3V60A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
PETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v60A00
1WFYA 1V86A 3PLVA 4KZCA 1RFAA 4EFOA 2KLCA 3ZTDA 1Q5WB 1WR1A 3ML8A 1WX9A 2MBHA 3ZNGC 2I1JA 3PHXB 3VUXA 1E7VA 5BO4B 4NY0A 4F8CB 2KQ7A 4PS7A 1G6JA 1P98A 2LVOA 2MLBA 3L0WB 2G45B 4ANWA 4HJKA 4ZRIA 3VHTC 2LGXA 3UQAA 4EOYA 1P9DU 1ZGUB 3T9LA 4TV3A 4GDKA 2KFKA 3P2BA 2NBWB 5L83A 4X57B 2NBUA 2WX0A 4LJOB 1WGYA 3DDCB 2C7NB 3DBHI 4BKTA 2AWTA 2KOXA 1VD2A 2GBNA 3RULA 2N7DA 4HDOA 2DAJA 2L7RA 2O2VB 4BBNF 2IO0B 4TQ1A 2ZCBA 2M0XA 3IFWB 4B9KA 4WJPA 2ZPNA 2FNJB 1R4NI 3KW5B 3VTUA 2V4LA 5AZFA 2EMTA 1V80A 3PZDA 4K81A 1ZKHA 2AYOB 4FN2A 3W1YA 4AOFA 2KTFA 3U30A 2D3GA 3PREA 4TKNA 2N7EA 5J2RA 3RCZA 1YX5B 2IO1B 1RAXA 3ECIA 3MJWA 4LCDE 1TTNA 2MX2A 2NS5A 1ISNA 4KDLB 1S1QB 3NOBA 2R2QA 3R66C 4ICUA 1T0YA 2VRRB 3M62B 4GB9A 4GU2A 4II3B 1PQSA 2JY6A 3APDA 5E6OA 1GG3A 4PYZA 3KVFB 4ZYNA 4ANUA 2JRIB 2CHZA 3H7PA 2OOBB 1J0GA 3VQIA 3SU8X 2ZPYA 2JVCA 4IW0A 5J17A 3TL5A 5JHAA 1GC6A 4DBGA 1K8RB 2PJHA 3VUWA 4G11A 2G3QB 1WXVA 4MJSB 4W9KA 2PE9A 3UQBA 4NAWA 4IM0A 3L16A 4XC2A 2JF5A 2C5LC 2D11A 1GC7A 2KTRA 3HK0A 1E8WA 4IM3A 4AUQC 4DDID 1UGMA 2KX0A 1R4MI 3NZSA 2LZ6A 2IBIB 2BGFA 1Y8RC 4II2B 4JGHB 2WWZA 4EKUA 3ZTCA 2UWQA 2HJ8A 1WXSA 4I6PA 3DVGX 1EF5A 3TCAA 3PGEA 2KJ6A 5DPWA 3LDZE 3AU4A 2K8CA 3DBSA 1WRDB 3HM6X 1WM3A 4IWOA 2EKEC 4ANXA 4GDKB 2KFKB 2N9PC 2HTHA 1E5WA 2FAZA 3KYDD 1OEYA 2MBEA 2LUEA 5DPRA 3EECA 3T8MA 2BWES 2MWSB 3PS6A 2FUHB 1MG8A 2KXJA 1FXTB 2R2OA 5CTRC 2ZCCA 3TJPA 2M8SA 1UELA 3WAPA 3ZRFA 4DHJD 1A5RA 3RD2A 2M4NA 1VCBA 2L05A 4ZRKA 2BYVE 4CHKA 3RYTA 2FCQA 3JSVA 1OQYA 1UBQA 2NBVB 3JW0X 3H9DA 4BBNC 2K6DB 2LASA 3DBLI 3KUCB 2DHZA 1RLFA 3L10B 2ZEQA 2LWPA 2ZVOA 4BKGA 2IY1B 3LJ3A 2WDTB 4IWPA 4AJYB 1XQQA 3RZFA 3VVWB 3UGBB 3L54A 1V9JA 4DXAB 1IPGA 2LI5A 2W9NA 2KDEB 2NPTA 4KIKA 4OVUA 5KHOA 3DVNV 3QAQA 3AU5A 4A20A 5JZEB 4AWJA 2KANA 3H7PB 2L8JA 4J6IA 2JXXA 1IYFA 2GBRA 1P1AA 3SDLC 3NY5A 2Y5BB 3VH4B 4MGZE 4BKSA 4BOZB 1WJNA 3D32A 3V6EB 2FIDA 4NAWB 5C1ZA 4NPNA 2DYMA 1LQBA 3ZLZA 1TBEA 2N1WA 3N32A 2KTRB 3A9JA 4GSWA 4PS8A 3VFKA 1V6EA 3ONSA 2KD0A 2K39A 2JRHA 1Q1OA 2B3AA 1WGDA 2BWFA 4PS3A 1F9JA 1WF9A 2CHWA 2PPHA 4AP4C 4K1RB 2JPHA 1LFDA 3EC8A 3OJ3A 1Z5SB 1L2NA 1V49A 2CU1A 1I42A 3B0AA 3KYCD 2L0FA 2ZZPB 3AULA 2LGDA 4DWFA 3VUYA 1L7YA 1WMHA 2Z59B 3QJZA 2JWZA 1Q0WB 3B08A 4KZ0A 3U8ZA 4IUMB 2KDIA 2KVRA 1SIFA 3JSVB 1GUAB 2MW5A 3KUDB 4FHJA 1HE8A 5D94A 4F7ZA 2BKFA 4I6LB 2MBQA 5J18A 2KDBA 1EO6A 5LXHA 1V81A 2DZIA 1V5TA 2IYDB 2KJHB 4ZDVA 4URKA 1AARA 4NQLB 2V3SA 1NDDA 4HPLB 2LRWA 2REXA 1S3SG 2UYZB 1WE7A 2J0KA 4NNJB 1KLVA 3IG3A 3QK0A 2NPTB 4KIKB 4IG7B 2LVQA 3VTVA 1WXMA 2BF8B 2AL3A 2GBKA 1WI0A 2LJ5A 4DHZE 2IO2B 3B1LX 3KH0A 1WJUA 2JZ3B 3ZDTA 3DPDA 3APCA 4A3OA 3PV1A 1D3ZA 2O6VA 5DCNA 4HCPB 1WGRA 2L00B 4K7UA 4W9GA 3VTWA 4DDGD 1KOTA 2FCNA 2C7MB 2EMSA 1YQBA 2KX3A 3UF8A 1LXDA 4RMAA 2KHWB 3ZUNA 3H1UA 3H6NA 3MHSD 2JT4B 2GBJA 3A9JB 3UIPB 3ZDMC 2MQJA 3NS8A 1TZ1A 3PHWB 3L08A 2DYBA 5C23A 4N9F4 2I1KA 3BINA 1EF1A 3RT3B 1M94A 3QHTA 2DAFA 3ZRCA 4MGIE 4RM9A 3QC8B 1WYWB 4P7IA 4WJNA 2XEWA 4WAAA 1WZ0A 2K8BA 3CSTA 3HM3A 1U4AA 4EZLA 3EHVA 2KFJA 3PRPB 1KJTA 2GOWA 4KVGB 2N4FA 3QX1A 4RM8A 2KNBA 2KWUB 5AZHA 2KWVB 3X0WA 1ZW7A 3DVGY 2YLMA 1WMHB 4CO7A 1OEYJ 2JZZA 3WAOA 3OLMD 2J0MA 2IY0B 3M95A 1X1MA 1E8YA 4GMVA 4MGYE 5AZGA 2CKHB 1P0RA 2C9WB 2G4SA 2A5UA 5JHBA 2BKRB 2IZVB 5D2MB 1OTRB 5AEKB 2DENB 5LXIB 2A4ZA 1JRUA 1UBIA 4JL9A 4AJWA 1WR6E 2DZJA 1E7UA 4G3XB 4NJ6A 2MCNB 1WZ3A 2KZRA 2YVCA 4GN1A 2DZKA 3W1SA 4HWIB 1UZXB 2CR5A 3TIXA 3H7SA 1Z2MA 2IO3B 3I3TB 4IWQA 4EUTA 4W9JA 3UIOB 2RD0A 3K9OB 4MDKE 2NVUI 1GJZA 2K8HA 2OJRA 2BYEA 4JQWC 4YL8A 3ZKJC 4ICVA 3S2AA 2JUOA 3JVZX 2O6VB 2PEAA 2V1YA 5D6JB 4KDIC 4CYEA 2KMCA 2XK5A 5JH5C 5IAAC 3IVFA 4W9DA 4BVUC 2MP2A 5KHQA 1WM2A 3A4SC 2L76A 4B95A 5HKHA 2CHXA 2C60A 2PE6B 4ASWC 4WQOB 1XT9B 3HHMA 3QARA 3ML9A 4M8MA 3VH3B 4E3CA 1J19A 1UD7A 3QIJA 4BKSD 4KV2A 3WIMA 4B6WA 2HE7A 2D07B 4A3PA 4MSQB 2KKCA 5E6NA 2KC2A 4EZJA 5CX3A 4MELA 3V6CB 4OVVA 2M17A 4EZKA 3QCAA 4WJQA 2N9EB 1J8CA 2AL6A 3OJ4B 3K9PB 2K25A 2LXAA 4ZRJA 1E8XA 1GNUA 1WJ6A 2ASQA 5EDSA 3IHPC 4HLEA 2DYOA 3QA8A 2AEHA 4PYUA 4W9FA 4HPMB 1NI2A 2KWCA 3WAMA 4K7WA 4MM3A 3VAWA 5L95C 1WH3A 4FA6A 4GXBA 3A33B 2J0JA 1WE6A 2RGFA 1V5OA 3PLUA 4NJ7A 2LVPA 3JYUA 3A1QA 3ZNZB 4E74A 3R7RA 2XBBC 3DCGA 1QZEA 1E8ZA 1BT0A 3VXWA 1SE9A 4MSMB 5GMVA 2L3ZA 3KUZA 5CHWA 4GOCA 4DHJB 3ZW3A 3DBRI 4FADA 3RZWC 5TR5A 1YJ1A 4BFRA 1C3TA 1WJ4A 4E71A 3AXCA 2G4DB 4GGQA 1SGHA 3UINB 4FJVB 4W9EA 2ZNVC 3R7QA 2NCNA 1YIWA 2LRUA 2FIFA 3HIZA 3PRMB 3SD5A 2GBMA 3L17A 3WA0A 2BYFA 4FBJB 1WGHA 2KLGA 2XK5B 2Z0DB 3M3JA 2HD5B 4NQKE 2WYQA 2MP2B 2MRPA 5LLIA 1C1YB 2D2QA 2M1MA 3AI5A 2O6VD 1LM8B 1WXAA 2KQSA 5G2NA 3ZNHB 4F1SA 3A9KA 3IBEA 1P3QU 4LDTB 4GDLA 3O65B 4XX5A 3ZVVA 3A4RA 3R3MA 3PTFC 4FULA 2L0TA 4TUUA 2KMAA 4LJPB 4W9IA 4G0NB 2C7HA 3ZNID 3N3KB 4TQ0A 2Z0EB 1TGZB 2FCMA 4K7SA 3RUIB 1E90A 1YD8U 3PVLA 3CSFA 4KSLC 4HVBA 3DOWA 4W9LA 1NBFC 2KK8A 3OAWA 3V61A 3N30A 2ZJDA 4WWNA 4FJYA 4M8NA 5DPTA 2DX5B 3DQVA 3CF6E 4FHKA 4GIVA 4W9HA 4HDQA 2MA9B 2RPQA 4IC7B 3ZO5B 1WX8A 3W1SC 3A1QB 1CMXB 3GOEA 3C0RB 2ZVNA 5CHVC 4FLHA 3Q3FA 3TBLD 1WGGA 1OGWA 3CMMB 2DZMA 5IA7A 2BPSA 3EFUA 3DVNU 2KN5A 2KJRA 1WX7A 2MBOA 2NR2A 3NZUA 4JIOU 1RRBA 5CHFA 4DK5A 4G50A 5D7GA 3U7DA 3VDZA 1KM7A 5FR6A 2LD9A 3ZIMA 4DHZB 5DPSA 3Q3JA 2N9XA 3GZNI 4IM2A 3BY4B 4XZ4A 2O2VA 4I6NB 4HK2A 5G55A 2MSED 2N1VA 3PPAA 4MH0E 2RR9A 4HCNB 3V60A 4MEMA 3NHEB 2CS4A 2FCSA 1YX6B 2J7QB 2KO3A 1UH6A 2ZNVB 3MTNB 2QHOA 1IP9A 3QQ8B 1I35A 3ALBA 1H8CA 3L13A 3ENEA 3APFA 2WX1A 4FJZA 4BOSC 1H4RA 4M0WB 3QWZB 1WY8A 1V2YA 3WALA 5E6PA 2RSUA 3A9KB 3PRZA 2GMIC 4EEWA 2D10A 4GDLB 4KSKC 2MBBB 1EUVB 2KDFB 4MGKE 2K1FA 4WWPA 4ANVA 2LXCA 3PSEB 2LGYA 4W9CA 3SHQA 2KC1A 2K6QA 4LDTD 4WWOA 3X23A 1WIAA 4HXDA 4JLCA 4WJOA 3TMPB 3V62A 4MJSA 3M63B 3PT2B 1XD3B 3WANA
chains in the Genus database with same CATH superfamily
3AEGB 3B2FA 1WFYA 3W5UB 1Q5WB 2RDHA 2V0GA 1WR1A 1V1PB 2LMCA 3ML8A 4YTPB 3PHXB 5BO4B 4F8CB 2KQ7A 4PS7A 4ITKA 5BYQA 4RF0A 4HJKA 1D5XC 1P9DU 1NENB 3HVZA 3P2BA 2QIEB 1IGCA 4LJOB 1WGYA 3DDCB 3N1YC 2GBNA 4RGTA 3RMKC 1ZUD2 4TQ1A 2M0XA 3IFWB 4B9KA 5IO9A 1R4NI 2V4IB 3VTUA 1L0YB 4AOFA 4TKNA 2N7EA 5J2RA 3RCZA 2BBCA 2KMMA 4LCDE 4WH4A 4KKIA 1ISNA 1YN5A 1PGXA 1GG3A 1XLQA 2JRIB 2CHZA 1J0GA 4K3CA 5J17A 4JWUC 1QILA 1L0VB 3UQBA 4NAWA 2JF5A 3HK0A 3R2IA 3Q3MC 2KX0A 3EA6A 2M56B 1Y56A 2IBIB 4II2B 2HJ8A 4I6PA 3PGEA 5DPWA 1WM3A 3ZXRA 2EKEC 2LGSA 1GB4A 2KFKB 4CQNA 3KYDD 5DPRA 3T3NA 3IAS1 1ZE3D 2OEDA 1FXTB 5CTRC 2JU6X 2ZCCA 1UELA 4LNNA 2M4NA 1V97A 2L05A 2N9LA 3Q3NC 3JSVA 1K51A 3L10B 2ZEQA 1L6UA 1ZDXA 4BKGA 2IY1B 2Q5WD 3LJ3A 2WDTB 4AJYB 4IKGA 3VVWB 2QEJC 2W9NA 5FR3A 3PZ8A 4KIKA 4OVUA 2CU3A 3PZ7A 4A20A 4AWJA 2LHDA 2PVGC 3H7PB 2KN4A 2JXXA 3FILB 4MGZE 4BKSA 3D32A 2KDMA 2WS3B 3LYYA 2N1WA 4IDIA 4XGAB 2KTRB 2TSSA 2WXJA 1SE2A 2KQ4X 3Q2AC 1FFVA 2B3AA 1WGDA 2BWFA 1F9JA 4XDCA 1L2NA 3GP7A 2ZZPB 2LFIA 2R61A 4DWFA 3AECB 1WMHA 2J52A 3U8ZA 2KVRA 2QDFA 2FE8A 2MH7A 3GB1A 2VZKB 1C4PA 1EO6A 2DZIA 1V5TA 4ZDVA 3TSSA 4URKA 2V3SA 1SXTA 3BK1A 2LRWA 2BS2B 3IG3A 3GE8C 2Y5PA 1JWUD 3R8BA 2GBKA 3AE5B 2JZPA 4DHZE 1WJUA 4A3OA 3PV1A 1OFFA 5C3JB 2L00B 4K7UA 1KOTA 4DDGD 2EMSA 2KX3A 3UF8A 1FNWA 2KHWB 1JWSD 3I57A 3H6NA 2JT4B 3ZDMC 3UIPB 3AE6B 3NS8A 3PHWB 3L08A 1SIJA 2JYTA 3BINA 3HRDD 1M94A 1D5ZC 2JQRB 4ZRQA 1YJIA 3QC8B 4P7IA 4WJNA 1U4AA 3EHVA 1AN8A 3PRPB 2N4FA 4RM8A 1SE4A 2KWVB 3EFCA 2VH2A 3OLMD 4RGNA 2IY0B 3M95A 1E8YA 2G4SA 1P0RA 2A5UA 2BKRB 2XN9C 1KH0A 5AEKB 2DENB 1IBXB 1UBIA 1ENFA 1WR6E 4NJ6A 4LNOA 2YVCA 1UZXB 3TIXA 3H7SA 1Z2MA 4IWQA 2J42A 3AH7A 1QKZA 3K9OB 4MDKE 3KWVA 2OJRA 1DYQA 2JUOA 3JVZX 2D3BA 4QAYA 3RNCC 2MP2A 4L23A 4S0RA 1F2RI 4N6EB 4E3CA 3QIJA 4BKSD 4B6WA 1YN4A 3LB8C 2D07B 4K3BA 4JWSC 5CX3A 4MELA 1DOYA 3HUIA 1J8CA 1PGBA 2K25A 2LXAA 2LHEA 1WJ6A 2WXHA 3FC4A 3RNBC 2V3PA 3QA8A 2AEHA 1XF5L 2KWCA 3WAMA 5L95C 1L4DB 3AE4B 1C79A 4FA6A 3A33B 3PLUA 1V5OA 2LVPA 1FD6A 3A1QA 3R7RA 4DHJB 5CHWA 4HPPA 1YJ1A 1ZOYB 4FJVB 1LO5D 2ZNVC 2WXLA 2WXMA 4ZRPA 3WA0A 3M3JA 4NQKE 3TEWA 1JWAD 1L6VA 3SEBA 1C1YB 1KFYB 1LM8B 2W3SA 2CJNA 1P3QU 2QMTA 4GDLA 3O65B 3BYTB 3CIRB 2QILA 1MHXA 2PIAA 3PTFC 3I63C 4FULA 4W9IA 4LJPB 2MJ3A 2Z0EB 1TGZB 4B0MA 1YD8U 2W82A 1GPXA 3CSFA 4HVBA 2KK8A 2JSVX 4MM3B 4OZBA 1V1PA 4WWNA 3U4EG 1TT5B 4W9HA 4IC7B 1TKEA 1WX8A 3W1SC 4ZOHC 1CMXB 3BVZA 1ZXIA 3Q3FA 1OGWA 3CMMB 1C4CA 1TKYA 3N9YC 1QLBB 2KN5A 1WX7A 4JIOU 5D7GA 1XO3A 2GLSA 2LD9A 3Q3JA 3GZNI 4XZ4A 2JX5A 2N1VA 3PPAA 4MH0E 2RR9A 4HCNB 4RCOA 4TSSA 3U52E 4MEMA 3NHEB 2CS4A 1YX6B 2X38A 1QOBA 1UH6A 3MTNB 2QHOA 3QQ8B 3ZQ4A 1SJHD 1H4RA 1WY8A 4AQ7A 5E6PA 2RSUA 3A9KB 2M19A 4EEWA 2D10A 1EUVB 2KDFB 2K1FA 2BB5A 3UI3A 4W9CA 1WWTA 4BAXA 2K6QA 4LDTD 4WWOA 4Q2JA 4DXGA 3IT4B 3ZJVA 3PLVA 1JMLA 3AV8A 1E7VA 4NY0A 1G6JA 1JALA 1P98A 2LVOA 2MLBA 5HHDG 5G5GA 2KYWA 5H92C 4ANWA 4ZRIA 4C7ZA 1F2RC 1ZGUB 3T9LA 2KFKA 2NBWB 4IOIE 2NBUA 2WX0A 4P1CC 4BKTA 2AWTA 3RULA 1ESFA 4HDOA 2DAJA 3B9JA 1FXAA 2L7RA 4L1BA 5BYRA 5AZFA 4OVZA 1L0XB 1V80A 4K81A 3P4RB 4FN2A 3W1YA 2KTFA 1L4ZB 1YX5B 2IO1B 1RAXA 3ECIA 3MJWA 3AEEB 1TTNA 2VRRB 4GU2A 4II3B 1MFWA 4YSZB 3H7PA 3VQIA 2ZPYA 3FILA 4IW0A 4MT5A 3TL5A 1GC6A 2PJHA 4D2KA 1NYQA 4KGTA 1ET9A 4LTUA 1N6ZA 1MI0A 4YXDB 1GC7A 1RM6C 1SJED 2KTRA 3P4PB 1R4MI 4RH6A 4WQMA 3ABVB 2WDRB 4LNKA 1KF6B 1WXSA 3DVGX 3AU4A 1YMHE 4GDKB 2HTHA 2FAZA 2KACA 2V9HA 3T8MA 2MWSB 1MG8A 2KXJA 3ZRFA 2M8SA 1A5RA 2MEKA 5FKAC 4A9AA 4ZRKA 3Q14C 2BYVE 2FCQA 3LXFA 2PMVA 4BBNC 3AE9B 2LASA 2OHFA 3KUCB 2W54A 1B9RA 5EE0A 2ZVOA 2ACZB 2N9KA 3NG0A 4NAMA 5LNK1 2NTTA 1EU3A 2I2YA 4REZA 3L54A 1V9JA 4DXAB 1IPGA 1SB3C 2G1EA 2GI9A 4C4VB 2PTLA 5JZEB 4XWWA 2KANA 1UGJA 4HKZE 3U7ZA 2CJOA 1IYFA 3VH4B 3OWEB 5C1ZA 1T3QA 2DYMA 1Q10A 2IPKD 4PS8A 3BVMA 1QT9A 2KT7A 2KD0A 2K39A 3DBHB 1T5XD 2E3TA 2WQYB 4K1RB 2K3UA 4JPSA 4XYCA 2ON8A 1V49A 2CU1A 3B0AA 5IOIA 3W5VB 2L0FA 3FAHA 3URYA 2LGDA 3VUYA 5HFYA 2Z59B 1D5MC 3B08A 4KZ0A 2KDIA 3KUDB 4F7ZA 4YSYB 5J18A 1NYRA 1IBXA 5LXHA 4NQLB 5JXVA 1JCKB 2J0KA 3QK0A 4IG7B 2LVQA 4ARCA 2BF8B 1V1OA 2LJ5A 1I4XA 3B1LX 3AMZA 3KH0A 3ZDTA 3ETRA 3BWUD 3DPDA 3APCA 1D3ZA 3BYYB 2Y3AA 4UDUC 2FCNA 1YQBA 3CWIA 4YTNB 2RPVA 2NTSA 3ZUNA 1VR9A 1BXTA 3A9JB 1KTKA 1JWBD 1EF1A 1XCQL 3RT3B 4JE3B 2BTEA 3ZRCA 4RM9A 2RMMA 1IUEA 4HJGE 2W55A 4WAAA 2K8BA 3HM3A 3MC8A 1FRDA 1MG4A 1N5WA 3QX1A 3X0WA 1KLUD 3GS2A 1SE3A 1OEYJ 1YNTE 1TJEA 1VRAB 3AEAB 2J4XA 4MGYE 1F52A 2C9WB 4WIPA 3SFDB 1OTRB 4MACA 2A4ZA 4A55A 1JRUA 1E7UA 4GN1A 2DZKA 4HWIB 1AW7A 4KGRA 1FPYA 2VZKD 1ZXHA 2IO3B 3AE3B 2E6XA 1NEKB 1QOFA 2BYEA 4JQWC 4YL8A 4OW0A 1QOGA 4ICVA 4P1BC 2O6VB 2PEAA 5D6JB 4CYEA 5IAAC 3IVFA 4W9DA 1FM0D 1WM2A 4B95A 4LNFA 4WQOB 1XT9B 3P63A 3QARA 3ML9A 4M8MA 3VH3B 1UD7A 4MSQB 1MHHE 2KC2A 4RF1A 3I9V1 2MJDA 2QCZA 2M17A 3TEXA 2N9EB 1J7CA 3P42A 2AL6A 5HI1A 4DQOC 1E8XA 1AWDA 1GNUA 2AQ2B 2JWUA 2ASQA 1KRHA 5EDSA 4PYUA 4W9FA 1NI2A 4MM3A 4PK1A 1WH3A 2BS4B 2J0JA 2RGFA 4NJ7A 4ZYSA 3ZNZB 4E74A 1QZEA 1BT0A 3VXWA 5GMVA 2L3ZA 3DWGC 4FADA 3RZWC 4BFRA 4NZLB 2IGHA 3Q8FA 3VR9B 2FBWB 1EU4A 2NCNA 1YIWA 3PRMB 3HIZA 3BVGA 2HDEA 1PGAA 2GBMA 4HRSA 1WGHA 2KLGA 2XK5B 2Z0DB 2WYQA 2MRPA 4DXFA 3VRAB 3AI5A 1N63A 2KQSA 1WXAA 5G2NA 3N1XC 2PVOD 2BS3B 2YEPB 3A9KA 5G5HA 2DNFA 1TZOA 1EM7A 1DOIA 3R3MA 1UWMA 2KMAA 4KX6B 4G0NB 1FNUA 2LJIA 3DBLB 3RUIB 1HA5A 1V8CA 4W9LA 3TUOA 5BMIA 3OAWA 4A6QA 1E0ZA 1TY2A 1XCTL 4M8NA 2WXFA 3DQVA 3CF6E 2ONQA 4FHKA 4GIVA 1JW9D 3GOEA 3C0RB 2ZVNA 2Z8LA 1XXGA 2EELA 1TS5A 4YT0B 1WGGA 3T3OA 2DZMA 2WU5B 1GB1A 2KJRA 2NR2A 1WGKA 3NZUA 3Q6BA 4DK5A 3U7DA 1KM7A 3ZIMA 4KGSA 3U2SC 2N9XA 4IM2A 5BMHA 4HK2A 3W2DA 2MSED 1UUPA 4XWTA 2FCSA 2J7QB 1UF0A 2WHIA 1OQQA 1I4GA 1I35A 3ALBA 2ZW1A 3L13A 4BOSC 4FJZA 1V2YA 1YOVB 2QJLA 4WWPA 1HTOA 4ANVA 1VJKA 4J3OD 1WIAA 4USAA 2L1AA 3V62A 3M63B 1JRPA 2BYTA 2LUMA 2AQ3B 4KZCA 1RFAA 3AB5A 3ZTDA 1SF0A 3ZNGC 3VUXA 2RDGA 1EWCA 1VZ6A 2PW9A 3IT6B 3VHTC 3UQAA 4TV3A 3MJ5A 4GDKA 4ZHPA 1P7EA 4WWMA 2C7NB 1C76A 1N60A 2KOXA 1C9FA 4BBNF 2WNMA 2GB1A 3KW5B 2EMTA 1L5PA 3AE1B 1ZKHA 2AYOB 3U30A 3PREA 1TY0A 2WXNA 2MX2A 1S1QB 3R66C 2R2QA 4C4VA 5E6OA 2JY6A 4PYZA 4ANUA 1C4AA 1MVKA 2OOBB 2J53A 3SU8X 1N61A 1XLOA 5EE1A 5JHAA 5TSSA 4WAFA 1RYJA 1K8RB 1FCLA 1WXVA 4MJSB 2PE9A 4A90A 4IM0A 3Q8AA 2C5LC 4AUQC 1E8WA 4DDID 4L2YA 1Y8RC 2WWZA 2UWQA 3NVYA 3TCAA 3RNEC 2UU7A 2AX5A 3LDZE 2K8CA 3DBSA 1WRDB 2WP9B 2N9PC 1OEYA 2MBEA 2LUEA 3O13A 2DBYA 3EECA 2BWES 3PS6A 4US9A 1GOZA 2FUHB 2DWQA 3RYTA 2K0PA 1B1ZA 1UBQA 2NBVB 3JW0X 3ZJTA 2K6DB 3DBLI 1FXIA 5I4DA 3ZGZA 2LWPA 1TYGB 1TS3A 2WXGA 3RZFA 3UGBB 4S17A 1ZP0B 2LI5A 1VLBA 2KDEB 3ZYYX 4WURA 1P1AA 3NY5A 4ZHOA 2Y5BB 4BOZB 1WJNA 5D3DA 3ZXVA 1TBEA 3N32A 3A9JA 3VFKA 2JRHA 2H89B 1Q1OA 4PS3A 1WF9A 3E56A 2SEBD 3Q3OC 4A8XC 3OJ3A 4KKJA 2PKOA 1MPEA 2HTME 3V05A 2WXQA 3AULA 1DOXA 1K53A 3QJZA 1Q0WB 4IUMB 1SIFA 2EKIA 1GUAB 2MW5A 4I6LB 1RWSA 1RFKA 1NDDA 4HPLB 2B76B 2UYZB 1WE7A 4M02A 4NNJB 1KLVA 2NPTB 1WXMA 1PYWD 5IN7A 3DHHC 2INDC 2O6VA 4OHJA 5DCNA 4HCPB 1WGRA 1I4QA 2K9XA 3NVZA 4W9GA 2K22A 2ICIA 2WXKA 4RMAA 2MJEA 4ACFA 1KLGD 3AE8B 2DAFA 4MGIE 3N20C 2XEWA 4EZLA 3CSTA 2KFJA 2GOWA 4KVGB 1PUTA 2KAJA 2KWUB 5AZHA 1ZW7A 3DVGY 1T0RC 1XEEA 4CO7A 2JZZA 3WAOA 2M0AA 2IZVB 3C8YA 5LXIB 1F0ZA 1SEBD 4JL9A 5GXGB 2BT6A 3EUB2 2MCNB 1WZ3A 2KZRA 2WDVB 1QQRA 2MHJA 4C00A 3I3TB 4EUTA 4W9JA 2RD0A 1GJZA 4GLSC 3AN1A 1E6EB 3ZKJC 3S2AA 2V1YA 2KMCA 1TS2A 3N1ZC 2XK5A 5JH5C 4BVUC 1FO4A 2N0SB 3A4SC 2L76A 5HKHA 2CHXA 2C60A 4ASWC 1CQVA 1J19A 5C2TB 3BK2A 2HE7A 4A3PA 2N7JA 4EE2A 4EZJA 1HEZE 3V6CB 1JROA 4OVVA 2INNE 4WJQA 3K9PB 4ZRJA 4OZCA 4HLEA 2DYOA 3VAWA 3NRZA 1QOAA 1D6EC 1WE6A 2X8XX 3W9CB 3JYUA 1HZ5A 3DCGA 2L52A 1E8ZA 1SE9A 1T0SC 3ZW3A 2BQQA 1VZ8A 1C3TA 4RGOS 4GGQA 3UINB 2BVCA 2HJ1A 2L32A 3R7QA 2LRUA 2L83A 4H2AA 3J9CA 3L17A 3KWLA 1HXYD 5LLIA 2D2QA 2M1MA 4BZAA 2O6VD 2JYEA 4LK0M 4O1NA 3RNFC 4F1SA 1P7FA 1WSPA 3ZVVA 5AUIA 3RN9C 2L0TA 3SR6A 2C7HA 3ZNID 3N3KB 3Q8CA 4TQ0A 2FCMA 4K7SA 3BIID 2SAKA 3PVLA 3DOWA 3V61A 2WLBA 3N30A 4XE0A 5DPTA 1YJJA 4C7YA 1M4VA 2MA9B 4HDQA 4JX1C 4US8A 2NMQA 4FLHA 5IA7A 2BPSA 3EFUA 3AE7B 3DVNU 2MBOA 1RRBA 2GRIA 5DPSA 2WGSA 3BY4B 4M01A 3MC9A 5G55A 2W3RA 2AQ1B 3C19A 2KO3A 1ZPSA 1IP9A 4N59A 1H8CA 3ENEA 3APFA 4M0WB 2WXRA 2QSDA 3QWZB 1CK1A 5IP4D 2GMIC 4KSKC 2MBBB 3NVVA 2KC1A 3X23A 4HXDA 4JLCA 4RGMA 1ROEA 1YN3A 4MJSA 5BMGA 1XD3B 1FIQA 1WXQA 3RNGC 1V86A 3TEYA 4EFOA 2KLCA 1WX9A 2MBHA 2I1JA 5HG2A 2KVZA 3L0WB 2G45B 1J7AA 2Y5CA 1JWMD 2LGXA 4PT5A 4EOYA 1FFUA 5L83A 4X57B 3DBHI 1YQ3B 1PFDA 1VD2A 2N7DA 3P1MA 5EE3A 1XLNA 4RFBA 2O2VB 2IO0B 2PLPA 2ZCBA 4XDDA 4WJPA 2ZPNA 1ZDVA 2FNJB 2V4LA 3MHZA 4R3DA 1STEA 3PZDA 2D3GA 4NJCA 4YTMB 2NS5A 4KDLB 3Q8BA 3NOBA 2WXIA 4ICUA 1T0YA 3M62B 1SSNA 4GB9A 1PQSA 3APDA 4FXCA 3DHIC 3KVFB 4ZYNA 3AE2B 2JVCA 1I4RA 2D3CA 1TIFA 1SBBB 4DBGA 3VUWA 4G11A 2G3QB 1C77A 4W9KA 1F77A 2D3AA 1TS4A 3L16A 4XC2A 2D11A 4IM3A 3NZ3A 1UGMA 3NZSA 2LZ6A 4JGHB 2BGFA 4EKUA 3ZTCA 2WXOA 3GZNB 1CJEA 1EF5A 1F1HA 2KJ6A 3HM6X 4IWOA 3I5JC 1D4BA 4ANXA 1BUIC 1E7PB 1E5WA 2BB6A 2IDYA 2R2OA 3TJPA 3WAPA 3L4PA 4DHJD 4ARIA 3RD2A 1VCBA 4CHKA 3TEZA 3DHGC 1OQYA 3H9DA 2DHZA 1RLFA 4IWPA 3MC0B 1XQQA 2WDQB 1AYFA 2OJWA 2G9HD 2NPTA 5KHOA 3DVNV 1HTQA 1T6BX 3QAQA 3AU5A 4MH8A 3RNAC 2L8JA 4J6IA 1HZ6A 2GBRA 3SDLC 3V6EB 2FIDA 4NAWB 4NPNA 3ZLZA 1LQBA 1E9MA 3DBRB 5IKCM 4GSWA 2V3NA 1V6EA 3ONSA 1ACCA 3R2TA 1FEHA 2CHWA 2PPHA 4AP4C 2JPHA 1LFDA 3EC8A 1Z5SB 1I42A 3KYCD 1EWYC 1L7YA 3DWMA 2JWZA 3RPFC 5H8YE 3JSVB 4HKQA 4M00A 2WU2B 3P4SB 4FHJA 1HE8A 5D94A 3PO0A 2BKFA 2DLBA 2MBQA 2KDBA 1V81A 2IYDB 2KJHB 1AARA 2REXA 1S3SG 3VR8B 4AS1A 3NUHB 4KIKB 3NJTA 3VTVA 2AL3A 2XNAC 1WI0A 2RDBC 2IO2B 1K52A 1R4MB 2JZ3B 2YEPF 2WXPA 3VTWA 2C7MB 3GE3C 1LXDA 1JQ4A 3H1UA 3MHSD 5EE9A 2GBJA 2MQJA 1TZ1A 2DYBA 5C23A 4N9F4 2I1KA 5AUKA 1OQRA 3QHTA 1E10A 4TMAB 1WYWB 5FK9C 1WZ0A 2IGGA 4LLGM 2IGDA 1KJTA 2LEKA 2QC8A 4RNAA 2KNBA 2YLMA 1WMHB 1FMAD 2IJ0A 2J0MA 5MPOA 1TKGA 1X1MA 3Q8EA 4GMVA 5AZGA 2CKHB 5JHBA 1QF6A 4YWGG 5D2MB 1DGJA 4AJWA 4G3XB 2DZJA 2BW2A 3W1SA 2CR5A 1K50A 1T0QC 4B0EA 2KWDA 3UIOB 2NVUI 3MFGA 2K8HA 2INPE 3OG5A 4KDIC 1I7HA 3NS1A 3VRBB 5KHQA 2LGIA 4OZAA 2PE6B 1CZPA 4C80A 3HHMA 2K5PA 4KV2A 3WIMA 2INCC 4HEA1 3B2GA 2KKCA 5E6NA 4EZKA 1IGDA 3IAM1 2ZW0A 3QCAA 1R4NB 2VH1A 3OJ4B 1A70A 3H8HA 3IHPC 4HPMB 1FCCC 1YQ4B 4K7WA 3IXSA 4GXBA 3Q69A 2I38A 3E9SA 4HROA 1N62A 1I4PA 2XBBC 3EGRA 4MSMB 2FUG1 3KUZA 4GOCA 3DBRI 1NI3A 4P6VF 5TR5A 1WJ4A 1PDXA 4E71A 3NVWA 4N58A 3AXCA 2G4DB 1SGHA 3KLSX 4W9EA 1I4HA 1WRIA 3WCQA 2FIFA 3SD5A 3V3XA 1GAQB 2BYFA 4FBJB 2HD5B 3AEBB 3HVDA 2MP2B 3RFZB 1MJDA 1R7SA 4M0WA 3ZNHB 3FKYA 3P4QB 1ET6A 3IBEA 2JXTA 4LDTB 4YSXB 4XX5A 3A4RA 4TUUA 1WYGA 1FNVA 1E90A 3KQ4A 3RI7C 1VDVA 1LGRA 4LNIA 4KSLC 1NBFC 3MP9A 2ZJDA 1UNSA 4FJYA 3AEFB 2DX5B 2RPQA 4P16A 1FRRA 3ZO5B 3A1QB 5CHVC 5E6JA 3AEDB 3TBLD 1NVID 5CHFA 4G50A 3VDZA 4DHZB 5FR6A 2O2VA 4I6NB 5D3IB 3SFEB 3V60A 1C78A 2ZNVB 5BYSA 3ZJUA 2WX1A 3BZDB 3WALA 3AM9A 3PRZA 4GDLB 1BMLC 2D5GA 5T8IA 4MGKE 2LXCA 3PSEB 1HQRD 2LGYA 1XLPA 1J7BA 3SHQA 1N5XA 1VZ7A 2H88B 4WJOA 3TMPB 4C56C 1UWXA 3PT2B 3WANA
chains in the Genus database with same CATH topology
1WFYA 1V86A 3PLVA 4KZCA 1RFAA 4EFOA 2KLCA 3ZTDA 1Q5WB 1WR1A 3ML8A 1WX9A 2MBHA 3ZNGC 2I1JA 3PHXB 3VUXA 1E7VA 5BO4B 4NY0A 4F8CB 2KQ7A 4PS7A 1G6JA 1P98A 2LVOA 2MLBA 3L0WB 2G45B 4ANWA 4HJKA 4ZRIA 3VHTC 2LGXA 3UQAA 4EOYA 1P9DU 1ZGUB 3T9LA 4TV3A 4GDKA 2KFKA 3P2BA 2NBWB 5L83A 4X57B 2NBUA 2WX0A 4LJOB 1WGYA 3DDCB 2C7NB 3DBHI 4BKTA 2AWTA 2KOXA 1VD2A 2GBNA 3RULA 2N7DA 4HDOA 2DAJA 2L7RA 2O2VB 4BBNF 2IO0B 4TQ1A 2ZCBA 2M0XA 3IFWB 4B9KA 4WJPA 2ZPNA 2FNJB 1R4NI 3KW5B 3VTUA 2V4LA 5AZFA 2EMTA 1V80A 3PZDA 4K81A 1ZKHA 2AYOB 4FN2A 3W1YA 4AOFA 2KTFA 3U30A 2D3GA 3PREA 4TKNA 2N7EA 5J2RA 3RCZA 1YX5B 2IO1B 1RAXA 3ECIA 3MJWA 4LCDE 1TTNA 2MX2A 2NS5A 1ISNA 4KDLB 1S1QB 3NOBA 2R2QA 3R66C 4ICUA 1T0YA 2VRRB 3M62B 4GB9A 4GU2A 4II3B 1PQSA 2JY6A 3APDA 5E6OA 1GG3A 4PYZA 3KVFB 4ZYNA 4ANUA 2JRIB 2CHZA 3H7PA 2OOBB 1J0GA 3VQIA 3SU8X 2ZPYA 2JVCA 4IW0A 5J17A 3TL5A 5JHAA 1GC6A 4DBGA 1K8RB 2PJHA 3VUWA 4G11A 2G3QB 1WXVA 4MJSB 4W9KA 2PE9A 3UQBA 4NAWA 4IM0A 3L16A 4XC2A 2JF5A 2C5LC 2D11A 1GC7A 2KTRA 3HK0A 1E8WA 4IM3A 4AUQC 4DDID 1UGMA 2KX0A 1R4MI 3NZSA 2LZ6A 2IBIB 2BGFA 1Y8RC 4II2B 4JGHB 2WWZA 4EKUA 3ZTCA 2UWQA 2HJ8A 1WXSA 4I6PA 3DVGX 1EF5A 3TCAA 3PGEA 2KJ6A 5DPWA 3LDZE 3AU4A 2K8CA 3DBSA 1WRDB 3HM6X 1WM3A 4IWOA 2EKEC 4ANXA 4GDKB 2KFKB 2N9PC 2HTHA 1E5WA 2FAZA 3KYDD 1OEYA 2MBEA 2LUEA 5DPRA 3EECA 3T8MA 2BWES 2MWSB 3PS6A 2FUHB 1MG8A 2KXJA 1FXTB 2R2OA 5CTRC 2ZCCA 3TJPA 2M8SA 1UELA 3WAPA 3ZRFA 4DHJD 1A5RA 3RD2A 2M4NA 1VCBA 2L05A 4ZRKA 2BYVE 4CHKA 3RYTA 2FCQA 3JSVA 1OQYA 1UBQA 2NBVB 3JW0X 3H9DA 4BBNC 2K6DB 2LASA 3DBLI 3KUCB 2DHZA 1RLFA 3L10B 2ZEQA 2LWPA 2ZVOA 4BKGA 2IY1B 3LJ3A 2WDTB 4IWPA 4AJYB 1XQQA 3RZFA 3VVWB 3UGBB 3L54A 1V9JA 4DXAB 1IPGA 2LI5A 2W9NA 2KDEB 2NPTA 4KIKA 4OVUA 5KHOA 3DVNV 3QAQA 3AU5A 4A20A 5JZEB 4AWJA 2KANA 3H7PB 2L8JA 4J6IA 2JXXA 1IYFA 2GBRA 1P1AA 3SDLC 3NY5A 2Y5BB 3VH4B 4MGZE 4BKSA 4BOZB 1WJNA 3D32A 3V6EB 2FIDA 4NAWB 5C1ZA 4NPNA 2DYMA 1LQBA 3ZLZA 1TBEA 2N1WA 3N32A 2KTRB 3A9JA 4GSWA 4PS8A 3VFKA 1V6EA 3ONSA 2KD0A 2K39A 2JRHA 1Q1OA 2B3AA 1WGDA 2BWFA 4PS3A 1F9JA 1WF9A 2CHWA 2PPHA 4AP4C 4K1RB 2JPHA 1LFDA 3EC8A 3OJ3A 1Z5SB 1L2NA 1V49A 2CU1A 1I42A 3B0AA 3KYCD 2L0FA 2ZZPB 3AULA 2LGDA 4DWFA 3VUYA 1L7YA 1WMHA 2Z59B 3QJZA 2JWZA 1Q0WB 3B08A 4KZ0A 3U8ZA 4IUMB 2KDIA 2KVRA 1SIFA 3JSVB 1GUAB 2MW5A 3KUDB 4FHJA 1HE8A 5D94A 4F7ZA 2BKFA 4I6LB 2MBQA 5J18A 2KDBA 1EO6A 5LXHA 1V81A 2DZIA 1V5TA 2IYDB 2KJHB 4ZDVA 4URKA 1AARA 4NQLB 2V3SA 1NDDA 4HPLB 2LRWA 2REXA 1S3SG 2UYZB 1WE7A 2J0KA 4NNJB 1KLVA 3IG3A 3QK0A 2NPTB 4KIKB 4IG7B 2LVQA 3VTVA 1WXMA 2BF8B 2AL3A 2GBKA 1WI0A 2LJ5A 4DHZE 2IO2B 3B1LX 3KH0A 1WJUA 2JZ3B 3ZDTA 3DPDA 3APCA 4A3OA 3PV1A 1D3ZA 2O6VA 5DCNA 4HCPB 1WGRA 2L00B 4K7UA 4W9GA 3VTWA 4DDGD 1KOTA 2FCNA 2C7MB 2EMSA 1YQBA 2KX3A 3UF8A 1LXDA 4RMAA 2KHWB 3ZUNA 3H1UA 3H6NA 3MHSD 2JT4B 2GBJA 3A9JB 3UIPB 3ZDMC 2MQJA 3NS8A 1TZ1A 3PHWB 3L08A 2DYBA 5C23A 4N9F4 2I1KA 3BINA 1EF1A 3RT3B 1M94A 3QHTA 2DAFA 3ZRCA 4MGIE 4RM9A 3QC8B 1WYWB 4P7IA 4WJNA 2XEWA 4WAAA 1WZ0A 2K8BA 3CSTA 3HM3A 1U4AA 4EZLA 3EHVA 2KFJA 3PRPB 1KJTA 2GOWA 4KVGB 2N4FA 3QX1A 4RM8A 2KNBA 2KWUB 5AZHA 2KWVB 3X0WA 1ZW7A 3DVGY 2YLMA 1WMHB 4CO7A 1OEYJ 2JZZA 3WAOA 3OLMD 2J0MA 2IY0B 3M95A 1X1MA 1E8YA 4GMVA 4MGYE 5AZGA 2CKHB 1P0RA 2C9WB 2G4SA 2A5UA 5JHBA 2BKRB 2IZVB 5D2MB 1OTRB 5AEKB 2DENB 5LXIB 2A4ZA 1JRUA 1UBIA 4JL9A 4AJWA 1WR6E 2DZJA 1E7UA 4G3XB 4NJ6A 2MCNB 1WZ3A 2KZRA 2YVCA 4GN1A 2DZKA 3W1SA 4HWIB 1UZXB 2CR5A 3TIXA 3H7SA 1Z2MA 2IO3B 3I3TB 4IWQA 4EUTA 4W9JA 3UIOB 2RD0A 3K9OB 4MDKE 2NVUI 1GJZA 2K8HA 2OJRA 2BYEA 4JQWC 4YL8A 3ZKJC 4ICVA 3S2AA 2JUOA 3JVZX 2O6VB 2PEAA 2V1YA 5D6JB 4KDIC 4CYEA 2KMCA 2XK5A 5JH5C 5IAAC 3IVFA 4W9DA 4BVUC 2MP2A 5KHQA 1WM2A 3A4SC 2L76A 4B95A 5HKHA 2CHXA 2C60A 2PE6B 4ASWC 4WQOB 1XT9B 3HHMA 3QARA 3ML9A 4M8MA 3VH3B 4E3CA 1J19A 1UD7A 3QIJA 4BKSD 4KV2A 3WIMA 4B6WA 2HE7A 2D07B 4A3PA 4MSQB 2KKCA 5E6NA 2KC2A 4EZJA 5CX3A 4MELA 3V6CB 4OVVA 2M17A 4EZKA 3QCAA 4WJQA 2N9EB 1J8CA 2AL6A 3OJ4B 3K9PB 2K25A 2LXAA 4ZRJA 1E8XA 1GNUA 1WJ6A 2ASQA 5EDSA 3IHPC 4HLEA 2DYOA 3QA8A 2AEHA 4PYUA 4W9FA 4HPMB 1NI2A 2KWCA 3WAMA 4K7WA 4MM3A 3VAWA 5L95C 1WH3A 4FA6A 4GXBA 3A33B 2J0JA 1WE6A 2RGFA 1V5OA 3PLUA 4NJ7A 2LVPA 3JYUA 3A1QA 3ZNZB 4E74A 3R7RA 2XBBC 3DCGA 1QZEA 1E8ZA 1BT0A 3VXWA 1SE9A 4MSMB 5GMVA 2L3ZA 3KUZA 5CHWA 4GOCA 4DHJB 3ZW3A 3DBRI 4FADA 3RZWC 5TR5A 1YJ1A 4BFRA 1C3TA 1WJ4A 4E71A 3AXCA 2G4DB 4GGQA 1SGHA 3UINB 4FJVB 4W9EA 2ZNVC 3R7QA 2NCNA 1YIWA 2LRUA 2FIFA 3HIZA 3PRMB 3SD5A 2GBMA 3L17A 3WA0A 2BYFA 4FBJB 1WGHA 2KLGA 2XK5B 2Z0DB 3M3JA 2HD5B 4NQKE 2WYQA 2MP2B 2MRPA 5LLIA 1C1YB 2D2QA 2M1MA 3AI5A 2O6VD 1LM8B 1WXAA 2KQSA 5G2NA 3ZNHB 4F1SA 3A9KA 3IBEA 1P3QU 4LDTB 4GDLA 3O65B 4XX5A 3ZVVA 3A4RA 3R3MA 3PTFC 4FULA 2L0TA 4TUUA 2KMAA 4LJPB 4W9IA 4G0NB 2C7HA 3ZNID 3N3KB 4TQ0A 2Z0EB 1TGZB 2FCMA 4K7SA 3RUIB 1E90A 1YD8U 3PVLA 3CSFA 4KSLC 4HVBA 3DOWA 4W9LA 1NBFC 2KK8A 3OAWA 3V61A 3N30A 2ZJDA 4WWNA 4FJYA 4M8NA 5DPTA 2DX5B 3DQVA 3CF6E 4FHKA 4GIVA 4W9HA 4HDQA 2MA9B 2RPQA 4IC7B 3ZO5B 1WX8A 3W1SC 3A1QB 1CMXB 3GOEA 3C0RB 2ZVNA 5CHVC 4FLHA 3Q3FA 3TBLD 1WGGA 1OGWA 3CMMB 2DZMA 5IA7A 2BPSA 3EFUA 3DVNU 2KN5A 2KJRA 1WX7A 2MBOA 2NR2A 3NZUA 4JIOU 1RRBA 5CHFA 4DK5A 4G50A 5D7GA 3U7DA 3VDZA 1KM7A 5FR6A 2LD9A 3ZIMA 4DHZB 5DPSA 3Q3JA 2N9XA 3GZNI 4IM2A 3BY4B 4XZ4A 2O2VA 4I6NB 4HK2A 5G55A 2MSED 2N1VA 3PPAA 4MH0E 2RR9A 4HCNB 3V60A 4MEMA 3NHEB 2CS4A 2FCSA 1YX6B 2J7QB 2KO3A 1UH6A 2ZNVB 3MTNB 2QHOA 1IP9A 3QQ8B 1I35A 3ALBA 1H8CA 3L13A 3ENEA 3APFA 2WX1A 4FJZA 4BOSC 1H4RA 4M0WB 3QWZB 1WY8A 1V2YA 3WALA 5E6PA 2RSUA 3A9KB 3PRZA 2GMIC 4EEWA 2D10A 4GDLB 4KSKC 2MBBB 1EUVB 2KDFB 4MGKE 2K1FA 4WWPA 4ANVA 2LXCA 3PSEB 2LGYA 4W9CA 3SHQA 2KC1A 2K6QA 4LDTD 4WWOA 3X23A 1WIAA 4HXDA 4JLCA 4WJOA 3TMPB 3V62A 4MJSA 3M63B 3PT2B 1XD3B 3WANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFY A;  1V86 A;  3PLV A;  4KZC A;  1RFA A;  4EFO A;  2KLC A;  3ZTD A;  1Q5W B;  1WR1 A;  3ML8 A;  1WX9 A;  2MBH A;  3ZNG C;  2I1J A;  3PHX B;  3VUX A;  1E7V A;  5BO4 B;  4NY0 A;  4F8C B;  2KQ7 A;  4PS7 A;  1G6J A;  1P98 A;  2LVO A;  2MLB A;  3L0W B;  2G45 B;  4ANW A;  4HJK A;  4ZRI A;  3VHT C;  2LGX A;  3UQA A;  4EOY A;  1P9D U;  1ZGU B;  3T9L A;  4TV3 A;  4GDK A;  2KFK A;  3P2B A;  2NBW B;  5L83 A;  4X57 B;  2NBU A;  2WX0 A;  4LJO B;  1WGY A;  3DDC B;  2C7N B;  3DBH I;  4BKT A;  2AWT A;  2KOX A;  1VD2 A;  2GBN A;  3RUL A;  2N7D A;  4HDO A;  2DAJ A;  2L7R A;  2O2V B;  4BBN F;  2IO0 B;  4TQ1 A;  2ZCB A;  2M0X A;  3IFW B;  4B9K A;  4WJP A;  2ZPN A;  2FNJ B;  1R4N I;  3KW5 B;  3VTU A;  2V4L A;  5AZF A;  2EMT A;  1V80 A;  3PZD A;  4K81 A;  1ZKH A;  2AYO B;  4FN2 A;  3W1Y A;  4AOF A;  2KTF A;  3U30 A;  2D3G A;  3PRE A;  4TKN A;  2N7E A;  5J2R A;  3RCZ A;  1YX5 B;  2IO1 B;  1RAX A;  3ECI A;  3MJW A;  4LCD E;  1TTN A;  2MX2 A;  2NS5 A;  1ISN A;  4KDL B;  1S1Q B;  3NOB A;  2R2Q A;  3R66 C;  4ICU A;  1T0Y A;  2VRR B;  3M62 B;  4GB9 A;  4GU2 A;  4II3 B;  1PQS A;  2JY6 A;  3APD A;  5E6O A;  1GG3 A;  4PYZ A;  3KVF B;  4ZYN A;  4ANU A;  2JRI B;  2CHZ A;  3H7P A;  2OOB B;  1J0G A;  3VQI A;  3SU8 X;  2ZPY A;  2JVC A;  4IW0 A;  5J17 A;  3TL5 A;  5JHA A;  1GC6 A;  4DBG A;  1K8R B;  2PJH A;  3VUW A;  4G11 A;  2G3Q B;  1WXV A;  4MJS B;  4W9K A;  2PE9 A;  3UQB A;  4NAW A;  4IM0 A;  3L16 A;  4XC2 A;  2JF5 A;  2C5L C;  2D11 A;  1GC7 A;  2KTR A;  3HK0 A;  1E8W A;  4IM3 A;  4AUQ C;  4DDI D;  1UGM A;  2KX0 A;  1R4M I;  3NZS A;  2LZ6 A;  2IBI B;  2BGF A;  1Y8R C;  4II2 B;  4JGH B;  2WWZ A;  4EKU A;  3ZTC A;  2UWQ A;  2HJ8 A;  1WXS A;  4I6P A;  3DVG X;  1EF5 A;  3TCA A;  3PGE A;  2KJ6 A;  5DPW A;  3LDZ E;  3AU4 A;  2K8C A;  3DBS A;  1WRD B;  3HM6 X;  1WM3 A;  4IWO A;  2EKE C;  4ANX A;  4GDK B;  2KFK B;  2N9P C;  2HTH A;  1E5W A;  2FAZ A;  3KYD D;  1OEY A;  2MBE A;  2LUE A;  5DPR A;  3EEC A;  3T8M A;  2BWE S;  2MWS B;  3PS6 A;  2FUH B;  1MG8 A;  2KXJ A;  1FXT B;  2R2O A;  5CTR C;  2ZCC A;  3TJP A;  2M8S A;  1UEL A;  3WAP A;  3ZRF A;  4DHJ D;  1A5R A;  3RD2 A;  2M4N A;  1VCB A;  2L05 A;  4ZRK A;  2BYV E;  4CHK A;  3RYT A;  2FCQ A;  3JSV A;  1OQY A;  1UBQ A;  2NBV B;  3JW0 X;  3H9D A;  4BBN C;  2K6D B;  2LAS A;  3DBL I;  3KUC B;  2DHZ A;  1RLF A;  3L10 B;  2ZEQ A;  2LWP A;  2ZVO A;  4BKG A;  2IY1 B;  3LJ3 A;  2WDT B;  4IWP A;  4AJY B;  1XQQ A;  3RZF A;  3VVW B;  3UGB B;  3L54 A;  1V9J A;  4DXA B;  1IPG A;  2LI5 A;  2W9N A;  2KDE B;  2NPT A;  4KIK A;  4OVU A;  5KHO A;  3DVN V;  3QAQ A;  3AU5 A;  4A20 A;  5JZE B;  4AWJ A;  2KAN A;  3H7P B;  2L8J A;  4J6I A;  2JXX A;  1IYF A;  2GBR A;  1P1A A;  3SDL C;  3NY5 A;  2Y5B B;  3VH4 B;  4MGZ E;  4BKS A;  4BOZ B;  1WJN A;  3D32 A;  3V6E B;  2FID A;  4NAW B;  5C1Z A;  4NPN A;  2DYM A;  1LQB A;  3ZLZ A;  1TBE A;  2N1W A;  3N32 A;  2KTR B;  3A9J A;  4GSW A;  4PS8 A;  3VFK A;  1V6E A;  3ONS A;  2KD0 A;  2K39 A;  2JRH A;  1Q1O A;  2B3A A;  1WGD A;  2BWF A;  4PS3 A;  1F9J A;  1WF9 A;  2CHW A;  2PPH A;  4AP4 C;  4K1R B;  2JPH A;  1LFD A;  3EC8 A;  3OJ3 A;  1Z5S B;  1L2N A;  1V49 A;  2CU1 A;  1I42 A;  3B0A A;  3KYC D;  2L0F A;  2ZZP B;  3AUL A;  2LGD A;  4DWF A;  3VUY A;  1L7Y A;  1WMH A;  2Z59 B;  3QJZ A;  2JWZ A;  1Q0W B;  3B08 A;  4KZ0 A;  3U8Z A;  4IUM B;  2KDI A;  2KVR A;  1SIF A;  3JSV B;  1GUA B;  2MW5 A;  3KUD B;  4FHJ A;  1HE8 A;  5D94 A;  4F7Z A;  2BKF A;  4I6L B;  2MBQ A;  5J18 A;  2KDB A;  1EO6 A;  5LXH A;  1V81 A;  2DZI A;  1V5T A;  2IYD B;  2KJH B;  4ZDV A;  4URK A;  1AAR A;  4NQL B;  2V3S A;  1NDD A;  4HPL B;  2LRW A;  2REX A;  1S3S G;  2UYZ B;  1WE7 A;  2J0K A;  4NNJ B;  1KLV A;  3IG3 A;  3QK0 A;  2NPT B;  4KIK B;  4IG7 B;  2LVQ A;  3VTV A;  1WXM A;  2BF8 B;  2AL3 A;  2GBK A;  1WI0 A;  2LJ5 A;  4DHZ E;  2IO2 B;  3B1L X;  3KH0 A;  1WJU A;  2JZ3 B;  3ZDT A;  3DPD A;  3APC A;  4A3O A;  3PV1 A;  1D3Z A;  2O6V A;  5DCN A;  4HCP B;  1WGR A;  2L00 B;  4K7U A;  4W9G A;  3VTW A;  4DDG D;  1KOT A;  2FCN A;  2C7M B;  2EMS A;  1YQB A;  2KX3 A;  3UF8 A;  1LXD A;  4RMA A;  2KHW B;  3ZUN A;  3H1U A;  3H6N A;  3MHS D;  2JT4 B;  2GBJ A;  3A9J B;  3UIP B;  3ZDM C;  2MQJ A;  3NS8 A;  1TZ1 A;  3PHW B;  3L08 A;  2DYB A;  5C23 A;  4N9F 4;  2I1K A;  3BIN A;  1EF1 A;  3RT3 B;  1M94 A;  3QHT A;  2DAF A;  3ZRC A;  4MGI E;  4RM9 A;  3QC8 B;  1WYW B;  4P7I A;  4WJN A;  2XEW A;  4WAA A;  1WZ0 A;  2K8B A;  3CST A;  3HM3 A;  1U4A A;  4EZL A;  3EHV A;  2KFJ A;  3PRP B;  1KJT A;  2GOW A;  4KVG B;  2N4F A;  3QX1 A;  4RM8 A;  2KNB A;  2KWU B;  5AZH A;  2KWV B;  3X0W A;  1ZW7 A;  3DVG Y;  2YLM A;  1WMH B;  4CO7 A;  1OEY J;  2JZZ A;  3WAO A;  3OLM D;  2J0M A;  2IY0 B;  3M95 A;  1X1M A;  1E8Y A;  4GMV A;  4MGY E;  5AZG A;  2CKH B;  1P0R A;  2C9W B;  2G4S A;  2A5U A;  5JHB A;  2BKR B;  2IZV B;  5D2M B;  1OTR B;  5AEK B;  2DEN B;  5LXI B;  2A4Z A;  1JRU A;  1UBI A;  4JL9 A;  4AJW A;  1WR6 E;  2DZJ A;  1E7U A;  4G3X B;  4NJ6 A;  2MCN B;  1WZ3 A;  2KZR A;  2YVC A;  4GN1 A;  2DZK A;  3W1S A;  4HWI B;  1UZX B;  2CR5 A;  3TIX A;  3H7S A;  1Z2M A;  2IO3 B;  3I3T B;  4IWQ A;  4EUT A;  4W9J A;  3UIO B;  2RD0 A;  3K9O B;  4MDK E;  2NVU I;  1GJZ A;  2K8H A;  2OJR A;  2BYE A;  4JQW C;  4YL8 A;  3ZKJ C;  4ICV A;  3S2A A;  2JUO A;  3JVZ X;  2O6V B;  2PEA A;  2V1Y A;  5D6J B;  4KDI C;  4CYE A;  2KMC A;  2XK5 A;  5JH5 C;  5IAA C;  3IVF A;  4W9D A;  4BVU C;  2MP2 A;  5KHQ A;  1WM2 A;  3A4S C;  2L76 A;  4B95 A;  5HKH A;  2CHX A;  2C60 A;  2PE6 B;  4ASW C;  4WQO B;  1XT9 B;  3HHM A;  3QAR A;  3ML9 A;  4M8M A;  3VH3 B;  4E3C A;  1J19 A;  1UD7 A;  3QIJ A;  4BKS D;  4KV2 A;  3WIM A;  4B6W A;  2HE7 A;  2D07 B;  4A3P A;  4MSQ B;  2KKC A;  5E6N A;  2KC2 A;  4EZJ A;  5CX3 A;  4MEL A;  3V6C B;  4OVV A;  2M17 A;  4EZK A;  3QCA A;  4WJQ A;  2N9E B;  1J8C A;  2AL6 A;  3OJ4 B;  3K9P B;  2K25 A;  2LXA A;  4ZRJ A;  1E8X A;  1GNU A;  1WJ6 A;  2ASQ A;  5EDS A;  3IHP C;  4HLE A;  2DYO A;  3QA8 A;  2AEH A;  4PYU A;  4W9F A;  4HPM B;  1NI2 A;  2KWC A;  3WAM A;  4K7W A;  4MM3 A;  3VAW A;  5L95 C;  1WH3 A;  4FA6 A;  4GXB A;  3A33 B;  2J0J A;  1WE6 A;  2RGF A;  1V5O A;  3PLU A;  4NJ7 A;  2LVP A;  3JYU A;  3A1Q A;  3ZNZ B;  4E74 A;  3R7R A;  2XBB C;  3DCG A;  1QZE A;  1E8Z A;  1BT0 A;  3VXW A;  1SE9 A;  4MSM B;  5GMV A;  2L3Z A;  3KUZ A;  5CHW A;  4GOC A;  4DHJ B;  3ZW3 A;  3DBR I;  4FAD A;  3RZW C;  5TR5 A;  1YJ1 A;  4BFR A;  1C3T A;  1WJ4 A;  4E71 A;  3AXC A;  2G4D B;  4GGQ A;  1SGH A;  3UIN B;  4FJV B;  4W9E A;  2ZNV C;  3R7Q A;  2NCN A;  1YIW A;  2LRU A;  2FIF A;  3HIZ A;  3PRM B;  3SD5 A;  2GBM A;  3L17 A;  3WA0 A;  2BYF A;  4FBJ B;  1WGH A;  2KLG A;  2XK5 B;  2Z0D B;  3M3J A;  2HD5 B;  4NQK E;  2WYQ A;  2MP2 B;  2MRP A;  5LLI A;  1C1Y B;  2D2Q A;  2M1M A;  3AI5 A;  2O6V D;  1LM8 B;  1WXA A;  2KQS A;  5G2N A;  3ZNH B;  4F1S A;  3A9K A;  3IBE A;  1P3Q U;  4LDT B;  4GDL A;  3O65 B;  4XX5 A;  3ZVV A;  3A4R A;  3R3M A;  3PTF C;  4FUL A;  2L0T A;  4TUU A;  2KMA A;  4LJP B;  4W9I A;  4G0N B;  2C7H A;  3ZNI D;  3N3K B;  4TQ0 A;  2Z0E B;  1TGZ B;  2FCM A;  4K7S A;  3RUI B;  1E90 A;  1YD8 U;  3PVL A;  3CSF A;  4KSL C;  4HVB A;  3DOW A;  4W9L A;  1NBF C;  2KK8 A;  3OAW A;  3V61 A;  3N30 A;  2ZJD A;  4WWN A;  4FJY A;  4M8N A;  5DPT A;  2DX5 B;  3DQV A;  3CF6 E;  4FHK A;  4GIV A;  4W9H A;  4HDQ A;  2MA9 B;  2RPQ A;  4IC7 B;  3ZO5 B;  1WX8 A;  3W1S C;  3A1Q B;  1CMX B;  3GOE A;  3C0R B;  2ZVN A;  5CHV C;  4FLH A;  3Q3F A;  3TBL D;  1WGG A;  1OGW A;  3CMM B;  2DZM A;  5IA7 A;  2BPS A;  3EFU A;  3DVN U;  2KN5 A;  2KJR A;  1WX7 A;  2MBO A;  2NR2 A;  3NZU A;  4JIO U;  1RRB A;  5CHF A;  4DK5 A;  4G50 A;  5D7G A;  3U7D A;  3VDZ A;  1KM7 A;  5FR6 A;  2LD9 A;  3ZIM A;  4DHZ B;  5DPS A;  3Q3J A;  2N9X A;  3GZN I;  4IM2 A;  3BY4 B;  4XZ4 A;  2O2V A;  4I6N B;  4HK2 A;  5G55 A;  2MSE D;  2N1V A;  3PPA A;  4MH0 E;  2RR9 A;  4HCN B;  3V60 A;  4MEM A;  3NHE B;  2CS4 A;  2FCS A;  1YX6 B;  2J7Q B;  2KO3 A;  1UH6 A;  2ZNV B;  3MTN B;  2QHO A;  1IP9 A;  3QQ8 B;  1I35 A;  3ALB A;  1H8C A;  3L13 A;  3ENE A;  3APF A;  2WX1 A;  4FJZ A;  4BOS C;  1H4R A;  4M0W B;  3QWZ B;  1WY8 A;  1V2Y A;  3WAL A;  5E6P A;  2RSU A;  3A9K B;  3PRZ A;  2GMI C;  4EEW A;  2D10 A;  4GDL B;  4KSK C;  2MBB B;  1EUV B;  2KDF B;  4MGK E;  2K1F A;  4WWP A;  4ANV A;  2LXC A;  3PSE B;  2LGY A;  4W9C A;  3SHQ A;  2KC1 A;  2K6Q A;  4LDT D;  4WWO A;  3X23 A;  1WIA A;  4HXD A;  4JLC A;  4WJO A;  3TMP B;  3V62 A;  4MJS A;  3M63 B;  3PT2 B;  1XD3 B;  3WAN A; 
#chains in the Genus database with same CATH topology
 3AEG B;  3B2F A;  1WFY A;  3W5U B;  1Q5W B;  2RDH A;  2V0G A;  1WR1 A;  1V1P B;  2LMC A;  3ML8 A;  4YTP B;  3PHX B;  5BO4 B;  4F8C B;  2KQ7 A;  4PS7 A;  4ITK A;  5BYQ A;  4RF0 A;  4HJK A;  1D5X C;  1P9D U;  1NEN B;  3HVZ A;  3P2B A;  2QIE B;  1IGC A;  4LJO B;  1WGY A;  3DDC B;  3N1Y C;  2GBN A;  4RGT A;  3RMK C;  1ZUD 2;  4TQ1 A;  2M0X A;  3IFW B;  4B9K A;  5IO9 A;  1R4N I;  2V4I B;  3VTU A;  1L0Y B;  4AOF A;  4TKN A;  2N7E A;  5J2R A;  3RCZ A;  2BBC A;  2KMM A;  4LCD E;  4WH4 A;  4KKI A;  1ISN A;  1YN5 A;  1PGX A;  1GG3 A;  1XLQ A;  2JRI B;  2CHZ A;  1J0G A;  4K3C A;  5J17 A;  4JWU C;  1QIL A;  1L0V B;  3UQB A;  4NAW A;  2JF5 A;  3HK0 A;  3R2I A;  3Q3M C;  2KX0 A;  3EA6 A;  2M56 B;  1Y56 A;  2IBI B;  4II2 B;  2HJ8 A;  4I6P A;  3PGE A;  5DPW A;  1WM3 A;  3ZXR A;  2EKE C;  2LGS A;  1GB4 A;  2KFK B;  4CQN A;  3KYD D;  5DPR A;  3T3N A;  3IAS 1;  1ZE3 D;  2OED A;  1FXT B;  5CTR C;  2JU6 X;  2ZCC A;  1UEL A;  4LNN A;  2M4N A;  1V97 A;  2L05 A;  2N9L A;  3Q3N C;  3JSV A;  1K51 A;  3L10 B;  2ZEQ A;  1L6U A;  1ZDX A;  4BKG A;  2IY1 B;  2Q5W D;  3LJ3 A;  2WDT B;  4AJY B;  4IKG A;  3VVW B;  2QEJ C;  2W9N A;  5FR3 A;  3PZ8 A;  4KIK A;  4OVU A;  2CU3 A;  3PZ7 A;  4A20 A;  4AWJ A;  2LHD A;  2PVG C;  3H7P B;  2KN4 A;  2JXX A;  3FIL B;  4MGZ E;  4BKS A;  3D32 A;  2KDM A;  2WS3 B;  3LYY A;  2N1W A;  4IDI A;  4XGA B;  2KTR B;  2TSS A;  2WXJ A;  1SE2 A;  2KQ4 X;  3Q2A C;  1FFV A;  2B3A A;  1WGD A;  2BWF A;  1F9J A;  4XDC A;  1L2N A;  3GP7 A;  2ZZP B;  2LFI A;  2R61 A;  4DWF A;  3AEC B;  1WMH A;  2J52 A;  3U8Z A;  2KVR A;  2QDF A;  2FE8 A;  2MH7 A;  3GB1 A;  2VZK B;  1C4P A;  1EO6 A;  2DZI A;  1V5T A;  4ZDV A;  3TSS A;  4URK A;  2V3S A;  1SXT A;  3BK1 A;  2LRW A;  2BS2 B;  3IG3 A;  3GE8 C;  2Y5P A;  1JWU D;  3R8B A;  2GBK A;  3AE5 B;  2JZP A;  4DHZ E;  1WJU A;  4A3O A;  3PV1 A;  1OFF A;  5C3J B;  2L00 B;  4K7U A;  1KOT A;  4DDG D;  2EMS A;  2KX3 A;  3UF8 A;  1FNW A;  2KHW B;  1JWS D;  3I57 A;  3H6N A;  2JT4 B;  3ZDM C;  3UIP B;  3AE6 B;  3NS8 A;  3PHW B;  3L08 A;  1SIJ A;  2JYT A;  3BIN A;  3HRD D;  1M94 A;  1D5Z C;  2JQR B;  4ZRQ A;  1YJI A;  3QC8 B;  4P7I A;  4WJN A;  1U4A A;  3EHV A;  1AN8 A;  3PRP B;  2N4F A;  4RM8 A;  1SE4 A;  2KWV B;  3EFC A;  2VH2 A;  3OLM D;  4RGN A;  2IY0 B;  3M95 A;  1E8Y A;  2G4S A;  1P0R A;  2A5U A;  2BKR B;  2XN9 C;  1KH0 A;  5AEK B;  2DEN B;  1IBX B;  1UBI A;  1ENF A;  1WR6 E;  4NJ6 A;  4LNO A;  2YVC A;  1UZX B;  3TIX A;  3H7S A;  1Z2M A;  4IWQ A;  2J42 A;  3AH7 A;  1QKZ A;  3K9O B;  4MDK E;  3KWV A;  2OJR A;  1DYQ A;  2JUO A;  3JVZ X;  2D3B A;  4QAY A;  3RNC C;  2MP2 A;  4L23 A;  4S0R A;  1F2R I;  4N6E B;  4E3C A;  3QIJ A;  4BKS D;  4B6W A;  1YN4 A;  3LB8 C;  2D07 B;  4K3B A;  4JWS C;  5CX3 A;  4MEL A;  1DOY A;  3HUI A;  1J8C A;  1PGB A;  2K25 A;  2LXA A;  2LHE A;  1WJ6 A;  2WXH A;  3FC4 A;  3RNB C;  2V3P A;  3QA8 A;  2AEH A;  1XF5 L;  2KWC A;  3WAM A;  5L95 C;  1L4D B;  3AE4 B;  1C79 A;  4FA6 A;  3A33 B;  3PLU A;  1V5O A;  2LVP A;  1FD6 A;  3A1Q A;  3R7R A;  4DHJ B;  5CHW A;  4HPP A;  1YJ1 A;  1ZOY B;  4FJV B;  1LO5 D;  2ZNV C;  2WXL A;  2WXM A;  4ZRP A;  3WA0 A;  3M3J A;  4NQK E;  3TEW A;  1JWA D;  1L6V A;  3SEB A;  1C1Y B;  1KFY B;  1LM8 B;  2W3S A;  2CJN A;  1P3Q U;  2QMT A;  4GDL A;  3O65 B;  3BYT B;  3CIR B;  2QIL A;  1MHX A;  2PIA A;  3PTF C;  3I63 C;  4FUL A;  4W9I A;  4LJP B;  2MJ3 A;  2Z0E B;  1TGZ B;  4B0M A;  1YD8 U;  2W82 A;  1GPX A;  3CSF A;  4HVB A;  2KK8 A;  2JSV X;  4MM3 B;  4OZB A;  1V1P A;  4WWN A;  3U4E G;  1TT5 B;  4W9H A;  4IC7 B;  1TKE A;  1WX8 A;  3W1S C;  4ZOH C;  1CMX B;  3BVZ A;  1ZXI A;  3Q3F A;  1OGW A;  3CMM B;  1C4C A;  1TKY A;  3N9Y C;  1QLB B;  2KN5 A;  1WX7 A;  4JIO U;  5D7G A;  1XO3 A;  2GLS A;  2LD9 A;  3Q3J A;  3GZN I;  4XZ4 A;  2JX5 A;  2N1V A;  3PPA A;  4MH0 E;  2RR9 A;  4HCN B;  4RCO A;  4TSS A;  3U52 E;  4MEM A;  3NHE B;  2CS4 A;  1YX6 B;  2X38 A;  1QOB A;  1UH6 A;  3MTN B;  2QHO A;  3QQ8 B;  3ZQ4 A;  1SJH D;  1H4R A;  1WY8 A;  4AQ7 A;  5E6P A;  2RSU A;  3A9K B;  2M19 A;  4EEW A;  2D10 A;  1EUV B;  2KDF B;  2K1F A;  2BB5 A;  3UI3 A;  4W9C A;  1WWT A;  4BAX A;  2K6Q A;  4LDT D;  4WWO A;  4Q2J A;  4DXG A;  3IT4 B;  3ZJV A;  3PLV A;  1JML A;  3AV8 A;  1E7V A;  4NY0 A;  1G6J A;  1JAL A;  1P98 A;  2LVO A;  2MLB A;  5HHD G;  5G5G A;  2KYW A;  5H92 C;  4ANW A;  4ZRI A;  4C7Z A;  1F2R C;  1ZGU B;  3T9L A;  2KFK A;  2NBW B;  4IOI E;  2NBU A;  2WX0 A;  4P1C C;  4BKT A;  2AWT A;  3RUL A;  1ESF A;  4HDO A;  2DAJ A;  3B9J A;  1FXA A;  2L7R A;  4L1B A;  5BYR A;  5AZF A;  4OVZ A;  1L0X B;  1V80 A;  4K81 A;  3P4R B;  4FN2 A;  3W1Y A;  2KTF A;  1L4Z B;  1YX5 B;  2IO1 B;  1RAX A;  3ECI A;  3MJW A;  3AEE B;  1TTN A;  2VRR B;  4GU2 A;  4II3 B;  1MFW A;  4YSZ B;  3H7P A;  3VQI A;  2ZPY A;  3FIL A;  4IW0 A;  4MT5 A;  3TL5 A;  1GC6 A;  2PJH A;  4D2K A;  1NYQ A;  4KGT A;  1ET9 A;  4LTU A;  1N6Z A;  1MI0 A;  4YXD B;  1GC7 A;  1RM6 C;  1SJE D;  2KTR A;  3P4P B;  1R4M I;  4RH6 A;  4WQM A;  3ABV B;  2WDR B;  4LNK A;  1KF6 B;  1WXS A;  3DVG X;  3AU4 A;  1YMH E;  4GDK B;  2HTH A;  2FAZ A;  2KAC A;  2V9H A;  3T8M A;  2MWS B;  1MG8 A;  2KXJ A;  3ZRF A;  2M8S A;  1A5R A;  2MEK A;  5FKA C;  4A9A A;  4ZRK A;  3Q14 C;  2BYV E;  2FCQ A;  3LXF A;  2PMV A;  4BBN C;  3AE9 B;  2LAS A;  2OHF A;  3KUC B;  2W54 A;  1B9R A;  5EE0 A;  2ZVO A;  2ACZ B;  2N9K A;  3NG0 A;  4NAM A;  5LNK 1;  2NTT A;  1EU3 A;  2I2Y A;  4REZ A;  3L54 A;  1V9J A;  4DXA B;  1IPG A;  1SB3 C;  2G1E A;  2GI9 A;  4C4V B;  2PTL A;  5JZE B;  4XWW A;  2KAN A;  1UGJ A;  4HKZ E;  3U7Z A;  2CJO A;  1IYF A;  3VH4 B;  3OWE B;  5C1Z A;  1T3Q A;  2DYM A;  1Q10 A;  2IPK D;  4PS8 A;  3BVM A;  1QT9 A;  2KT7 A;  2KD0 A;  2K39 A;  3DBH B;  1T5X D;  2E3T A;  2WQY B;  4K1R B;  2K3U A;  4JPS A;  4XYC A;  2ON8 A;  1V49 A;  2CU1 A;  3B0A A;  5IOI A;  3W5V B;  2L0F A;  3FAH A;  3URY A;  2LGD A;  3VUY A;  5HFY A;  2Z59 B;  1D5M C;  3B08 A;  4KZ0 A;  2KDI A;  3KUD B;  4F7Z A;  4YSY B;  5J18 A;  1NYR A;  1IBX A;  5LXH A;  4NQL B;  5JXV A;  1JCK B;  2J0K A;  3QK0 A;  4IG7 B;  2LVQ A;  4ARC A;  2BF8 B;  1V1O A;  2LJ5 A;  1I4X A;  3B1L X;  3AMZ A;  3KH0 A;  3ZDT A;  3ETR A;  3BWU D;  3DPD A;  3APC A;  1D3Z A;  3BYY B;  2Y3A A;  4UDU C;  2FCN A;  1YQB A;  3CWI A;  4YTN B;  2RPV A;  2NTS A;  3ZUN A;  1VR9 A;  1BXT A;  3A9J B;  1KTK A;  1JWB D;  1EF1 A;  1XCQ L;  3RT3 B;  4JE3 B;  2BTE A;  3ZRC A;  4RM9 A;  2RMM A;  1IUE A;  4HJG E;  2W55 A;  4WAA A;  2K8B A;  3HM3 A;  3MC8 A;  1FRD A;  1MG4 A;  1N5W A;  3QX1 A;  3X0W A;  1KLU D;  3GS2 A;  1SE3 A;  1OEY J;  1YNT E;  1TJE A;  1VRA B;  3AEA B;  2J4X A;  4MGY E;  1F52 A;  2C9W B;  4WIP A;  3SFD B;  1OTR B;  4MAC A;  2A4Z A;  4A55 A;  1JRU A;  1E7U A;  4GN1 A;  2DZK A;  4HWI B;  1AW7 A;  4KGR A;  1FPY A;  2VZK D;  1ZXH A;  2IO3 B;  3AE3 B;  2E6X A;  1NEK B;  1QOF A;  2BYE A;  4JQW C;  4YL8 A;  4OW0 A;  1QOG A;  4ICV A;  4P1B C;  2O6V B;  2PEA A;  5D6J B;  4CYE A;  5IAA C;  3IVF A;  4W9D A;  1FM0 D;  1WM2 A;  4B95 A;  4LNF A;  4WQO B;  1XT9 B;  3P63 A;  3QAR A;  3ML9 A;  4M8M A;  3VH3 B;  1UD7 A;  4MSQ B;  1MHH E;  2KC2 A;  4RF1 A;  3I9V 1;  2MJD A;  2QCZ A;  2M17 A;  3TEX A;  2N9E B;  1J7C A;  3P42 A;  2AL6 A;  5HI1 A;  4DQO C;  1E8X A;  1AWD A;  1GNU A;  2AQ2 B;  2JWU A;  2ASQ A;  1KRH A;  5EDS A;  4PYU A;  4W9F A;  1NI2 A;  4MM3 A;  4PK1 A;  1WH3 A;  2BS4 B;  2J0J A;  2RGF A;  4NJ7 A;  4ZYS A;  3ZNZ B;  4E74 A;  1QZE A;  1BT0 A;  3VXW A;  5GMV A;  2L3Z A;  3DWG C;  4FAD A;  3RZW C;  4BFR A;  4NZL B;  2IGH A;  3Q8F A;  3VR9 B;  2FBW B;  1EU4 A;  2NCN A;  1YIW A;  3PRM B;  3HIZ A;  3BVG A;  2HDE A;  1PGA A;  2GBM A;  4HRS A;  1WGH A;  2KLG A;  2XK5 B;  2Z0D B;  2WYQ A;  2MRP A;  4DXF A;  3VRA B;  3AI5 A;  1N63 A;  2KQS A;  1WXA A;  5G2N A;  3N1X C;  2PVO D;  2BS3 B;  2YEP B;  3A9K A;  5G5H A;  2DNF A;  1TZO A;  1EM7 A;  1DOI A;  3R3M A;  1UWM A;  2KMA A;  4KX6 B;  4G0N B;  1FNU A;  2LJI A;  3DBL B;  3RUI B;  1HA5 A;  1V8C A;  4W9L A;  3TUO A;  5BMI A;  3OAW A;  4A6Q A;  1E0Z A;  1TY2 A;  1XCT L;  4M8N A;  2WXF A;  3DQV A;  3CF6 E;  2ONQ A;  4FHK A;  4GIV A;  1JW9 D;  3GOE A;  3C0R B;  2ZVN A;  2Z8L A;  1XXG A;  2EEL A;  1TS5 A;  4YT0 B;  1WGG A;  3T3O A;  2DZM A;  2WU5 B;  1GB1 A;  2KJR A;  2NR2 A;  1WGK A;  3NZU A;  3Q6B A;  4DK5 A;  3U7D A;  1KM7 A;  3ZIM A;  4KGS A;  3U2S C;  2N9X A;  4IM2 A;  5BMH A;  4HK2 A;  3W2D A;  2MSE D;  1UUP A;  4XWT A;  2FCS A;  2J7Q B;  1UF0 A;  2WHI A;  1OQQ A;  1I4G A;  1I35 A;  3ALB A;  2ZW1 A;  3L13 A;  4BOS C;  4FJZ A;  1V2Y A;  1YOV B;  2QJL A;  4WWP A;  1HTO A;  4ANV A;  1VJK A;  4J3O D;  1WIA A;  4USA A;  2L1A A;  3V62 A;  3M63 B;  1JRP A;  2BYT A;  2LUM A;  2AQ3 B;  4KZC A;  1RFA A;  3AB5 A;  3ZTD A;  1SF0 A;  3ZNG C;  3VUX A;  2RDG A;  1EWC A;  1VZ6 A;  2PW9 A;  3IT6 B;  3VHT C;  3UQA A;  4TV3 A;  3MJ5 A;  4GDK A;  4ZHP A;  1P7E A;  4WWM A;  2C7N B;  1C76 A;  1N60 A;  2KOX A;  1C9F A;  4BBN F;  2WNM A;  2GB1 A;  3KW5 B;  2EMT A;  1L5P A;  3AE1 B;  1ZKH A;  2AYO B;  3U30 A;  3PRE A;  1TY0 A;  2WXN A;  2MX2 A;  1S1Q B;  3R66 C;  2R2Q A;  4C4V A;  5E6O A;  2JY6 A;  4PYZ A;  4ANU A;  1C4A A;  1MVK A;  2OOB B;  2J53 A;  3SU8 X;  1N61 A;  1XLO A;  5EE1 A;  5JHA A;  5TSS A;  4WAF A;  1RYJ A;  1K8R B;  1FCL A;  1WXV A;  4MJS B;  2PE9 A;  4A90 A;  4IM0 A;  3Q8A A;  2C5L C;  4AUQ C;  1E8W A;  4DDI D;  4L2Y A;  1Y8R C;  2WWZ A;  2UWQ A;  3NVY A;  3TCA A;  3RNE C;  2UU7 A;  2AX5 A;  3LDZ E;  2K8C A;  3DBS A;  1WRD B;  2WP9 B;  2N9P C;  1OEY A;  2MBE A;  2LUE A;  3O13 A;  2DBY A;  3EEC A;  2BWE S;  3PS6 A;  4US9 A;  1GOZ A;  2FUH B;  2DWQ A;  3RYT A;  2K0P A;  1B1Z A;  1UBQ A;  2NBV B;  3JW0 X;  3ZJT A;  2K6D B;  3DBL I;  1FXI A;  5I4D A;  3ZGZ A;  2LWP A;  1TYG B;  1TS3 A;  2WXG A;  3RZF A;  3UGB B;  4S17 A;  1ZP0 B;  2LI5 A;  1VLB A;  2KDE B;  3ZYY X;  4WUR A;  1P1A A;  3NY5 A;  4ZHO A;  2Y5B B;  4BOZ B;  1WJN A;  5D3D A;  3ZXV A;  1TBE A;  3N32 A;  3A9J A;  3VFK A;  2JRH A;  2H89 B;  1Q1O A;  4PS3 A;  1WF9 A;  3E56 A;  2SEB D;  3Q3O C;  4A8X C;  3OJ3 A;  4KKJ A;  2PKO A;  1MPE A;  2HTM E;  3V05 A;  2WXQ A;  3AUL A;  1DOX A;  1K53 A;  3QJZ A;  1Q0W B;  4IUM B;  1SIF A;  2EKI A;  1GUA B;  2MW5 A;  4I6L B;  1RWS A;  1RFK A;  1NDD A;  4HPL B;  2B76 B;  2UYZ B;  1WE7 A;  4M02 A;  4NNJ B;  1KLV A;  2NPT B;  1WXM A;  1PYW D;  5IN7 A;  3DHH C;  2IND C;  2O6V A;  4OHJ A;  5DCN A;  4HCP B;  1WGR A;  1I4Q A;  2K9X A;  3NVZ A;  4W9G A;  2K22 A;  2ICI A;  2WXK A;  4RMA A;  2MJE A;  4ACF A;  1KLG D;  3AE8 B;  2DAF A;  4MGI E;  3N20 C;  2XEW A;  4EZL A;  3CST A;  2KFJ A;  2GOW A;  4KVG B;  1PUT A;  2KAJ A;  2KWU B;  5AZH A;  1ZW7 A;  3DVG Y;  1T0R C;  1XEE A;  4CO7 A;  2JZZ A;  3WAO A;  2M0A A;  2IZV B;  3C8Y A;  5LXI B;  1F0Z A;  1SEB D;  4JL9 A;  5GXG B;  2BT6 A;  3EUB 2;  2MCN B;  1WZ3 A;  2KZR A;  2WDV B;  1QQR A;  2MHJ A;  4C00 A;  3I3T B;  4EUT A;  4W9J A;  2RD0 A;  1GJZ A;  4GLS C;  3AN1 A;  1E6E B;  3ZKJ C;  3S2A A;  2V1Y A;  2KMC A;  1TS2 A;  3N1Z C;  2XK5 A;  5JH5 C;  4BVU C;  1FO4 A;  2N0S B;  3A4S C;  2L76 A;  5HKH A;  2CHX A;  2C60 A;  4ASW C;  1CQV A;  1J19 A;  5C2T B;  3BK2 A;  2HE7 A;  4A3P A;  2N7J A;  4EE2 A;  4EZJ A;  1HEZ E;  3V6C B;  1JRO A;  4OVV A;  2INN E;  4WJQ A;  3K9P B;  4ZRJ A;  4OZC A;  4HLE A;  2DYO A;  3VAW A;  3NRZ A;  1QOA A;  1D6E C;  1WE6 A;  2X8X X;  3W9C B;  3JYU A;  1HZ5 A;  3DCG A;  2L52 A;  1E8Z A;  1SE9 A;  1T0S C;  3ZW3 A;  2BQQ A;  1VZ8 A;  1C3T A;  4RGO S;  4GGQ A;  3UIN B;  2BVC A;  2HJ1 A;  2L32 A;  3R7Q A;  2LRU A;  2L83 A;  4H2A A;  3J9C A;  3L17 A;  3KWL A;  1HXY D;  5LLI A;  2D2Q A;  2M1M A;  4BZA A;  2O6V D;  2JYE A;  4LK0 M;  4O1N A;  3RNF C;  4F1S A;  1P7F A;  1WSP A;  3ZVV A;  5AUI A;  3RN9 C;  2L0T A;  3SR6 A;  2C7H A;  3ZNI D;  3N3K B;  3Q8C A;  4TQ0 A;  2FCM A;  4K7S A;  3BII D;  2SAK A;  3PVL A;  3DOW A;  3V61 A;  2WLB A;  3N30 A;  4XE0 A;  5DPT A;  1YJJ A;  4C7Y A;  1M4V A;  2MA9 B;  4HDQ A;  4JX1 C;  4US8 A;  2NMQ A;  4FLH A;  5IA7 A;  2BPS A;  3EFU A;  3AE7 B;  3DVN U;  2MBO A;  1RRB A;  2GRI A;  5DPS A;  2WGS A;  3BY4 B;  4M01 A;  3MC9 A;  5G55 A;  2W3R A;  2AQ1 B;  3C19 A;  2KO3 A;  1ZPS A;  1IP9 A;  4N59 A;  1H8C A;  3ENE A;  3APF A;  4M0W B;  2WXR A;  2QSD A;  3QWZ B;  1CK1 A;  5IP4 D;  2GMI C;  4KSK C;  2MBB B;  3NVV A;  2KC1 A;  3X23 A;  4HXD A;  4JLC A;  4RGM A;  1ROE A;  1YN3 A;  4MJS A;  5BMG A;  1XD3 B;  1FIQ A;  1WXQ A;  3RNG C;  1V86 A;  3TEY A;  4EFO A;  2KLC A;  1WX9 A;  2MBH A;  2I1J A;  5HG2 A;  2KVZ A;  3L0W B;  2G45 B;  1J7A A;  2Y5C A;  1JWM D;  2LGX A;  4PT5 A;  4EOY A;  1FFU A;  5L83 A;  4X57 B;  3DBH I;  1YQ3 B;  1PFD A;  1VD2 A;  2N7D A;  3P1M A;  5EE3 A;  1XLN A;  4RFB A;  2O2V B;  2IO0 B;  2PLP A;  2ZCB A;  4XDD A;  4WJP A;  2ZPN A;  1ZDV A;  2FNJ B;  2V4L A;  3MHZ A;  4R3D A;  1STE A;  3PZD A;  2D3G A;  4NJC A;  4YTM B;  2NS5 A;  4KDL B;  3Q8B A;  3NOB A;  2WXI A;  4ICU A;  1T0Y A;  3M62 B;  1SSN A;  4GB9 A;  1PQS A;  3APD A;  4FXC A;  3DHI C;  3KVF B;  4ZYN A;  3AE2 B;  2JVC A;  1I4R A;  2D3C A;  1TIF A;  1SBB B;  4DBG A;  3VUW A;  4G11 A;  2G3Q B;  1C77 A;  4W9K A;  1F77 A;  2D3A A;  1TS4 A;  3L16 A;  4XC2 A;  2D11 A;  4IM3 A;  3NZ3 A;  1UGM A;  3NZS A;  2LZ6 A;  4JGH B;  2BGF A;  4EKU A;  3ZTC A;  2WXO A;  3GZN B;  1CJE A;  1EF5 A;  1F1H A;  2KJ6 A;  3HM6 X;  4IWO A;  3I5J C;  1D4B A;  4ANX A;  1BUI C;  1E7P B;  1E5W A;  2BB6 A;  2IDY A;  2R2O A;  3TJP A;  3WAP A;  3L4P A;  4DHJ D;  4ARI A;  3RD2 A;  1VCB A;  4CHK A;  3TEZ A;  3DHG C;  1OQY A;  3H9D A;  2DHZ A;  1RLF A;  4IWP A;  3MC0 B;  1XQQ A;  2WDQ B;  1AYF A;  2OJW A;  2G9H D;  2NPT A;  5KHO A;  3DVN V;  1HTQ A;  1T6B X;  3QAQ A;  3AU5 A;  4MH8 A;  3RNA C;  2L8J A;  4J6I A;  1HZ6 A;  2GBR A;  3SDL C;  3V6E B;  2FID A;  4NAW B;  4NPN A;  3ZLZ A;  1LQB A;  1E9M A;  3DBR B;  5IKC M;  4GSW A;  2V3N A;  1V6E A;  3ONS A;  1ACC A;  3R2T A;  1FEH A;  2CHW A;  2PPH A;  4AP4 C;  2JPH A;  1LFD A;  3EC8 A;  1Z5S B;  1I42 A;  3KYC D;  1EWY C;  1L7Y A;  3DWM A;  2JWZ A;  3RPF C;  5H8Y E;  3JSV B;  4HKQ A;  4M00 A;  2WU2 B;  3P4S B;  4FHJ A;  1HE8 A;  5D94 A;  3PO0 A;  2BKF A;  2DLB A;  2MBQ A;  2KDB A;  1V81 A;  2IYD B;  2KJH B;  1AAR A;  2REX A;  1S3S G;  3VR8 B;  4AS1 A;  3NUH B;  4KIK B;  3NJT A;  3VTV A;  2AL3 A;  2XNA C;  1WI0 A;  2RDB C;  2IO2 B;  1K52 A;  1R4M B;  2JZ3 B;  2YEP F;  2WXP A;  3VTW A;  2C7M B;  3GE3 C;  1LXD A;  1JQ4 A;  3H1U A;  3MHS D;  5EE9 A;  2GBJ A;  2MQJ A;  1TZ1 A;  2DYB A;  5C23 A;  4N9F 4;  2I1K A;  5AUK A;  1OQR A;  3QHT A;  1E10 A;  4TMA B;  1WYW B;  5FK9 C;  1WZ0 A;  2IGG A;  4LLG M;  2IGD A;  1KJT A;  2LEK A;  2QC8 A;  4RNA A;  2KNB A;  2YLM A;  1WMH B;  1FMA D;  2IJ0 A;  2J0M A;  5MPO A;  1TKG A;  1X1M A;  3Q8E A;  4GMV A;  5AZG A;  2CKH B;  5JHB A;  1QF6 A;  4YWG G;  5D2M B;  1DGJ A;  4AJW A;  4G3X B;  2DZJ A;  2BW2 A;  3W1S A;  2CR5 A;  1K50 A;  1T0Q C;  4B0E A;  2KWD A;  3UIO B;  2NVU I;  3MFG A;  2K8H A;  2INP E;  3OG5 A;  4KDI C;  1I7H A;  3NS1 A;  3VRB B;  5KHQ A;  2LGI A;  4OZA A;  2PE6 B;  1CZP A;  4C80 A;  3HHM A;  2K5P A;  4KV2 A;  3WIM A;  2INC C;  4HEA 1;  3B2G A;  2KKC A;  5E6N A;  4EZK A;  1IGD A;  3IAM 1;  2ZW0 A;  3QCA A;  1R4N B;  2VH1 A;  3OJ4 B;  1A70 A;  3H8H A;  3IHP C;  4HPM B;  1FCC C;  1YQ4 B;  4K7W A;  3IXS A;  4GXB A;  3Q69 A;  2I38 A;  3E9S A;  4HRO A;  1N62 A;  1I4P A;  2XBB C;  3EGR A;  4MSM B;  2FUG 1;  3KUZ A;  4GOC A;  3DBR I;  1NI3 A;  4P6V F;  5TR5 A;  1WJ4 A;  1PDX A;  4E71 A;  3NVW A;  4N58 A;  3AXC A;  2G4D B;  1SGH A;  3KLS X;  4W9E A;  1I4H A;  1WRI A;  3WCQ A;  2FIF A;  3SD5 A;  3V3X A;  1GAQ B;  2BYF A;  4FBJ B;  2HD5 B;  3AEB B;  3HVD A;  2MP2 B;  3RFZ B;  1MJD A;  1R7S A;  4M0W A;  3ZNH B;  3FKY A;  3P4Q B;  1ET6 A;  3IBE A;  2JXT A;  4LDT B;  4YSX B;  4XX5 A;  3A4R A;  4TUU A;  1WYG A;  1FNV A;  1E90 A;  3KQ4 A;  3RI7 C;  1VDV A;  1LGR A;  4LNI A;  4KSL C;  1NBF C;  3MP9 A;  2ZJD A;  1UNS A;  4FJY A;  3AEF B;  2DX5 B;  2RPQ A;  4P16 A;  1FRR A;  3ZO5 B;  3A1Q B;  5CHV C;  5E6J A;  3AED B;  3TBL D;  1NVI D;  5CHF A;  4G50 A;  3VDZ A;  4DHZ B;  5FR6 A;  2O2V A;  4I6N B;  5D3I B;  3SFE B;  3V60 A;  1C78 A;  2ZNV B;  5BYS A;  3ZJU A;  2WX1 A;  3BZD B;  3WAL A;  3AM9 A;  3PRZ A;  4GDL B;  1BML C;  2D5G A;  5T8I A;  4MGK E;  2LXC A;  3PSE B;  1HQR D;  2LGY A;  1XLP A;  1J7B A;  3SHQ A;  1N5X A;  1VZ7 A;  2H88 B;  4WJO A;  3TMP B;  4C56 C;  1UWX A;  3PT2 B;  3WAN A; 
#chains in the Genus database with same CATH homology
 1WFY A;  1V86 A;  3PLV A;  4KZC A;  1RFA A;  4EFO A;  2KLC A;  3ZTD A;  1Q5W B;  1WR1 A;  3ML8 A;  1WX9 A;  2MBH A;  3ZNG C;  2I1J A;  3PHX B;  3VUX A;  1E7V A;  5BO4 B;  4NY0 A;  4F8C B;  2KQ7 A;  4PS7 A;  1G6J A;  1P98 A;  2LVO A;  2MLB A;  3L0W B;  2G45 B;  4ANW A;  4HJK A;  4ZRI A;  3VHT C;  2LGX A;  3UQA A;  4EOY A;  1P9D U;  1ZGU B;  3T9L A;  4TV3 A;  4GDK A;  2KFK A;  3P2B A;  2NBW B;  5L83 A;  4X57 B;  2NBU A;  2WX0 A;  4LJO B;  1WGY A;  3DDC B;  2C7N B;  3DBH I;  4BKT A;  2AWT A;  2KOX A;  1VD2 A;  2GBN A;  3RUL A;  2N7D A;  4HDO A;  2DAJ A;  2L7R A;  2O2V B;  4BBN F;  2IO0 B;  4TQ1 A;  2ZCB A;  2M0X A;  3IFW B;  4B9K A;  4WJP A;  2ZPN A;  2FNJ B;  1R4N I;  3KW5 B;  3VTU A;  2V4L A;  5AZF A;  2EMT A;  1V80 A;  3PZD A;  4K81 A;  1ZKH A;  2AYO B;  4FN2 A;  3W1Y A;  4AOF A;  2KTF A;  3U30 A;  2D3G A;  3PRE A;  4TKN A;  2N7E A;  5J2R A;  3RCZ A;  1YX5 B;  2IO1 B;  1RAX A;  3ECI A;  3MJW A;  4LCD E;  1TTN A;  2MX2 A;  2NS5 A;  1ISN A;  4KDL B;  1S1Q B;  3NOB A;  2R2Q A;  3R66 C;  4ICU A;  1T0Y A;  2VRR B;  3M62 B;  4GB9 A;  4GU2 A;  4II3 B;  1PQS A;  2JY6 A;  3APD A;  5E6O A;  1GG3 A;  4PYZ A;  3KVF B;  4ZYN A;  4ANU A;  2JRI B;  2CHZ A;  3H7P A;  2OOB B;  1J0G A;  3VQI A;  3SU8 X;  2ZPY A;  2JVC A;  4IW0 A;  5J17 A;  3TL5 A;  5JHA A;  1GC6 A;  4DBG A;  1K8R B;  2PJH A;  3VUW A;  4G11 A;  2G3Q B;  1WXV A;  4MJS B;  4W9K A;  2PE9 A;  3UQB A;  4NAW A;  4IM0 A;  3L16 A;  4XC2 A;  2JF5 A;  2C5L C;  2D11 A;  1GC7 A;  2KTR A;  3HK0 A;  1E8W A;  4IM3 A;  4AUQ C;  4DDI D;  1UGM A;  2KX0 A;  1R4M I;  3NZS A;  2LZ6 A;  2IBI B;  2BGF A;  1Y8R C;  4II2 B;  4JGH B;  2WWZ A;  4EKU A;  3ZTC A;  2UWQ A;  2HJ8 A;  1WXS A;  4I6P A;  3DVG X;  1EF5 A;  3TCA A;  3PGE A;  2KJ6 A;  5DPW A;  3LDZ E;  3AU4 A;  2K8C A;  3DBS A;  1WRD B;  3HM6 X;  1WM3 A;  4IWO A;  2EKE C;  4ANX A;  4GDK B;  2KFK B;  2N9P C;  2HTH A;  1E5W A;  2FAZ A;  3KYD D;  1OEY A;  2MBE A;  2LUE A;  5DPR A;  3EEC A;  3T8M A;  2BWE S;  2MWS B;  3PS6 A;  2FUH B;  1MG8 A;  2KXJ A;  1FXT B;  2R2O A;  5CTR C;  2ZCC A;  3TJP A;  2M8S A;  1UEL A;  3WAP A;  3ZRF A;  4DHJ D;  1A5R A;  3RD2 A;  2M4N A;  1VCB A;  2L05 A;  4ZRK A;  2BYV E;  4CHK A;  3RYT A;  2FCQ A;  3JSV A;  1OQY A;  1UBQ A;  2NBV B;  3JW0 X;  3H9D A;  4BBN C;  2K6D B;  2LAS A;  3DBL I;  3KUC B;  2DHZ A;  1RLF A;  3L10 B;  2ZEQ A;  2LWP A;  2ZVO A;  4BKG A;  2IY1 B;  3LJ3 A;  2WDT B;  4IWP A;  4AJY B;  1XQQ A;  3RZF A;  3VVW B;  3UGB B;  3L54 A;  1V9J A;  4DXA B;  1IPG A;  2LI5 A;  2W9N A;  2KDE B;  2NPT A;  4KIK A;  4OVU A;  5KHO A;  3DVN V;  3QAQ A;  3AU5 A;  4A20 A;  5JZE B;  4AWJ A;  2KAN A;  3H7P B;  2L8J A;  4J6I A;  2JXX A;  1IYF A;  2GBR A;  1P1A A;  3SDL C;  3NY5 A;  2Y5B B;  3VH4 B;  4MGZ E;  4BKS A;  4BOZ B;  1WJN A;  3D32 A;  3V6E B;  2FID A;  4NAW B;  5C1Z A;  4NPN A;  2DYM A;  1LQB A;  3ZLZ A;  1TBE A;  2N1W A;  3N32 A;  2KTR B;  3A9J A;  4GSW A;  4PS8 A;  3VFK A;  1V6E A;  3ONS A;  2KD0 A;  2K39 A;  2JRH A;  1Q1O A;  2B3A A;  1WGD A;  2BWF A;  4PS3 A;  1F9J A;  1WF9 A;  2CHW A;  2PPH A;  4AP4 C;  4K1R B;  2JPH A;  1LFD A;  3EC8 A;  3OJ3 A;  1Z5S B;  1L2N A;  1V49 A;  2CU1 A;  1I42 A;  3B0A A;  3KYC D;  2L0F A;  2ZZP B;  3AUL A;  2LGD A;  4DWF A;  3VUY A;  1L7Y A;  1WMH A;  2Z59 B;  3QJZ A;  2JWZ A;  1Q0W B;  3B08 A;  4KZ0 A;  3U8Z A;  4IUM B;  2KDI A;  2KVR A;  1SIF A;  3JSV B;  1GUA B;  2MW5 A;  3KUD B;  4FHJ A;  1HE8 A;  5D94 A;  4F7Z A;  2BKF A;  4I6L B;  2MBQ A;  5J18 A;  2KDB A;  1EO6 A;  5LXH A;  1V81 A;  2DZI A;  1V5T A;  2IYD B;  2KJH B;  4ZDV A;  4URK A;  1AAR A;  4NQL B;  2V3S A;  1NDD A;  4HPL B;  2LRW A;  2REX A;  1S3S G;  2UYZ B;  1WE7 A;  2J0K A;  4NNJ B;  1KLV A;  3IG3 A;  3QK0 A;  2NPT B;  4KIK B;  4IG7 B;  2LVQ A;  3VTV A;  1WXM A;  2BF8 B;  2AL3 A;  2GBK A;  1WI0 A;  2LJ5 A;  4DHZ E;  2IO2 B;  3B1L X;  3KH0 A;  1WJU A;  2JZ3 B;  3ZDT A;  3DPD A;  3APC A;  4A3O A;  3PV1 A;  1D3Z A;  2O6V A;  5DCN A;  4HCP B;  1WGR A;  2L00 B;  4K7U A;  4W9G A;  3VTW A;  4DDG D;  1KOT A;  2FCN A;  2C7M B;  2EMS A;  1YQB A;  2KX3 A;  3UF8 A;  1LXD A;  4RMA A;  2KHW B;  3ZUN A;  3H1U A;  3H6N A;  3MHS D;  2JT4 B;  2GBJ A;  3A9J B;  3UIP B;  3ZDM C;  2MQJ A;  3NS8 A;  1TZ1 A;  3PHW B;  3L08 A;  2DYB A;  5C23 A;  4N9F 4;  2I1K A;  3BIN A;  1EF1 A;  3RT3 B;  1M94 A;  3QHT A;  2DAF A;  3ZRC A;  4MGI E;  4RM9 A;  3QC8 B;  1WYW B;  4P7I A;  4WJN A;  2XEW A;  4WAA A;  1WZ0 A;  2K8B A;  3CST A;  3HM3 A;  1U4A A;  4EZL A;  3EHV A;  2KFJ A;  3PRP B;  1KJT A;  2GOW A;  4KVG B;  2N4F A;  3QX1 A;  4RM8 A;  2KNB A;  2KWU B;  5AZH A;  2KWV B;  3X0W A;  1ZW7 A;  3DVG Y;  2YLM A;  1WMH B;  4CO7 A;  1OEY J;  2JZZ A;  3WAO A;  3OLM D;  2J0M A;  2IY0 B;  3M95 A;  1X1M A;  1E8Y A;  4GMV A;  4MGY E;  5AZG A;  2CKH B;  1P0R A;  2C9W B;  2G4S A;  2A5U A;  5JHB A;  2BKR B;  2IZV B;  5D2M B;  1OTR B;  5AEK B;  2DEN B;  5LXI B;  2A4Z A;  1JRU A;  1UBI A;  4JL9 A;  4AJW A;  1WR6 E;  2DZJ A;  1E7U A;  4G3X B;  4NJ6 A;  2MCN B;  1WZ3 A;  2KZR A;  2YVC A;  4GN1 A;  2DZK A;  3W1S A;  4HWI B;  1UZX B;  2CR5 A;  3TIX A;  3H7S A;  1Z2M A;  2IO3 B;  3I3T B;  4IWQ A;  4EUT A;  4W9J A;  3UIO B;  2RD0 A;  3K9O B;  4MDK E;  2NVU I;  1GJZ A;  2K8H A;  2OJR A;  2BYE A;  4JQW C;  4YL8 A;  3ZKJ C;  4ICV A;  3S2A A;  2JUO A;  3JVZ X;  2O6V B;  2PEA A;  2V1Y A;  5D6J B;  4KDI C;  4CYE A;  2KMC A;  2XK5 A;  5JH5 C;  5IAA C;  3IVF A;  4W9D A;  4BVU C;  2MP2 A;  5KHQ A;  1WM2 A;  3A4S C;  2L76 A;  4B95 A;  5HKH A;  2CHX A;  2C60 A;  2PE6 B;  4ASW C;  4WQO B;  1XT9 B;  3HHM A;  3QAR A;  3ML9 A;  4M8M A;  3VH3 B;  4E3C A;  1J19 A;  1UD7 A;  3QIJ A;  4BKS D;  4KV2 A;  3WIM A;  4B6W A;  2HE7 A;  2D07 B;  4A3P A;  4MSQ B;  2KKC A;  5E6N A;  2KC2 A;  4EZJ A;  5CX3 A;  4MEL A;  3V6C B;  4OVV A;  2M17 A;  4EZK A;  3QCA A;  4WJQ A;  2N9E B;  1J8C A;  2AL6 A;  3OJ4 B;  3K9P B;  2K25 A;  2LXA A;  4ZRJ A;  1E8X A;  1GNU A;  1WJ6 A;  2ASQ A;  5EDS A;  3IHP C;  4HLE A;  2DYO A;  3QA8 A;  2AEH A;  4PYU A;  4W9F A;  4HPM B;  1NI2 A;  2KWC A;  3WAM A;  4K7W A;  4MM3 A;  3VAW A;  5L95 C;  1WH3 A;  4FA6 A;  4GXB A;  3A33 B;  2J0J A;  1WE6 A;  2RGF A;  1V5O A;  3PLU A;  4NJ7 A;  2LVP A;  3JYU A;  3A1Q A;  3ZNZ B;  4E74 A;  3R7R A;  2XBB C;  3DCG A;  1QZE A;  1E8Z A;  1BT0 A;  3VXW A;  1SE9 A;  4MSM B;  5GMV A;  2L3Z A;  3KUZ A;  5CHW A;  4GOC A;  4DHJ B;  3ZW3 A;  3DBR I;  4FAD A;  3RZW C;  5TR5 A;  1YJ1 A;  4BFR A;  1C3T A;  1WJ4 A;  4E71 A;  3AXC A;  2G4D B;  4GGQ A;  1SGH A;  3UIN B;  4FJV B;  4W9E A;  2ZNV C;  3R7Q A;  2NCN A;  1YIW A;  2LRU A;  2FIF A;  3HIZ A;  3PRM B;  3SD5 A;  2GBM A;  3L17 A;  3WA0 A;  2BYF A;  4FBJ B;  1WGH A;  2KLG A;  2XK5 B;  2Z0D B;  3M3J A;  2HD5 B;  4NQK E;  2WYQ A;  2MP2 B;  2MRP A;  5LLI A;  1C1Y B;  2D2Q A;  2M1M A;  3AI5 A;  2O6V D;  1LM8 B;  1WXA A;  2KQS A;  5G2N A;  3ZNH B;  4F1S A;  3A9K A;  3IBE A;  1P3Q U;  4LDT B;  4GDL A;  3O65 B;  4XX5 A;  3ZVV A;  3A4R A;  3R3M A;  3PTF C;  4FUL A;  2L0T A;  4TUU A;  2KMA A;  4LJP B;  4W9I A;  4G0N B;  2C7H A;  3ZNI D;  3N3K B;  4TQ0 A;  2Z0E B;  1TGZ B;  2FCM A;  4K7S A;  3RUI B;  1E90 A;  1YD8 U;  3PVL A;  3CSF A;  4KSL C;  4HVB A;  3DOW A;  4W9L A;  1NBF C;  2KK8 A;  3OAW A;  3V61 A;  3N30 A;  2ZJD A;  4WWN A;  4FJY A;  4M8N A;  5DPT A;  2DX5 B;  3DQV A;  3CF6 E;  4FHK A;  4GIV A;  4W9H A;  4HDQ A;  2MA9 B;  2RPQ A;  4IC7 B;  3ZO5 B;  1WX8 A;  3W1S C;  3A1Q B;  1CMX B;  3GOE A;  3C0R B;  2ZVN A;  5CHV C;  4FLH A;  3Q3F A;  3TBL D;  1WGG A;  1OGW A;  3CMM B;  2DZM A;  5IA7 A;  2BPS A;  3EFU A;  3DVN U;  2KN5 A;  2KJR A;  1WX7 A;  2MBO A;  2NR2 A;  3NZU A;  4JIO U;  1RRB A;  5CHF A;  4DK5 A;  4G50 A;  5D7G A;  3U7D A;  3VDZ A;  1KM7 A;  5FR6 A;  2LD9 A;  3ZIM A;  4DHZ B;  5DPS A;  3Q3J A;  2N9X A;  3GZN I;  4IM2 A;  3BY4 B;  4XZ4 A;  2O2V A;  4I6N B;  4HK2 A;  5G55 A;  2MSE D;  2N1V A;  3PPA A;  4MH0 E;  2RR9 A;  4HCN B;  3V60 A;  4MEM A;  3NHE B;  2CS4 A;  2FCS A;  1YX6 B;  2J7Q B;  2KO3 A;  1UH6 A;  2ZNV B;  3MTN B;  2QHO A;  1IP9 A;  3QQ8 B;  1I35 A;  3ALB A;  1H8C A;  3L13 A;  3ENE A;  3APF A;  2WX1 A;  4FJZ A;  4BOS C;  1H4R A;  4M0W B;  3QWZ B;  1WY8 A;  1V2Y A;  3WAL A;  5E6P A;  2RSU A;  3A9K B;  3PRZ A;  2GMI C;  4EEW A;  2D10 A;  4GDL B;  4KSK C;  2MBB B;  1EUV B;  2KDF B;  4MGK E;  2K1F A;  4WWP A;  4ANV A;  2LXC A;  3PSE B;  2LGY A;  4W9C A;  3SHQ A;  2KC1 A;  2K6Q A;  4LDT D;  4WWO A;  3X23 A;  1WIA A;  4HXD A;  4JLC A;  4WJO A;  3TMP B;  3V62 A;  4MJS A;  3M63 B;  3PT2 B;  1XD3 B;  3WAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...