3V64C

Crystal structure of agrin and lrp4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
341
structure length
338
Chain Sequence
YCSQGCTNSFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACALEVLFQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Low-density lipoprotein receptor-related protein 4
total genus 80
structure length 338
sequence length 341
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3v64C01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3v64C02
3BT2A 3N8WB 1JL9A 1CQ1A 3IITB 3LTFB 3Q6TA 3S2KA 4X8UL 1URKA 2FZZL 1QBIA 4GN8A 3S8ZA 3POYA 3U0SA 3U73A 1IP0A 2XC4L 1G1TA 4HHOA 3QH0A 1PRHA 1CCFA 4BXWA 1C9UA 3TC9A 4D0EA 2W3KB 3CA7A 5L30L 2W26B 3KRKA 2MHPA 1C5KA 2Y7XB 2UWOB 3M36L 1E1AA 1IVOC 4ZAEB 2OYUP 4ZXXL 1U8CB 1L5GB 1MQ5L 1ADXA 2XBWL 1CCVA 3MDLA 2VVUL 4BTTA 1EPJA 3K9XA 4X8TL 3MQEA 3BPSE 2B7DL 1FF7A 1NQLB 5GTQA 2BOHA 1B9WA 2G8SA 4RUTA 2D1JB 4CSYA 3HS5A 1HJ7A 5CKMA 2F9BL 4RRZA 1WU1B 4X8VL 3V64C 1FAKL 4Z6AL 1XKBA 4JMLA 2IAXA 4LORA 3TK6B 3NTBA 2WPJE 3TGFA 1KLJL 3GCWE 2M74A 2IAVA 3TH3L 2XC0L 1DDXA 1OB1C 4PH9A 1TOZA 2WPKE 2V91A 5KN5C 1COUA 2BO2A 3F6UL 5D9BA 1FSBA 1LPZA 1FAXL 4GN7A 3HPTA 3G4HA 1P0SL 4Z0KB 4D90A 3DASA 5L2YL 2EI8B 4ZH8B 2XBVL 5JBBE 1Q4GA 2VH0B 1A3PA 2FPCA 4Y7AB 4IYGA 2PUQL 3PGHA 2FLGA 1KSNB 1IQIL 3CS7L 4GNCA 5JVZA 2P3FN 1YO8A 5GX2A 3V1SA 4CUFA 5KIRA 2P93L 1P9JA 2XBXL 4O02B 1K37A 1HREA 5CKNA 4Q1UA 2J2UB 3ASIA 1Z6EL 4COXA 1EPHA 1BF9A 4GNAA 2K2SB 2GD4A 3N8VA 1UZJA 4LMFA 1PJXA 2RA0L 5CKQA 1NFWB 1EQHA 2DSOA 1PFXL 4XLWA 1U67A 5CISA 2P3UA 3GCXE 4MMXB 1F7MA 1N7DA 1WHFA 2H9EL 3LTGD 4M11A 1WHEA 3Q6PA 1Q7FA 4OTJA 4BTIA 1F0SB 1PGEA 4NGAL 4BDWA 3KK6A 3TK5B 4RRYA 3A9HA 3IAXA 2P3TA 1CRZA 3KQDL 3OLUA 3N8YA 3S94A 4NG9L 3Q3KB 1F0RB 1IQNL 3LC5B 4Y79B 1EQGA 5K0HB 1CVWL 3N8XA 2IAPA 1EBVA 2BOUA 1ATAA 2EI7B 4Y6DB 4FM5A 4E1GA 4JYVL 3N8ZA 1IGXA 1GK5A 1UZKA 3HRPA 1YUFA 1G2MB 2WG4B 3HLIA 2GVWA 3V65B 5GX3A 4MMYB 4ZLRA 1V04A 1CVMA 3GISX 3HO4A 2NPRA 1LMJA 4CUEA 3O4PA 2CJIB 4CUDA 3FW0A 2WFXB 3LAQA 4X8SL 2POOA 2YGOA 5IKRA 1MQ6L 2BQ7A 4Y7BB 1POOA 4HHQA 2GVVA 3S8VA 2VWNL 2K2TA 3P5BL 3RR3A 1UZPA 2MGRA 4GNBA 1YGCL 1PXXA 2J94B 4TGFA 2Y7ZB 4YT6L 1IQML 1HT5A 3FBYA 1YUGA 2MGPA 2BMGA 5COXA 3NT1A 1DQBA 1K36A 4BTUA 1HZ8A 4HW6A 1M1XB 3KQCL 2P28B 4MMZB 1FJSL 2UWLB 3QCWA 4RS0A 1IQLL 2Y38A 5GX5A 2IASA 2W3IB 2YGPA 1NPEB 5IKTA 4YZUB 2IAOA 1IQJL 1NT0A 1TLEA 1I0UA 3SOBB 3F1SB 1G1RA 2Y81B 3FFGL 4OTYA 3R05A 5D9CA 4A0PA 4JZEL 4ISIL 2IAQA 1EZQB 2IAUA 4BDXA 2FD6A 2Y80B 5EGMB 1KLOA 1APQA 4G1MB 3HO5A 3N8WA 2FLBL 1IGZA 1ATDA 1ZAQA 3QMOA 1HCGB 4ZHAB 1W8BL 1IOXA 1LPGA 5JB9E 3HS7A 2VAQA 1N1IA 2W2ME 3FVZA 1IQGL 1O5DL 3OLTA 2FPBA 2FLRL 2P95L 1HAFA 1F7EA 1NZIA 1ATEA 4O1ZA 2I9AA 3N8YB 1V3XB 2WPME 3DEMA 2J38B 2XBYL 3A9GA 4D0FA 2UWPB 2VH6B 2P94L 1X7AL 1Z6CA 1HX2A 4XBMA 1DIYA 4JZFL 2P4OA 1G1SA 1NPEA 5JW1A 3BT1A 1SZBA 2GVUA 2BQWA 3LN0A 1PTHA 3KL6B 2W86A 4DG6A 1G2LB 1C5MF 2Y5FL 4O5SA 2PHBB 3KQEL 3M37L 2EI6B 4Y71B 2WPHE 2RNLA 2HQSA 3IJEB 4RRXA 1IQKL 1J9CL 3C9AC 1NFYB 2FP8A 1DVAL 3HS6A 1KIGL 5JBCE 3U7UG 1EMOA 2QE8A 1NFXB 1HT8A 3TZIA 5IKQA 4O5TA 2AYLA 1KLIL 2IATA 5IKVA 3HLHA 3WWAA 1LPKA 3LN1A 3SREA 3ELAL 6COXA 4YT7L 1AUTL 2J95B 2W2QE 1CX2A 2WG3C 4Y76B 1JV2B 2VWLL 2W8BB 3HO3A 2FP9A 2DG1A 1EAIC 3SW2A 2WYGB 1RWIA 3WW9A 4XL1A 5L2ZL 2DG0A 1APOA 3ZYIB 3NJPC 2BZ6L 1EPGA 1IOEL 1IJQA 1XKAL 1ATBA 1HRFA 5EX7A 3G4EA 1NFUB 2KB9A 2VWMK 4R40A 1TPGA 3ZYJB 1EPIA 2GVXA 2JKHL 2IVZA 1IQFL 1QFKL 2W2NE 2TGFA 2KV4A 3Q6KA 5F19A 2P26A 3BYCA 2P3FL 4JYUL 2BOXA 3KYAA 1W7XL 1MOXC 2OJHA 3SOVA 2BOKL 5FWWA 2RHPA 5JB8E 3LC3B 2Q1JB 1EMNA 2PR3B 3SRGA 1IQHL 2WPIE 1IQEL 2G00L 2I9BA 2W2PE 2WFTA 3TBDA 4C16A 3CENL 1UZQA 5GX4A 3KGGA 1CRUA 3EGFA 3LIWB 5JBAE 3DR2A 2IAWA 2J4IB 3LI4A 2VJ3A 4PWZA 2OYEP 4NA9L 4ZXYL 4JZDL 1EGFA 2VVVL 2W2OE 3H5CB 1H6LA 1XDTR 4IMBA 2P16L 4M10A 1XFEA 3Q7DA 4RRWA 4BXSA 3LI5A 4GN9A 2KL7A 2BQ6A 4AQTA 3E5ZA 3ENSA 1CQEA 1G1QA 4Z0LA 1CEJA 2DDUA 3KCGL 2ADXA 5GX1A 5F1AA 2VVCK 5E8DA 2Y82B 3SOQA 1L3YA 2W8BA 3I1CA 3NTGA 2ISMA 2Y5HL 5JVYA 1DX5I 3KQBL 1FE2A 1HAEA 1YUKB 3LI3A 4ISHL 1FFMA 1RWLA 2GHSA 3ZYGA 2WPLE 3AMRA 1RFNB 2J34B 1QLGA 2Y5GL 3CFWA 2WYJB 5FDQA 1JBUL 1LQDA 2XC5L 2IARA 5I46L 2VWOL 3AMSA 1CVUA 4A7IA 5D9DA 3FCSB
chains in the Genus database with same CATH superfamily
4FP2A 2HU4A 3BT2A 3N8WB 1JL9A 1CQ1A 1IVBA 3IITB 2X9MA 3LTFB 1DIMA 1SUUA 1INXA 5NN9A 3Q6TA 1LMMA 3S2KA 2QWHA 1E8UA 4X8UL 1URKA 2FZZL 1QBIA 4GN8A 3S8ZA 4GZQA 4XJZA 3POYA 2H2NA 3U0SA 1V1IA 3U73A 4N1BA 4D52C 1IP0A 5FWWA 2F11A 2XC4L 4XJRA 1G1TA 4HHOA 4CH9A 5HUNA 3H72A 3QH0A 1PRHA 1CCFA 4FJ6A 4BXWA 1XOGA 1C9UA 3TC9A 4D0EA 4MZEA 2W3KB 3CA7A 5L30L 2W26B 3KRKA 2MHPA 1C5KA 5EO8A 2Y7XB 2UWOB 3M36L 1E1AA 4FOWA 2ZB5A 4GJTA 1IVOC 4ZAEB 2OYUP 4ZXXL 2F29A 1A4QA 4D4UA 1U8CB 1L5GB 4MJUA 1MQ5L 1K32A 1INWA 4XJWA 1ADXA 2QWKA 1VCJA 2ZWAA 2XBWL 1CCVA 3MDLA 4WA5A 1IVEA 2VVUL 2YA4A 4MWJA 1N6FA 4SLIA 5B2DA 1NN2A 4BTTA 1B9SA 1EPJA 3K9XA 3H71A 4X8TL 4CPMA 3MQEA 2XN4A 3BPSE 4K1HA 2B7DL 1FF7A 1N6DA 1NQLB 1WCSA 1EUSA 4XMBA 5FNUA 5GTQA 2BOHA 1F8BA 1B9WA 2G8SA 4M3MA 1U6DX 3TIAA 4QN7A 2HTUA 4RUTA 4G3NA 4GB1A 2D1JB 4CSYA 3HS5A 3ZGCA 3ALWA 4MWRA 2QWGA 1HJ7A 2XCYA 2XZJA 5CKMA 2F9BL 1INYA 4RRZA 4GU4A 4M4VA 4B7QA 1WU1B 4X8VL 3V64C 1X2JA 1NCBN 4D8SA 1FAKL 4Z6AL 1NNBA 1XKBA 4XOGA 3SLIA 4FPJA 4JMLA 4MWQA 2IAXA 1SNTA 4LORA 3H6JA 3TK6B 1INVA 3NTBA 2WPJE 3TGFA 4ZGCA 1KLJL 1B9VA 3GCWE 2M74A 1W8OA 2IAVA 2VRSA 3TH3L 2XC0L 1DDXA 1OB1C 4PH9A 1W0PA 3CKZA 3VNGA 1TOZA 2WPKE 2V91A 4MWLA 5CGJA 2C4LA 5KN5C 1COUA 1A4GA 2BO2A 3F6UL 2VSMA 1MR5A 5D9BA 1FSBA 1LPZA 4QN5A 4XJ9A 1FAXL 4HZVA 4GN7A 1V2IA 1F8DA 4GEZA 3HPTA 4CPNA 1V0FA 3G4HA 1P0SL 4Z0KB 3SALA 4D90A 2QWCA 3DASA 4DGRA 5L2YL 3TIBA 2EI8B 4YY8A 2W38A 4ZH8B 4WEFA 2XBVL 5HUKA 5JBBE 1Q4GA 2VH0B 1A3PA 2FPCA 4Y7AB 4KS4A 4IYGA 4KS1A 4FOYA 2AGSA 2PUQL 3PGHA 3TICA 2FLGA 1KSNB 5B2CA 1IQIL 2YA8A 3CS7L 4L7CA 4GNCA 5JVZA 2P3FN 1YO8A 5GX2A 3V1SA 4CUFA 5KIRA 2P93L 1P9JA 2XBXL 1VCUA 4FQ4A 4CPYA 1V1HA 3CL0A 6NN9A 4GZSA 3H73A 4O02B 1K37A 1HREA 3II7A 5CKNA 3A71A 4Q1UA 2J2UB 3ASIA 1Z6EL 4COXA 1EPHA 4A94C 1BF9A 4GNAA 4CPOA 2HORA 2K2SB 2GD4A 3N8VA 1UZJA 4LMFA 1EUTA 1PJXA 4B7JA 2SIMA 2RA0L 1V0EA 1Z50A 4GU3A 4I00A 4KS5A 2F28A 5CKQA 1NFWB 1L7HA 1EQHA 2VWDA 1Z4WA 4WEGA 2DSOA 1PFXL 4XLWA 2VVZA 2ZZKA 1U67A 5CISA 2P3UA 3GCXE 2ZW9A 1F7MA 1N7DA 4MMXB 1MS9A 1WHFA 2SILA 3CL2A 4CSDA 2H9EL 3LTGD 4M11A 1KITA 1NCDN 2W5OA 1WHEA 4M4NA 2VW0A 3Q6PA 1Q7FA 4OTJA 4BTIA 5HUMA 1F0SB 1PGEA 1A14N 4NGAL 1W0OA 4BDWA 3VNHA 3KK6A 3TK5B 4JF7A 4RRYA 1N1YA 3A9HA 3IAXA 2P3TA 4MWXA 1CRZA 3A72A 2ZB6A 1S0IA 1Z4ZA 3KQDL 3OLUA 3N8YA 3S94A 4NG9L 3Q3KB 1F0RB 1IQNL 3LC5B 4Y79B 1EQGA 5K0HB 1SO7A 1CVWL 3N8XA 4L7BA 2IAPA 1EBVA 2BOUA 1ATAA 2EI7B 4Y6DB 4FPOB 3TI8A 4FM5A 4YW1A 4MJVA 2AEQA 5FZJA 4E1GA 4MWVA 4JYVL 3N8ZA 1IGXA 1GK5A 4M4UA 4YZ2A 2HTYA 1UZKA 3HRPA 4NN9A 1YUFA 2QWEA 1X2RA 4HZZA 1G2MB 1MS8A 2WG4B 3TI6A 3HLIA 2BT7A 3V65B 2GVWA 4X47A 4XYXA 5GX3A 2HTWA 2VSKA 4MMYB 4HZYA 1V04A 4ZLRA 1CVMA 3D11A 3GISX 3HO4A 2NPRA 1V3EA 1LMJA 4CUEA 1EUUA 3O4PA 4XHXA 4AHAA 2CJIB 2HOXA 3TI5A 4CUDA 2FHRA 3FW0A 2WFXB 2HT8A 3NN9A 3LAQA 4D52A 4X8SL 4FZHA 3B69A 2POOA 2YGOA 5IKRA 1MQ6L 2BQ7A 4Y7BB 1POOA 2YDTA 4HHQA 1NNAA 2GVVA 3S8VA 2VWNL 2K2TA 1N1SA 3P5BL 3K37A 4XJUA 3RR3A 3B7EA 1UZPA 2MGRA 4GNBA 1YGCL 1PXXA 2J94B 4HZXA 4NC5A 4TGFA 2Y7ZB 4YT6L 4FPYA 4HZWA 4X4AA 1MZ6A 1IQML 4FP3A 4NCSA 1HT5A 3FBYA 1YUGA 2MGPA 2BMGA 2B8HA 5COXA 3NT1A 1DQBA 1IVCA 1K36A 4X49A 4BTUA 1HZ8A 4H53A 1M1XB 3KQCL 4HW6A 4QNPA 2P28B 4MMZB 1V0ZA 1FJSL 4KS2A 2UWLB 3QCWA 4RS0A 4XIOA 3NO0A 2BZDA 3JU4A 1IQLL 2Y38A 5GX5A 1MS4A 2IASA 3INBA 2W3IB 3L6VA 3WDZA 2YGPA 2F25A 1NPEB 5IKTA 1OFZA 3CYEA 4YZUB 1WP5A 2IAOA 2QWJA 1NMBN 4GZTA 1IQJL 4QN3A 3D12A 2XZIA 1NT0A 4CPZA 1TLEA 1MS1A 1I0UA 3SOBB 3F1SB 3O9JA 3OPZA 1DILA 5FNRA 1G1RA 2Y81B 3FFGL 4OTYA 3R05A 1L7FA 1XOEA 4JZEL 4ISIL 4XMIA 2XZKA 4YZ3A 5D9CA 1NSDA 2IAQA 4C1YA 1INGA 1EZQB 2IAUA 4BDXA 2FD6A 2Y80B 5EGMB 4J9TA 1KLOA 3GVJA 1APQA 4B7RA 4G1MB 3HO5A 3N8WA 2FLBL 1IGZA 1ZI0A 3K3AA 1ATDA 4FPFA 1ZAQA 3QMOA 1NCCN 4FPGA 1HCGB 4ZHAB 1IVFA 1W8BL 2VK7A 2W5NA 2SLIA 5FZNA 1E8VA 1IOXA 1N6EA 1ZGKA 3NSSA 4XILA 4YZ5A 1LPGA 5JB9E 1IUBA 2QWFA 4IQKA 3HS7A 2VAQA 1N1IA 2W2ME 3FVZA 1IQGL 4FVKA 1O5DL 3OLTA 4ASCA 2FPBA 2FLRL 2HT7A 1S0JA 2P95L 2A75A 1HAFA 2YDPA 2QWBA 1F7EA 1NZIA 1ATEA 4O1ZA 2I9AA 3N8YB 1V3XB 1MS0A 2WPME 3DEMA 2J38B 2VK6A 2XBYL 3A9GA 4D0FA 4FPEA 2UWPB 2VH6B 4XJAA 1KKEA 2P94L 1IVGA 1X7AL 1Z6CA 1HX2A 4XBMA 1DIYA 4JZFL 1SLIA 2AH2A 1G1SA 1NPEA 5JW1A 2HTVA 2P4OA 3BT1A 4AGTA 1SZBA 2GVUA 4XMAA 2C4AA 2BQWA 3LN0A 3S6XA 2JJLA 3T1EA 4K3YA 1PTHA 3W09A 3KL6B 1Z4YA 2W86A 3BEQA 4Q6KA 4DG6A 1G2LB 1C5MF 2Y5FL 2W20A 4O5SA 1LK9A 2PHBB 3KQEL 4YZ4A 3M37L 4CHBA 2WOZA 4UF7A 2EI6B 4Y71B 2DYHA 2F0ZA 4HIZA 5JYYA 2WPHE 1NCAN 1NNCA 2RNLA 2HQSA 4IFNX 1EURA 3IJEB 4XE9A 4QN6A 3K36A 4RRXA 5F72C 1IQKL 1J9CL 3C9AC 3UC1A 1NFYB 2FP8A 1DVAL 5H47A 3HS6A 1KIGL 5JBCE 3U7UG 1EMOA 1IVDA 2F27A 2F10A 2QE8A 1NFXB 4UOUA 4CPLA 1HT8A 3SILA 3TZIA 5IKQA 2YA5A 4O5TA 2AYLA 1KLIL 2IATA 5IKVA 3HLHA 3WWAA 1LPKA 3LN1A 3SREA 3ELAL 6COXA 4MX0A 2VK5A 4YT7L 1AUTL 2J95B 3ZGDA 4FOQA 2QWIA 2W2QE 2BERA 2RKCA 1CX2A 4MZAA 2WG3C 1MS3A 1BJIA 4Y76B 1JV2B 2VWLL 5FNTA 3TI3A 1W20A 4ZY3A 4A0PA 1N1VA 2W8BB 3HO3A 4H52A 2FP9A 4MWYA 2DG1A 5F9TA 1EAIC 3SW2A 2WYGB 5EO7A 1RWIA 3WW9A 4XL1A 2F24A 3WN7A 5L2ZL 2Z32A 2DG0A 2HT5A 1APOA 3ZYIB 3NJPC 2BZ6L 5HUGA 1EPGA 2WZPP 1MZ5A 1IOEL 1IJQA 1XKAL 1ATBA 2BATA 4K1KA 3SANA 1HRFA 5EX7A 2JKBA 2HTQA 2QWDA 2HU0A 3G4EA 1NFUB 2KB9A 4MWUA 4XHBA 2VWMK 4R40A 4YW2A 1TPGA 3ZYJB 4L7DA 1EPIA 1W21A 2GVXA 5HX0A 2JKHL 2IVZA 1IQFL 1MS5A 1QFKL 2W2NE 1INHA 2TGFA 4X6KA 1INFA 2KV4A 2YA6A 4D52B 3Q6KA 4WA4A 2BF6A 2FLUX 5F19A 2P26A 1V3DA 3BYCA 2P3FL 4JYUL 4FPCA 2BOXA 3TI4A 5M1ZA 1L7GA 3KYAA 1N1TA 1W7XL 4IFJA 1MOXC 2OJHA 4FPLA 3SOVA 2BOKL 2F13A 2RHPA 5JB8E 1NMAN 2VPJA 4GZXA 2F26A 3LC3B 2Q1JB 1EMNA 1MWEA 2PR3B 1F8CA 4FOVA 1V3CA 4QN4A 3SRGA 2VW1A 1IQHL 2WPIE 7NN9A 1IQEL 2G00L 2I9BA 2W2PE 4GDJA 1QIUA 2WFTA 3TBDA 4YW4A 2F12A 4GZWA 1Z4VA 4C16A 3CENL 1UZQA 5GX4A 2AEPA 3KGGA 1CRUA 3EGFA 1USXA 3LIWB 5JBAE 3DR2A 2IAWA 4IFLX 2J4IB 1Z4XA 2VJ3A 3LI4A 3ALXA 2OYEP 4PWZA 1F8EA 4NA9L 4ZXYL 4JZDL 1EGFA 4BBWA 1B9TA 2VVVL 2W2OE 3H5CB 1H6LA 1XDTR 4IMBA 4KS3A 2P16L 4M10A 1USRA 3O9KA 4WA3A 4B7MA 1V3BA 1XFEA 3Q7DA 4FPKA 4RRWA 3K38A 2BSFA 4BXSA 4YW3A 3LI5A 1IUCA 2CMLA 4FPHA 2KL7A 4GN9A 4K1IA 2BQ6A 4AQTA 3E5ZA 3ENSA 1CQEA 1G1QA 2HTRA 4B7NA 4Z0LA 1E8TA 1NMCA 4MC7A 4XJQA 4XIKA 4GZOA 1CEJA 4YW5A 2DDUA 3KCGL 4IN4A 2ADXA 5GX1A 1WCQA 5F1AA 2VVCK 5E8DA 2Y82B 3SOQA 1L3YA 2W8BA 3I1CA 1W8NA 4GDIA 3PJQA 3NTGA 5FNQA 1S1DA 2ISMA 4K1JA 5FNSA 2Y5HL 4AGIA 5JVYA 2BT8A 2KNIA 1W1XA 1DX5I 3KQBL 1FE2A 1HAEA 1YUKB 2YA7A 3GVKA 3LI3A 4ISHL 1NSBA 1FFMA 1RWLA 4AH4A 2GHSA 4YZ1A 1SLLA 3ZYGA 2WPLE 1S18A 3AMRA 3GVLA 1RFNB 2J34B 4XJ8A 1QLGA 2Y5GL 2QWAA 4GZPA 3CFWA 2WYJB 5FDQA 2XC5L 1JBUL 1LQDA 2IARA 3ADEA 5I46L 2VWOL 2H9EC 3AMSA 1NSCA 2H2UA 1CVUA 2YGQA 4MWWA 2VW2A 4C1YB 3K39A 4A7IA 5D9DA 3FCSB
chains in the Genus database with same CATH topology
3BT2A 3N8WB 1JL9A 1CQ1A 3IITB 3LTFB 3Q6TA 1LMMA 3S2KA 4X8UL 1URKA 2FZZL 1QBIA 4GN8A 3S8ZA 3POYA 3U0SA 3U73A 1IP0A 2XC4L 1G1TA 4HHOA 3QH0A 1PRHA 1CCFA 4BXWA 1C9UA 3TC9A 4D0EA 2W3KB 3CA7A 5L30L 2W26B 3KRKA 2MHPA 1C5KA 2Y7XB 2UWOB 3M36L 1E1AA 1IVOC 4ZAEB 2OYUP 4ZXXL 1U8CB 1L5GB 1MQ5L 1ADXA 2XBWL 1CCVA 3MDLA 2VVUL 4BTTA 1EPJA 3K9XA 4X8TL 3MQEA 3BPSE 2B7DL 1FF7A 1NQLB 5GTQA 2BOHA 1B9WA 2G8SA 4RUTA 2D1JB 4CSYA 3HS5A 1HJ7A 5CKMA 2F9BL 4RRZA 1WU1B 4X8VL 3V64C 1FAKL 4Z6AL 1XKBA 4JMLA 2IAXA 4LORA 3TK6B 3NTBA 2WPJE 3TGFA 1KLJL 3GCWE 2M74A 2IAVA 3TH3L 2XC0L 1DDXA 1OB1C 4PH9A 1TOZA 2WPKE 2V91A 5KN5C 1COUA 2BO2A 3F6UL 5D9BA 1FSBA 1LPZA 1FAXL 4GN7A 3HPTA 3G4HA 1P0SL 4Z0KB 4D90A 3DASA 5L2YL 2EI8B 4ZH8B 2XBVL 5JBBE 1Q4GA 2VH0B 1A3PA 2FPCA 4Y7AB 4IYGA 2PUQL 3PGHA 2FLGA 1KSNB 1IQIL 3CS7L 4GNCA 5JVZA 2P3FN 1YO8A 5GX2A 3V1SA 4CUFA 5KIRA 2P93L 1P9JA 2XBXL 4O02B 1K37A 1HREA 5CKNA 4Q1UA 2J2UB 3ASIA 1Z6EL 4COXA 1EPHA 4A94C 1BF9A 4GNAA 2K2SB 2GD4A 3N8VA 1UZJA 4LMFA 1PJXA 2RA0L 5CKQA 1NFWB 1EQHA 2DSOA 1PFXL 4XLWA 1U67A 5CISA 2P3UA 3GCXE 4MMXB 1F7MA 1N7DA 1WHFA 2H9EL 3LTGD 4M11A 1WHEA 3Q6PA 1Q7FA 4OTJA 4BTIA 1F0SB 1PGEA 4NGAL 4BDWA 3KK6A 3TK5B 4RRYA 3A9HA 3IAXA 2P3TA 1CRZA 3KQDL 3OLUA 3N8YA 3S94A 4NG9L 3Q3KB 1F0RB 1IQNL 3LC5B 4Y79B 1EQGA 5K0HB 1CVWL 3N8XA 2IAPA 1EBVA 2BOUA 1ATAA 2EI7B 4Y6DB 4FM5A 4E1GA 4JYVL 3N8ZA 1IGXA 1GK5A 1UZKA 3HRPA 1YUFA 1G2MB 2WG4B 3HLIA 2GVWA 3V65B 5GX3A 4MMYB 4ZLRA 1V04A 1CVMA 3GISX 3HO4A 2NPRA 1LMJA 4CUEA 3O4PA 2CJIB 4CUDA 3FW0A 2WFXB 3LAQA 4X8SL 2POOA 2YGOA 5IKRA 1MQ6L 2BQ7A 4Y7BB 1POOA 4HHQA 2GVVA 3S8VA 2VWNL 2K2TA 3P5BL 3RR3A 1UZPA 2MGRA 4GNBA 1YGCL 1PXXA 2J94B 4TGFA 2Y7ZB 4YT6L 1IQML 1HT5A 3FBYA 1YUGA 2MGPA 2BMGA 5COXA 3NT1A 1DQBA 1K36A 4BTUA 1HZ8A 4HW6A 1M1XB 3KQCL 2P28B 4MMZB 1FJSL 2UWLB 3QCWA 4RS0A 1IQLL 2Y38A 5GX5A 2IASA 2W3IB 2YGPA 1NPEB 5IKTA 4YZUB 2IAOA 1IQJL 1NT0A 1TLEA 1I0UA 3SOBB 3F1SB 1G1RA 2Y81B 3FFGL 4OTYA 3R05A 5D9CA 4A0PA 4JZEL 4ISIL 2IAQA 1EZQB 2IAUA 4BDXA 2FD6A 2Y80B 5EGMB 1KLOA 1APQA 4G1MB 3HO5A 3N8WA 2FLBL 1IGZA 1ATDA 1ZAQA 3QMOA 1HCGB 4ZHAB 1W8BL 1IOXA 1LPGA 5JB9E 3HS7A 2VAQA 1N1IA 2W2ME 3FVZA 1IQGL 1O5DL 3OLTA 2FPBA 2FLRL 2P95L 1HAFA 1F7EA 1NZIA 1ATEA 4O1ZA 2I9AA 3N8YB 1V3XB 2WPME 3DEMA 2J38B 2XBYL 3A9GA 4D0FA 2UWPB 2VH6B 2P94L 1X7AL 1Z6CA 1HX2A 4XBMA 1DIYA 4JZFL 2P4OA 1G1SA 1NPEA 5JW1A 3BT1A 1SZBA 2GVUA 2BQWA 3LN0A 3S6XA 1PTHA 3KL6B 2W86A 4DG6A 1G2LB 1C5MF 2Y5FL 4O5SA 2PHBB 3KQEL 3M37L 2EI6B 4Y71B 2WPHE 2RNLA 2HQSA 3IJEB 4RRXA 1IQKL 1J9CL 3C9AC 1NFYB 2FP8A 1DVAL 3HS6A 1KIGL 5JBCE 3U7UG 1EMOA 2QE8A 1NFXB 1HT8A 3TZIA 5IKQA 4O5TA 2AYLA 1KLIL 2IATA 5IKVA 3HLHA 3WWAA 1LPKA 3LN1A 3SREA 3ELAL 6COXA 4YT7L 1AUTL 2J95B 2W2QE 1CX2A 2WG3C 4Y76B 1JV2B 2VWLL 2W8BB 3HO3A 2FP9A 2DG1A 1EAIC 3SW2A 2WYGB 1RWIA 3WW9A 4XL1A 5L2ZL 2DG0A 1APOA 3ZYIB 3NJPC 2BZ6L 1EPGA 2WZPP 1IOEL 1IJQA 1XKAL 1ATBA 1HRFA 5EX7A 3G4EA 1NFUB 2KB9A 2VWMK 4R40A 1TPGA 3ZYJB 1EPIA 2GVXA 2JKHL 2IVZA 1IQFL 1QFKL 2W2NE 2TGFA 2KV4A 3Q6KA 5F19A 2P26A 3BYCA 2P3FL 4JYUL 2BOXA 3KYAA 1W7XL 1MOXC 2OJHA 3SOVA 2BOKL 5FWWA 2RHPA 5JB8E 3LC3B 2Q1JB 1EMNA 2PR3B 3SRGA 1IQHL 2WPIE 1IQEL 2G00L 2I9BA 2W2PE 2WFTA 3TBDA 4C16A 3CENL 1UZQA 5GX4A 3KGGA 1CRUA 3EGFA 3LIWB 5JBAE 3DR2A 2IAWA 2J4IB 3LI4A 2VJ3A 4PWZA 2OYEP 4NA9L 4ZXYL 4JZDL 1EGFA 2VVVL 2W2OE 3H5CB 1H6LA 1XDTR 4IMBA 2P16L 4M10A 1XFEA 3Q7DA 4RRWA 4BXSA 3LI5A 4GN9A 2KL7A 2BQ6A 4AQTA 3E5ZA 3ENSA 1CQEA 1G1QA 4Z0LA 1CEJA 2DDUA 3KCGL 2ADXA 5GX1A 5F1AA 2VVCK 5E8DA 2Y82B 3SOQA 1L3YA 2W8BA 3I1CA 3NTGA 2ISMA 2Y5HL 5JVYA 2KNIA 1DX5I 3KQBL 1FE2A 1HAEA 1YUKB 3LI3A 4ISHL 1FFMA 1RWLA 2GHSA 3ZYGA 2WPLE 3AMRA 1RFNB 2J34B 1QLGA 2Y5GL 3CFWA 2WYJB 5FDQA 2XC5L 1JBUL 1LQDA 2IARA 5I46L 2VWOL 2H9EC 3AMSA 1CVUA 2YGQA 4A7IA 5D9DA 3FCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BT2 A;  3N8W B;  1JL9 A;  1CQ1 A;  3IIT B;  3LTF B;  3Q6T A;  3S2K A;  4X8U L;  1URK A;  2FZZ L;  1QBI A;  4GN8 A;  3S8Z A;  3POY A;  3U0S A;  3U73 A;  1IP0 A;  2XC4 L;  1G1T A;  4HHO A;  3QH0 A;  1PRH A;  1CCF A;  4BXW A;  1C9U A;  3TC9 A;  4D0E A;  2W3K B;  3CA7 A;  5L30 L;  2W26 B;  3KRK A;  2MHP A;  1C5K A;  2Y7X B;  2UWO B;  3M36 L;  1E1A A;  1IVO C;  4ZAE B;  2OYU P;  4ZXX L;  1U8C B;  1L5G B;  1MQ5 L;  1ADX A;  2XBW L;  1CCV A;  3MDL A;  2VVU L;  4BTT A;  1EPJ A;  3K9X A;  4X8T L;  3MQE A;  3BPS E;  2B7D L;  1FF7 A;  1NQL B;  5GTQ A;  2BOH A;  1B9W A;  2G8S A;  4RUT A;  2D1J B;  4CSY A;  3HS5 A;  1HJ7 A;  5CKM A;  2F9B L;  4RRZ A;  1WU1 B;  4X8V L;  3V64 C;  1FAK L;  4Z6A L;  1XKB A;  4JML A;  2IAX A;  4LOR A;  3TK6 B;  3NTB A;  2WPJ E;  3TGF A;  1KLJ L;  3GCW E;  2M74 A;  2IAV A;  3TH3 L;  2XC0 L;  1DDX A;  1OB1 C;  4PH9 A;  1TOZ A;  2WPK E;  2V91 A;  5KN5 C;  1COU A;  2BO2 A;  3F6U L;  5D9B A;  1FSB A;  1LPZ A;  1FAX L;  4GN7 A;  3HPT A;  3G4H A;  1P0S L;  4Z0K B;  4D90 A;  3DAS A;  5L2Y L;  2EI8 B;  4ZH8 B;  2XBV L;  5JBB E;  1Q4G A;  2VH0 B;  1A3P A;  2FPC A;  4Y7A B;  4IYG A;  2PUQ L;  3PGH A;  2FLG A;  1KSN B;  1IQI L;  3CS7 L;  4GNC A;  5JVZ A;  2P3F N;  1YO8 A;  5GX2 A;  3V1S A;  4CUF A;  5KIR A;  2P93 L;  1P9J A;  2XBX L;  4O02 B;  1K37 A;  1HRE A;  5CKN A;  4Q1U A;  2J2U B;  3ASI A;  1Z6E L;  4COX A;  1EPH A;  1BF9 A;  4GNA A;  2K2S B;  2GD4 A;  3N8V A;  1UZJ A;  4LMF A;  1PJX A;  2RA0 L;  5CKQ A;  1NFW B;  1EQH A;  2DSO A;  1PFX L;  4XLW A;  1U67 A;  5CIS A;  2P3U A;  3GCX E;  4MMX B;  1F7M A;  1N7D A;  1WHF A;  2H9E L;  3LTG D;  4M11 A;  1WHE A;  3Q6P A;  1Q7F A;  4OTJ A;  4BTI A;  1F0S B;  1PGE A;  4NGA L;  4BDW A;  3KK6 A;  3TK5 B;  4RRY A;  3A9H A;  3IAX A;  2P3T A;  1CRZ A;  3KQD L;  3OLU A;  3N8Y A;  3S94 A;  4NG9 L;  3Q3K B;  1F0R B;  1IQN L;  3LC5 B;  4Y79 B;  1EQG A;  5K0H B;  1CVW L;  3N8X A;  2IAP A;  1EBV A;  2BOU A;  1ATA A;  2EI7 B;  4Y6D B;  4FM5 A;  4E1G A;  4JYV L;  3N8Z A;  1IGX A;  1GK5 A;  1UZK A;  3HRP A;  1YUF A;  1G2M B;  2WG4 B;  3HLI A;  2GVW A;  3V65 B;  5GX3 A;  4MMY B;  4ZLR A;  1V04 A;  1CVM A;  3GIS X;  3HO4 A;  2NPR A;  1LMJ A;  4CUE A;  3O4P A;  2CJI B;  4CUD A;  3FW0 A;  2WFX B;  3LAQ A;  4X8S L;  2POO A;  2YGO A;  5IKR A;  1MQ6 L;  2BQ7 A;  4Y7B B;  1POO A;  4HHQ A;  2GVV A;  3S8V A;  2VWN L;  2K2T A;  3P5B L;  3RR3 A;  1UZP A;  2MGR A;  4GNB A;  1YGC L;  1PXX A;  2J94 B;  4TGF A;  2Y7Z B;  4YT6 L;  1IQM L;  1HT5 A;  3FBY A;  1YUG A;  2MGP A;  2BMG A;  5COX A;  3NT1 A;  1DQB A;  1K36 A;  4BTU A;  1HZ8 A;  4HW6 A;  1M1X B;  3KQC L;  2P28 B;  4MMZ B;  1FJS L;  2UWL B;  3QCW A;  4RS0 A;  1IQL L;  2Y38 A;  5GX5 A;  2IAS A;  2W3I B;  2YGP A;  1NPE B;  5IKT A;  4YZU B;  2IAO A;  1IQJ L;  1NT0 A;  1TLE A;  1I0U A;  3SOB B;  3F1S B;  1G1R A;  2Y81 B;  3FFG L;  4OTY A;  3R05 A;  5D9C A;  4A0P A;  4JZE L;  4ISI L;  2IAQ A;  1EZQ B;  2IAU A;  4BDX A;  2FD6 A;  2Y80 B;  5EGM B;  1KLO A;  1APQ A;  4G1M B;  3HO5 A;  3N8W A;  2FLB L;  1IGZ A;  1ATD A;  1ZAQ A;  3QMO A;  1HCG B;  4ZHA B;  1W8B L;  1IOX A;  1LPG A;  5JB9 E;  3HS7 A;  2VAQ A;  1N1I A;  2W2M E;  3FVZ A;  1IQG L;  1O5D L;  3OLT A;  2FPB A;  2FLR L;  2P95 L;  1HAF A;  1F7E A;  1NZI A;  1ATE A;  4O1Z A;  2I9A A;  3N8Y B;  1V3X B;  2WPM E;  3DEM A;  2J38 B;  2XBY L;  3A9G A;  4D0F A;  2UWP B;  2VH6 B;  2P94 L;  1X7A L;  1Z6C A;  1HX2 A;  4XBM A;  1DIY A;  4JZF L;  2P4O A;  1G1S A;  1NPE A;  5JW1 A;  3BT1 A;  1SZB A;  2GVU A;  2BQW A;  3LN0 A;  1PTH A;  3KL6 B;  2W86 A;  4DG6 A;  1G2L B;  1C5M F;  2Y5F L;  4O5S A;  2PHB B;  3KQE L;  3M37 L;  2EI6 B;  4Y71 B;  2WPH E;  2RNL A;  2HQS A;  3IJE B;  4RRX A;  1IQK L;  1J9C L;  3C9A C;  1NFY B;  2FP8 A;  1DVA L;  3HS6 A;  1KIG L;  5JBC E;  3U7U G;  1EMO A;  2QE8 A;  1NFX B;  1HT8 A;  3TZI A;  5IKQ A;  4O5T A;  2AYL A;  1KLI L;  2IAT A;  5IKV A;  3HLH A;  3WWA A;  1LPK A;  3LN1 A;  3SRE A;  3ELA L;  6COX A;  4YT7 L;  1AUT L;  2J95 B;  2W2Q E;  1CX2 A;  2WG3 C;  4Y76 B;  1JV2 B;  2VWL L;  2W8B B;  3HO3 A;  2FP9 A;  2DG1 A;  1EAI C;  3SW2 A;  2WYG B;  1RWI A;  3WW9 A;  4XL1 A;  5L2Z L;  2DG0 A;  1APO A;  3ZYI B;  3NJP C;  2BZ6 L;  1EPG A;  1IOE L;  1IJQ A;  1XKA L;  1ATB A;  1HRF A;  5EX7 A;  3G4E A;  1NFU B;  2KB9 A;  2VWM K;  4R40 A;  1TPG A;  3ZYJ B;  1EPI A;  2GVX A;  2JKH L;  2IVZ A;  1IQF L;  1QFK L;  2W2N E;  2TGF A;  2KV4 A;  3Q6K A;  5F19 A;  2P26 A;  3BYC A;  2P3F L;  4JYU L;  2BOX A;  3KYA A;  1W7X L;  1MOX C;  2OJH A;  3SOV A;  2BOK L;  5FWW A;  2RHP A;  5JB8 E;  3LC3 B;  2Q1J B;  1EMN A;  2PR3 B;  3SRG A;  1IQH L;  2WPI E;  1IQE L;  2G00 L;  2I9B A;  2W2P E;  2WFT A;  3TBD A;  4C16 A;  3CEN L;  1UZQ A;  5GX4 A;  3KGG A;  1CRU A;  3EGF A;  3LIW B;  5JBA E;  3DR2 A;  2IAW A;  2J4I B;  3LI4 A;  2VJ3 A;  4PWZ A;  2OYE P;  4NA9 L;  4ZXY L;  4JZD L;  1EGF A;  2VVV L;  2W2O E;  3H5C B;  1H6L A;  1XDT R;  4IMB A;  2P16 L;  4M10 A;  1XFE A;  3Q7D A;  4RRW A;  4BXS A;  3LI5 A;  4GN9 A;  2KL7 A;  2BQ6 A;  4AQT A;  3E5Z A;  3ENS A;  1CQE A;  1G1Q A;  4Z0L A;  1CEJ A;  2DDU A;  3KCG L;  2ADX A;  5GX1 A;  5F1A A;  2VVC K;  5E8D A;  2Y82 B;  3SOQ A;  1L3Y A;  2W8B A;  3I1C A;  3NTG A;  2ISM A;  2Y5H L;  5JVY A;  1DX5 I;  3KQB L;  1FE2 A;  1HAE A;  1YUK B;  3LI3 A;  4ISH L;  1FFM A;  1RWL A;  2GHS A;  3ZYG A;  2WPL E;  3AMR A;  1RFN B;  2J34 B;  1QLG A;  2Y5G L;  3CFW A;  2WYJ B;  5FDQ A;  1JBU L;  1LQD A;  2XC5 L;  2IAR A;  5I46 L;  2VWO L;  3AMS A;  1CVU A;  4A7I A;  5D9D A;  3FCS B; 
#chains in the Genus database with same CATH topology
 4FP2 A;  2HU4 A;  3BT2 A;  3N8W B;  1JL9 A;  1CQ1 A;  1IVB A;  3IIT B;  2X9M A;  3LTF B;  1DIM A;  1SUU A;  1INX A;  5NN9 A;  3Q6T A;  1LMM A;  3S2K A;  2QWH A;  1E8U A;  4X8U L;  1URK A;  2FZZ L;  1QBI A;  4GN8 A;  3S8Z A;  4GZQ A;  4XJZ A;  3POY A;  2H2N A;  3U0S A;  1V1I A;  3U73 A;  4N1B A;  4D52 C;  1IP0 A;  5FWW A;  2F11 A;  2XC4 L;  4XJR A;  1G1T A;  4HHO A;  4CH9 A;  5HUN A;  3H72 A;  3QH0 A;  1PRH A;  1CCF A;  4FJ6 A;  4BXW A;  1XOG A;  1C9U A;  3TC9 A;  4D0E A;  4MZE A;  2W3K B;  3CA7 A;  5L30 L;  2W26 B;  3KRK A;  2MHP A;  1C5K A;  5EO8 A;  2Y7X B;  2UWO B;  3M36 L;  1E1A A;  4FOW A;  2ZB5 A;  4GJT A;  1IVO C;  4ZAE B;  2OYU P;  4ZXX L;  2F29 A;  1A4Q A;  4D4U A;  1U8C B;  1L5G B;  4MJU A;  1MQ5 L;  1K32 A;  1INW A;  4XJW A;  1ADX A;  2QWK A;  1VCJ A;  2ZWA A;  2XBW L;  1CCV A;  3MDL A;  4WA5 A;  1IVE A;  2VVU L;  2YA4 A;  4MWJ A;  1N6F A;  4SLI A;  5B2D A;  1NN2 A;  4BTT A;  1B9S A;  1EPJ A;  3K9X A;  3H71 A;  4X8T L;  4CPM A;  3MQE A;  2XN4 A;  3BPS E;  4K1H A;  2B7D L;  1FF7 A;  1N6D A;  1NQL B;  1WCS A;  1EUS A;  4XMB A;  5FNU A;  5GTQ A;  2BOH A;  1F8B A;  1B9W A;  2G8S A;  4M3M A;  1U6D X;  3TIA A;  4QN7 A;  2HTU A;  4RUT A;  4G3N A;  4GB1 A;  2D1J B;  4CSY A;  3HS5 A;  3ZGC A;  3ALW A;  4MWR A;  2QWG A;  1HJ7 A;  2XCY A;  2XZJ A;  5CKM A;  2F9B L;  1INY A;  4RRZ A;  4GU4 A;  4M4V A;  4B7Q A;  1WU1 B;  4X8V L;  3V64 C;  1X2J A;  1NCB N;  4D8S A;  1FAK L;  4Z6A L;  1NNB A;  1XKB A;  4XOG A;  3SLI A;  4FPJ A;  4JML A;  4MWQ A;  2IAX A;  1SNT A;  4LOR A;  3H6J A;  3TK6 B;  1INV A;  3NTB A;  2WPJ E;  3TGF A;  4ZGC A;  1KLJ L;  1B9V A;  3GCW E;  2M74 A;  1W8O A;  2IAV A;  2VRS A;  3TH3 L;  2XC0 L;  1DDX A;  1OB1 C;  4PH9 A;  1W0P A;  3CKZ A;  3VNG A;  1TOZ A;  2WPK E;  2V91 A;  4MWL A;  5CGJ A;  2C4L A;  5KN5 C;  1COU A;  1A4G A;  2BO2 A;  3F6U L;  2VSM A;  1MR5 A;  5D9B A;  1FSB A;  1LPZ A;  4QN5 A;  4XJ9 A;  1FAX L;  4HZV A;  4GN7 A;  1V2I A;  1F8D A;  4GEZ A;  3HPT A;  4CPN A;  1V0F A;  3G4H A;  1P0S L;  4Z0K B;  3SAL A;  4D90 A;  2QWC A;  3DAS A;  4DGR A;  5L2Y L;  3TIB A;  2EI8 B;  4YY8 A;  2W38 A;  4ZH8 B;  4WEF A;  2XBV L;  5HUK A;  5JBB E;  1Q4G A;  2VH0 B;  1A3P A;  2FPC A;  4Y7A B;  4KS4 A;  4IYG A;  4KS1 A;  4FOY A;  2AGS A;  2PUQ L;  3PGH A;  3TIC A;  2FLG A;  1KSN B;  5B2C A;  1IQI L;  2YA8 A;  3CS7 L;  4L7C A;  4GNC A;  5JVZ A;  2P3F N;  1YO8 A;  5GX2 A;  3V1S A;  4CUF A;  5KIR A;  2P93 L;  1P9J A;  2XBX L;  1VCU A;  4FQ4 A;  4CPY A;  1V1H A;  3CL0 A;  6NN9 A;  4GZS A;  3H73 A;  4O02 B;  1K37 A;  1HRE A;  3II7 A;  5CKN A;  3A71 A;  4Q1U A;  2J2U B;  3ASI A;  1Z6E L;  4COX A;  1EPH A;  4A94 C;  1BF9 A;  4GNA A;  4CPO A;  2HOR A;  2K2S B;  2GD4 A;  3N8V A;  1UZJ A;  4LMF A;  1EUT A;  1PJX A;  4B7J A;  2SIM A;  2RA0 L;  1V0E A;  1Z50 A;  4GU3 A;  4I00 A;  4KS5 A;  2F28 A;  5CKQ A;  1NFW B;  1L7H A;  1EQH A;  2VWD A;  1Z4W A;  4WEG A;  2DSO A;  1PFX L;  4XLW A;  2VVZ A;  2ZZK A;  1U67 A;  5CIS A;  2P3U A;  3GCX E;  2ZW9 A;  1F7M A;  1N7D A;  4MMX B;  1MS9 A;  1WHF A;  2SIL A;  3CL2 A;  4CSD A;  2H9E L;  3LTG D;  4M11 A;  1KIT A;  1NCD N;  2W5O A;  1WHE A;  4M4N A;  2VW0 A;  3Q6P A;  1Q7F A;  4OTJ A;  4BTI A;  5HUM A;  1F0S B;  1PGE A;  1A14 N;  4NGA L;  1W0O A;  4BDW A;  3VNH A;  3KK6 A;  3TK5 B;  4JF7 A;  4RRY A;  1N1Y A;  3A9H A;  3IAX A;  2P3T A;  4MWX A;  1CRZ A;  3A72 A;  2ZB6 A;  1S0I A;  1Z4Z A;  3KQD L;  3OLU A;  3N8Y A;  3S94 A;  4NG9 L;  3Q3K B;  1F0R B;  1IQN L;  3LC5 B;  4Y79 B;  1EQG A;  5K0H B;  1SO7 A;  1CVW L;  3N8X A;  4L7B A;  2IAP A;  1EBV A;  2BOU A;  1ATA A;  2EI7 B;  4Y6D B;  4FPO B;  3TI8 A;  4FM5 A;  4YW1 A;  4MJV A;  2AEQ A;  5FZJ A;  4E1G A;  4MWV A;  4JYV L;  3N8Z A;  1IGX A;  1GK5 A;  4M4U A;  4YZ2 A;  2HTY A;  1UZK A;  3HRP A;  4NN9 A;  1YUF A;  2QWE A;  1X2R A;  4HZZ A;  1G2M B;  1MS8 A;  2WG4 B;  3TI6 A;  3HLI A;  2BT7 A;  3V65 B;  2GVW A;  4X47 A;  4XYX A;  5GX3 A;  2HTW A;  2VSK A;  4MMY B;  4HZY A;  1V04 A;  4ZLR A;  1CVM A;  3D11 A;  3GIS X;  3HO4 A;  2NPR A;  1V3E A;  1LMJ A;  4CUE A;  1EUU A;  3O4P A;  4XHX A;  4AHA A;  2CJI B;  2HOX A;  3TI5 A;  4CUD A;  2FHR A;  3FW0 A;  2WFX B;  2HT8 A;  3NN9 A;  3LAQ A;  4D52 A;  4X8S L;  4FZH A;  3B69 A;  2POO A;  2YGO A;  5IKR A;  1MQ6 L;  2BQ7 A;  4Y7B B;  1POO A;  2YDT A;  4HHQ A;  1NNA A;  2GVV A;  3S8V A;  2VWN L;  2K2T A;  1N1S A;  3P5B L;  3K37 A;  4XJU A;  3RR3 A;  3B7E A;  1UZP A;  2MGR A;  4GNB A;  1YGC L;  1PXX A;  2J94 B;  4HZX A;  4NC5 A;  4TGF A;  2Y7Z B;  4YT6 L;  4FPY A;  4HZW A;  4X4A A;  1MZ6 A;  1IQM L;  4FP3 A;  4NCS A;  1HT5 A;  3FBY A;  1YUG A;  2MGP A;  2BMG A;  2B8H A;  5COX A;  3NT1 A;  1DQB A;  1IVC A;  1K36 A;  4X49 A;  4BTU A;  1HZ8 A;  4H53 A;  1M1X B;  3KQC L;  4HW6 A;  4QNP A;  2P28 B;  4MMZ B;  1V0Z A;  1FJS L;  4KS2 A;  2UWL B;  3QCW A;  4RS0 A;  4XIO A;  3NO0 A;  2BZD A;  3JU4 A;  1IQL L;  2Y38 A;  5GX5 A;  1MS4 A;  2IAS A;  3INB A;  2W3I B;  3L6V A;  3WDZ A;  2YGP A;  2F25 A;  1NPE B;  5IKT A;  1OFZ A;  3CYE A;  4YZU B;  1WP5 A;  2IAO A;  2QWJ A;  1NMB N;  4GZT A;  1IQJ L;  4QN3 A;  3D12 A;  2XZI A;  1NT0 A;  4CPZ A;  1TLE A;  1MS1 A;  1I0U A;  3SOB B;  3F1S B;  3O9J A;  3OPZ A;  1DIL A;  5FNR A;  1G1R A;  2Y81 B;  3FFG L;  4OTY A;  3R05 A;  1L7F A;  1XOE A;  4JZE L;  4ISI L;  4XMI A;  2XZK A;  4YZ3 A;  5D9C A;  1NSD A;  2IAQ A;  4C1Y A;  1ING A;  1EZQ B;  2IAU A;  4BDX A;  2FD6 A;  2Y80 B;  5EGM B;  4J9T A;  1KLO A;  3GVJ A;  1APQ A;  4B7R A;  4G1M B;  3HO5 A;  3N8W A;  2FLB L;  1IGZ A;  1ZI0 A;  3K3A A;  1ATD A;  4FPF A;  1ZAQ A;  3QMO A;  1NCC N;  4FPG A;  1HCG B;  4ZHA B;  1IVF A;  1W8B L;  2VK7 A;  2W5N A;  2SLI A;  5FZN A;  1E8V A;  1IOX A;  1N6E A;  1ZGK A;  3NSS A;  4XIL A;  4YZ5 A;  1LPG A;  5JB9 E;  1IUB A;  2QWF A;  4IQK A;  3HS7 A;  2VAQ A;  1N1I A;  2W2M E;  3FVZ A;  1IQG L;  4FVK A;  1O5D L;  3OLT A;  4ASC A;  2FPB A;  2FLR L;  2HT7 A;  1S0J A;  2P95 L;  2A75 A;  1HAF A;  2YDP A;  2QWB A;  1F7E A;  1NZI A;  1ATE A;  4O1Z A;  2I9A A;  3N8Y B;  1V3X B;  1MS0 A;  2WPM E;  3DEM A;  2J38 B;  2VK6 A;  2XBY L;  3A9G A;  4D0F A;  4FPE A;  2UWP B;  2VH6 B;  4XJA A;  1KKE A;  2P94 L;  1IVG A;  1X7A L;  1Z6C A;  1HX2 A;  4XBM A;  1DIY A;  4JZF L;  1SLI A;  2AH2 A;  1G1S A;  1NPE A;  5JW1 A;  2HTV A;  2P4O A;  3BT1 A;  4AGT A;  1SZB A;  2GVU A;  4XMA A;  2C4A A;  2BQW A;  3LN0 A;  3S6X A;  2JJL A;  3T1E A;  4K3Y A;  1PTH A;  3W09 A;  3KL6 B;  1Z4Y A;  2W86 A;  3BEQ A;  4Q6K A;  4DG6 A;  1G2L B;  1C5M F;  2Y5F L;  2W20 A;  4O5S A;  1LK9 A;  2PHB B;  3KQE L;  4YZ4 A;  3M37 L;  4CHB A;  2WOZ A;  4UF7 A;  2EI6 B;  4Y71 B;  2DYH A;  2F0Z A;  4HIZ A;  5JYY A;  2WPH E;  1NCA N;  1NNC A;  2RNL A;  2HQS A;  4IFN X;  1EUR A;  3IJE B;  4XE9 A;  4QN6 A;  3K36 A;  4RRX A;  5F72 C;  1IQK L;  1J9C L;  3C9A C;  3UC1 A;  1NFY B;  2FP8 A;  1DVA L;  5H47 A;  3HS6 A;  1KIG L;  5JBC E;  3U7U G;  1EMO A;  1IVD A;  2F27 A;  2F10 A;  2QE8 A;  1NFX B;  4UOU A;  4CPL A;  1HT8 A;  3SIL A;  3TZI A;  5IKQ A;  2YA5 A;  4O5T A;  2AYL A;  1KLI L;  2IAT A;  5IKV A;  3HLH A;  3WWA A;  1LPK A;  3LN1 A;  3SRE A;  3ELA L;  6COX A;  4MX0 A;  2VK5 A;  4YT7 L;  1AUT L;  2J95 B;  3ZGD A;  4FOQ A;  2QWI A;  2W2Q E;  2BER A;  2RKC A;  1CX2 A;  4MZA A;  2WG3 C;  1MS3 A;  1BJI A;  4Y76 B;  1JV2 B;  2VWL L;  5FNT A;  3TI3 A;  1W20 A;  4ZY3 A;  4A0P A;  1N1V A;  2W8B B;  3HO3 A;  4H52 A;  2FP9 A;  4MWY A;  2DG1 A;  5F9T A;  1EAI C;  3SW2 A;  2WYG B;  5EO7 A;  1RWI A;  3WW9 A;  4XL1 A;  2F24 A;  3WN7 A;  5L2Z L;  2Z32 A;  2DG0 A;  2HT5 A;  1APO A;  3ZYI B;  3NJP C;  2BZ6 L;  5HUG A;  1EPG A;  2WZP P;  1MZ5 A;  1IOE L;  1IJQ A;  1XKA L;  1ATB A;  2BAT A;  4K1K A;  3SAN A;  1HRF A;  5EX7 A;  2JKB A;  2HTQ A;  2QWD A;  2HU0 A;  3G4E A;  1NFU B;  2KB9 A;  4MWU A;  4XHB A;  2VWM K;  4R40 A;  4YW2 A;  1TPG A;  3ZYJ B;  4L7D A;  1EPI A;  1W21 A;  2GVX A;  5HX0 A;  2JKH L;  2IVZ A;  1IQF L;  1MS5 A;  1QFK L;  2W2N E;  1INH A;  2TGF A;  4X6K A;  1INF A;  2KV4 A;  2YA6 A;  4D52 B;  3Q6K A;  4WA4 A;  2BF6 A;  2FLU X;  5F19 A;  2P26 A;  1V3D A;  3BYC A;  2P3F L;  4JYU L;  4FPC A;  2BOX A;  3TI4 A;  5M1Z A;  1L7G A;  3KYA A;  1N1T A;  1W7X L;  4IFJ A;  1MOX C;  2OJH A;  4FPL A;  3SOV A;  2BOK L;  2F13 A;  2RHP A;  5JB8 E;  1NMA N;  2VPJ A;  4GZX A;  2F26 A;  3LC3 B;  2Q1J B;  1EMN A;  1MWE A;  2PR3 B;  1F8C A;  4FOV A;  1V3C A;  4QN4 A;  3SRG A;  2VW1 A;  1IQH L;  2WPI E;  7NN9 A;  1IQE L;  2G00 L;  2I9B A;  2W2P E;  4GDJ A;  1QIU A;  2WFT A;  3TBD A;  4YW4 A;  2F12 A;  4GZW A;  1Z4V A;  4C16 A;  3CEN L;  1UZQ A;  5GX4 A;  2AEP A;  3KGG A;  1CRU A;  3EGF A;  1USX A;  3LIW B;  5JBA E;  3DR2 A;  2IAW A;  4IFL X;  2J4I B;  1Z4X A;  2VJ3 A;  3LI4 A;  3ALX A;  2OYE P;  4PWZ A;  1F8E A;  4NA9 L;  4ZXY L;  4JZD L;  1EGF A;  4BBW A;  1B9T A;  2VVV L;  2W2O E;  3H5C B;  1H6L A;  1XDT R;  4IMB A;  4KS3 A;  2P16 L;  4M10 A;  1USR A;  3O9K A;  4WA3 A;  4B7M A;  1V3B A;  1XFE A;  3Q7D A;  4FPK A;  4RRW A;  3K38 A;  2BSF A;  4BXS A;  4YW3 A;  3LI5 A;  1IUC A;  2CML A;  4FPH A;  2KL7 A;  4GN9 A;  4K1I A;  2BQ6 A;  4AQT A;  3E5Z A;  3ENS A;  1CQE A;  1G1Q A;  2HTR A;  4B7N A;  4Z0L A;  1E8T A;  1NMC A;  4MC7 A;  4XJQ A;  4XIK A;  4GZO A;  1CEJ A;  4YW5 A;  2DDU A;  3KCG L;  4IN4 A;  2ADX A;  5GX1 A;  1WCQ A;  5F1A A;  2VVC K;  5E8D A;  2Y82 B;  3SOQ A;  1L3Y A;  2W8B A;  3I1C A;  1W8N A;  4GDI A;  3PJQ A;  3NTG A;  5FNQ A;  1S1D A;  2ISM A;  4K1J A;  5FNS A;  2Y5H L;  4AGI A;  5JVY A;  2BT8 A;  2KNI A;  1W1X A;  1DX5 I;  3KQB L;  1FE2 A;  1HAE A;  1YUK B;  2YA7 A;  3GVK A;  3LI3 A;  4ISH L;  1NSB A;  1FFM A;  1RWL A;  4AH4 A;  2GHS A;  4YZ1 A;  1SLL A;  3ZYG A;  2WPL E;  1S18 A;  3AMR A;  3GVL A;  1RFN B;  2J34 B;  4XJ8 A;  1QLG A;  2Y5G L;  2QWA A;  4GZP A;  3CFW A;  2WYJ B;  5FDQ A;  2XC5 L;  1JBU L;  1LQD A;  2IAR A;  3ADE A;  5I46 L;  2VWO L;  2H9E C;  3AMS A;  1NSC A;  2H2U A;  1CVU A;  2YGQ A;  4MWW A;  2VW2 A;  4C1Y B;  3K39 A;  4A7I A;  5D9D A;  3FCS B; 
#chains in the Genus database with same CATH homology
 3BT2 A;  3N8W B;  1JL9 A;  1CQ1 A;  3IIT B;  3LTF B;  3Q6T A;  1LMM A;  3S2K A;  4X8U L;  1URK A;  2FZZ L;  1QBI A;  4GN8 A;  3S8Z A;  3POY A;  3U0S A;  3U73 A;  1IP0 A;  2XC4 L;  1G1T A;  4HHO A;  3QH0 A;  1PRH A;  1CCF A;  4BXW A;  1C9U A;  3TC9 A;  4D0E A;  2W3K B;  3CA7 A;  5L30 L;  2W26 B;  3KRK A;  2MHP A;  1C5K A;  2Y7X B;  2UWO B;  3M36 L;  1E1A A;  1IVO C;  4ZAE B;  2OYU P;  4ZXX L;  1U8C B;  1L5G B;  1MQ5 L;  1ADX A;  2XBW L;  1CCV A;  3MDL A;  2VVU L;  4BTT A;  1EPJ A;  3K9X A;  4X8T L;  3MQE A;  3BPS E;  2B7D L;  1FF7 A;  1NQL B;  5GTQ A;  2BOH A;  1B9W A;  2G8S A;  4RUT A;  2D1J B;  4CSY A;  3HS5 A;  1HJ7 A;  5CKM A;  2F9B L;  4RRZ A;  1WU1 B;  4X8V L;  3V64 C;  1FAK L;  4Z6A L;  1XKB A;  4JML A;  2IAX A;  4LOR A;  3TK6 B;  3NTB A;  2WPJ E;  3TGF A;  1KLJ L;  3GCW E;  2M74 A;  2IAV A;  3TH3 L;  2XC0 L;  1DDX A;  1OB1 C;  4PH9 A;  1TOZ A;  2WPK E;  2V91 A;  5KN5 C;  1COU A;  2BO2 A;  3F6U L;  5D9B A;  1FSB A;  1LPZ A;  1FAX L;  4GN7 A;  3HPT A;  3G4H A;  1P0S L;  4Z0K B;  4D90 A;  3DAS A;  5L2Y L;  2EI8 B;  4ZH8 B;  2XBV L;  5JBB E;  1Q4G A;  2VH0 B;  1A3P A;  2FPC A;  4Y7A B;  4IYG A;  2PUQ L;  3PGH A;  2FLG A;  1KSN B;  1IQI L;  3CS7 L;  4GNC A;  5JVZ A;  2P3F N;  1YO8 A;  5GX2 A;  3V1S A;  4CUF A;  5KIR A;  2P93 L;  1P9J A;  2XBX L;  4O02 B;  1K37 A;  1HRE A;  5CKN A;  4Q1U A;  2J2U B;  3ASI A;  1Z6E L;  4COX A;  1EPH A;  4A94 C;  1BF9 A;  4GNA A;  2K2S B;  2GD4 A;  3N8V A;  1UZJ A;  4LMF A;  1PJX A;  2RA0 L;  5CKQ A;  1NFW B;  1EQH A;  2DSO A;  1PFX L;  4XLW A;  1U67 A;  5CIS A;  2P3U A;  3GCX E;  4MMX B;  1F7M A;  1N7D A;  1WHF A;  2H9E L;  3LTG D;  4M11 A;  1WHE A;  3Q6P A;  1Q7F A;  4OTJ A;  4BTI A;  1F0S B;  1PGE A;  4NGA L;  4BDW A;  3KK6 A;  3TK5 B;  4RRY A;  3A9H A;  3IAX A;  2P3T A;  1CRZ A;  3KQD L;  3OLU A;  3N8Y A;  3S94 A;  4NG9 L;  3Q3K B;  1F0R B;  1IQN L;  3LC5 B;  4Y79 B;  1EQG A;  5K0H B;  1CVW L;  3N8X A;  2IAP A;  1EBV A;  2BOU A;  1ATA A;  2EI7 B;  4Y6D B;  4FM5 A;  4E1G A;  4JYV L;  3N8Z A;  1IGX A;  1GK5 A;  1UZK A;  3HRP A;  1YUF A;  1G2M B;  2WG4 B;  3HLI A;  2GVW A;  3V65 B;  5GX3 A;  4MMY B;  4ZLR A;  1V04 A;  1CVM A;  3GIS X;  3HO4 A;  2NPR A;  1LMJ A;  4CUE A;  3O4P A;  2CJI B;  4CUD A;  3FW0 A;  2WFX B;  3LAQ A;  4X8S L;  2POO A;  2YGO A;  5IKR A;  1MQ6 L;  2BQ7 A;  4Y7B B;  1POO A;  4HHQ A;  2GVV A;  3S8V A;  2VWN L;  2K2T A;  3P5B L;  3RR3 A;  1UZP A;  2MGR A;  4GNB A;  1YGC L;  1PXX A;  2J94 B;  4TGF A;  2Y7Z B;  4YT6 L;  1IQM L;  1HT5 A;  3FBY A;  1YUG A;  2MGP A;  2BMG A;  5COX A;  3NT1 A;  1DQB A;  1K36 A;  4BTU A;  1HZ8 A;  4HW6 A;  1M1X B;  3KQC L;  2P28 B;  4MMZ B;  1FJS L;  2UWL B;  3QCW A;  4RS0 A;  1IQL L;  2Y38 A;  5GX5 A;  2IAS A;  2W3I B;  2YGP A;  1NPE B;  5IKT A;  4YZU B;  2IAO A;  1IQJ L;  1NT0 A;  1TLE A;  1I0U A;  3SOB B;  3F1S B;  1G1R A;  2Y81 B;  3FFG L;  4OTY A;  3R05 A;  5D9C A;  4A0P A;  4JZE L;  4ISI L;  2IAQ A;  1EZQ B;  2IAU A;  4BDX A;  2FD6 A;  2Y80 B;  5EGM B;  1KLO A;  1APQ A;  4G1M B;  3HO5 A;  3N8W A;  2FLB L;  1IGZ A;  1ATD A;  1ZAQ A;  3QMO A;  1HCG B;  4ZHA B;  1W8B L;  1IOX A;  1LPG A;  5JB9 E;  3HS7 A;  2VAQ A;  1N1I A;  2W2M E;  3FVZ A;  1IQG L;  1O5D L;  3OLT A;  2FPB A;  2FLR L;  2P95 L;  1HAF A;  1F7E A;  1NZI A;  1ATE A;  4O1Z A;  2I9A A;  3N8Y B;  1V3X B;  2WPM E;  3DEM A;  2J38 B;  2XBY L;  3A9G A;  4D0F A;  2UWP B;  2VH6 B;  2P94 L;  1X7A L;  1Z6C A;  1HX2 A;  4XBM A;  1DIY A;  4JZF L;  2P4O A;  1G1S A;  1NPE A;  5JW1 A;  3BT1 A;  1SZB A;  2GVU A;  2BQW A;  3LN0 A;  3S6X A;  1PTH A;  3KL6 B;  2W86 A;  4DG6 A;  1G2L B;  1C5M F;  2Y5F L;  4O5S A;  2PHB B;  3KQE L;  3M37 L;  2EI6 B;  4Y71 B;  2WPH E;  2RNL A;  2HQS A;  3IJE B;  4RRX A;  1IQK L;  1J9C L;  3C9A C;  1NFY B;  2FP8 A;  1DVA L;  3HS6 A;  1KIG L;  5JBC E;  3U7U G;  1EMO A;  2QE8 A;  1NFX B;  1HT8 A;  3TZI A;  5IKQ A;  4O5T A;  2AYL A;  1KLI L;  2IAT A;  5IKV A;  3HLH A;  3WWA A;  1LPK A;  3LN1 A;  3SRE A;  3ELA L;  6COX A;  4YT7 L;  1AUT L;  2J95 B;  2W2Q E;  1CX2 A;  2WG3 C;  4Y76 B;  1JV2 B;  2VWL L;  2W8B B;  3HO3 A;  2FP9 A;  2DG1 A;  1EAI C;  3SW2 A;  2WYG B;  1RWI A;  3WW9 A;  4XL1 A;  5L2Z L;  2DG0 A;  1APO A;  3ZYI B;  3NJP C;  2BZ6 L;  1EPG A;  2WZP P;  1IOE L;  1IJQ A;  1XKA L;  1ATB A;  1HRF A;  5EX7 A;  3G4E A;  1NFU B;  2KB9 A;  2VWM K;  4R40 A;  1TPG A;  3ZYJ B;  1EPI A;  2GVX A;  2JKH L;  2IVZ A;  1IQF L;  1QFK L;  2W2N E;  2TGF A;  2KV4 A;  3Q6K A;  5F19 A;  2P26 A;  3BYC A;  2P3F L;  4JYU L;  2BOX A;  3KYA A;  1W7X L;  1MOX C;  2OJH A;  3SOV A;  2BOK L;  5FWW A;  2RHP A;  5JB8 E;  3LC3 B;  2Q1J B;  1EMN A;  2PR3 B;  3SRG A;  1IQH L;  2WPI E;  1IQE L;  2G00 L;  2I9B A;  2W2P E;  2WFT A;  3TBD A;  4C16 A;  3CEN L;  1UZQ A;  5GX4 A;  3KGG A;  1CRU A;  3EGF A;  3LIW B;  5JBA E;  3DR2 A;  2IAW A;  2J4I B;  3LI4 A;  2VJ3 A;  4PWZ A;  2OYE P;  4NA9 L;  4ZXY L;  4JZD L;  1EGF A;  2VVV L;  2W2O E;  3H5C B;  1H6L A;  1XDT R;  4IMB A;  2P16 L;  4M10 A;  1XFE A;  3Q7D A;  4RRW A;  4BXS A;  3LI5 A;  4GN9 A;  2KL7 A;  2BQ6 A;  4AQT A;  3E5Z A;  3ENS A;  1CQE A;  1G1Q A;  4Z0L A;  1CEJ A;  2DDU A;  3KCG L;  2ADX A;  5GX1 A;  5F1A A;  2VVC K;  5E8D A;  2Y82 B;  3SOQ A;  1L3Y A;  2W8B A;  3I1C A;  3NTG A;  2ISM A;  2Y5H L;  5JVY A;  2KNI A;  1DX5 I;  3KQB L;  1FE2 A;  1HAE A;  1YUK B;  3LI3 A;  4ISH L;  1FFM A;  1RWL A;  2GHS A;  3ZYG A;  2WPL E;  3AMR A;  1RFN B;  2J34 B;  1QLG A;  2Y5G L;  3CFW A;  2WYJ B;  5FDQ A;  2XC5 L;  1JBU L;  1LQD A;  2IAR A;  5I46 L;  2VWO L;  2H9E C;  3AMS A;  1CVU A;  2YGQ A;  4A7I A;  5D9D A;  3FCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...