW0A 1QZEA 2I2YA 2X38A 4LNKA 1HTQA 2HTHA 2C7HA 2WXKA 4ZRIA 2V4IB 2E6XA 2EKIA 5G55A 4WWOA 3L54A 3N3KB 3CF6E 1FD6A 4C7YA 3IAM1 2YEPF 2N4FA 3SFDB 2CR5A 3Q8AA 2KVRA 2Q5WD 2NMQA 2N9KA 3AE5B 3RCZA 3R66C 3B9JA 3PGEA 3Q3JA 1I42A 1N62A 2JXTA 2N9XA 2DAJA 1VJKA 3J9CA 4LNIA 2B76B 2L05A 2KMAA 4WQOB 4AJWA 2KQ7A 2KX3A 1JWAD 3T3OA 2LRUA 1XLPA 3FILB 2KT7A 5JH5C 2N1VA 1J0GA 1A70A 4EKUA 3IT4B 3HUIA 2IYDB 2D3BA 4HXDA 4B0EA 4TQ0A 3UIPB 1FMAD 2JWZA 2KDEB 2WXLA 1ZGUB 4W9DA 1ZP0B 2V4LA 2A5UA 4MH8A 5AZHA 2BS2B 2HTME 3SD5A 4ZHOA 2ICIA 3ZXRA 4D2KA 5D3IB 4NQKE 1FIQA 2EMSA 3KQ4A 1TKGA 3DHHC 2JVCA 1HQRD 4HDQA 1XXGA 3PLVA 2WU5B 3NUHB 4YTNB 3HVDA 2WX0A 2W3SA 4KIKB 1STEA 1SF0A 1N63A 1G6JA 5GXGB 2GLSA 2MCNB 1E7VA 4XWWA 2KTFA 3PZ8A 1QQRA 2L1AA 4NQLB 4CQNA 4RF0A 5JZEB 3U52E 1EUVB 2Z59B 2WXQA 1EWCA 1TZ1A 1IYFA 2WHIA 4YTMB 3AB5A 4C4VB 4LTUA 4E71A 3ZYYX 3ECIA 4BOSC 5CTRC 3C8YA 1V80A 5AUKA 4C4VA 3LB8C 2I1JA 1JCKB 2L00B 2JRHA 2MLBA 4C00A 3QWZB 2ZW0A 1LFDA 2D10A 3AV8A 3ZNHB 3UQAA 3ZTCA 2LEKA 3PPAA 2RSUA 1WWTA 3ABVB 5D6JB 3N20C 1WM3A 4BKSD 3KYDD 4FULA 4KVGB 4B9KA 1GB4A 3HRDD 1I4QA 1ZUD2 2ZCCA 3AE2B 4YT0B 5L83A 1KTKA 1AW7A 2LVOA 3KVFB 4JPSA 2XBBC 4HJKA 2JQRB 3V61A 1NI3A 2CHWA 3SEBA 1MHHE 1T0YA 3CIRB 1KM7A 3I57A 4WQMA 3TEYA 1WF9A 3APCA 2MRPA 3OAWA 2K3UA 2C60A 4LNNA 3AEGB 1D6EC 1E8XA 3QA8A 3TBLD 1YN3A 1JQ4A 3RZWC 1E8YA 2KYWA 4L2YA 2ZNVC 2RDHA 2BB6A 3BZDB 4I6PA 1WGGA 5J17A 2FCQA 1YQ3B 1D4BA 4NNJB 5D3DA 4WJPA 3X23A 1UGMA 3VFKA 4G50A 1L0YB 4FN2A 3L16A 1FCCC 1VR9A 2DZMA 3BY4B 2RDGA 2C9WB 2M0XA 2ACZB 5IAAC 3DHIC 4ICVA 1I4RA 1TZOA 4AJYB 1V9JA 1YIWA 2LHDA 4FA6A 4EOYA 3ZNZB 5EE3A 1BUIC 2BW2A 2IGGA 1SE2A 4JQWC 4KZ0A 5BO4B 4A8XC 2ZEQA 2HD5B 5IP4D 3NZ3A 2XNAC 1JROA 2M8SA 4EUTA 2FIDA 1EO6A 2VH1A 3NVZA 4M0WB 3TMPB 1WJ6A 3KW5B 2BS3B 1ZKHA 1V86A 4YL8A 3MC9A 4PYUA 2IDYA 3HVZA 2R2OA 2JUOA 3EUB2 3IT6B 2BYVE 2INPE 2GBMA 2PVGC 3Q2AC 4K3CA 3I9V1 2HJ8A 2IGDA 2B3AA 3B08A 4TKNA 2JYTA 1NI2A 1AARA 1NENB 3PZ7A 4N58A 2WDVB 5HI1A 1L5PA 2IO3B 4ASWC 3TEWA 2ZW1A 2V3NA 2LWPA 3AH7A 4K3BA 3AULA 4DHJB 3VH3B 3K9PB 3MHSD 1TIFA 3TIXA 2FCNA 2C7MB 3QCAA 3RNCC 1GAQB 2QC8A 3APFA 5AUIA 5AZGA 4B0MA 2LASA 4FJVB 1F2RC 3TCAA 1GPXA 2BGFA 4N6EB 3MJWA 3ONSA 3Q3NC 4MDKE 2K6QA 3AE4B 1LQBA 2J42A 3H8HA 5FR3A 2MBBB 2INDC 2NBWB 3AEBB 3KUZA 1P7EA 3L17A 1KH0A 3VR8B 2WDRB 3A9KB 3O65B 1WR6E 3DVGY 3KWVA 4W9LA 4EZKA 2VRRB 1J8CA 3JYUA 2G4SA 2KJRA 2MX2A 2N7JA 3VHTC 2PE6B 2XN9C 4RGTA 4ICUA 4G3XB 3L08A 2JWUA 2CJNA 1DYQA 2K1FA 3NZUA 4KSKC 1F9JA 3N1YC 3M95A 1M4VA 4JX1C 4RGNA 1IGCA 3DCGA 1C76A 1U4AA 4BKSA 5JXVA 3M62B 4RFBA 1L0VB 3ZLZA 2KDIA 4OVZA 4DK5A 1ZW7A 2PJHA 3VRAB 4ANWA 1EF1A 2GI9A 3A4RA 2BVCA 2PMVA 3AE9B 1WGDA 3PO0A 2J52A 3P63A 3Q69A 5LXHA 4M0WA 2FUHB 3VRBB 2QEJC 5C1ZA 1XD3B 1RLFA 3EECA 5H8YE 3UF8A 2LGYA 2KFKB 4GN1A 1JWUD 4XGAB 3AE6B 3PSEB 1WGKA 2SAKA 2MJDA 3BK2A 5J2RA 3DBLI 3VTVA 1MJDA 1F2RI 1GC6A 3Q3OC 1J7BA 3H1UA 3ZGZA 3WAMA 2J4XA 3W1SC 4BBNC 3NZSA 1KOTA 3AU4A 2KHWB 2H88B 3VVWB 3B2FA 2W9NA 2BPSA 3V62A 3QX1A 4DWFA 2C7NB 3OJ3A 3TSSA 1NBFC 1NYRA 2DHZA 2BKRB 1QOFA 5HG2A 1XLNA 4A55A 1UWXA 5G5HA 3FILA 4M8NA 3RUIB 1UH6A 4M02A 4L1BA 4KX6B 2WGSA 4FHKA 3I5JC 4WWNA 4LNOA 3WAOA 3JVZX 3NS8A 2ZNVB 2LVQA 2J0KA 5G2NA 2CKHB 4F8CB 2BYTA 2KDMA 4HCPB 2V1YA 2NBVB 1X1MA 4GDLA 5LXIB 3IFWB 3ZO5B 1KFYB 2WXHA 1WE7A 3ML8A 3TEZA 2RD0A 1YQBA 3L13A 3FAHA 1F0ZA 2KO3A 1V81A 3DBLB 4KDIC 1JRPA 1XQQA 1Y56A 2KFJA 3L4PA 3RFZB 2LJIA 4ARCA 2QIEB 3GZNI 1N6ZA 1P1AA 2GBRA 1ET9A 3R3MA 1ROEA 4MACA 2RPVA 2W54A 3ZDTA 1P98A 1WSPA 3A1QA 4AS1A 1XCTL 3PV1A 5HHDG 5LLIA 2KK8A 3AEFB 4J3OD 1JW9D 3ZJTA 3AXCA 1WR1A 5IOIA 4KGSA 3VUWA 4ZYSA 4IUMB 3V3XA 2LGSA 1PGBA 2M56B 4DDGD 3LJ3A 2OEDA 5HKHA 1TYGB 1CZPA 1YJJA 5D7GA 1N5WA 3KUCB 4IM2A 1MG4A 3ZIMA 1XO3A 2LD9A 5BMGA 3IHPC 1K50A 3VTWA 3LXFA 2PLPA 2Y3AA 4XDDA 2KVZA 2KJHB 1L6VA 3Q3FA 2BBCA 2ZZPB 1RRBA 2GBNA 1VRAB 4K7UA 3R2TA 1E0ZA 5J18A 4YSYB 4US8A 4BKTA 1L0XB 1ACCA 1JALA 3N1XC 3JW0X 5E6JA 1ZDXA 2KMMA 2KLCA 3N1ZC 2OJRA 3SDLC 3RNAC 3AEEB 3AE7B 2R2QA 2CHZA 3OJ4B 1DOXA 3VQIA 4HDOA 4RH6A 1TTNA 4A3OA 1ZOYB 1L7YA 2L0TA 2CJOA 4KKIA 2DNFA 4BBNF 3EFUA 2VZKB 4WJOA 1N60A 3AEAB 3QJZA 4ZHPA 2WQYB 4XDCA 5EDSA 4KGTA 1E6EB 3IVFA 3ZTDA 1PQSA 1UZXB 2WXIA 3QK0A 4LCDE 2SEBD 2BS4B 4IKGA 1K51A 3QARA 1UUPA 4PS8A 5EE9A 2PIAA 3CWIA 1WMHB 4PS3A 2K8BA 1E8WA 4NAWA 4II3B 3PVLA 1NYQA 1CQVA 2MBOA 2RR9A 4WIPA 2EELA 3DVNV 4ANUA 2V3PA 2RPQA 2JXXA 1F77A 2RMMA 3NRZA 2JYEA 2QCZA 4ZOHC 5CHVC 3DWMA 4URKA 2BB5A 1C3TA 2WXOA 1V5TA 2MBQA 1T0QC 1OFFA 4B95A 1FRRA 1SE9A 2DYOA 4ITKA 4IWOA 4LK0M 1AYFA 1V1PA 1L4ZB 1MPEA 4IM3A 4W9EA 3A4SC 4DQOC 1L4DB 1JRUA 2WXFA 3GB1A 2G3QB 3R2IA 4GB9A 2MSED 3RNGC 2GBKA 2FIFA 3VTUA 5JHAA 1HZ5A 2M19A 3VH4B 4A6QA 1E5WA 4O1NA 3NVYA 1WGYA 3AN1A 4C7ZA 4BFRA 2YVCA 4WJNA 2KANA 1XLOA 3ZUNA 1V49A 1WXMA 1E7UA 4LNFA 1C79A 2Y5BB 4ACFA 1EU3A 3HK0A 2Z0DB 2QILA 4QAYA 3GP7A 2K6DB 1IBXA 1H4RA 1D5XC 4ZDVA 5IA7A 1Q5WB 2GMIC 2MJEA 2X8XX 3W5UB 2DX5B 1WX7A 3DVNU 1FXAA 3LDZE 4MGYE 4AP4C 5LNK1 3MC8A 1C77A 3C0RB 1Z5SB 3GS2A 1BMLC 3CSTA 3C19A 3L0WB 3O13A 2J0JA 1KLUD 3AE1B 1PFDA 2FCMA 4YSZB 2VH2A 1SIFA 4K7WA 2WYQA 1DOYA 3L10B 1I4PA 4A20A 2LI5A 3QQ8B 1OQRA 4TMAB 3BVMA 3H6NA 4IW0A 4WH4A 2N9PC 3N30A 1N61A 3KWLA 2IZVB 1QLBB 1C4AA 4P1BC 4GXBA 1CJEA 1M94A 2D11A 2IO2B 2FBWB 2BYFA 1C4CA 5E6NA 4XYCA 1UBQA 2MWSB 4P7IA 3ZNGC 2W3RA 1FM0D 4J6IA 3UGBB 1D5MC 2LGDA 4GDKA 3GE3C 2L32A 1VCBA 3SFEB 3W1YA 4W9IA 2IO0B 2JRIB 1HEZE 4OZAA 5MPOA 1Z2MA 5FR6A 2NPTA 1JMLA 3BVGA 3V60A 4MGKE 1PYWD 3DDCB 1YJIA 5CX3A 2N7DA 2UWQA 3M3JA 4NJCA 1SSNA 4NPNA 2DAFA 3PRZA 3URYA 2ON8A 1EM7A 3PZDA 1WX9A 2LVPA 5BYQA 4HLEA 3NJTA 1P7FA 5TSSA 1KLVA 1S3SG 2L83A 5HFYA 1FXIA 1EU4A 2JY6A 1NVID 2KWVB 3BWUD 3ZQ4A 3DOWA 2BTEA 2KAJA 3CSFA 2BF8B 1WY8A 4X57B 2DZJA 3U30A 3DBHI 3SHQA 3WIMA 2ZVOA 4XZ4A 2WXNA 3H7PB 4MM3A 1WX8A 3P4RB 1P3QU 1FFUA 1UD7A 2KOXA 4EZJA 1CK1A 4LJPB 2A4ZA 2MA9B 2QDFA 2FCSA 1JWBD 2FNJB 4RMAA 4WAFA 4GU2A 2C5LC 1WXQA 2N0SB 5CHFA 3DQVA 2L76A 3ZNID 4IM0A 4C80A 1HA5A 1TS4A 2LFIA 2PVOD 1YX5B 2WWZA 1QOAA 1GC7A 4HVBA 3A33B 3PREA 1HTOA 2Y5PA 2NBUA 1QOBA 1UWMA 2INNE 2JPHA 4W9KA 2AX5A 4W9CA 2KD0A 1A5RA 2JZ3B 4WWMA 1RAXA 2KWUB 5JHBA 4A90A 2K5PA 2QHOA 2KZRA 2MJ3A 2N7EA 3IG3A 4WWPA 1K52A 4ZRKA 1WYGA 2LGXA 3MJ5A 4GIVA 2KX0A 1E7PB 1UF0A 1R4MI 3KH0A 2L3ZA 3EC8A 2MBHA 1NDDA 4OVVA 1C4PA 4LDTD 3R7QA 4WURA 2GB1A 3T3NA 3TJPA 3UINB 3R8BA 1QOGA 4EZLA 4F1SA 1WGHA 1Y8RC 3PT2B 1GB1A 3OWEB 5IKCM 2W82A 1OEYA 4HCNB 3ZRCA 4ANVA 2WXRA 4FJYA 4REZA 3EHVA 2KKCA 1ZPSA 2IGHA 4KKJA 4R3DA 2AL3A 3PLUA 4OZCA 2D3GA 3KYCD 1VZ8A 3PHWB 3PTFC 2BYEA 1R4NI 2K25A 5BMIA 1UELA 3NOBA 4JIOU 3IBEA 2R61A 3EFCA 4RNAA 5GMVA 1NEKB 2NPTB 3BIID 2DWQA 2MEKA 1L6UA 1WZ0A 3A9JB 2WDTB 2UYZB 1FCLA 2I38A 3RT3B 2N9EB 2DZKA 2KC1A 2LZ6A 4US9A 2PPHA 3ML9A 4BAXA 1AWDA 4W9FA 3U7ZA 3LYYA 1T5XD 2KWCA 3KLSX 1WFYA 4Q2JA 4DBGA 2O6VD 1YQ4B 4ZYNA 2KJ6A 2DBYA 3PRPB 1I35A 3V05A 1RYJA 2K9XA 1IP9A 2ONQA 4MSMB 2KTRA 2KDBA 3N9YC 1ZDVA 1E10A 2O6VB 2YEPB 2LJ5A 5DCNA 2L0FA 1SXTA 1CMXB 4F7ZA 3W2DA 1SB3C 4TQ1A 2PEAA 5H92C 4P16A 4FADA 2WNMA 5IN7A 2WXJA 3T9LA 4FHJA 2UU7A 4JGHB 1PDXA 2D07B 4DHZE 4UDUC 2M17A 2E3TA 2ZVNA 1TS5A 2INCC 4FXCA 4P6VF 4A9AA 4KSLC 2WS3B 2NS5A 3BINA 3MFGA 1DOIA 2DYBA 3P1MA 2Z8LA 3MTNB 3Q14C 1V8CA 2XK5A 1WXAA 1GG3A 5AEKB 3WALA 4LJOB 2PW9A 4KZCA 3U2SC 3I63C 3VAWA 1E8ZA 5DPWA 1TGZB 5I4DA 1EWYC 3IXSA 4MM3B 1WI0A 1QF6A 1V1OA 1WRDB 2BQQA 4B6WA 1VDVA 4IWPA 4EE2A 3DVGX 2NTTA 4K81A 2MQJA 2O2VA 4IG7B 2AYOB 5L95C 4IOIE 2CS4A 2PKOA 2BWFA 3W1SA 3B1LX 5EE1A 2L8JA 1F1HA 1TBEA 3VR9B 1UNSA 2MH7A 4BVUC 1FFVA 4CO7A 2NVUI 2BT6A 2BWES 5AZFA 5D2MB 4NJ6A 2N9LA 4CHKA 1ZE3D 3RPFC 1HXYD 3BYYB 3K9OB 2LRWA 3B2GA 1QILA 4E74A 1VZ7A 1YN4A 2KLGA 4PS7A 3A9JA 4YXDB 2WDQB 4NJ7A 4MGIE 4MGZE 2J7QB 1OQYA 1B1ZA 4MELA 1JWSD 1PUTA 2LXAA 1SE4A 3GZNB 3OLMD 2L7RA 4MH0E 1LO5D 5FKAC 3AE3B 2V0GA 2MP2B 3HHMA 1J7AA 3P4QB 1XT9B 4JWUC 3T8MA 4W9HA 1EF5A 1Q10A 3ALBA 2V3SA 3R7RA 2OOBB 2GRIA 2XEWA 1JWMD 2IJ0A 4I6NB 3VDZA 3AM9A 4BKGA 1Q1OA 3D32A 2ZPNA 3RZFA 4JE3B 1YNTE 2IO1B 3EA6A 2RDBC 3ZXVA 4PK1A 3ZJUA 3U7DA 2O2VB 1WXVA 1WM2A 2M1MA 4G0NB 4RGMA 2IY1B 3PHXB 1FNWA 1MI0A 1GNUA 3NVWA 1C1YB 2QJLA 4N9F4 1Q0WB 2MBEA 4YWGG 3TL5A 1VD2A 3JSVB 2GOWA 4EEWA 2AWTA 4HKZE 4OZBA 1KRHA 5IO9A 4KV2A 1XEEA 3SU8X 1BXTA 2LXCA 1FO4A 1TY2A 2JZPA 1P9DU 3E9SA 2NR2A 2IPKD 2EMTA 2WXPA 3IAS1 2DENB 3V6CB 2D3CA 4MJSA 1GJZA 2LMCA 1RFAA 4K1RB 3H7PA 3B0AA 4HPPA 1PGAA 3QAQA 4W9GA 2WP9B 3AEDB 3AU5A 4OHJA 1WIAA 2M0AA 3FKYA
chains in the Genus database with same CATH topology
3M63B 5LXHA 2FUHB 2KFKA 1WH3A 1MG8A 2KQSA 2K8HA 3N32A 4OVUA 5C1ZA 4WJQA 1KLVA 1YJ1A 1S3SG 1QZEA 1XD3B 1RLFA 3EECA 4ZRJA 4KIKA 1KJTA 2JY6A 3S2AA 2LGYA 2HTHA 2IY0B 3UF8A 2C7HA 2KWVB 2KFKB 2AEHA 4GN1A 4ZRIA 5G55A 4WWOA 3L54A 3DOWA 3N3KB 3CF6E 3CSFA 2BF8B 1WY8A 2ZPYA 3PSEB 3ZDMC 4WAAA 4X57B 2DZJA 3U30A 5J2RA 3DBLI 2N4FA 3VTVA 4E3CA 5KHOA 3DBHI 2CR5A 3SHQA 3VUYA 1SGHA 3WIMA 2KVRA 2ZVOA 4XZ4A 3UIOB 1GC6A 3PRMB 3H1UA 5D94A 3WAMA 3W1SC 3H7PB 4MM3A 1WX8A 4BBNC 4MJSB 1P3QU 3NZSA 1UD7A 1KOTA 3AU4A 2KOXA 2KHWB 3R66C 4GSWA 3PGEA 3Q3JA 3RCZA 3VVWB 4EZJA 1I42A 4LJPB 3AI5A 2N9XA 2W9NA 2A4ZA 2DAJA 2MA9B 3QC8B 2BPSA 3V62A 2FCSA 2KN5A 3QX1A 2FNJB 1V6EA 4RMAA 4DWFA 2L05A 4GU2A 2C5LC 2C7NB 2KMAA 3OJ3A 5CHFA 1NBFC 4WQOB 1OEYJ 3DQVA 2KQ7A 4AJWA 2KX3A 2L76A 3ZNID 2DHZA 4DDID 2BKRB 2ASQA 4IM0A 2KXJA 2XK5B 1YD8U 2YLMA 2LRUA 4GGQA 5JH5C 2G4DB 4CYEA 2M4NA 2N1VA 5KHQA 1YX5B 1J0GA 3RUIB 4M8NA 2ZJDA 1UH6A 2WWZA 4EKUA 1GC7A 5C23A 4HVBA 3A33B 3PREA 4RM9A 2NBUA 3JSVA 4FHKA 2IYDB 2JPHA 4HXDA 4W9KA 4WWNA 4TQ0A 3UIPB 1UBIA 4W9CA 2KD0A 3WAOA 3JVZX 1A5RA 3NS8A 2JWZA 2ZNVB 2LVQA 2JZ3B 2KDEB 2J0KA 4LDTB 5G2NA 1D3ZA 2CKHB 4FBJB 4F8CB 1ZGUB 1RAXA 2BKFA 2KWUB 4W9DA 4HCPB 5JHBA 4EFOA 2V1YA 2V4LA 2NBVB 2QHOA 2A5UA 2KZRA 1X1MA 4GDLA 2N7EA 3IG3A 4WWPA 4ZRKA 5AZHA 5LXIB 3IFWB 3ZO5B 3SD5A 2LGXA 2O6VA 1E90A 1WE7A 4GIVA 3ML8A 2KX0A 1J19A 2RD0A 1R4MI 1YQBA 3L13A 3KH0A 2L3ZA 3EC8A 2KO3A 2MBHA 1V81A 1NDDA 4KDIC 3ZRFA 2KTRB 4OVVA 2GBJA 4NQKE 2EMSA 1XQQA 2JVCA 4LDTD 3R7QA 2KFJA 2D2QA 4HDQA 3PLVA 2N1WA 1WJUA 3TJPA 3UINB 3GOEA 2WX0A 4EZLA 2DYMA 3GZNI 1P1AA 4KIKB 4F1SA 1WGHA 1Y8RC 2GBRA 3X0WA 4XX5A 3R3MA 3PT2B 1G6JA 4HCNB 1OEYA 3ZRCA 3HM3A 4ANVA 4FLHA 2MP2A 3ZDTA 4FJYA 1P98A 3EHVA 2MCNB 1E7VA 2KKCA 2KTFA 3A1QA 3PV1A 1H8CA 1LXDA 2AL3A 3DBRI 3PLUA 5LLIA 4NQLB 2KK8A 2D3GA 3KYCD 3PHWB 5JZEB 3PTFC 2BYEA 3AXCA 1R4NI 1EUVB 1WR1A 2K25A 2Z59B 3VUWA 1IPGA 1UELA 1TZ1A 2RGFA 3NOBA 4JIOU 3IBEA 4IUMB 1IYFA 4DDGD 2DZIA 3LJ3A 5GMVA 4E71A 5HKHA 3ECIA 2NPTB 5D7GA 4HLEA 2IBIB 3KUCB 4BOSC 4IM2A 3ZIMA 1WZ0A 3A9JB 3DBSA 4TUUA 2WDTB 5CTRC 4I6LB 2UYZB 2MW5A 2LD9A 1V80A 2I1JA 3IHPC 3RT3B 2N9EB 2DZKA 2L00B 2KC1A 3I3TB 2JRHA 2LZ6A 2MLBA 3VTWA 2PPHA 3ML9A 4W9FA 3QWZB 2KJHB 3Q3FA 3P2BA 2ZZPB 1RRBA 2GBNA 2KWCA 1LFDA 2FAZA 2D10A 1WFYA 2G45B 4K7UA 3A1QB 4DBGA 2O6VD 4IWQA 3ZNHB 3ZTCA 4A3PA 3UQAA 3PPAA 5J18A 2RSUA 5D6JB 3QIJA 4M8MA 4MSQB 4ZYNA 2KJ6A 1WM3A 4BKSD 3PRPB 4BKTA 1I35A 3KYDD 4FULA 3JW0X 4KVGB 3QHTA 4B9KA 2KLCA 2OJRA 3SDLC 2ZCCA 1IP9A 5L83A 4MSMB 3A9KA 2KTRA 2LVOA 2KDBA 2R2QA 3KVFB 2XBBC 2CHZA 3OJ4B 4HJKA 3NHEB 3V61A 3VQIA 2CHWA 3DPDA 2O6VB 3UQBA 4HDOA 2LJ5A 5DCNA 1T0YA 1TTNA 2L0FA 4A3OA 1KM7A 1CMXB 1L7YA 4F7ZA 1FXTB 2L0TA 4TQ1A 4BBNF 2PEAA 3EFUA 4FADA 1WF9A 3APCA 4WJOA 2MRPA 3QJZA 3OAWA 3VUXA 3T9LA 5EDSA 4FHJA 1WZ3A 4JGHB 2D07B 1S1QB 2C60A 2KC2A 4DHZE 2M17A 2ZVNA 4HWIB 1E8XA 3IVFA 3VXWA 4KSLC 3RULA 3QA8A 4K7SA 3TBLD 2NS5A 4GDKB 4HK2A 3BINA 3RZWC 1PQSA 1UZXB 3ZTDA 4DHZB 1E8YA 3QK0A 1WMHA 2DYBA 5DPSA 2ZNVC 4LCDE 4AWJA 4I6PA 3H9DA 1WGGA 5J17A 2FCQA 3NY5A 3QARA 2WX1A 4AUQC 3MTNB 4NNJB 1WJNA 2XK5A 4XC2A 1WXAA 4PS8A 1WMHB 4PS3A 4WJPA 1UGMA 2K8BA 3X23A 1E8WA 3VFKA 2JF5A 4G50A 3U8ZA 1GG3A 4NAWA 4FN2A 4II3B 5AEKB 3PVLA 4G11A 3WALA 3L16A 2JZZA 2MBOA 4LJOB 2DZMA 2RR9A 4KZCA 3BY4B 2CU1A 3VAWA 1E8ZA 5DPWA 3DVNV 1V2YA 2C9WB 2M0XA 4ANUA 1TGZB 5IAAC 2RPQA 4ANXA 2JXXA 4ICVA 1WI0A 2AL6A 5CHVC 2KMCA 1K8RB 3RYTA 4AJYB 1V9JA 4URKA 1C3TA 1WRDB 4B6WA 4IWPA 3DVGX 1V5TA 2MBQA 1YIWA 4B95A 1SE9A 4K81A 4NY0A 4FA6A 2MQJA 2DYOA 2O2VA 4IG7B 4IWOA 4EOYA 2AYOB 5L95C 4IM3A 3ZNZB 4W9EA 3A4SC 5E6PA 2CS4A 1JRUA 2BWFA 2G3QB 3W1SA 3ZVVA 3B1LX 4JQWC 4GB9A 4KZ0A 2L8JA 2MSED 1TBEA 2GBKA 5BO4B 2ZEQA 3KUDB 4BVUC 1LM8B 2FIFA 4CO7A 2HD5B 3VTUA 2NVUI 5JHAA 2BWES 5AZFA 2M8SA 4EUTA 2FIDA 4NJ6A 5D2MB 1EO6A 3VH4B 4M0WB 1E5WA 3TMPB 1WJ6A 2REXA 3KW5B 3CMMB 1ZKHA 5E6OA 4CHKA 2LUEA 1V86A 4YL8A 2JT4B 1ISNA 1WGYA 4BFRA 4PYUA 3K9OB 2LRWA 2R2OA 2YVCA 4WJNA 4E74A 2KANA 3ZUNA 1V49A 1WXSA 3ZKJC 2JUOA 2KLGA 4PS7A 3A9JA 2PE9A 1OGWA 1WXMA 1E7UA 4NJ7A 4MGIE 4MGZE 2J7QB 2Y5BB 2Z0EB 2BYVE 2I1KA 1OQYA 2GBMA 4MELA 3HK0A 2LXAA 2Z0DB 2HJ8A 3OLMD 2B3AA 4TV3A 2HE7A 2L7RA 3B08A 4TKNA 2K6DB 1NI2A 1AARA 1H4RA 1WGRA 1WJ4A 4MH0E 4ZDVA 4JL9A 2MP2B 3HHMA 5IA7A 1Q5WB 2IO3B 1XT9B 4IC7B 4ASWC 2GMIC 3T8MA 1EF5A 3ALBA 4W9HA 2LWPA 2DX5B 1WX7A 3DVNU 2V3SA 3LDZE 3AULA 4MGYE 3R7RA 3H7SA 4AP4C 4DHJB 3VH3B 2OOBB 2XEWA 3C0RB 3K9PB 3MHSD 3TIXA 4HPMB 2FCNA 2C7MB 1Z5SB 4I6NB 3VDZA 3CSTA 5DPTA 4BKGA 3WANA 1Q1OA 3D32A 2ZPNA 3L0WB 3QCAA 3HM6X 3RZFA 2J0JA 3APFA 2EKEC 5AZGA 2J0MA 3WA0A 1HE8A 2IO1B 3ZW3A 2FCMA 1OTRB 1WYWB 2LASA 3APDA 3U7DA 2O2VB 4FJVB 2ZCBA 3RD2A 1WXVA 3TCAA 1WM2A 4DHJD 4HPLB 4DXAB 1SIFA 4K7WA 2M1MA 4GMVA 4G0NB 2BGFA 2WYQA 3MJWA 3ONSA 3L10B 4MDKE 2IY1B 2K6QA 2K8CA 3PHXB 4GDLB 1LQBA 4AOFA 4A20A 2LI5A 3QQ8B 2MBBB 2NBWB 1GNUA 1C1YB 3KUZA 3H6NA 4N9F4 1Q0WB 2MBEA 3L17A 1WE6A 1P0RA 3TL5A 4IW0A 1VD2A 4GOCA 3JSVB 2GOWA 2N9PC 3A9KB 3N30A 4EEWA 3O65B 1WR6E 2IZVB 2AWTA 4MEMA 3DVGY 4GXBA 4KV2A 4NAWB 4W9LA 1M94A 2D11A 2VRRB 4EZKA 2IO2B 2CHXA 1J8CA 2BYFA 3SU8X 3JYUA 5E6NA 1YX6B 2G4SA 4PYZA 1UBQA 2MWSB 4FJZA 2KJRA 4II2B 2MX2A 3VHTC 4P7IA 3ZNGC 2PE6B 5DPRA 2LXCA 4J6IA 4ICUA 3UGBB 4G3XB 3L08A 2LGDA 2K1FA 2KNBA 4GDKA 3NZUA 1P9DU 4KSKC 1L2NA 1F9JA 1VCBA 2NR2A 3HIZA 3M95A 2EMTA 3W1YA 4JLCA 4W9IA 5CHWA 1BT0A 2DENB 2IO0B 2JRIB 3V6CB 3V6EB 4MJSA 3DCGA 1GUAB 1Z2MA 2KDFB 5FR6A 3PS6A 1GJZA 2NPTA 1RFAA 1U4AA 3V60A 4MGKE 4BOZB 4K1RB 3H7PA 3DDCB 4BKSA 3B0AA 3M62B 3QAQA 3ENEA 4W9GA 2KDIA 3ZLZA 4DK5A 1ZW7A 1V5OA 2PJHA 4ANWA 5CX3A 1EF1A 2N7DA 3AU5A 2UWQA 3M3JA 2NCNA 5TR5A 4W9JA 1WIAA 4NPNA 2DAFA 3PRZA 4KDLB 3A4RA 4RM8A 3WAPA 2K39A 1WGDA 3PZDA 1WX9A 2LVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  5LXH A;  2FUH B;  2KFK A;  1WH3 A;  1MG8 A;  2KQS A;  2K8H A;  3N32 A;  4OVU A;  5C1Z A;  4WJQ A;  1KLV A;  1YJ1 A;  1S3S G;  1QZE A;  1XD3 B;  1RLF A;  3EEC A;  4ZRJ A;  4KIK A;  1KJT A;  2JY6 A;  3S2A A;  2LGY A;  2HTH A;  2IY0 B;  3UF8 A;  2C7H A;  2KWV B;  2KFK B;  2AEH A;  4GN1 A;  4ZRI A;  5G55 A;  4WWO A;  3L54 A;  3DOW A;  3N3K B;  3CF6 E;  3CSF A;  2BF8 B;  1WY8 A;  2ZPY A;  3PSE B;  3ZDM C;  4WAA A;  4X57 B;  2DZJ A;  3U30 A;  5J2R A;  3DBL I;  2N4F A;  3VTV A;  4E3C A;  5KHO A;  3DBH I;  2CR5 A;  3SHQ A;  3VUY A;  1SGH A;  3WIM A;  2KVR A;  2ZVO A;  4XZ4 A;  3UIO B;  1GC6 A;  3PRM B;  3H1U A;  5D94 A;  3WAM A;  3W1S C;  3H7P B;  4MM3 A;  1WX8 A;  4BBN C;  4MJS B;  1P3Q U;  3NZS A;  1UD7 A;  1KOT A;  3AU4 A;  2KOX A;  2KHW B;  3R66 C;  4GSW A;  3PGE A;  3Q3J A;  3RCZ A;  3VVW B;  4EZJ A;  1I42 A;  4LJP B;  3AI5 A;  2N9X A;  2W9N A;  2A4Z A;  2DAJ A;  2MA9 B;  3QC8 B;  2BPS A;  3V62 A;  2FCS A;  2KN5 A;  3QX1 A;  2FNJ B;  1V6E A;  4RMA A;  4DWF A;  2L05 A;  4GU2 A;  2C5L C;  2C7N B;  2KMA A;  3OJ3 A;  5CHF A;  1NBF C;  4WQO B;  1OEY J;  3DQV A;  2KQ7 A;  4AJW A;  2KX3 A;  2L76 A;  3ZNI D;  2DHZ A;  4DDI D;  2BKR B;  2ASQ A;  4IM0 A;  2KXJ A;  2XK5 B;  1YD8 U;  2YLM A;  2LRU A;  4GGQ A;  5JH5 C;  2G4D B;  4CYE A;  2M4N A;  2N1V A;  5KHQ A;  1YX5 B;  1J0G A;  3RUI B;  4M8N A;  2ZJD A;  1UH6 A;  2WWZ A;  4EKU A;  1GC7 A;  5C23 A;  4HVB A;  3A33 B;  3PRE A;  4RM9 A;  2NBU A;  3JSV A;  4FHK A;  2IYD B;  2JPH A;  4HXD A;  4W9K A;  4WWN A;  4TQ0 A;  3UIP B;  1UBI A;  4W9C A;  2KD0 A;  3WAO A;  3JVZ X;  1A5R A;  3NS8 A;  2JWZ A;  2ZNV B;  2LVQ A;  2JZ3 B;  2KDE B;  2J0K A;  4LDT B;  5G2N A;  1D3Z A;  2CKH B;  4FBJ B;  4F8C B;  1ZGU B;  1RAX A;  2BKF A;  2KWU B;  4W9D A;  4HCP B;  5JHB A;  4EFO A;  2V1Y A;  2V4L A;  2NBV B;  2QHO A;  2A5U A;  2KZR A;  1X1M A;  4GDL A;  2N7E A;  3IG3 A;  4WWP A;  4ZRK A;  5AZH A;  5LXI B;  3IFW B;  3ZO5 B;  3SD5 A;  2LGX A;  2O6V A;  1E90 A;  1WE7 A;  4GIV A;  3ML8 A;  2KX0 A;  1J19 A;  2RD0 A;  1R4M I;  1YQB A;  3L13 A;  3KH0 A;  2L3Z A;  3EC8 A;  2KO3 A;  2MBH A;  1V81 A;  1NDD A;  4KDI C;  3ZRF A;  2KTR B;  4OVV A;  2GBJ A;  4NQK E;  2EMS A;  1XQQ A;  2JVC A;  4LDT D;  3R7Q A;  2KFJ A;  2D2Q A;  4HDQ A;  3PLV A;  2N1W A;  1WJU A;  3TJP A;  3UIN B;  3GOE A;  2WX0 A;  4EZL A;  2DYM A;  3GZN I;  1P1A A;  4KIK B;  4F1S A;  1WGH A;  1Y8R C;  2GBR A;  3X0W A;  4XX5 A;  3R3M A;  3PT2 B;  1G6J A;  4HCN B;  1OEY A;  3ZRC A;  3HM3 A;  4ANV A;  4FLH A;  2MP2 A;  3ZDT A;  4FJY A;  1P98 A;  3EHV A;  2MCN B;  1E7V A;  2KKC A;  2KTF A;  3A1Q A;  3PV1 A;  1H8C A;  1LXD A;  2AL3 A;  3DBR I;  3PLU A;  5LLI A;  4NQL B;  2KK8 A;  2D3G A;  3KYC D;  3PHW B;  5JZE B;  3PTF C;  2BYE A;  3AXC A;  1R4N I;  1EUV B;  1WR1 A;  2K25 A;  2Z59 B;  3VUW A;  1IPG A;  1UEL A;  1TZ1 A;  2RGF A;  3NOB A;  4JIO U;  3IBE A;  4IUM B;  1IYF A;  4DDG D;  2DZI A;  3LJ3 A;  5GMV A;  4E71 A;  5HKH A;  3ECI A;  2NPT B;  5D7G A;  4HLE A;  2IBI B;  3KUC B;  4BOS C;  4IM2 A;  3ZIM A;  1WZ0 A;  3A9J B;  3DBS A;  4TUU A;  2WDT B;  5CTR C;  4I6L B;  2UYZ B;  2MW5 A;  2LD9 A;  1V80 A;  2I1J A;  3IHP C;  3RT3 B;  2N9E B;  2DZK A;  2L00 B;  2KC1 A;  3I3T B;  2JRH A;  2LZ6 A;  2MLB A;  3VTW A;  2PPH A;  3ML9 A;  4W9F A;  3QWZ B;  2KJH B;  3Q3F A;  3P2B A;  2ZZP B;  1RRB A;  2GBN A;  2KWC A;  1LFD A;  2FAZ A;  2D10 A;  1WFY A;  2G45 B;  4K7U A;  3A1Q B;  4DBG A;  2O6V D;  4IWQ A;  3ZNH B;  3ZTC A;  4A3P A;  3UQA A;  3PPA A;  5J18 A;  2RSU A;  5D6J B;  3QIJ A;  4M8M A;  4MSQ B;  4ZYN A;  2KJ6 A;  1WM3 A;  4BKS D;  3PRP B;  4BKT A;  1I35 A;  3KYD D;  4FUL A;  3JW0 X;  4KVG B;  3QHT A;  4B9K A;  2KLC A;  2OJR A;  3SDL C;  2ZCC A;  1IP9 A;  5L83 A;  4MSM B;  3A9K A;  2KTR A;  2LVO A;  2KDB A;  2R2Q A;  3KVF B;  2XBB C;  2CHZ A;  3OJ4 B;  4HJK A;  3NHE B;  3V61 A;  3VQI A;  2CHW A;  3DPD A;  2O6V B;  3UQB A;  4HDO A;  2LJ5 A;  5DCN A;  1T0Y A;  1TTN A;  2L0F A;  4A3O A;  1KM7 A;  1CMX B;  1L7Y A;  4F7Z A;  1FXT B;  2L0T A;  4TQ1 A;  4BBN F;  2PEA A;  3EFU A;  4FAD A;  1WF9 A;  3APC A;  4WJO A;  2MRP A;  3QJZ A;  3OAW A;  3VUX A;  3T9L A;  5EDS A;  4FHJ A;  1WZ3 A;  4JGH B;  2D07 B;  1S1Q B;  2C60 A;  2KC2 A;  4DHZ E;  2M17 A;  2ZVN A;  4HWI B;  1E8X A;  3IVF A;  3VXW A;  4KSL C;  3RUL A;  3QA8 A;  4K7S A;  3TBL D;  2NS5 A;  4GDK B;  4HK2 A;  3BIN A;  3RZW C;  1PQS A;  1UZX B;  3ZTD A;  4DHZ B;  1E8Y A;  3QK0 A;  1WMH A;  2DYB A;  5DPS A;  2ZNV C;  4LCD E;  4AWJ A;  4I6P A;  3H9D A;  1WGG A;  5J17 A;  2FCQ A;  3NY5 A;  3QAR A;  2WX1 A;  4AUQ C;  3MTN B;  4NNJ B;  1WJN A;  2XK5 A;  4XC2 A;  1WXA A;  4PS8 A;  1WMH B;  4PS3 A;  4WJP A;  1UGM A;  2K8B A;  3X23 A;  1E8W A;  3VFK A;  2JF5 A;  4G50 A;  3U8Z A;  1GG3 A;  4NAW A;  4FN2 A;  4II3 B;  5AEK B;  3PVL A;  4G11 A;  3WAL A;  3L16 A;  2JZZ A;  2MBO A;  4LJO B;  2DZM A;  2RR9 A;  4KZC A;  3BY4 B;  2CU1 A;  3VAW A;  1E8Z A;  5DPW A;  3DVN V;  1V2Y A;  2C9W B;  2M0X A;  4ANU A;  1TGZ B;  5IAA C;  2RPQ A;  4ANX A;  2JXX A;  4ICV A;  1WI0 A;  2AL6 A;  5CHV C;  2KMC A;  1K8R B;  3RYT A;  4AJY B;  1V9J A;  4URK A;  1C3T A;  1WRD B;  4B6W A;  4IWP A;  3DVG X;  1V5T A;  2MBQ A;  1YIW A;  4B95 A;  1SE9 A;  4K81 A;  4NY0 A;  4FA6 A;  2MQJ A;  2DYO A;  2O2V A;  4IG7 B;  4IWO A;  4EOY A;  2AYO B;  5L95 C;  4IM3 A;  3ZNZ B;  4W9E A;  3A4S C;  5E6P A;  2CS4 A;  1JRU A;  2BWF A;  2G3Q B;  3W1S A;  3ZVV A;  3B1L X;  4JQW C;  4GB9 A;  4KZ0 A;  2L8J A;  2MSE D;  1TBE A;  2GBK A;  5BO4 B;  2ZEQ A;  3KUD B;  4BVU C;  1LM8 B;  2FIF A;  4CO7 A;  2HD5 B;  3VTU A;  2NVU I;  5JHA A;  2BWE S;  5AZF A;  2M8S A;  4EUT A;  2FID A;  4NJ6 A;  5D2M B;  1EO6 A;  3VH4 B;  4M0W B;  1E5W A;  3TMP B;  1WJ6 A;  2REX A;  3KW5 B;  3CMM B;  1ZKH A;  5E6O A;  4CHK A;  2LUE A;  1V86 A;  4YL8 A;  2JT4 B;  1ISN A;  1WGY A;  4BFR A;  4PYU A;  3K9O B;  2LRW A;  2R2O A;  2YVC A;  4WJN A;  4E74 A;  2KAN A;  3ZUN A;  1V49 A;  1WXS A;  3ZKJ C;  2JUO A;  2KLG A;  4PS7 A;  3A9J A;  2PE9 A;  1OGW A;  1WXM A;  1E7U A;  4NJ7 A;  4MGI E;  4MGZ E;  2J7Q B;  2Y5B B;  2Z0E B;  2BYV E;  2I1K A;  1OQY A;  2GBM A;  4MEL A;  3HK0 A;  2LXA A;  2Z0D B;  2HJ8 A;  3OLM D;  2B3A A;  4TV3 A;  2HE7 A;  2L7R A;  3B08 A;  4TKN A;  2K6D B;  1NI2 A;  1AAR A;  1H4R A;  1WGR A;  1WJ4 A;  4MH0 E;  4ZDV A;  4JL9 A;  2MP2 B;  3HHM A;  5IA7 A;  1Q5W B;  2IO3 B;  1XT9 B;  4IC7 B;  4ASW C;  2GMI C;  3T8M A;  1EF5 A;  3ALB A;  4W9H A;  2LWP A;  2DX5 B;  1WX7 A;  3DVN U;  2V3S A;  3LDZ E;  3AUL A;  4MGY E;  3R7R A;  3H7S A;  4AP4 C;  4DHJ B;  3VH3 B;  2OOB B;  2XEW A;  3C0R B;  3K9P B;  3MHS D;  3TIX A;  4HPM B;  2FCN A;  2C7M B;  1Z5S B;  4I6N B;  3VDZ A;  3CST A;  5DPT A;  4BKG A;  3WAN A;  1Q1O A;  3D32 A;  2ZPN A;  3L0W B;  3QCA A;  3HM6 X;  3RZF A;  2J0J A;  3APF A;  2EKE C;  5AZG A;  2J0M A;  3WA0 A;  1HE8 A;  2IO1 B;  3ZW3 A;  2FCM A;  1OTR B;  1WYW B;  2LAS A;  3APD A;  3U7D A;  2O2V B;  4FJV B;  2ZCB A;  3RD2 A;  1WXV A;  3TCA A;  1WM2 A;  4DHJ D;  4HPL B;  4DXA B;  1SIF A;  4K7W A;  2M1M A;  4GMV A;  4G0N B;  2BGF A;  2WYQ A;  3MJW A;  3ONS A;  3L10 B;  4MDK E;  2IY1 B;  2K6Q A;  2K8C A;  3PHX B;  4GDL B;  1LQB A;  4AOF A;  4A20 A;  2LI5 A;  3QQ8 B;  2MBB B;  2NBW B;  1GNU A;  1C1Y B;  3KUZ A;  3H6N A;  4N9F 4;  1Q0W B;  2MBE A;  3L17 A;  1WE6 A;  1P0R A;  3TL5 A;  4IW0 A;  1VD2 A;  4GOC A;  3JSV B;  2GOW A;  2N9P C;  3A9K B;  3N30 A;  4EEW A;  3O65 B;  1WR6 E;  2IZV B;  2AWT A;  4MEM A;  3DVG Y;  4GXB A;  4KV2 A;  4NAW B;  4W9L A;  1M94 A;  2D11 A;  2VRR B;  4EZK A;  2IO2 B;  2CHX A;  1J8C A;  2BYF A;  3SU8 X;  3JYU A;  5E6N A;  1YX6 B;  2G4S A;  4PYZ A;  1UBQ A;  2MWS B;  4FJZ A;  2KJR A;  4II2 B;  2MX2 A;  3VHT C;  4P7I A;  3ZNG C;  2PE6 B;  5DPR A;  2LXC A;  4J6I A;  4ICU A;  3UGB B;  4G3X B;  3L08 A;  2LGD A;  2K1F A;  2KNB A;  4GDK A;  3NZU A;  1P9D U;  4KSK C;  1L2N A;  1F9J A;  1VCB A;  2NR2 A;  3HIZ A;  3M95 A;  2EMT A;  3W1Y A;  4JLC A;  4W9I A;  5CHW A;  1BT0 A;  2DEN B;  2IO0 B;  2JRI B;  3V6C B;  3V6E B;  4MJS A;  3DCG A;  1GUA B;  1Z2M A;  2KDF B;  5FR6 A;  3PS6 A;  1GJZ A;  2NPT A;  1RFA A;  1U4A A;  3V60 A;  4MGK E;  4BOZ B;  4K1R B;  3H7P A;  3DDC B;  4BKS A;  3B0A A;  3M62 B;  3QAQ A;  3ENE A;  4W9G A;  2KDI A;  3ZLZ A;  4DK5 A;  1ZW7 A;  1V5O A;  2PJH A;  4ANW A;  5CX3 A;  1EF1 A;  2N7D A;  3AU5 A;  2UWQ A;  3M3J A;  2NCN A;  5TR5 A;  4W9J A;  1WIA A;  4NPN A;  2DAF A;  3PRZ A;  4KDL B;  3A4R A;  4RM8 A;  3WAP A;  2K39 A;  1WGD A;  3PZD A;  1WX9 A;  2LVP A; 
#chains in the Genus database with same CATH topology
 3M63 B;  3DBR B;  4HJG E;  2KFK A;  1WH3 A;  4TSS A;  4MT5 A;  1LGR A;  2K8H A;  1B9R A;  2KAC A;  1YJ1 A;  2WU2 B;  2HJ1 A;  3NVV A;  5EE0 A;  4ZRJ A;  3AEC B;  4KIK A;  5T8I A;  1KJT A;  1YOV B;  3S2A A;  2IY0 B;  2K0P A;  2AEH A;  1T3Q A;  2KQ4 X;  1V1P B;  2ZPY A;  1UGJ A;  3ZDM C;  4WAA A;  4E3C A;  3MC0 B;  5FK9 C;  5KHO A;  3VUY A;  1SGH A;  1WRI A;  3UIO B;  3PRM B;  1T6B X;  5D94 A;  1IGD A;  2K22 A;  2JX5 A;  4MJS B;  3W5V B;  3OG5 A;  4GSW A;  3AI5 A;  3QC8 B;  1T0R C;  2KN5 A;  1V6E A;  5C2T B;  1C78 A;  1OEY J;  2TSS A;  1ZXH A;  4DDI D;  3UI3 A;  1RM6 C;  2ASQ A;  1R7S A;  2KXJ A;  1TJE A;  1YD8 U;  2XK5 B;  2YLM A;  4GGQ A;  2G4D B;  4CYE A;  2M4N A;  5KHQ A;  4HKQ A;  2ZJD A;  2KWD A;  2KN4 A;  5C23 A;  1FRD A;  4RM9 A;  2WXM A;  3JSV A;  1UBI A;  2FUG 1;  4LDT B;  1D3Z A;  4FBJ B;  1HZ6 A;  2BKF A;  4EFO A;  1TS2 A;  2LGI A;  2QSD A;  2O6V A;  1E90 A;  3RNE C;  1J19 A;  3RNB C;  3WCQ A;  1R4N B;  3ZRF A;  2KTR B;  1KLG D;  2GBJ A;  4HRS A;  2D2Q A;  2N1W A;  1WJU A;  2D3A A;  1SIJ A;  3GOE A;  1R4M B;  4IDI A;  2DYM A;  2WXG A;  1SE3 A;  5G5G A;  4XX5 A;  3X0W A;  2AQ2 B;  3HM3 A;  4FLH A;  2MP2 A;  1OQQ A;  1D5Z C;  1GOZ A;  1XLQ A;  1H8C A;  1LXD A;  3DBR I;  4ZRQ A;  1IPG A;  2RGF A;  2DZI A;  4LLG M;  2AQ3 B;  3RI7 C;  2IBI B;  1FPY A;  4TUU A;  3DBS A;  4I6L B;  2MW5 A;  3BVZ A;  3I3T B;  3P2B A;  1E9M A;  2FAZ A;  1QT9 A;  2G45 B;  3A1Q B;  4IWQ A;  4A3P A;  4HRO A;  3BK1 A;  3SR6 A;  1C9F A;  3QIJ A;  4M8M A;  4MSQ B;  5BYR A;  2DLB A;  4S0R A;  1FNV A;  1VLB A;  4AQ7 A;  3QHT A;  2W55 A;  3E56 A;  2LUM A;  3Q8E A;  2OJW A;  3A9K A;  1MFW A;  3DBH B;  4NZL B;  4ZRP A;  1RWS A;  3NHE B;  3Q8C A;  1K53 A;  3DPD A;  3Q8F A;  1VZ6 A;  3UQB A;  1J7C A;  3BYT B;  2AQ1 B;  1FXT B;  3P4P B;  4KGR A;  3Q6B A;  3VUX A;  3P4S B;  2FE8 A;  1WZ3 A;  2KC2 A;  1S1Q B;  4ARI A;  4HWI B;  2QMT A;  2HDE A;  3VXW A;  3RUL A;  4K7S A;  4HK2 A;  4GDK B;  1AN8 A;  4DHZ B;  1WMH A;  1TS3 A;  5DPS A;  4AWJ A;  3H9D A;  1FNU A;  3NY5 A;  1RFK A;  2WX1 A;  4AUQ C;  3TUO A;  4C56 C;  1WJN A;  4XC2 A;  2JF5 A;  3U8Z A;  4G11 A;  2JZZ A;  4H2A A;  5BMH A;  1IUE A;  1TKY A;  2CU1 A;  1V97 A;  3RN9 C;  1V2Y A;  4XWT A;  4ANX A;  4JWS C;  1XCQ L;  2AL6 A;  2PTL A;  2KMC A;  1K8R B;  3RYT A;  2Y5C A;  2L52 A;  1ENF A;  3P42 A;  4NY0 A;  2D5G A;  5E6P A;  4DXG A;  1TKE A;  3RMK C;  1ESF A;  3ZVV A;  5BYS A;  2J53 A;  3NG0 A;  1ZXI A;  3KUD B;  1LM8 B;  4M00 A;  1I7H A;  2JSV X;  4P1C C;  4BZA A;  2REX A;  3CMM B;  1YMH E;  5E6O A;  2LUE A;  2G1E A;  2JT4 B;  1ISN A;  4RGO S;  1SEB D;  2G9H D;  3NS1 A;  1WXS A;  4NAM A;  4HEA 1;  3ZKJ C;  2PE9 A;  1OGW A;  1I4X A;  2Z0E B;  2I1K A;  4USA A;  4GLS C;  4S17 A;  3DWG C;  4PT5 A;  4TV3 A;  2HE7 A;  5C3J B;  1WJ4 A;  1WGR A;  3W9C B;  4JL9 A;  2JU6 X;  4RF1 A;  4IC7 B;  1DGJ A;  2OHF A;  4YSX B;  3H7S A;  4N59 A;  4HPM B;  1KF6 B;  1SBB B;  1FEH A;  5DPT A;  1SJH D;  3WAN A;  1XF5 L;  1F52 A;  3ETR A;  3GE8 C;  3HM6 X;  4M01 A;  2EKE C;  2J0M A;  3WA0 A;  1HE8 A;  1I4G A;  3ZW3 A;  1OTR B;  1WYW B;  3APD A;  1PGX A;  2ZCB A;  3RD2 A;  2NTS A;  4DHJ D;  4HPL B;  4DXA B;  1I4H A;  4GMV A;  1SJE D;  4GDL B;  1T0S C;  2K8C A;  4AOF A;  3MP9 A;  2H89 B;  1MVK A;  3TEX A;  4XE0 A;  2VZK D;  1WE6 A;  1P0R A;  4GOC A;  2LHE A;  4MEM A;  4L23 A;  3MHZ A;  1QKZ A;  4NAW B;  2CHX A;  1YX6 B;  4PYZ A;  4FJZ A;  4II2 B;  5DPR A;  2CU3 A;  4DXF A;  1ET6 A;  3AE8 B;  1IBX B;  2KNB A;  3Q3M C;  1L2N A;  3HIZ A;  4JLC A;  3ZJV A;  1TT5 B;  5CHW A;  1BT0 A;  3U4E G;  3V6E B;  1GUA B;  2KDF B;  1TY0 A;  3PS6 A;  1N5X A;  4BOZ B;  3ENE A;  4YTP B;  1V5O A;  2MHJ A;  2NCN A;  5TR5 A;  4W9J A;  4KDL B;  3EGR A;  4RM8 A;  3WAP A;  2K39 A;  1YN5 A;  3DHG C;  1MHX A;  2V9H A;  3FC4 A;  3RNF C;  4RCO A;  3AMZ A;  3Q8B A;  1MG8 A;  2KQS A;  3N32 A;  4OVU A;  4WJQ A;  2WLB A;  4OW0 A;  1QZE A;  2I2Y A;  2X38 A;  4LNK A;  1HTQ A;  2HTH A;  2C7H A;  2WXK A;  4ZRI A;  2V4I B;  2E6X A;  2EKI A;  5G55 A;  4WWO A;  3L54 A;  3N3K B;  3CF6 E;  1FD6 A;  4C7Y A;  3IAM 1;  2YEP F;  2N4F A;  3SFD B;  2CR5 A;  3Q8A A;  2KVR A;  2Q5W D;  2NMQ A;  2N9K A;  3AE5 B;  3RCZ A;  3R66 C;  3B9J A;  3PGE A;  3Q3J A;  1I42 A;  1N62 A;  2JXT A;  2N9X A;  2DAJ A;  1VJK A;  3J9C A;  4LNI A;  2B76 B;  2L05 A;  2KMA A;  4WQO B;  4AJW A;  2KQ7 A;  2KX3 A;  1JWA D;  3T3O A;  2LRU A;  1XLP A;  3FIL B;  2KT7 A;  5JH5 C;  2N1V A;  1J0G A;  1A70 A;  4EKU A;  3IT4 B;  3HUI A;  2IYD B;  2D3B A;  4HXD A;  4B0E A;  4TQ0 A;  3UIP B;  1FMA D;  2JWZ A;  2KDE B;  2WXL A;  1ZGU B;  4W9D A;  1ZP0 B;  2V4L A;  2A5U A;  4MH8 A;  5AZH A;  2BS2 B;  2HTM E;  3SD5 A;  4ZHO A;  2ICI A;  3ZXR A;  4D2K A;  5D3I B;  4NQK E;  1FIQ A;  2EMS A;  3KQ4 A;  1TKG A;  3DHH C;  2JVC A;  1HQR D;  4HDQ A;  1XXG A;  3PLV A;  2WU5 B;  3NUH B;  4YTN B;  3HVD A;  2WX0 A;  2W3S A;  4KIK B;  1STE A;  1SF0 A;  1N63 A;  1G6J A;  5GXG B;  2GLS A;  2MCN B;  1E7V A;  4XWW A;  2KTF A;  3PZ8 A;  1QQR A;  2L1A A;  4NQL B;  4CQN A;  4RF0 A;  5JZE B;  3U52 E;  1EUV B;  2Z59 B;  2WXQ A;  1EWC A;  1TZ1 A;  1IYF A;  2WHI A;  4YTM B;  3AB5 A;  4C4V B;  4LTU A;  4E71 A;  3ZYY X;  3ECI A;  4BOS C;  5CTR C;  3C8Y A;  1V80 A;  5AUK A;  4C4V A;  3LB8 C;  2I1J A;  1JCK B;  2L00 B;  2JRH A;  2MLB A;  4C00 A;  3QWZ B;  2ZW0 A;  1LFD A;  2D10 A;  3AV8 A;  3ZNH B;  3UQA A;  3ZTC A;  2LEK A;  3PPA A;  2RSU A;  1WWT A;  3ABV B;  5D6J B;  3N20 C;  1WM3 A;  4BKS D;  3KYD D;  4FUL A;  4KVG B;  4B9K A;  1GB4 A;  3HRD D;  1I4Q A;  1ZUD 2;  2ZCC A;  3AE2 B;  4YT0 B;  5L83 A;  1KTK A;  1AW7 A;  2LVO A;  3KVF B;  4JPS A;  2XBB C;  4HJK A;  2JQR B;  3V61 A;  1NI3 A;  2CHW A;  3SEB A;  1MHH E;  1T0Y A;  3CIR B;  1KM7 A;  3I57 A;  4WQM A;  3TEY A;  1WF9 A;  3APC A;  2MRP A;  3OAW A;  2K3U A;  2C60 A;  4LNN A;  3AEG B;  1D6E C;  1E8X A;  3QA8 A;  3TBL D;  1YN3 A;  1JQ4 A;  3RZW C;  1E8Y A;  2KYW A;  4L2Y A;  2ZNV C;  2RDH A;  2BB6 A;  3BZD B;  4I6P A;  1WGG A;  5J17 A;  2FCQ A;  1YQ3 B;  1D4B A;  4NNJ B;  5D3D A;  4WJP A;  3X23 A;  1UGM A;  3VFK A;  4G50 A;  1L0Y B;  4FN2 A;  3L16 A;  1FCC C;  1VR9 A;  2DZM A;  3BY4 B;  2RDG A;  2C9W B;  2M0X A;  2ACZ B;  5IAA C;  3DHI C;  4ICV A;  1I4R A;  1TZO A;  4AJY B;  1V9J A;  1YIW A;  2LHD A;  4FA6 A;  4EOY A;  3ZNZ B;  5EE3 A;  1BUI C;  2BW2 A;  2IGG A;  1SE2 A;  4JQW C;  4KZ0 A;  5BO4 B;  4A8X C;  2ZEQ A;  2HD5 B;  5IP4 D;  3NZ3 A;  2XNA C;  1JRO A;  2M8S A;  4EUT A;  2FID A;  1EO6 A;  2VH1 A;  3NVZ A;  4M0W B;  3TMP B;  1WJ6 A;  3KW5 B;  2BS3 B;  1ZKH A;  1V86 A;  4YL8 A;  3MC9 A;  4PYU A;  2IDY A;  3HVZ A;  2R2O A;  2JUO A;  3EUB 2;  3IT6 B;  2BYV E;  2INP E;  2GBM A;  2PVG C;  3Q2A C;  4K3C A;  3I9V 1;  2HJ8 A;  2IGD A;  2B3A A;  3B08 A;  4TKN A;  2JYT A;  1NI2 A;  1AAR A;  1NEN B;  3PZ7 A;  4N58 A;  2WDV B;  5HI1 A;  1L5P A;  2IO3 B;  4ASW C;  3TEW A;  2ZW1 A;  2V3N A;  2LWP A;  3AH7 A;  4K3B A;  3AUL A;  4DHJ B;  3VH3 B;  3K9P B;  3MHS D;  1TIF A;  3TIX A;  2FCN A;  2C7M B;  3QCA A;  3RNC C;  1GAQ B;  2QC8 A;  3APF A;  5AUI A;  5AZG A;  4B0M A;  2LAS A;  4FJV B;  1F2R C;  3TCA A;  1GPX A;  2BGF A;  4N6E B;  3MJW A;  3ONS A;  3Q3N C;  4MDK E;  2K6Q A;  3AE4 B;  1LQB A;  2J42 A;  3H8H A;  5FR3 A;  2MBB B;  2IND C;  2NBW B;  3AEB B;  3KUZ A;  1P7E A;  3L17 A;  1KH0 A;  3VR8 B;  2WDR B;  3A9K B;  3O65 B;  1WR6 E;  3DVG Y;  3KWV A;  4W9L A;  4EZK A;  2VRR B;  1J8C A;  3JYU A;  2G4S A;  2KJR A;  2MX2 A;  2N7J A;  3VHT C;  2PE6 B;  2XN9 C;  4RGT A;  4ICU A;  4G3X B;  3L08 A;  2JWU A;  2CJN A;  1DYQ A;  2K1F A;  3NZU A;  4KSK C;  1F9J A;  3N1Y C;  3M95 A;  1M4V A;  4JX1 C;  4RGN A;  1IGC A;  3DCG A;  1C76 A;  1U4A A;  4BKS A;  5JXV A;  3M62 B;  4RFB A;  1L0V B;  3ZLZ A;  2KDI A;  4OVZ A;  4DK5 A;  1ZW7 A;  2PJH A;  3VRA B;  4ANW A;  1EF1 A;  2GI9 A;  3A4R A;  2BVC A;  2PMV A;  3AE9 B;  1WGD A;  3PO0 A;  2J52 A;  3P63 A;  3Q69 A;  5LXH A;  4M0W A;  2FUH B;  3VRB B;  2QEJ C;  5C1Z A;  1XD3 B;  1RLF A;  3EEC A;  5H8Y E;  3UF8 A;  2LGY A;  2KFK B;  4GN1 A;  1JWU D;  4XGA B;  3AE6 B;  3PSE B;  1WGK A;  2SAK A;  2MJD A;  3BK2 A;  5J2R A;  3DBL I;  3VTV A;  1MJD A;  1F2R I;  1GC6 A;  3Q3O C;  1J7B A;  3H1U A;  3ZGZ A;  3WAM A;  2J4X A;  3W1S C;  4BBN C;  3NZS A;  1KOT A;  3AU4 A;  2KHW B;  2H88 B;  3VVW B;  3B2F A;  2W9N A;  2BPS A;  3V62 A;  3QX1 A;  4DWF A;  2C7N B;  3OJ3 A;  3TSS A;  1NBF C;  1NYR A;  2DHZ A;  2BKR B;  1QOF A;  5HG2 A;  1XLN A;  4A55 A;  1UWX A;  5G5H A;  3FIL A;  4M8N A;  3RUI B;  1UH6 A;  4M02 A;  4L1B A;  4KX6 B;  2WGS A;  4FHK A;  3I5J C;  4WWN A;  4LNO A;  3WAO A;  3JVZ X;  3NS8 A;  2ZNV B;  2LVQ A;  2J0K A;  5G2N A;  2CKH B;  4F8C B;  2BYT A;  2KDM A;  4HCP B;  2V1Y A;  2NBV B;  1X1M A;  4GDL A;  5LXI B;  3IFW B;  3ZO5 B;  1KFY B;  2WXH A;  1WE7 A;  3ML8 A;  3TEZ A;  2RD0 A;  1YQB A;  3L13 A;  3FAH A;  1F0Z A;  2KO3 A;  1V81 A;  3DBL B;  4KDI C;  1JRP A;  1XQQ A;  1Y56 A;  2KFJ A;  3L4P A;  3RFZ B;  2LJI A;  4ARC A;  2QIE B;  3GZN I;  1N6Z A;  1P1A A;  2GBR A;  1ET9 A;  3R3M A;  1ROE A;  4MAC A;  2RPV A;  2W54 A;  3ZDT A;  1P98 A;  1WSP A;  3A1Q A;  4AS1 A;  1XCT L;  3PV1 A;  5HHD G;  5LLI A;  2KK8 A;  3AEF B;  4J3O D;  1JW9 D;  3ZJT A;  3AXC A;  1WR1 A;  5IOI A;  4KGS A;  3VUW A;  4ZYS A;  4IUM B;  3V3X A;  2LGS A;  1PGB A;  2M56 B;  4DDG D;  3LJ3 A;  2OED A;  5HKH A;  1TYG B;  1CZP A;  1YJJ A;  5D7G A;  1N5W A;  3KUC B;  4IM2 A;  1MG4 A;  3ZIM A;  1XO3 A;  2LD9 A;  5BMG A;  3IHP C;  1K50 A;  3VTW A;  3LXF A;  2PLP A;  2Y3A A;  4XDD A;  2KVZ A;  2KJH B;  1L6V A;  3Q3F A;  2BBC A;  2ZZP B;  1RRB A;  2GBN A;  1VRA B;  4K7U A;  3R2T A;  1E0Z A;  5J18 A;  4YSY B;  4US8 A;  4BKT A;  1L0X B;  1ACC A;  1JAL A;  3N1X C;  3JW0 X;  5E6J A;  1ZDX A;  2KMM A;  2KLC A;  3N1Z C;  2OJR A;  3SDL C;  3RNA C;  3AEE B;  3AE7 B;  2R2Q A;  2CHZ A;  3OJ4 B;  1DOX A;  3VQI A;  4HDO A;  4RH6 A;  1TTN A;  4A3O A;  1ZOY B;  1L7Y A;  2L0T A;  2CJO A;  4KKI A;  2DNF A;  4BBN F;  3EFU A;  2VZK B;  4WJO A;  1N60 A;  3AEA B;  3QJZ A;  4ZHP A;  2WQY B;  4XDC A;  5EDS A;  4KGT A;  1E6E B;  3IVF A;  3ZTD A;  1PQS A;  1UZX B;  2WXI A;  3QK0 A;  4LCD E;  2SEB D;  2BS4 B;  4IKG A;  1K51 A;  3QAR A;  1UUP A;  4PS8 A;  5EE9 A;  2PIA A;  3CWI A;  1WMH B;  4PS3 A;  2K8B A;  1E8W A;  4NAW A;  4II3 B;  3PVL A;  1NYQ A;  1CQV A;  2MBO A;  2RR9 A;  4WIP A;  2EEL A;  3DVN V;  4ANU A;  2V3P A;  2RPQ A;  2JXX A;  1F77 A;  2RMM A;  3NRZ A;  2JYE A;  2QCZ A;  4ZOH C;  5CHV C;  3DWM A;  4URK A;  2BB5 A;  1C3T A;  2WXO A;  1V5T A;  2MBQ A;  1T0Q C;  1OFF A;  4B95 A;  1FRR A;  1SE9 A;  2DYO A;  4ITK A;  4IWO A;  4LK0 M;  1AYF A;  1V1P A;  1L4Z B;  1MPE A;  4IM3 A;  4W9E A;  3A4S C;  4DQO C;  1L4D B;  1JRU A;  2WXF A;  3GB1 A;  2G3Q B;  3R2I A;  4GB9 A;  2MSE D;  3RNG C;  2GBK A;  2FIF A;  3VTU A;  5JHA A;  1HZ5 A;  2M19 A;  3VH4 B;  4A6Q A;  1E5W A;  4O1N A;  3NVY A;  1WGY A;  3AN1 A;  4C7Z A;  4BFR A;  2YVC A;  4WJN A;  2KAN A;  1XLO A;  3ZUN A;  1V49 A;  1WXM A;  1E7U A;  4LNF A;  1C79 A;  2Y5B B;  4ACF A;  1EU3 A;  3HK0 A;  2Z0D B;  2QIL A;  4QAY A;  3GP7 A;  2K6D B;  1IBX A;  1H4R A;  1D5X C;  4ZDV A;  5IA7 A;  1Q5W B;  2GMI C;  2MJE A;  2X8X X;  3W5U B;  2DX5 B;  1WX7 A;  3DVN U;  1FXA A;  3LDZ E;  4MGY E;  4AP4 C;  5LNK 1;  3MC8 A;  1C77 A;  3C0R B;  1Z5S B;  3GS2 A;  1BML C;  3CST A;  3C19 A;  3L0W B;  3O13 A;  2J0J A;  1KLU D;  3AE1 B;  1PFD A;  2FCM A;  4YSZ B;  2VH2 A;  1SIF A;  4K7W A;  2WYQ A;  1DOY A;  3L10 B;  1I4P A;  4A20 A;  2LI5 A;  3QQ8 B;  1OQR A;  4TMA B;  3BVM A;  3H6N A;  4IW0 A;  4WH4 A;  2N9P C;  3N30 A;  1N61 A;  3KWL A;  2IZV B;  1QLB B;  1C4A A;  4P1B C;  4GXB A;  1CJE A;  1M94 A;  2D11 A;  2IO2 B;  2FBW B;  2BYF A;  1C4C A;  5E6N A;  4XYC A;  1UBQ A;  2MWS B;  4P7I A;  3ZNG C;  2W3R A;  1FM0 D;  4J6I A;  3UGB B;  1D5M C;  2LGD A;  4GDK A;  3GE3 C;  2L32 A;  1VCB A;  3SFE B;  3W1Y A;  4W9I A;  2IO0 B;  2JRI B;  1HEZ E;  4OZA A;  5MPO A;  1Z2M A;  5FR6 A;  2NPT A;  1JML A;  3BVG A;  3V60 A;  4MGK E;  1PYW D;  3DDC B;  1YJI A;  5CX3 A;  2N7D A;  2UWQ A;  3M3J A;  4NJC A;  1SSN A;  4NPN A;  2DAF A;  3PRZ A;  3URY A;  2ON8 A;  1EM7 A;  3PZD A;  1WX9 A;  2LVP A;  5BYQ A;  4HLE A;  3NJT A;  1P7F A;  5TSS A;  1KLV A;  1S3S G;  2L83 A;  5HFY A;  1FXI A;  1EU4 A;  2JY6 A;  1NVI D;  2KWV B;  3BWU D;  3ZQ4 A;  3DOW A;  2BTE A;  2KAJ A;  3CSF A;  2BF8 B;  1WY8 A;  4X57 B;  2DZJ A;  3U30 A;  3DBH I;  3SHQ A;  3WIM A;  2ZVO A;  4XZ4 A;  2WXN A;  3H7P B;  4MM3 A;  1WX8 A;  3P4R B;  1P3Q U;  1FFU A;  1UD7 A;  2KOX A;  4EZJ A;  1CK1 A;  4LJP B;  2A4Z A;  2MA9 B;  2QDF A;  2FCS A;  1JWB D;  2FNJ B;  4RMA A;  4WAF A;  4GU2 A;  2C5L C;  1WXQ A;  2N0S B;  5CHF A;  3DQV A;  2L76 A;  3ZNI D;  4IM0 A;  4C80 A;  1HA5 A;  1TS4 A;  2LFI A;  2PVO D;  1YX5 B;  2WWZ A;  1QOA A;  1GC7 A;  4HVB A;  3A33 B;  3PRE A;  1HTO A;  2Y5P A;  2NBU A;  1QOB A;  1UWM A;  2INN E;  2JPH A;  4W9K A;  2AX5 A;  4W9C A;  2KD0 A;  1A5R A;  2JZ3 B;  4WWM A;  1RAX A;  2KWU B;  5JHB A;  4A90 A;  2K5P A;  2QHO A;  2KZR A;  2MJ3 A;  2N7E A;  3IG3 A;  4WWP A;  1K52 A;  4ZRK A;  1WYG A;  2LGX A;  3MJ5 A;  4GIV A;  2KX0 A;  1E7P B;  1UF0 A;  1R4M I;  3KH0 A;  2L3Z A;  3EC8 A;  2MBH A;  1NDD A;  4OVV A;  1C4P A;  4LDT D;  3R7Q A;  4WUR A;  2GB1 A;  3T3N A;  3TJP A;  3UIN B;  3R8B A;  1QOG A;  4EZL A;  4F1S A;  1WGH A;  1Y8R C;  3PT2 B;  1GB1 A;  3OWE B;  5IKC M;  2W82 A;  1OEY A;  4HCN B;  3ZRC A;  4ANV A;  2WXR A;  4FJY A;  4REZ A;  3EHV A;  2KKC A;  1ZPS A;  2IGH A;  4KKJ A;  4R3D A;  2AL3 A;  3PLU A;  4OZC A;  2D3G A;  3KYC D;  1VZ8 A;  3PHW B;  3PTF C;  2BYE A;  1R4N I;  2K25 A;  5BMI A;  1UEL A;  3NOB A;  4JIO U;  3IBE A;  2R61 A;  3EFC A;  4RNA A;  5GMV A;  1NEK B;  2NPT B;  3BII D;  2DWQ A;  2MEK A;  1L6U A;  1WZ0 A;  3A9J B;  2WDT B;  2UYZ B;  1FCL A;  2I38 A;  3RT3 B;  2N9E B;  2DZK A;  2KC1 A;  2LZ6 A;  4US9 A;  2PPH A;  3ML9 A;  4BAX A;  1AWD A;  4W9F A;  3U7Z A;  3LYY A;  1T5X D;  2KWC A;  3KLS X;  1WFY A;  4Q2J A;  4DBG A;  2O6V D;  1YQ4 B;  4ZYN A;  2KJ6 A;  2DBY A;  3PRP B;  1I35 A;  3V05 A;  1RYJ A;  2K9X A;  1IP9 A;  2ONQ A;  4MSM B;  2KTR A;  2KDB A;  3N9Y C;  1ZDV A;  1E10 A;  2O6V B;  2YEP B;  2LJ5 A;  5DCN A;  2L0F A;  1SXT A;  1CMX B;  4F7Z A;  3W2D A;  1SB3 C;  4TQ1 A;  2PEA A;  5H92 C;  4P16 A;  4FAD A;  2WNM A;  5IN7 A;  2WXJ A;  3T9L A;  4FHJ A;  2UU7 A;  4JGH B;  1PDX A;  2D07 B;  4DHZ E;  4UDU C;  2M17 A;  2E3T A;  2ZVN A;  1TS5 A;  2INC C;  4FXC A;  4P6V F;  4A9A A;  4KSL C;  2WS3 B;  2NS5 A;  3BIN A;  3MFG A;  1DOI A;  2DYB A;  3P1M A;  2Z8L A;  3MTN B;  3Q14 C;  1V8C A;  2XK5 A;  1WXA A;  1GG3 A;  5AEK B;  3WAL A;  4LJO B;  2PW9 A;  4KZC A;  3U2S C;  3I63 C;  3VAW A;  1E8Z A;  5DPW A;  1TGZ B;  5I4D A;  1EWY C;  3IXS A;  4MM3 B;  1WI0 A;  1QF6 A;  1V1O A;  1WRD B;  2BQQ A;  4B6W A;  1VDV A;  4IWP A;  4EE2 A;  3DVG X;  2NTT A;  4K81 A;  2MQJ A;  2O2V A;  4IG7 B;  2AYO B;  5L95 C;  4IOI E;  2CS4 A;  2PKO A;  2BWF A;  3W1S A;  3B1L X;  5EE1 A;  2L8J A;  1F1H A;  1TBE A;  3VR9 B;  1UNS A;  2MH7 A;  4BVU C;  1FFV A;  4CO7 A;  2NVU I;  2BT6 A;  2BWE S;  5AZF A;  5D2M B;  4NJ6 A;  2N9L A;  4CHK A;  1ZE3 D;  3RPF C;  1HXY D;  3BYY B;  3K9O B;  2LRW A;  3B2G A;  1QIL A;  4E74 A;  1VZ7 A;  1YN4 A;  2KLG A;  4PS7 A;  3A9J A;  4YXD B;  2WDQ B;  4NJ7 A;  4MGI E;  4MGZ E;  2J7Q B;  1OQY A;  1B1Z A;  4MEL A;  1JWS D;  1PUT A;  2LXA A;  1SE4 A;  3GZN B;  3OLM D;  2L7R A;  4MH0 E;  1LO5 D;  5FKA C;  3AE3 B;  2V0G A;  2MP2 B;  3HHM A;  1J7A A;  3P4Q B;  1XT9 B;  4JWU C;  3T8M A;  4W9H A;  1EF5 A;  1Q10 A;  3ALB A;  2V3S A;  3R7R A;  2OOB B;  2GRI A;  2XEW A;  1JWM D;  2IJ0 A;  4I6N B;  3VDZ A;  3AM9 A;  4BKG A;  1Q1O A;  3D32 A;  2ZPN A;  3RZF A;  4JE3 B;  1YNT E;  2IO1 B;  3EA6 A;  2RDB C;  3ZXV A;  4PK1 A;  3ZJU A;  3U7D A;  2O2V B;  1WXV A;  1WM2 A;  2M1M A;  4G0N B;  4RGM A;  2IY1 B;  3PHX B;  1FNW A;  1MI0 A;  1GNU A;  3NVW A;  1C1Y B;  2QJL A;  4N9F 4;  1Q0W B;  2MBE A;  4YWG G;  3TL5 A;  1VD2 A;  3JSV B;  2GOW A;  4EEW A;  2AWT A;  4HKZ E;  4OZB A;  1KRH A;  5IO9 A;  4KV2 A;  1XEE A;  3SU8 X;  1BXT A;  2LXC A;  1FO4 A;  1TY2 A;  2JZP A;  1P9D U;  3E9S A;  2NR2 A;  2IPK D;  2EMT A;  2WXP A;  3IAS 1;  2DEN B;  3V6C B;  2D3C A;  4MJS A;  1GJZ A;  2LMC A;  1RFA A;  4K1R B;  3H7P A;  3B0A A;  4HPP A;  1PGA A;  3QAQ A;  4W9G A;  2WP9 B;  3AED B;  3AU5 A;  4OHJ A;  1WIA A;  2M0A A;  3FKY A; 
#chains in the Genus database with same CATH homology
 3M63 B;  5LXH A;  2FUH B;  2KFK A;  1WH3 A;  1MG8 A;  2KQS A;  2K8H A;  3N32 A;  4OVU A;  5C1Z A;  4WJQ A;  1KLV A;  1YJ1 A;  1S3S G;  1QZE A;  1XD3 B;  1RLF A;  3EEC A;  4ZRJ A;  4KIK A;  1KJT A;  2JY6 A;  3S2A A;  2LGY A;  2HTH A;  2IY0 B;  3UF8 A;  2C7H A;  2KWV B;  2KFK B;  2AEH A;  4GN1 A;  4ZRI A;  5G55 A;  4WWO A;  3L54 A;  3DOW A;  3N3K B;  3CF6 E;  3CSF A;  2BF8 B;  1WY8 A;  2ZPY A;  3PSE B;  3ZDM C;  4WAA A;  4X57 B;  2DZJ A;  3U30 A;  5J2R A;  3DBL I;  2N4F A;  3VTV A;  4E3C A;  5KHO A;  3DBH I;  2CR5 A;  3SHQ A;  3VUY A;  1SGH A;  3WIM A;  2KVR A;  2ZVO A;  4XZ4 A;  3UIO B;  1GC6 A;  3PRM B;  3H1U A;  5D94 A;  3WAM A;  3W1S C;  3H7P B;  4MM3 A;  1WX8 A;  4BBN C;  4MJS B;  1P3Q U;  3NZS A;  1UD7 A;  1KOT A;  3AU4 A;  2KOX A;  2KHW B;  3R66 C;  4GSW A;  3PGE A;  3Q3J A;  3RCZ A;  3VVW B;  4EZJ A;  1I42 A;  4LJP B;  3AI5 A;  2N9X A;  2W9N A;  2A4Z A;  2DAJ A;  2MA9 B;  3QC8 B;  2BPS A;  3V62 A;  2FCS A;  2KN5 A;  3QX1 A;  2FNJ B;  1V6E A;  4RMA A;  4DWF A;  2L05 A;  4GU2 A;  2C5L C;  2C7N B;  2KMA A;  3OJ3 A;  5CHF A;  1NBF C;  4WQO B;  1OEY J;  3DQV A;  2KQ7 A;  4AJW A;  2KX3 A;  2L76 A;  3ZNI D;  2DHZ A;  4DDI D;  2BKR B;  2ASQ A;  4IM0 A;  2KXJ A;  2XK5 B;  1YD8 U;  2YLM A;  2LRU A;  4GGQ A;  5JH5 C;  2G4D B;  4CYE A;  2M4N A;  2N1V A;  5KHQ A;  1YX5 B;  1J0G A;  3RUI B;  4M8N A;  2ZJD A;  1UH6 A;  2WWZ A;  4EKU A;  1GC7 A;  5C23 A;  4HVB A;  3A33 B;  3PRE A;  4RM9 A;  2NBU A;  3JSV A;  4FHK A;  2IYD B;  2JPH A;  4HXD A;  4W9K A;  4WWN A;  4TQ0 A;  3UIP B;  1UBI A;  4W9C A;  2KD0 A;  3WAO A;  3JVZ X;  1A5R A;  3NS8 A;  2JWZ A;  2ZNV B;  2LVQ A;  2JZ3 B;  2KDE B;  2J0K A;  4LDT B;  5G2N A;  1D3Z A;  2CKH B;  4FBJ B;  4F8C B;  1ZGU B;  1RAX A;  2BKF A;  2KWU B;  4W9D A;  4HCP B;  5JHB A;  4EFO A;  2V1Y A;  2V4L A;  2NBV B;  2QHO A;  2A5U A;  2KZR A;  1X1M A;  4GDL A;  2N7E A;  3IG3 A;  4WWP A;  4ZRK A;  5AZH A;  5LXI B;  3IFW B;  3ZO5 B;  3SD5 A;  2LGX A;  2O6V A;  1E90 A;  1WE7 A;  4GIV A;  3ML8 A;  2KX0 A;  1J19 A;  2RD0 A;  1R4M I;  1YQB A;  3L13 A;  3KH0 A;  2L3Z A;  3EC8 A;  2KO3 A;  2MBH A;  1V81 A;  1NDD A;  4KDI C;  3ZRF A;  2KTR B;  4OVV A;  2GBJ A;  4NQK E;  2EMS A;  1XQQ A;  2JVC A;  4LDT D;  3R7Q A;  2KFJ A;  2D2Q A;  4HDQ A;  3PLV A;  2N1W A;  1WJU A;  3TJP A;  3UIN B;  3GOE A;  2WX0 A;  4EZL A;  2DYM A;  3GZN I;  1P1A A;  4KIK B;  4F1S A;  1WGH A;  1Y8R C;  2GBR A;  3X0W A;  4XX5 A;  3R3M A;  3PT2 B;  1G6J A;  4HCN B;  1OEY A;  3ZRC A;  3HM3 A;  4ANV A;  4FLH A;  2MP2 A;  3ZDT A;  4FJY A;  1P98 A;  3EHV A;  2MCN B;  1E7V A;  2KKC A;  2KTF A;  3A1Q A;  3PV1 A;  1H8C A;  1LXD A;  2AL3 A;  3DBR I;  3PLU A;  5LLI A;  4NQL B;  2KK8 A;  2D3G A;  3KYC D;  3PHW B;  5JZE B;  3PTF C;  2BYE A;  3AXC A;  1R4N I;  1EUV B;  1WR1 A;  2K25 A;  2Z59 B;  3VUW A;  1IPG A;  1UEL A;  1TZ1 A;  2RGF A;  3NOB A;  4JIO U;  3IBE A;  4IUM B;  1IYF A;  4DDG D;  2DZI A;  3LJ3 A;  5GMV A;  4E71 A;  5HKH A;  3ECI A;  2NPT B;  5D7G A;  4HLE A;  2IBI B;  3KUC B;  4BOS C;  4IM2 A;  3ZIM A;  1WZ0 A;  3A9J B;  3DBS A;  4TUU A;  2WDT B;  5CTR C;  4I6L B;  2UYZ B;  2MW5 A;  2LD9 A;  1V80 A;  2I1J A;  3IHP C;  3RT3 B;  2N9E B;  2DZK A;  2L00 B;  2KC1 A;  3I3T B;  2JRH A;  2LZ6 A;  2MLB A;  3VTW A;  2PPH A;  3ML9 A;  4W9F A;  3QWZ B;  2KJH B;  3Q3F A;  3P2B A;  2ZZP B;  1RRB A;  2GBN A;  2KWC A;  1LFD A;  2FAZ A;  2D10 A;  1WFY A;  2G45 B;  4K7U A;  3A1Q B;  4DBG A;  2O6V D;  4IWQ A;  3ZNH B;  3ZTC A;  4A3P A;  3UQA A;  3PPA A;  5J18 A;  2RSU A;  5D6J B;  3QIJ A;  4M8M A;  4MSQ B;  4ZYN A;  2KJ6 A;  1WM3 A;  4BKS D;  3PRP B;  4BKT A;  1I35 A;  3KYD D;  4FUL A;  3JW0 X;  4KVG B;  3QHT A;  4B9K A;  2KLC A;  2OJR A;  3SDL C;  2ZCC A;  1IP9 A;  5L83 A;  4MSM B;  3A9K A;  2KTR A;  2LVO A;  2KDB A;  2R2Q A;  3KVF B;  2XBB C;  2CHZ A;  3OJ4 B;  4HJK A;  3NHE B;  3V61 A;  3VQI A;  2CHW A;  3DPD A;  2O6V B;  3UQB A;  4HDO A;  2LJ5 A;  5DCN A;  1T0Y A;  1TTN A;  2L0F A;  4A3O A;  1KM7 A;  1CMX B;  1L7Y A;  4F7Z A;  1FXT B;  2L0T A;  4TQ1 A;  4BBN F;  2PEA A;  3EFU A;  4FAD A;  1WF9 A;  3APC A;  4WJO A;  2MRP A;  3QJZ A;  3OAW A;  3VUX A;  3T9L A;  5EDS A;  4FHJ A;  1WZ3 A;  4JGH B;  2D07 B;  1S1Q B;  2C60 A;  2KC2 A;  4DHZ E;  2M17 A;  2ZVN A;  4HWI B;  1E8X A;  3IVF A;  3VXW A;  4KSL C;  3RUL A;  3QA8 A;  4K7S A;  3TBL D;  2NS5 A;  4GDK B;  4HK2 A;  3BIN A;  3RZW C;  1PQS A;  1UZX B;  3ZTD A;  4DHZ B;  1E8Y A;  3QK0 A;  1WMH A;  2DYB A;  5DPS A;  2ZNV C;  4LCD E;  4AWJ A;  4I6P A;  3H9D A;  1WGG A;  5J17 A;  2FCQ A;  3NY5 A;  3QAR A;  2WX1 A;  4AUQ C;  3MTN B;  4NNJ B;  1WJN A;  2XK5 A;  4XC2 A;  1WXA A;  4PS8 A;  1WMH B;  4PS3 A;  4WJP A;  1UGM A;  2K8B A;  3X23 A;  1E8W A;  3VFK A;  2JF5 A;  4G50 A;  3U8Z A;  1GG3 A;  4NAW A;  4FN2 A;  4II3 B;  5AEK B;  3PVL A;  4G11 A;  3WAL A;  3L16 A;  2JZZ A;  2MBO A;  4LJO B;  2DZM A;  2RR9 A;  4KZC A;  3BY4 B;  2CU1 A;  3VAW A;  1E8Z A;  5DPW A;  3DVN V;  1V2Y A;  2C9W B;  2M0X A;  4ANU A;  1TGZ B;  5IAA C;  2RPQ A;  4ANX A;  2JXX A;  4ICV A;  1WI0 A;  2AL6 A;  5CHV C;  2KMC A;  1K8R B;  3RYT A;  4AJY B;  1V9J A;  4URK A;  1C3T A;  1WRD B;  4B6W A;  4IWP A;  3DVG X;  1V5T A;  2MBQ A;  1YIW A;  4B95 A;  1SE9 A;  4K81 A;  4NY0 A;  4FA6 A;  2MQJ A;  2DYO A;  2O2V A;  4IG7 B;  4IWO A;  4EOY A;  2AYO B;  5L95 C;  4IM3 A;  3ZNZ B;  4W9E A;  3A4S C;  5E6P A;  2CS4 A;  1JRU A;  2BWF A;  2G3Q B;  3W1S A;  3ZVV A;  3B1L X;  4JQW C;  4GB9 A;  4KZ0 A;  2L8J A;  2MSE D;  1TBE A;  2GBK A;  5BO4 B;  2ZEQ A;  3KUD B;  4BVU C;  1LM8 B;  2FIF A;  4CO7 A;  2HD5 B;  3VTU A;  2NVU I;  5JHA A;  2BWE S;  5AZF A;  2M8S A;  4EUT A;  2FID A;  4NJ6 A;  5D2M B;  1EO6 A;  3VH4 B;  4M0W B;  1E5W A;  3TMP B;  1WJ6 A;  2REX A;  3KW5 B;  3CMM B;  1ZKH A;  5E6O A;  4CHK A;  2LUE A;  1V86 A;  4YL8 A;  2JT4 B;  1ISN A;  1WGY A;  4BFR A;  4PYU A;  3K9O B;  2LRW A;  2R2O A;  2YVC A;  4WJN A;  4E74 A;  2KAN A;  3ZUN A;  1V49 A;  1WXS A;  3ZKJ C;  2JUO A;  2KLG A;  4PS7 A;  3A9J A;  2PE9 A;  1OGW A;  1WXM A;  1E7U A;  4NJ7 A;  4MGI E;  4MGZ E;  2J7Q B;  2Y5B B;  2Z0E B;  2BYV E;  2I1K A;  1OQY A;  2GBM A;  4MEL A;  3HK0 A;  2LXA A;  2Z0D B;  2HJ8 A;  3OLM D;  2B3A A;  4TV3 A;  2HE7 A;  2L7R A;  3B08 A;  4TKN A;  2K6D B;  1NI2 A;  1AAR A;  1H4R A;  1WGR A;  1WJ4 A;  4MH0 E;  4ZDV A;  4JL9 A;  2MP2 B;  3HHM A;  5IA7 A;  1Q5W B;  2IO3 B;  1XT9 B;  4IC7 B;  4ASW C;  2GMI C;  3T8M A;  1EF5 A;  3ALB A;  4W9H A;  2LWP A;  2DX5 B;  1WX7 A;  3DVN U;  2V3S A;  3LDZ E;  3AUL A;  4MGY E;  3R7R A;  3H7S A;  4AP4 C;  4DHJ B;  3VH3 B;  2OOB B;  2XEW A;  3C0R B;  3K9P B;  3MHS D;  3TIX A;  4HPM B;  2FCN A;  2C7M B;  1Z5S B;  4I6N B;  3VDZ A;  3CST A;  5DPT A;  4BKG A;  3WAN A;  1Q1O A;  3D32 A;  2ZPN A;  3L0W B;  3QCA A;  3HM6 X;  3RZF A;  2J0J A;  3APF A;  2EKE C;  5AZG A;  2J0M A;  3WA0 A;  1HE8 A;  2IO1 B;  3ZW3 A;  2FCM A;  1OTR B;  1WYW B;  2LAS A;  3APD A;  3U7D A;  2O2V B;  4FJV B;  2ZCB A;  3RD2 A;  1WXV A;  3TCA A;  1WM2 A;  4DHJ D;  4HPL B;  4DXA B;  1SIF A;  4K7W A;  2M1M A;  4GMV A;  4G0N B;  2BGF A;  2WYQ A;  3MJW A;  3ONS A;  3L10 B;  4MDK E;  2IY1 B;  2K6Q A;  2K8C A;  3PHX B;  4GDL B;  1LQB A;  4AOF A;  4A20 A;  2LI5 A;  3QQ8 B;  2MBB B;  2NBW B;  1GNU A;  1C1Y B;  3KUZ A;  3H6N A;  4N9F 4;  1Q0W B;  2MBE A;  3L17 A;  1WE6 A;  1P0R A;  3TL5 A;  4IW0 A;  1VD2 A;  4GOC A;  3JSV B;  2GOW A;  2N9P C;  3A9K B;  3N30 A;  4EEW A;  3O65 B;  1WR6 E;  2IZV B;  2AWT A;  4MEM A;  3DVG Y;  4GXB A;  4KV2 A;  4NAW B;  4W9L A;  1M94 A;  2D11 A;  2VRR B;  4EZK A;  2IO2 B;  2CHX A;  1J8C A;  2BYF A;  3SU8 X;  3JYU A;  5E6N A;  1YX6 B;  2G4S A;  4PYZ A;  1UBQ A;  2MWS B;  4FJZ A;  2KJR A;  4II2 B;  2MX2 A;  3VHT C;  4P7I A;  3ZNG C;  2PE6 B;  5DPR A;  2LXC A;  4J6I A;  4ICU A;  3UGB B;  4G3X B;  3L08 A;  2LGD A;  2K1F A;  2KNB A;  4GDK A;  3NZU A;  1P9D U;  4KSK C;  1L2N A;  1F9J A;  1VCB A;  2NR2 A;  3HIZ A;  3M95 A;  2EMT A;  3W1Y A;  4JLC A;  4W9I A;  5CHW A;  1BT0 A;  2DEN B;  2IO0 B;  2JRI B;  3V6C B;  3V6E B;  4MJS A;  3DCG A;  1GUA B;  1Z2M A;  2KDF B;  5FR6 A;  3PS6 A;  1GJZ A;  2NPT A;  1RFA A;  1U4A A;  3V60 A;  4MGK E;  4BOZ B;  4K1R B;  3H7P A;  3DDC B;  4BKS A;  3B0A A;  3M62 B;  3QAQ A;  3ENE A;  4W9G A;  2KDI A;  3ZLZ A;  4DK5 A;  1ZW7 A;  1V5O A;  2PJH A;  4ANW A;  5CX3 A;  1EF1 A;  2N7D A;  3AU5 A;  2UWQ A;  3M3J A;  2NCN A;  5TR5 A;  4W9J A;  1WIA A;  4NPN A;  2DAF A;  3PRZ A;  4KDL B;  3A4R A;  4RM8 A;  3WAP A;  2K39 A;  1WGD A;  3PZD A;  1WX9 A;  2LVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...