3V62B

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
255
structure length
255
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
molecule keywords Ubiquitin-like protein SMT3
molecule tags Protein binding/dna binding protein
source organism Saccharomyces cerevisiae
total genus 58
structure length 255
sequence length 255
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
B PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3v62B00
2HIIA 2AWAA 4CS5A 2IX2C 3U61F 1U7BA 2NTIC 3GGRA 3U60F 1VYMA 3F1WA 4L6PA 3A1JA 1GE8A 1PLRA 2ZVWA 3GPNA 3AIZC 3LX2A 5E0TA 1W60A 5CFKA 2IO4B 3FDSD 3FDSC 3G65B 3I2MX 2IX2A 1AXCA 1SXJF 1VYJA 5DA7A 3WGWA 2NTIA 1RXZA 1IZ4A 1IZ5A 2HIKB 3LX1A 4D2GA 3AIZA 3V62B 1UD9A 3AIXB 3P87A 2AVTA 3G65C 1T6LA 3GPMA 4ZTDA 3VKXA 4YHRA 5DAIA 1CZDA 2HIKC 2ZVKA 5AUJA 1RXMA 3P91A 1YYPA 2IZOB 2Z0LA 3P83A 2IO4A 5HACA 1DMLA 1RWZA 3G65A 2IJXA 5IXAA 5H0TA 1B8HA 4L60A 3K4XA 2OD8A 2HIKA 2HIIB 2ZVLA 2IZOC 2ZVVA 4HK1A 3V61B 2ZVMA 3AIXA 5B7OA 1UL1A 3GGRB 4TR6A 3IFVA 3A1JB 3TBLA 3V60B 2HIIC 5E0VA 1U76A 5IY4A 1PLQA 3U5ZF 5E0UA 2IX2B 1B77A 5IWDA 2NTIB 3GGRC 1ISQA 3A2FB 3HSLX 5JNED 4RJFA 3A1JC 5A6DA 3HI8A
chains in the Genus database with same CATH superfamily
2HIIA 2AWAA 4CS5A 2IX2C 3U61F 1U7BA 2NTIC 3GGRA 3U60F 1VYMA 3F1WA 4L6PA 3A1JA 1GE8A 1PLRA 2ZVWA 3GPNA 3AIZC 3LX2A 5E0TA 1W60A 5CFKA 2IO4B 3FDSD 3FDSC 3G65B 3I2MX 2IX2A 1AXCA 1SXJF 1VYJA 5DA7A 3WGWA 2NTIA 1RXZA 1IZ4A 1IZ5A 2HIKB 3LX1A 4D2GA 3AIZA 3V62B 1UD9A 3AIXB 3P87A 2AVTA 3G65C 1T6LA 3GPMA 4ZTDA 3VKXA 4YHRA 5DAIA 1CZDA 2HIKC 2ZVKA 5AUJA 1RXMA 3P91A 1YYPA 2IZOB 2Z0LA 3P83A 2IO4A 5HACA 1DMLA 1RWZA 3G65A 2IJXA 5IXAA 5H0TA 1B8HA 4L60A 3K4XA 2OD8A 2HIKA 2HIIB 2ZVLA 2IZOC 2ZVVA 4HK1A 3V61B 2ZVMA 3AIXA 5B7OA 1UL1A 3GGRB 4TR6A 3IFVA 3A1JB 3TBLA 3V60B 2HIIC 5E0VA 1U76A 5IY4A 1PLQA 3U5ZF 5E0UA 2IX2B 1B77A 5IWDA 2NTIB 3GGRC 1ISQA 3A2FB 3HSLX 5JNED 4RJFA 3A1JC 5A6DA 3HI8A
chains in the Genus database with same CATH topology
2HIIA 2AWAA 4CS5A 2IX2C 3U61F 1U7BA 2NTIC 3GGRA 3U60F 1VYMA 3F1WA 4L6PA 3A1JA 1GE8A 1PLRA 2ZVWA 3GPNA 3AIZC 3LX2A 5E0TA 1W60A 5CFKA 2IO4B 3FDSD 3FDSC 3G65B 3I2MX 2IX2A 1AXCA 1SXJF 1VYJA 5DA7A 3WGWA 2NTIA 1RXZA 1IZ4A 1IZ5A 2HIKB 3LX1A 4D2GA 3AIZA 3V62B 1UD9A 3AIXB 3P87A 2AVTA 3G65C 1T6LA 3GPMA 4ZTDA 3VKXA 4YHRA 5DAIA 1CZDA 2HIKC 2ZVKA 5AUJA 1RXMA 3P91A 1YYPA 2IZOB 2Z0LA 3P83A 2IO4A 5HACA 1DMLA 1RWZA 3G65A 2IJXA 5IXAA 5H0TA 1B8HA 4L60A 3K4XA 2OD8A 2HIKA 2HIIB 2ZVLA 2IZOC 2ZVVA 4HK1A 3V61B 2ZVMA 3AIXA 5B7OA 1UL1A 3GGRB 4TR6A 3IFVA 3A1JB 3TBLA 3V60B 2HIIC 5E0VA 1U76A 5IY4A 1PLQA 3U5ZF 5E0UA 2IX2B 1B77A 5IWDA 2NTIB 3GGRC 1ISQA 3A2FB 3HSLX 5JNED 4RJFA 3A1JC 5A6DA 3HI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HII A;  2AWA A;  4CS5 A;  2IX2 C;  3U61 F;  1U7B A;  2NTI C;  3GGR A;  3U60 F;  1VYM A;  3F1W A;  4L6P A;  3A1J A;  1GE8 A;  1PLR A;  2ZVW A;  3GPN A;  3AIZ C;  3LX2 A;  5E0T A;  1W60 A;  5CFK A;  2IO4 B;  3FDS D;  3FDS C;  3G65 B;  3I2M X;  2IX2 A;  1AXC A;  1SXJ F;  1VYJ A;  5DA7 A;  3WGW A;  2NTI A;  1RXZ A;  1IZ4 A;  1IZ5 A;  2HIK B;  3LX1 A;  4D2G A;  3AIZ A;  3V62 B;  1UD9 A;  3AIX B;  3P87 A;  2AVT A;  3G65 C;  1T6L A;  3GPM A;  4ZTD A;  3VKX A;  4YHR A;  5DAI A;  1CZD A;  2HIK C;  2ZVK A;  5AUJ A;  1RXM A;  3P91 A;  1YYP A;  2IZO B;  2Z0L A;  3P83 A;  2IO4 A;  5HAC A;  1DML A;  1RWZ A;  3G65 A;  2IJX A;  5IXA A;  5H0T A;  1B8H A;  4L60 A;  3K4X A;  2OD8 A;  2HIK A;  2HII B;  2ZVL A;  2IZO C;  2ZVV A;  4HK1 A;  3V61 B;  2ZVM A;  3AIX A;  5B7O A;  1UL1 A;  3GGR B;  4TR6 A;  3IFV A;  3A1J B;  3TBL A;  3V60 B;  2HII C;  5E0V A;  1U76 A;  5IY4 A;  1PLQ A;  3U5Z F;  5E0U A;  2IX2 B;  1B77 A;  5IWD A;  2NTI B;  3GGR C;  1ISQ A;  3A2F B;  3HSL X;  5JNE D;  4RJF A;  3A1J C;  5A6D A;  3HI8 A; 
#chains in the Genus database with same CATH topology
 2HII A;  2AWA A;  4CS5 A;  2IX2 C;  3U61 F;  1U7B A;  2NTI C;  3GGR A;  3U60 F;  1VYM A;  3F1W A;  4L6P A;  3A1J A;  1GE8 A;  1PLR A;  2ZVW A;  3GPN A;  3AIZ C;  3LX2 A;  5E0T A;  1W60 A;  5CFK A;  2IO4 B;  3FDS D;  3FDS C;  3G65 B;  3I2M X;  2IX2 A;  1AXC A;  1SXJ F;  1VYJ A;  5DA7 A;  3WGW A;  2NTI A;  1RXZ A;  1IZ4 A;  1IZ5 A;  2HIK B;  3LX1 A;  4D2G A;  3AIZ A;  3V62 B;  1UD9 A;  3AIX B;  3P87 A;  2AVT A;  3G65 C;  1T6L A;  3GPM A;  4ZTD A;  3VKX A;  4YHR A;  5DAI A;  1CZD A;  2HIK C;  2ZVK A;  5AUJ A;  1RXM A;  3P91 A;  1YYP A;  2IZO B;  2Z0L A;  3P83 A;  2IO4 A;  5HAC A;  1DML A;  1RWZ A;  3G65 A;  2IJX A;  5IXA A;  5H0T A;  1B8H A;  4L60 A;  3K4X A;  2OD8 A;  2HIK A;  2HII B;  2ZVL A;  2IZO C;  2ZVV A;  4HK1 A;  3V61 B;  2ZVM A;  3AIX A;  5B7O A;  1UL1 A;  3GGR B;  4TR6 A;  3IFV A;  3A1J B;  3TBL A;  3V60 B;  2HII C;  5E0V A;  1U76 A;  5IY4 A;  1PLQ A;  3U5Z F;  5E0U A;  2IX2 B;  1B77 A;  5IWD A;  2NTI B;  3GGR C;  1ISQ A;  3A2F B;  3HSL X;  5JNE D;  4RJF A;  3A1J C;  5A6D A;  3HI8 A; 
#chains in the Genus database with same CATH homology
 2HII A;  2AWA A;  4CS5 A;  2IX2 C;  3U61 F;  1U7B A;  2NTI C;  3GGR A;  3U60 F;  1VYM A;  3F1W A;  4L6P A;  3A1J A;  1GE8 A;  1PLR A;  2ZVW A;  3GPN A;  3AIZ C;  3LX2 A;  5E0T A;  1W60 A;  5CFK A;  2IO4 B;  3FDS D;  3FDS C;  3G65 B;  3I2M X;  2IX2 A;  1AXC A;  1SXJ F;  1VYJ A;  5DA7 A;  3WGW A;  2NTI A;  1RXZ A;  1IZ4 A;  1IZ5 A;  2HIK B;  3LX1 A;  4D2G A;  3AIZ A;  3V62 B;  1UD9 A;  3AIX B;  3P87 A;  2AVT A;  3G65 C;  1T6L A;  3GPM A;  4ZTD A;  3VKX A;  4YHR A;  5DAI A;  1CZD A;  2HIK C;  2ZVK A;  5AUJ A;  1RXM A;  3P91 A;  1YYP A;  2IZO B;  2Z0L A;  3P83 A;  2IO4 A;  5HAC A;  1DML A;  1RWZ A;  3G65 A;  2IJX A;  5IXA A;  5H0T A;  1B8H A;  4L60 A;  3K4X A;  2OD8 A;  2HIK A;  2HII B;  2ZVL A;  2IZO C;  2ZVV A;  4HK1 A;  3V61 B;  2ZVM A;  3AIX A;  5B7O A;  1UL1 A;  3GGR B;  4TR6 A;  3IFV A;  3A1J B;  3TBL A;  3V60 B;  2HII C;  5E0V A;  1U76 A;  5IY4 A;  1PLQ A;  3U5Z F;  5E0U A;  2IX2 B;  1B77 A;  5IWD A;  2NTI B;  3GGR C;  1ISQ A;  3A2F B;  3HSL X;  5JNE D;  4RJF A;  3A1J C;  5A6D A;  3HI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...