3V65A

Crystal structure of agrin and lrp4 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
191
Chain Sequence
b'ALETLAFDGRTYIEYLNAVIESELTNEIPAEKALQSNHFELSLRTEATQGLVLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLRSTVKVNTNRWLRIRAHREHREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDAVTKPELRPCPTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Agrin
molecule tags Protein binding
source organism Rattus norvegicus
publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
total genus 35
structure length 191
sequence length 191
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3v65A00
1GSLA 3WUDA 1BQPA 1AJKA 4BOWA 1Q8SA 3HMYA 1LGNA 4FQZA 4XMIA 4TZDA 4YZ4A 4XJ8A 5GLZA 4L8QA 3WCSA 2GMMA 3A4UA 2ZHKA 1F31A 3AP7A 3MW3A 4ZXKA 1SLAA 2DUQA 4P9WA 2KM2A 2DVDA 2AENA 5F5QA 3ZVXA 3WVJA 2A3WA 1XQNA 2V73A 4Y1YA 3UJQA 1SBDA 1PZ7A 2ZGTA 4LBQA 1WLDA 2C9AA 2ZHMA 3WHTA 3ASIA 5CBLA 2I2SA 4Q27A 5DUXA 3V65A 5HCAA 4FOYA 4D69A 2R49A 4YGDA 3USUB 3O0XA 3SH5A 1WBLA 3PJQA 4FPEA 3DGTA 4CRQA 4YLZA 1SLBA 2UU8A 1YXWA 2CWSA 4YM0A 1GV9A 2D6MA 4XBQA 1SACA 4BMEA 2R1BA 1D2SA 1B09A 5GLUA 2NM1A 5H9SA 3OPZA 3MW4A 1S0EA 3V0AB 2ZABA 4WV8A 1YO8A 5KXCA 1CIWA 2ERFA 3WCRA 1OFSA 1UL9A 4Q8KA 4Y1ZA 1Z78A 4GWNA 4XOGA 1CESA 1DZQA 1KDKA 4YG6A 1IS3A 1JOJA 2ZGUA 4BLJA 4Y22B 4AGRA 3OY8A 3WV6A 1NXD1 4DRRA 1S1AA 2DTYA 4FOWA 1QOSA 1W6QB 1KQRA 4YFZA 3WDWA 2Q5TA 3ZSKA 5T55A 3SH3A 1JBCA 5EYYA 5SV8A 5T5LA 5IT6A 2VW2A 5KXBA 1GZWB 1GZCA 4UW5A 4YG0A 1S0CA 3V0BA 3AYCA 2JE9A 4XXAA 1DQ4A 1LOAA 2EXKA 4XXPA 2EXJA 1KITA 4YGCA 4YW3A 1JXNA 2CTVA 3INAA 3VKOA 4HANA 4Y1UA 3WG1A 3M1HA 1N1SA 1SLLA 2PHRA 3NV2A 5GZCA 2SLIA 1ZM1A 4K1ZA 2ZHNA 1AXKA 1S0DA 1WW4A 2DVAA 2H0BA 3R4SA 2DVGA 4LBQB 1VIWB 2WT0A 5JVVA 1FAYA 1W6NA 2PHWA 2NZ9A 2ZHLA 4YFWA 4GXLA 3RG0A 3QLQA 2EXIA 2ZA9A 5DG1A 3ZSJA 1ZA4A 1S0JA 5FRAA 2GNDA 2A70A 3AP6A 1ULEA 2V5YA 4Y20A 4ATFA 1N3PA 3LCPA 1G86A 3AZYA 4U2AA 3FLRA 1TEIA 1MR5A 1ULDA 3ZYRA 3O0WA 2ZKNA 1LENA 3RMYA 5BYNA 4UW4A 5JOZA 2YMZA 3IPVB 2ZGRA 3AJZA 4R9DA 1WLWA 1V6IA 4M3CE 2FHRA 3POWA 2DU0A 1CN1A 2ZAAA 5IK5A 1QDCA 2JJ6A 4Y22A 3WG4A 3RS6A 5H9PA 5HCBA 1G9FA 3L2YA 3MW2A 3M2MA 1GANA 1HLCA 1YIFA 2XB6C 4YW4A 1LOFC 3RRDA 2A75A 1A3KA 1WD3A 4FPLA 4JCKA 2NP0A 3FLPA 3AP5A 1GZWA 3M3CA 4FOQA 1ENRA 2YZ4A 3TB0A 1UAIA 3H0OA 3FFZA 3VKFC 5GZGA 5GLVA 3SNMA 4ASMB 1UKGA 2JKBA 1V00A 3AZWA 1JYCA 4Q26A 4FPCA 4YW2A 4FPOB 2EALA 1H9PA 1HKDA 1UN1A 1AX0A 1GKBA 1LEMA 2ZGOA 3GNEA 5GZFA 3VKLA 3R4UA 5GZDA 5E89A 2C5DA 2EF6A 4CZSA 2E6VA 2YROA 4AGGA 1FV2A 3MPPG 5AVAA 1Q8QA 3BIWE 3ILRA 4ISQA 5CB7A 5JOXA 3VKMA 3I8TA 1GYKA 1MS9A 3AYAA 5JLVA 4UW3A 1GBGA 2ZBJA 3NWKA 5JMCA 2A6VA 1HQLA 1LHVA 1MS0A 2AUYA 2CWMA 3RSJA 2D6OX 1DQ0A 3OYWB 4PBPA 4SLIA 3BODA 3O0VA 2UWAA 3O12A 1H9WA 3FUQA 1LESA 1URXA 2P34A 1GNZA 2P3KA 3N7JA 1H30A 4W65A 1KDMA 2WT1A 1AXZA 3UJOA 4ZKTB 2GN7A 2DYCA 2P2KA 1V6JA 3AZVA 1J1TA 2VH9A 4M3CF 5DZGA 1N1VA 4XBLA 1VALA 4XTMA 5JOWA 1QOTA 4K20A 4YZ5A 4R9CA 3ILNA 4Q1RA 3HN1A 2RHPA 5T52A 3AXEA 2W08A 3BOPA 3AJYA 2ES3A 1FV3A 5GALA 1LHOA 2UURA 1SLCA 5CNAA 4KBBA 4C1WA 3V0AA 3T1LA 4PCRA 3WOGA 3A0KA 5KXEA 4WVVA 3M3QA 3A0NA 5T5PA 4AVVA 1IOAA 2A6WA 2DUOA 1W6OA 4GKYA 2B7YA 1SLTA 1C1FA 3AYDA 2P37A 4TYSA 4XHBA 1LCLA 1BXHA 1WW5A 2WT2A 2WQZC 4XJWA 5EYXA 2A7AA 3RQ0A 2AYHA 3WDTA 4XILA 1MACA 2GNMA 2D6NA 5KXDA 2VUAA 1S0IA 3FLTA 2GDFA 1SLIA 1FNZA 4M01A 3M3EA 2VW0A 1MS1A 4DQAA 3AK0A 3WDXA 3WUCA 2W68A 1CR7A 3PVNA 1F5FA 1JYIA 5DUWA 4NO4A 1R1ZA 4YGBA 2R1DA 1W6PB 3ZXJA 3OYWA 4PBOA 2A3YA 1V6KA 4FPYA 5IK7A 5IK4A 3IKWA 1C4RA 3ILFA 2E53A 1LOEA 2SBAA 3V64A 5CA6A 3PVEA 2WJSA 1G7YA 1LHWA 2A6XA 2EIGA 1GICA 2ZMNA 1ULGA 2PHFA 5T5JA 5GLTA 1DYPA 3U4XA 1LECA 4LBMA 2ZGNA 5GM0A 5GZEA 4Y26A 1Q56A 3UL2A 2DTWA 4YZ1A 1GZ9A 1JW6A 2WSVA 2OVUA 3WDUA 3SH4A 2WNEA 2A71A 3IM0A 1CPNA 1DYKA 1N3QA 4R9AA 2A6YA 1Z0HA 5IUQA 3MEPA 1Q8PA 2BQPA 3N7LA 3WDYA 4LBJA 2D7FA 3UK9A 1WD4A 4BQ1A 2GALA 4XDQA 1QMJA 1IKQA 4M00A 1DIWA 4MYEA 4HL0A 2XG3A 4IQPA 3VV1A 1ONAA 4PQ9A 2LALA 3D5OA 1W6MB 3ATGA 3WNXA 4JRAA 3T1MA 4LBOA 1O4ZA 4AWDA 2E7TA 1IS6A 2ZGMA 2ZZJA 3NV4A 2D43A 2GMPA 2PHTA 4XJ9A 1WW6A 3OY8B 3LSDA 2PHXA 4GA9A 5T50A 3AP4A 3NV3A 1QGLA 3KQRA 4FPJA 4XIOA 3PVOA 2JECA 3N36A 3RMXA 1MS5A 1O4YA 5GJ6A 1N47A 1V6LA 2W52A 4XZPA 4I30A 4XJUA 2D3PA 1BYHA 3FBYA 2NN8A 3WG3A 1WUVA 2TEPA 4WZFA 4LBLA 2Z42A 3QCWA 1DGLA 2VY0A 4OZXA 5DG2A 3KM5A 1AX1A 2ZGLA 1BZWA 3T2TA 1MVEA 4YM1A 5EWSA 3ENRA 1CVNA 3JUUA 2D6LX 1FX5A 4P14A 2NYYA 4FP3A 5H9RA 3W59A 1BJQA 1C57A 1SBEA 1LU1A 1SCRA 1W6QA 3POYA 3PMEA 3ZXKA 1I1EA 1HDKA 2GMEA 3AX4A 4FVVA 1QNYA 4BPZA 2EXHA 1G9BA 4BMBA 1G9CA 1APNA 1QF3A 1EPWA 2DVBA 5JOYA 2D6PA 4Y1VA 3B00A 3LSEA 1RIRA 2CL2A 3CNAA 1SFYA 4LBQD 2UWBA 1U0AA 4DS0A 1JN2P 4XMAA 4M3CA 1A78A 1V6MA 5DUUA 3N7MA 5DZEA 3ZYPA 2E51A 1Y7BA 4BM8A 1DBNA 1CPMA 2OUHA 2A5ZA 1MZ6A 2W39A 3N7KA 4AVTA 3VUOA 1KRIA 4XE9A 1UX6A 3OGGA 2JDZA 1DQ1A 1V6NA 2WSUA 1S0BA 5H9QA 1MS3A 3WLUA 3FUOA 1AF9A 2DWRA 2NMNA 4Y1XA 3OJBA 4FP2A 4YGEA 1ENSA 1LOCA 1Q8VA 3B9CA 1W6OB 3M3OA 4Q1PA 4YG3A 1RINA 1KJRA 5F9TA 2D6KA 1UMZA 1UZYA 4Y24A 3ZPYA 1JUIA 2ZGKA 2ZACA 3ZXEA 2YY1A 1YYNA 1LHUA 4YW1A 4YM3A 2R16A 4Z8BA 2ENRA 1AX2A 4Q8LA 4XIKA 3AZXA 2D3SA 1DFQA 4FPHA 2D44A 4C1XA 4LBKA 1RITA 1UPSA 1DQ5A 1MZ5A 4K1YA 1G8WA 2NMOA 2R0HA 1C1LA 2YV8A 3AXDA 4F83A 1GNHA 3B69A 4P9XA 1JHNA 4JC1A 5DZFA 4DFSA 1W6PA 2PHUA 2PELA 4YZ3A 1YI7A 2DUPA 1W0PA 1DQ6A 3USUA 4U36A 2A6ZA 4R9BA 2DV9A 3SISA 2AREA 4XHXA 1N1TA 3ZXLA 1ULFA 5IK8A 2EAKA 1QDOA 1FNYA 1LOFA 4FPKA 1YRZA 4XBNA 3ZXFA 1LOGA 2ZGQA 1HQWA 3I4IA 1MVQA 2P3JA 4FPGA 1V6OA 3IMNA 1LEDA 4H55A 4AGVA 1G9AA 1N3OA 2ZMLA 2HYKA 2ZMKA 2GNTA 4WVWA 1VAVA 3W58A 1DHKB 4RL7A 4BLIA 1MS4A 4GALA 4DRVA 4LBNA 2G4IA 1QOOA 2P3IA 2FMDA 2AGSA 2ARXA 4AVSA 1WW7A 4K21A 1LGBA 1CQ9A 1PZ9A 2GN3A 2OUJA 1IS4A 2ZGPA 3R05A 1WLCA 2OW4A 1QNWA 2DURA 1VLNA 1A8DA 2JD4A 1SBFA 2VU9A 1AZDA 4Q2FA 5E8AA 3V0BB 1W6MA 4ATEA 1IKPA 1N1YA 1W6NB 2A3XA 5GLWA 1WBFA 3OBRA 1LODA 3WG2A 4NOTA 4RA0A 5HCFA 2D3RA 1D0HA 4UW6A 1UZZA 3SLIA 3APBA 2JE7A 2VW1A 4ISRA 3B3QE 1PZ8A 3WDVA 4GWMA 1DQ2A 2CNAA 1FATA 2AH2A 4XJZA 1LULA 1ENQA 3IN9A 4P9YA 3AYEA 4XYXA 2UWCA 4XTPA 3JU9A 3IPVA 4AYUA 5EXOA 1LTEA 1LU2A 3TAYA 4Y20B 5CAZA 3Q9OA 1S0GA 1KJLA 4ITCA 2YXSA 4DPNA 1WCSA 3AZZA 1W0OA 5T5OA 5DUVA 5L73A 4FPFA 1G9DA 3D6EA 3ZSLA 2ZGSA 3NV1A 2GNBA 4XJAA 1OKQA 1MS8A 1DLLA 2WKKA 2DVFA 3WZ1A 2DU1A 1AXYA 2AR6A 1F9KA 3AP9A 3WHUA 4FOVA 1OQ1A 3OBTA 1CONA 2CY6A 2E7QA 2LTNA 3O5SA 5JDBA 1QKQA 3SITA 1LHNA 3C2UA 1LGCA 1SCSA 3HR9A 4GKXA 4PF5A 1BKZA 3BTAA 2VXRA 1LOBA 4YM2A 3DUIA 5LK5A 3GALA 1AJOA 2CYFA 3POSA 4YZ2A 1X50A 5DXDA 3N35A 4M3CB 3D4KA 1CJPA 3B01A 1ULCA 1GLHA 5T54A 1I3HA 2ARBA 2WLQA 1QU0A 5E88A 3ZSMA 4CTEA 1Q8OA 3N3HA 1LJ7A 1NLSA 3VKNA 4FQ4A 1VAMA 1FYUA 1S0FA 5FREA 2R0FA 1AVBA 1IS5A 4YW5A 3AFKA
chains in the Genus database with same CATH superfamily
5FYVA 4BQ5A 4BOWA 1Q8SA 2GZWA 3HMYA 4KQ7A 2VMCA 5FZ4A 1PVC2 1OOPC 2FMYA 3VBFA 5GLZA 1FOD3 4E27A 3GBWA 2ZHKA 1HB2A 4P9IA 2VOKA 3ZN6B 4OZOA 2DVDA 5F2SA 3WF2A 3VDDB 1XQNA 2YGMA 2HWE1 1YFXA 5FYYA 4YPJA 2ZGTA 4LBQA 3LWCA 3J9SA 5LRRA 1ND2C 4P9JA 2J1RA 2JEMA 3I54A 4Q27A 1YI9A 4Z82A 3V65A 5EIYB 3NO8A 2QQPA 1X33A 1ZBE3 1LB2A 5ISLA 3SH5A 5KHGA 2XWBB 2FDJA 2Q0AA 4YLZA 2VZOA 3VZKA 1O6UA 3B5LB 2ARAA 4N8MA 4KWUA 4BMEA 4CXWA 1C5HA 1YNAA 3NAPA 1BVVA 5LATA 5F5IA 1R083 3MLKA 3MW4A 2VOWA 3VBRB 2ZABA 3JB8A 4S2HA 4WV8A 2RMU2 2QQMA 1XE7A 2ERFA 2WR9A 4XURA 3WCRA 1H2LA 3SC7X 4DXZA 1Z78A 4GWNA 5FLIA 3PTYA 1CESA 1DZQA 1BCXA 1KDKA 3NJXA 1IS3A 4LHKA 2TNFA 2GC0A 4A41A 3WV6A 3PUAA 4FOWA 1QOSA 1TZOA 1O91A 1AHSA 5A1FA 4DEVA 4UFHA 2Q5TA 1FMD3 4GAZA 5SV8A 4ZHNA 4QHZA 1EAH2 5T5LA 1ZBE1 4EE2A 2Z5WA 4RHV2 4QM9A 1GZWB 1GZCA 1HRV3 4UW5A 3DPRC 4PDWA 2JE9A 4INDA 4XXAA 1AL0G 1LOAA 4LE3A 4YGCA 1COV2 4S2FA 5E1RA 2CTVA 2WWUA 1ZZ7A 2AEYA 3CZJA 3INAA 3JD72 3VBFB 3VL9A 4AK3A 2O14A 3B94A 4PI2A 2Q1FA 3NV2A 2Q8EA 5CFDC 5GZCA 3IDCB 3EJKA 5BXXA 1AR62 4K1ZA 1H0BA 1WW4A 3R4SA 4QU1A 3I7DA 5A7SA 4COVA 4EV0A 1NCRB 4N43A 3BUCA 4K8FA 1GQPA 1VIWB 1YJKA 1VR3A 1STMA 4RYDA 4YFWA 3RG0A 4CYDA 2ZXQA 2XJQA 2R6QA 4PLNA 3VGIA 3AVSA 5C3QA 2JG9C 4AHXA 3THCA 3AP6A 4ES9A 1MEC2 3BU7A 4IL7A 4Y20A 5FMCA 4ATFA 4CU9A 5IVJA 1PVXA 1MZEA 3NNFA 4LO4B 3NNMA 3ZX7A 3D0SA 1VPHA 1TEIA 4ORFA 2YC2A 5FZDA 2BEOA 3PUIA 3IPVB 4ZS3A 2ZGRA 1ND3B 1V6IA 1OOPA 3KSCA 4W6YA 4RHV1 4N53B 3ZYIB 2VBBA 1RUG3 2ZAAA 4Y22A 1IG0A 2IWGB 3WNLA 3SMHA 5H9PA 5HCBA 2O8OA 2Z2SB 4NJ4A 1NQDA 1GANA 1HLCA 2XB6C 1EYBA 5C6CA 2BBVA 2DBIA 1WD3A 5JIAA 2E32A 5BY5A 1GZWA 3M3CA 4NHKA 5A3NA 4J6GA 4ZXEA 1OA3A 1HN1A 3J8F2 3VBUC 4EWAA 3AM2A 5LB6A 4YW2A 3I3EA 4FTEA 3VKLA 1AX0A 2WABA 4UF0B 3R4UA 4CZSA 2EF6A 2BUKA 4CUCA 4GWJA 4CU8A 3MHZA 1SZBA 3GHMA 3E1F1 2Y6JA 2E31A 4URTA 4KWKA 1WMXA 2W87A 4ISQA 5CB7A 5JOXA 4OI0A 3I8TA 1GYKA 5JLVA 2VXJA 2RS52 3NWKA 1W0NA 2QQUA 4L97A 1A34A 2X29A 3MV11 2CWMA 2ZKLA 5FY9A 3CO2A 4Q4X3 2ZJCA 2HEYF 5FKCA 1PVC1 4PBPA 4UAPA 5C8WA 4SLIA 4RS5C 3ZIXA 3O0VA 4IETA 4A3ZA 4NPLA 2N7GA 1W8OA 1URXA 4RGAA 3ACIA 3HD8B 2B5HA 2P3KA 4CDUA 4EWDA 3I3BA 2IXIA 4W50A 3KF5A 4XCAA 3UJOA 1W2AX 2DYCA 1J1TA 2VH9A 2XLGA 5DZGA 5K0UB 1N1VA 2ZEWA 5A7QA 1A8MA 4BJ0A 3E97A 1QOTA 3POBA 4QQ2A 4OHXA 4IE5A 4QHOA 4KNCA 4HOOA 3HN1A 5T52A 5LA0A 3AXEA 1W3VA 4H14A 2W08A 2YPDA 4N43C 5LA2A 1YQ8A 3C7HA 1VAKA 3ABZA 1LR5A 3KMHA 1VBA1 5GALA 1JU3A 4QB6A 2BP6A 5JXJA 3WOGA 1XPWA 2YUEA 1KFXL 2P1BA 5J36A 4AI3A 4AVVA 1F35A 1W6OA 4H2AA 1RUC3 2Q8OA 5FPXA 5CG9A 1WW5A 3B9IA 3HN3A 1OXCA 3WDTA 2BWCA 4XILA 1O3SA 4LHLA 5EHDA 1PNGA 3VHRA 5KXDA 3Q8EA 2MEV3 4EN9B 4UOJA 2J22A 3FLTA 1OD5A 3T30A 1BEV3 4M01A 1JS9A 1W2TA 2V4VA 4R52A 1MS1A 5I0UA 2X10A 3WDXA 3M3IA 3N9NA 4JAAA 3VB9A 5B4XA 1AYM2 1F5FA 4QWNA 1GP6A 2GP3A 1W6PB 2V5DA 4PBOA 1V6KA 1H6YA 4KI5M 1JZ8A 4Q4W3 4IE0A 2PYTA 1C4RA 2VL4A 3IKWA 1YQ6A 3GXUA 3ILFA 1YFWA 4RD7A 4EJRA 1US3A 1ND2B 1QQP1 3ZKYA 2BGCA 3ZXGA 1QQP3 1QXRA 1U12A 4JGYB 2X5IB 1ZBA3 1CZTA 5EV7A 1LECA 1CJDA 4LBMA 1YQ2A 4I2OA 2Q30A 1UOFA 1OPMA 2ZGNA 5G05L 5FUPA 4CCCA 5LA9A 2DTWA 3FN9A 1W8HA 2OVUA 4MGQA 4CDQB 1R092 5FO7B 2WNEA 2W92A 4UFJA 3R6SA 5C3SA 1NQJA 5FYMA 3N7LA 2RS11 3OBZA 4CUBA 4LBJA 4BQ1A 4HG6B 1HXS1 3Q8AA 1JODA 3HJRA 4YVSA 3J7NA 4E8DA 4Y5SA 3A7QA 3LEMA 3LPGA 4TN7A 3CKHA 5DAQA 4JRAA 3T1MA 3AKSA 1RUC1 2E7TA 4AHZA 4FAHA 4RQPC 1KFUL 2ZGMA 2YGLA 2ZZJA 3NV4A 2D40A 4XJ9A 3MFCA 1EAH1 2PHXA 3TEWA 3AP4A 5IVYA 1ZRDA 3MIDA 3H1MA 3PVOA 5IVCA 1AR72 4LNVA 1O4YA 3J7LA 1OVPA 3J4UH 3K77A 4UBGA 1QIQA 1Y3TA 2D3PA 2OQ6A 2E7AA 3PLQA 4JV4A 2RR13 4JQRA 1I5ZA 2A1XA 4HETA 5FZKA 4XFCA 3RVHA 4IGQA 3KB5A 2R041 4V2WA 5ERLA 1CVNA 1HV0A 2BOJA 3JUUA 3K3OA 2RJLA 3LDKA 4IV3C 4OFGA 4FP3A 4UFKA 4XQ4A 5K7PA 2VZ1A 1XYPA 4Q0VA 3W59A 1RC6A 1C57A 1SBEA 1SCRA 3N9MA 4IEXA 4JGYA 4B7EA 2MNGA 4Q4W2 4MG2A 3HPNA 1XNCA 2VMFA 5I8SA 4EZ4A 4IEPA 4FBFA 5C8CA 3KT1A 1J1LA 2G9ZA 5D21A 3DL3A 1EPWA 3B00A 5E16A 1PMIA 2BJSA 1BLZA 2YC4A 1M06G 3PIJA 1SFYA 3ZM8A 5HBAA 1ULPA 1JN2P 2X8KA 5EQUA 1REFA 3WY6A 3BTYA 3PL0A 4Z2WA 5B4NA 5FAXA 4MSVA 1HJFA 4A7YA 1UU4A 1MZ6A 1UY3A 4QX7A 1UX6A 3C7EA 3WNPA 5C71A 1DQ1A 3X29B 1L7LA 4CVUA 4YWAA 3LZZA 2R30A 1OA4A 2WSUA 3HBKA 2R043 4PF1A 5H9QA 3WLUA 2Z79A 2K46A 4OHVA 4Y1XA 1FI2A 2WZR1 3H9AA 1Q8VA 3ETPA 3M3OA 1VBE1 4Q1PA 4R8HA 2ZS6B 3GJAA 4UBHA 4YG3A 1HB4A 2CSGA 1RUI2 2D6KA 3DXTA 3ZPYA 1W05A 3IIIA 4AFCA 1JUIA 2DDUA 2ZGKA 1ZVFA 1YYNA 3U37A 1LHUA 3LD8A 4QQOA 3E5QA 5BNNA 1RJ8A 2J1EA 3AFGA 5FTTC 1HRV1 4FPHA 4C1XA 2WUHA 1RITA 1CD3G 4K1YA 2NMOA 2YC0A 2R0HA 2YV8A 3BTZA 2XGXA 1O7FA 2XJRA 4EQVA 3ROUA 4XF4A 3S0MA 4E9KA 5FMBA 1BK1A 3VBRA 2JIJA 2UY9A 5BPXA 1SFPA 4A7ZA 4XEZA 4YZ3A 3USUA 5ABJA 1FPN1 4U36A 1Q43A 1UZWA 1YC61 2DV9A 2PLV3 5C4WB 5CYYA 1FNYA 4LJHA 2Q8DA 4P5YA 2L9LA 4XBNA 3ZXFA 2ZGQA 1AR63 1HQWA 4UFLA 3THPA 4N90A 3U07A 2P3JA 1RUI1 5I0SA 3PURA 3IMNA 1C8M1 1V9U3 1LEDA 4AGVA 1US2A 3POIA 5L19A 2ZCWA 2HYKA 2E26A 5A7WA 5LW9A 4GZ9A 4WVWA 4BLIA 3SHRA 5JPMB 2P3IA 1QOOA 2Y33A 4IGPA 5FZ9A 2VE1A 4XFBA 1WW7A 1NUKA 2QQLA 3T2PA 1ND3C 4S2GA 1CQ9A 3NKTA 5E6HA 4QKBA 5FK7A 3R05A 4AFAA 2XVGA 1PVC3 1VLNA 1A8DA 3FBMA 3ON7A 1OF4A 1NZIA 5FUIA 1N1YA 2X05A 1XNBA 1AR81 2V09A 4CCLA 1LODA 1SPPB 5BNOC 3WG2A 3ORJA 4NOTA 4AVBA 3RI8A 4CXYA 1OVSA 1W8ZA 1S2BA 2BU9A 1D0HA 5JMOA 1UZZA 2C1FA 3SLIA 2YU2A 2Y64A 4GWMA 4I01A 3RNSA 4AEJA 2QUOA 4KGGA 5JR2A 2AH2A 3OUJA 4XJZA 2BNMA 3W20A 3EXUA 5F39A 4D7TA 5LASA 4KL1A 1PIV2 2R061 1UOJA 4YW6A 4MGTA 1LU2A 1K3IA 3WP6A 5J37A 1S0GA 4PLOA 2YXSA 2PXJA 1XNDA 4BA6A 5DUVA 1XNKA 2RVAA 2WZ8A 2WZR3 5CADA 3VZLA 5FK8A 4XAAA 2HWE2 2D98A 2WKKA 3BTXA 3K46A 1VBD1 1F9KA 2JDYA 1GZTA 3VBSC 3AP9A 1VB4A 4K8RB 2VUCA 1GWLA 1OQ1A 3OBTA 4QX0A 5F3CA 2UYAA 3H1YA 5FOJB 3GCXA 1GQGA 4L9BA 3VBHC 1LOBA 3WEZA 3O14A 1H8TA 4CSWA 3P5BA 2CYFA 2VCAA 1X50A 2YDEA 3UESA 1CJPA 3K2OA 4XFGA 1ULCA 1GLHA 4LUMA 4UF0A 5E88A 1QU0A 4E4ZA 4WVMB 1BMV2 4W6WA 4PIZA 1K5MB 2WWJA 3N3HA 4KBZA 4SBVA 4NIIA 3VBRC 5LA1A 5F6KA 5C4WC 2JDHA 5FY7A 4FQ4A 1VAMA 2VMDA 2Y26A 4BCUA 1B35B 2WA4A 3HVDA 5FREA 2R0FA 1ZREA 1IS5A 4Q4V2 1EV13 4CDWB 4NHLA 4EROA 3N9OA 1EV11 1SPPA 1WMFA 2I74A 5I0DA 4HFSA 4FQZA 1ZZBA 1RHI1 4CE8A 3WCSA 3CHXA 2GMMA 1UU6A 1JYNA 3K51A 1SLAA 1UYZA 2P6CA 1NXMA 4JKMA 4E2SA 2AENA 2A3WA 4Y1YA 2AC1A 3H8RA 1W99A 1JYXA 4OI1A 2C9AA 5IFPA 3WHTA 1W9FA 3BN6A 3MLLA 5CBLA 2BVBA 1U5YA 1DU3D 1SMVA 4OUEA 5D8AA 2IFRA 4D69A 4JKKA 4WZCA 3O0XA 1WBLA 3PJQA 4OHWA 1TMF2 3DGTA 4OQ9A 4ZU4A 1UU5A 1SG3A 1SLBA 1U5IA 1R64A 1VBD3 4YM0A 4W8JA 2D6MA 4K3UA 1SACA 4ET7A 2R1BA 3F2ZA 4I3GA 4LTAA 5L36A 3SKJE 1V9U1 5LY1A 3MLJA 3RYPA 3H8UA 5JI7A 1NE4A 5H9SA 1W9WA 1UQXA 4YVSC 4TWTA 5FLJA 1XRUA 4OHZA 4WM8A 4WM7C 1YO8A 2QTWB 1AR61 1T6BX 3H3UA 4AHYA 2EA7A 1OFSA 4LO5B 1UL9A 2HBUA 2OXBA 1K12A 4CEYC 1RUG1 4CCEA 3ZFEA 1OHFA 4NRQA 4AHWA 4DINB 1D4VB 4LOSA 2ZGUA 5FYCA 1E5SA 2RS53 4Q0UA 1XU1A 4DUXA 2LS6A 5IAVA 5I91A 1K5MA 4XDOA 2VNRA 1KQRA 3ES1A 5CVRA 3WDWA 4BK5A 1GWKA 2QZ3A 1B35A 2RM22 4A6SA 5CFCB 5EYYA 3RWKX 5KXBA 3ZFGC 1UZVA 1YUDA 4IV1C 4CDWA 1RJ7A 1S0CA 3G7DA 3AYCA 3VL8A 3V0BA 4D8MA 3C7OA 2EXKA 5FZGA 4AW7A 2EXJA 3FWEA 2VZSA 1JXNA 3RWNA 2HWE3 3OUHA 4AAXA 2ZOEB 1RUJ2 2HWC2 4KU8A 1N1SA 2PHRA 3RYRA 2Y38A 5C5UA 1JYWA 2KXLA 4P5HA 4IE7A 2IFWA 2ZHNA 1AXKA 4RFRB 2J1SA 4LBQB 3HOBA 2XONA 3JBG1 1AL23 5A3OA 4IV3B 3VBHA 3WD5A 2DCZA 4W4ZA 4OQ8A 3LF7A 3LA2A 1FAYA 2ZHLA 4GXLA 3QLQA 2EXIA 2ZA9A 3ZSJA 4LO8A 3K75B 4N7IA 1K5JA 1VRH1 1QHDA 3TRSB 2A70A 2YU1A 3LA3A 1KEXA 5EJ3A 5FPBA 4LPLA 1N3PA 4CDQA 1FMD2 3AZYA 3LAGA 3LIGA 3FLRA 4K9SA 5HV0A 3ZR6A 3PJYA 5IVBA 5A70A 2VVDA 2D97A 2JDAA 4MLOA 3RMYA 4EWEA 2VZUA 5AC93 3KV6A 1VBD2 5FPUA 4Z07A 3I2DA 1DCSA 4M3CE 3ZYGA 4BQWA 5IVFA 2DU0A 3AKQA 5IK5A 1QDCA 2RDRA 1QWRA 3EB7A 5ABJB 4UWDA 3RS6A 5DABA 1G9FA 1X82A 3T3YA 1QJFA 3DKQA 4GH4B 1JUHA 4YW4A 1UY1A 1O5UA 1OUSA 1W2NA 5FMOS 3WF4A 3E5UA 5CFCA 4FPLA 5A3UA 3MUZ1 2OZ6A 5DAVA 5FPVA 3FLPA 3IDBB 2OKXA 2EAAA 3LDRA 3T4VA 3I3MA 3WF3A 4FOQA 1ENRA 4NPRA 4QDQA 3TB0A 5GZGA 1POV0 5J1XA 2QZ2A 3SNMA 4ASMB 1RUH2 2VBPA 1UKGA 1KGYA 1V00A 1ZRIA 3AZWA 1JYCA 1VBA3 4MGSA 3VN4A 5CIRA 5A32A 4IEUA 1Z7S3 4FTSA 4NVPA 1H9PA 1HKDA 5GZFA 4A3XA 1GKBA 3TN93 5I0RA 5J96B 2ADDA 2VTXA 2WAOA 4N9IA 1OI6A 5KHJA 2E6VA 2YROA 4LORA 2FCTA 2WS93 4QPGA 2E63A 2PLV2 5AVAA 5FWEA 3WP3A 4D94A 1RGSA 2YBKA 4META 5FO8B 2XL7A 1OBNA 2JB4A 4HBNA 4NE9A 3VKMA 2BOIA 3AYAA 5EPAA 4MX3A 3WQ7A 4UW3A 1GBGA 4EN7B 2XJSA 3WQ1A 4LO7A 3MF6A 2A6VA 1LHVA 1MS0A 1QJX3 2ZEZA 3DXUA 1HV1A 1DQ0A 1QJEA 1RUF1 3OTFA 1C8M3 3OYWB 5IJRA 3VZNA 5KR7A 2YBSA 2ZX4A 3BODA 1QJU3 4H7MA 1W8NA 2JD9A 5FZ1A 1AYN2 3SXWA 1PK6B 3NSTA 3NW4A 5FP3A 1CGPA 1GU3A 2P34A 1XSQA 5DAWA 1GNZA 3N7JA 4W65A 5C5TA 3J8F3 3TN92 1ND3A 1KDMA 1S4CA 1IQDC 2RDQA 5A3PA 2XBO1 1W3XA 2OT7A 4M4PA 1V6JA 4M3CF 1XJAA 4XZUG 4GQ7A 4K20A 4YZ5A 4OI4A 4Q1RA 3LFMA 5BNOA 1W9SA 4L2NA 4JTOA 3AJYA 4QKDA 4LHSA 4PT6A 2ES3A 4RFT0 1SFNA 5I8YA 1O8SA 1LHOA 3CBNA 3FE5A 3POFA 4E4DX 5A3WA 3V0AA 3ACFA 2RE9A 4PCRA 2XUMA 3T1LA 5FPLA 1W39A 1QQP2 1DP0A 2FBEA 3A0NA 1OLRA 5L7OB 4B1MA 1NLRA 3GZAA 1AR73 3PU8A 2P37A 4XHBA 4QX8A 1LCLA 1VMFA 1D0GA 2HBTA 2WNOA 4QPGB 4QX3A 3RZJA 2VTFA 2D6NA 4E2QA 4QKFA 2VTXJ 5A1AA 5CU1A 3WP4A 2VNVA 2IXKA 2GDFA 1FNZA 2G9GA 1GOFA 2VNOA 2WQ4A 3CJIA 3LE0A 1X9PA 1QH7A 1OLQA 2W91A 3AK0A 1CAVA 2VECA 3KV5A 4P9LA 4YGBA 1R1ZA 1AR83 5AVPA 5FZFA 2RJKA 3DYMA 4FPYA 5FZAA 5F5CA 5IK7A 1F8VA 1LAJA 4FFGA 4JVAA 5CA6A 2SBAA 3V64A 5CFCC 2JICA 4V2VA 4J25A 2JX9A 4KG0A 4X8PA 3LEGA 3VD4A 5FJHA 4FXGB 4QXHA 1GICA 3CF6E 3LGRA 5FWJA 2PHDA 1OF3A 3LQCA 1UYYA 1UY4A 3NJZA 1DYPA 4AXOA 1UXXX 2YFUA 1QJZA 3C3VA 4NROA 3ZLIA 1VMHA 1JMUB 3M70A 5GM0A 5GZEA 3UL2A 1X8MA 4YZ1A 3PNAA 1JW6A 4IV1B 3OB8A 4CDXC 2F17A 4HSLA 5DAXA 1BHGA 4BIFA 1N3QA 1DYKA 5IUQA 4AF9A 1PMHX 1HX6A 3MEPA 2D5HA 3C7FA 5F7UA 3N9LA 2BQPA 4BQXA 1VBE2 4HKOA 1WD4A 4XDQA 1CWPA 4LMFA 1DIWA 3MICA 5ANQA 3S7EA 3ZSEA 3VV1A 3WF1A 5KHIA 1GFF2 2RMU3 4PQ9A 3D5OA 3AKPA 3ATGA 3ZMNA 4DIQA 5SV5A 3ZFFA 4LBOA 5A3LA 4L99A 1AR71 4XF0A 3MUY1 3E5XA 3NQHA 2WS91 4TLGA 1UMIA 4WM7B 4E4SA 1OQEA 5DAPA 1VB2A 5FYIA 4QPIB 2D43A 1PNFA 2IVJA 5FLHA 5T50A 3LA7A 4FPJA 2RS12 2JECA 1RUC2 5C9AC 3ZYHA 4JGZA 5GJ6A 1HXS3 2RM23 1N47A 4LKFA 1J58A 2W52A 4I30A 1WUVA 3OCPA 2Z42A 3WINE 2C4XA 1DGLA 3BVCA 2XJTA 4OZXA 5DG2A 1C8NA 3ZDVA 1RHI3 4IEYA 1NX9A 3DPRB 4Q4Y1 3ENRA 1HN0A 1FX5A 4P14A 1R091 2NYYA 2DCKA 3J8F1 1YWKA 5FKBA 1ZBA1 2NPIA 4R4ZA 1BJQA 1F4AA 3JQXA 4BQYA 5JXHA 1GOHA 1TNFA 3AX4A 4BPZA 1QNYA 4L11A 4Q0SA 4COWA 3PUSA 1G9BA 1W8WA 4BMBA 1G9CA 4OUSA 4NAMA 3OPTA 4IV1A 2QBXA 4CDWC 5JOYA 3V56A 4BYYA 3HQXA 2VCMA 4LIVA 5FZ7A 3IDEA 4XMAA 4M3CA 1QJY2 1A78A 5DZEA 1FPN3 3ZYPA 1WA4A 4DUVA 2UY8A 3KCXA 3VHPA 4B4PA 1CPMA 3MZHA 2A5ZA 3PTRB 1JHJA 4QQPA 1WMEA 2VZQA 4AVTA 4GWIA 2Y6HA 3Q8BA 3VUOA 2VZ3A 4EN0A 3HQRA 5EP9A 2XXZA 1UWWA 2C24A 3EYPA 3FUOA 4FCAA 4MXWA 3C8XA 4CEWC 5KBFA 2WLPA 1LOCA 2E33A 1PGL2 3B9CA 5KC5A 5BNPC 1RINA 2IXJA 4AEDB 1NA1C 1GNYA 1I5PA 1Q3EA 3ZXEA 4QPIC 1UX7A 2B9UA 4GIQA 4YW1A 4YM3A 4X6QB 3ZN4A 2P3YA 2JDPA 1NCQA 3AMPA 1AX2A 5DDJ3 3AZXA 2R073 3KT4A 1OD3A 3T2QA 2ZPXA 4QGLA 1DQ5A 3S5QA 1G8WA 1ALYA 2F4PA 1C1LA 3NNGA 1IQAA 5AC92 3B69A 1VBA2 4P9XA 1JHNA 2VZTA 1CIYA 2VUDA 4QB2A 5DZFA 3RJ2X 1D4M1 2PELA 2KR2A 1YI7A 2DFCA 1W0PA 1DQ6A 4N9HA 3BCWA 3UV9A 1EV12 4AOCA 5FPZA 4HKLA 2AREA 2VOXA 5IVVA 1HW5A 3TBDA 2OQ7A 1RHI2 1YRZA 1LOGA 2JDMA 4XPVA 3LOIA 3K4AA 1AYM1 2ZX0A 5LY2A 3LKJA 1MVQA 1GWMA 4Q5OA 3DKWA 3TNQA 5BNPB 4K7JA 4CCJA 4ZU7A 2VQAA 2VMEA 4GMP1 4H55A 2FDKA 1DG6A 1PX3A 2BV4A 4JGZC 2GNTA 1PM4A 1TVGA 3AB0A 3DV8A 3GYDA 1L7QA 4XUNA 2JDNA 4Y5TA 3ZOIA 1PO12 1XC6A 3E6DA 1PO22 4BXFA 2XBO2 5M0TA 1UOGA 2F4LA 1NKGA 4FFIA 2HWD3 4HVRA 2AGSA 4O7XA 1BEV2 4NMIA 5FQ0B 2CU5A 5HPOA 2NQYA 1LGBA 2GN3A 1PZ9A 3U75A 4F8AA 2ZEYA 5FZOB 2H6BA 2OW4A 2ZZQA 5E8AA 1RUF3 4P08A 4PDWB 1XB9A 1AZDA 4OCTA 1W6MA 3NAPC 4LKSA 2G9FA 4CP0A 4QGNA 3MF9A 4UFMA 1AL22 3AL5A 2PMWB 4MOAA 3OBRA 2HEWF 3VDAA 3GZUC 5HCFA 1NCQB 5CKMA 3OGSA 1BEV1 2XKPA 3I2GA 3RZLA 1E5IA 4UW6A 3APBA 4ISRA 1MEC3 1PZ8A 4GMP3 4QHBA 4AG4A 2TUNA 1UKRA 3WDVA 2ET7A 4FSJA 5FPAA 1FATA 3T09A 3WNOA 3S7IA 2PAEA 2HH9A 1R1A1 4QB1A 5DDJ1 5L7OA 2JWPA 2RS32 4CP9B 3JU9A 1XYNA 3IPVA 3I2IA 2OX0A 4COZA 4AQ2A 1PO23 2VPVA 3HNYM 4QX2A 1OH4A 5J3UA 3KT7A 1LTEA 3TAYA 3KZ4C 4FXKB 4Y20B 5CAZA 3BIEA 1BBT1 4DPNA 4ITCA 3ZN5A 1WCSA 3FX3A 5T5OA 4FPFA 3D6EA 2BDRA 4HLTA 2XHKA 2ZGSA 3ZSLA 2GNBA 1IPJA 4XJAA 4BU2A 1MS8A 1ACCA 1W90A 1ZZ8A 5FZLA 2DVFA 3WZ1A 1O3TA 3CJIB 2RJ2A 5LEJA 5A7NA 3WHUA 5BNPA 4G3YC 4FOVA 1AR82 1PMJX 1TNRA 3SKVA 3TNPB 4C8DA 1RUNA 4P00B 4GD4A 2XHNA 5LBBA 2XQXA 5JDBA 1QKQA 3KV4A 2WZPP 3SITA 3C2UA 3HR9A 5BV6A 2GH8A 1KS4A 3BTAA 2VXRA 1DDLA 3DUIA 3GALA 2Y6LA 5DXDA 3N35A 2YHJA 3RFRA 3ZSMA 2ARBA 5A6XA 3CEWA 3ELNA 4HK8A 4HPKA 1H8VA 2B42B 3EMRA 4WBBA 2B9VA 2VZVA 1NLSA 4Q4V3 2WIIB 5FZHA 1FYUA 1OH3A 4M0HA 1AVBA 4YW5A 2Q1MA 3DECA 3AFKA 4QX1A 1GSLA 2XLAA 3WUDA 3U0ZA 5F37A 4XMIA 4XFAA 3UGFA 1YFYA 3WX5A 4B8EA 1ASJ3 3OBAA 4QPWA 1IPKA 3NMBA 4L8QA 2W5FA 4AFBA 4ZXKA 3A4UA 1F31A 3GBFA 3JXSA 2VNGA 3DEMA 3ZYJB 4FFHA 3U10A 1EY2A 4P9WA 2KM2A 2PQSA 1OLME 4IE4A 3KHBA 5F3EA 5F5QA 4ARXA 4JHZA 3NVCA 4QAWA 1Q5OA 2WINB 3UJQA 2R7EB 3N9PA 1OLMA 4CDXB 4CP9A 3KCCA 1YJLA 1T6GC 2ZHMA 3CU7A 2I2SA 1PM7A 4BH9A 1RL3A 1FXZA 4FOYA 3UGGA 2RDNA 1QJY3 3MYXA 5CISA 1HRI2 1EUUA 3ECQA 3USUB 5IYYA 5JAXA 3K48A 1X8EA 4FPEA 3QBQA 3RI9A 3LEIA 5F8PA 5FY1A 2JG8B 2QE3A 4AQTA 1NG0A 4DMIA 5LEKA 5BNOB 1UZ0A 4JGZB 1PIV3 3NNJA 2HLEA 3OF1A 2NM1A 4QX5A 1UY2A 3R0RA 5GLUA 3TOJA 4BK4A 3OPZA 5JXIA 3SCHA 2ZX1A 1EUTA 1S0EA 1H2NA 2ADEA 1YCIA 2EIBA 3A21A 5F5AA 2YYOA 3ZFFB 5I8TA 4ZS2A 4MO3M 4XOGA 4E8CA 2B39A 2ORXA 1REDA 2BFUS 5ANNA 4D0QA 3N4MA 5A7WB 2VC9A 3JD71 1PGW2 4HT1T 1RUE3 1ST8A 5ACA1 4JGYC 5IVEA 4WVMA 2XUEA 5K8SA 1J59A 5LRSA 5FY5A 5F32A 4XQWA 5J98B 5A33A 4GB32 4DZGA 2J42A 4UI9L 2JE8A 4RS5A 3ZSKA 5C8CC 5T55A 3SH3A 4YSFA 1JBCA 3ACLA 4NIGA 1QJY1 3KCYA 2VW2A 3P3PA 3CJXA 5JSPA 4QMAA 4YG0A 4M0NA 3ZXDA 2BWAA 4CDUC 1OMIA 3MO4A 4XXPA 3I2KA 3ACHA 4YW3A 3KGZA 4EYUA 1VP6A 2W1WA 3VKOA 1SEFA 3I2FA 1RXFA 4Y1UA 5C3PA 3MIHA 4C90A 3ZXAC 2BFUL 1O3RA 2SLIA 2WN3A 1PK6C 1WKYA 4D7YA 1ASJ1 1RXGA 3ST7A 1F2NA 5JVVA 4BQ4A 2X5IA 4BISA 4G4FA 3J7HA 3GF6A 5DG1A 3UKNA 1IGOA 1ZA4A 1OFNA 3OD4A 1XOYA 2GNDA 3O1MA 3RGBA 4Q4V1 2JG9B 2LUWA 2V5YA 3VHOA 3SQOA 1TQ5A 4QXKA 4XC9A 5CEHA 1H6XA 1G86A 4U2AA 3GZTB 3HAGA 5KC6A 3NL1A 5FYTA 2H6CA 4RHV3 3O0WA 5F2WA 2PTMA 2FD8A 2BW8A 3I97A 3OG2A 5JZGC 4UW4A 3IMMA 2RS51 1JH5A 2YMZA 4ZY9A 4YVSB 5IFTA 1UIJA 3AJZA 4YVWA 3VDBA 1QXJA 2FHRA 3P6BA 4A2UA 3EBRA 3WG4A 4DXSA 4AEDA 1NE6A 3MW2A 1SDWA 1CAWA 1NA1A 4OLLA 1YIFA 3BKZA 2VD7A 2BNOA 2ILMA 2R071 2Q1ZB 4QPIA 1RUJ1 2HWC1 2A75A 2AEZA 2WNUA 4BQ2A 1S2EA 2MPFA 4JCKA 1DF0A 4QXCA 4JX0A 4CP2A 1JI6A 4OUMA 3AP5A 2NP0A 1W8TA 4AI1A 2YZ4A 1NZCA 5FY0A 4DEQA 1PO21 3VKFC 5A3MA 5F3IA 4O9EA 2JKBA 4Q26A 4FPCA 3JB4C 4LHNA 4FPOB 2EALA 4LA3A 5FZ6A 2YB7A 3U11A 3QH7A 2IZWA 1BK0A 1LEMA 2WN2A 2ZGOA 2W47A 3K3NA 3MFAA 5AFBA 2C5DA 2GC3A 2K9ZA 4X6RB 3MI8A 1VBC1 1TME1 1NY71 3MPPG 4AGGA 4J1WA 5LK7B 2IXLA 1ODMA 3B02A 3BIWE 1C28A 4XUPA 5FZOA 1RUG2 1O5LA 3NKGA 3CDZB 4YNIA 3VD5A 3RSJA 2AUYA 1POQA 5FP9A 5T3NA 4I0WB 1J3PA 3TN91 4XFFA 2OZJA 1W04A 4YARA 5IAXA 5EFUA 2UWAA 3ACGA 1U5XA 2VMHA 3O12A 1H9WA 3FUQA 1LESA 1JTZX 2ZX3A 2XJVA 3OD0A 5JWPA 5A7PA 4CA9A 4ASLA 3NAPB 5AFEA 3VDDC 4Y4YA 2DFBA 4ZKTB 3RDIA 3LFIA 5FYSA 5FP8A 3HQUA 2O8QA 2BTVC 5FO9B 1H2MA 3NJVA 2J7MA 3L2HA 1RB8G 1D4M3 4CU7A 1GOGA 3JQWA 4XTMA 3J7MA 1WCKA 4M4RA 4GH4A 2CGNA 3ILNA 3KQ4B 5JI9A 2XL9A 5A6QA 5JSRA 3S6PA 2ATFA 2CDOA 1CAXB 1FV3A 4OMCA 1QEXA 3IDAA 1SLCA 5CNAA 2BRTA 4C1WA 2IVIB 3FMGA 3T0BA 2CGPA 4YW7A 2Y6GA 1VJ2A 5DDJ2 5T5PA 3PMSA 1IOAA 2A6WA 2DUOA 4IEWA 1ZRRA 1RUE2 1GP5A 1C1FA 3AYDA 4TYSA 2VVFA 1H8TC 4KWJA 1R1A3 5EYXA 3ZFGB 2WQZC 1U5ZA 3D82A 3GBGA 4QXBA 2IC1A 2RMU1 4L0PA 1M4WA 1H1MA 3H8OA 2GNMA 1K42A 2RS31 3POGA 1YEWA 2VUAA 1SLIA 5J48A 3D0JA 2WFF3 1RTVA 4XF1A 5C4WA 2VW0A 4DQAA 1JZ6A 3H7JA 2BBAA 1AL21 5FY4A 4EN6B 2W68A 1CR7A 2ORZA 3PVNA 4IDZA 5FYBA 4H3WA 1JYIA 5D1IA 5A80A 5B2GB 4MGKE 3ZXJA 3OYWA 2A3YA 5FIXA 4LIUA 3AKTA 1XYOA 2E53A 1LOEA 3MIFA 1VRH2 4OVEA 2WJSA 4RR3B 1RMU3 5JXGA 1G7YA 3KVBA 3KS7A 3LB9A 3MDPA 4IW3A 5HXVA 5FZMA 2CAVA 2EIGA 2QQKA 3HWJA 1E5HA 1CAUB 4NHYA 1H4HA 1SHWB 1PGW1 1ULGA 2PHFA 2W1SA 2GSYA 2WO7A 1X9TA 2HWF2 3OSDA 5FZIA 4AI0A 5FQ0A 4HN0A 2VO5A 4XABA 4FTBA 3RYKA 4H7LA 5JUVA 2JDKA 5FYUA 4NUBA 1CX4A 2WSVA 3AC0A 1PO11 4YRDA 4ASKA 2WS92 2HWB2 3M8LA 4MZUA 3SH4A 3UYJA 3WDUA 3JCIA 2A71A 4HK9A 3S30A 4C0HA 3ES4A 1BBT3 1S2KA 3IM0A 2A6YA 5CKQA 4HMZA 3BPZA 3H7YA 4XAEA 1RVF2 1UD1A 1Q8PA 1WLTA 4QT6A 3WDYA 4IEVA 4XACA 3UK9A 1PHMA 2G19A 3WP5A 2MEV1 1QMJA 1IKQA 4AQSA 1XU2A 3CQOA 3CMGA 3VZJA 4IQPA 4YYOA 5CFDB 1R081 2OYZA 4CCNA 4XQDA 1QJX2 1UXZA 4QKNA 2LALA 5DPNA 1WMDA 5LBEA 5HXMA 3WNXA 4CEYA 3WQ0A 1O4ZA 4HN1A 3WR0A 1VBC3 1DZRA 3FHAA 3RPQA 2Y0IA 4MGZE 4K40A 4I09A 3AMHA 4XF3A 4AEKA 2G1MA 2GMPA 2PHTA 2W2IA 3IAPA 3M3EA 4BIOA 4CU6A 5BUVA 4B4QA 1K5MC 3NV3A 1HIXA 1NOVA 1REEA 3PIGA 3F95A 3N36A 4IEOA 1MS5A 3RMXA 3GZEA 4P02B 2QKDA 4AI8A 3FBYA 2NN8A 3WG3A 2C0ZA 1XE0A 4HXCA 5FDBA 3JBG2 4AAPA 3QCWA 1VBE3 4R4XA 3VZMA 2O1QA 3KM5A 1AX1A 3HNBM 2WAAA 2TBVA 3T2TA 3U14A 1MVEA 2LRPA 1COV1 5EWSA 3GM8A 3O1UA 2D6LX 3I59B 3A22A 2P17A 2BYVE 3I49A 2BZDA 2J1AA 1H8TB 5H9RA 3ZIWA 4LA2A 2WO1A 2W46A 3PUQA 1FOD2 3ZXKA 1OKOA 1I1EA 4RS5B 1HDKA 2GMEA 4FVVA 5LBCA 2FDGA 5J09A 1RMU1 4XDPA 2IXCA 1C8M2 1VBC2 1APNA 1PO13 1HB1A 2V72A 1QF3A 2DVBA 3NNLA 4BB3A 2LW8A 1NAEA 4QPYA 1L3JA 1RIRA 2XKOA 1CZSA 3CNAA 3QACA 2UWBA 4HVQA 2QDRA 1V6MA 5DUUA 3HBZA 2WDBA 3D8CA 2BGPA 1DBNA 4MVTA 2W0XA 2OUHA 1JOBA 2W39A 5CFDA 1FPN2 4Y3OA 5J7MA 3N7KA 1KRIA 2X09A 3OGGA 3J26N 2HWB1 3N9QA 3THDA 1V6NA 2B46X 1TME2 1S0BA 4IEQA 1MS3A 4AE2A 3CZUA 1XSRA 2QQWA 3LDBA 1ENSA 1RVF1 1IZ3A 1KXGA 1W6OB 2RR11 1F4HA 2B45X 1KJRA 5F9TA 1UZYA 3B7MA 4UFIA 2JG9A 2PAMA 2J1TA 2ZACA 4B4RA 5LCWL 4KH9A 4Z8BA 2JKXA 2R16A 3AMQA 3KF3A 2ENRA 4XUTA 1HRI3 2WO2A 4Z2AA 1UO9A 3BU0A 2D3SA 1DFQA 4F7ZA 3BI3A 4LBKA 4LLFA 1UPSA 1MZ5A 4B3NA 4Y33A 3AXDA 2VMGA 3H42B 2DF7A 2PHLA 5FP7A 2GU9A 2FCVA 4YVWC 4DFSA 1W6PA 2VCCA 2PHUA 2BGOA 4E2GA 1W28A 5FJKA 2A73B 5A6YA 3U78A 5I93A 4G9SB 3ZFEB 2I07B 2WBKA 4QPGC 2Y34A 1V0AA 2OPKA 3KD4A 3SISA 1N1TA 1YFUA 3URFA 1ULFA 3ZXLA 2WNVB 4A44A 3O1VA 5IK8A 3FFQA 2VAUA 2VMIA 3WXPA 1CZVA 4O9GA 2B4KA 3E6CC 3OOXA 4RQPA 1AR92 2FDHA 1IPSA 4CPBA 1V6OA 2ET1A 4I0AA 4LK7A 5FR3A 3OUIA 3VBUA 3W21A 1N3OA 1Y43B 2ZMLA 1QJU2 3VBOB 5BNQA 1F15A 1VAVA 4RL7A 4AI2A 1MS4A 4GALA 3VLBB 2YG0A 1NYWA 4FI9A 2FMDA 3QD6A 4AVSA 5FCCA 4COUA 2OS2A 2PA7A 4K21A 4B1LA 2OUJA 3OGVA 4MXWB 1AYM3 1POV1 4PIXA 3HIFA 1IG3A 2VU9A 4Q4X1 3V0BB 3KV9A 4ATEA 4IV3A 3CIHA 1IKPA 1T2XA 1Y4WA 2A3XA 2BVVA 3G6JB 4A6OA 1UW8A 2WC2A 2VGDA 3OGRA 4WM7A 4D3WA 3LOBA 4RA0A 3MV01 4HSJA 3IT8A 2D3RA 4XFIA 1H1IA 1O3QA 3AL6A 4PQQA 1JZ7A 3CLPA 3WW2A 5FFOC 2QQVA 1EPZA 1DZTA 1LNSA 1NLQA 4OULA 1HB3A 5FZ8A 3VBHB 2Y8KA 2YBPA 4IERA 2QQOA 3DYPA 1VBB2 4GB31 3UT0A 5IW0A 1Y9GA 2ZX2A 3VDDA 4X8NA 1WA6X 5FYZA 1ENQA 1XXNA 4BXSV 2KA3A 4XTPA 1WCUA 1B35C 1JZ4A 4CPBD 4D7SA 1C3HA 5EXOA 1UF2C 3ZFGA 1JYVA 1ZRFA 1MQTA 3AMMA 1KJLA 1G9DA 4LKEA 3AZZA 1W0OA 3ZYBA 5FZCA 3RZGA 3NV1A 3NRUA 1JOPA 1RUD2 4HZFA 4Q0QA 2DU1A 3WSOA 2W95A 4I3PA 2BPA2 2WNUB 1XBFA 4LUKA 3BOWA 5C3RA 2KD7A 5C8CB 3FJSA 3THTA 3T0DA 2E7QA 2LTNA 3O5SA 5C70A 3VBOA 1LHNA 1LGCA 1HRI1 1SCSA 4GKXA 4IXLA 1BKZA 4PF5A 4YM2A 3U1XA 5F6LB 1OURA 5FYHA 5LK5A 2XH6A 1OC1A 4P9GA 5AC91 3POSA 1WGPA 3BPSA 3D4KA 1DGRN 2F6BA 5EJ1B 3WNMA 1I3HA 2WLQA 4DB5A 3QOPA 1W9TA 4NIAA 5FXXA 1Q8OA 4CTEA 3TEXA 2QDNA 2Y6KA 1LJ7A 2FDFA 1ZRCA 1XNTA 5ACA2 2FDIA 1S0FA 2VOTA 4JHTA 4V1PA 4NPMA 3AVRA 4O61A 1YQCA 1MEC1 1FT9A 3BYWA 1W8FA 5LBFA 1BQPA 1AJKA 2BERA 4PJYA 3VBSB 4PLMA 4JDOA 1LGNA 4TZDA 2C9KA 1RUF2 4YZ4A 4AQ6A 3SEEA 4XJ8A 3GDBA 2K0GA 4DXRA 1AYN1 4Q4X2 3AP7A 1QY4A 3MW3A 4LKDA 5FZ0A 2DUQA 3KHCA 1CAUA 3ZVXA 1V9U2 5BNNB 1S55A 3ETQA 3WVJA 2V73A 4CXXA 3O1PA 1SBDA 1PZ7A 2JXAA 1WLDA 3POEA 4CCOA 5IHRA 3ASIA 4K6BA 5DUXA 5HCAA 3TEZA 2P5BA 1PX4A 2R49A 3BALA 4YGDA 1QXPA 1F5JA 3K4DA 4CRQA 3E6BA 1BBT2 2GAUA 2FQPA 1V70A 1YXWA 2CWSA 1W2UA 1ZZ6A 1GV9A 2QNKA 2UU8A 3H3LA 3KGLA 1AR91 4XBQA 1D2SA 2EIDA 2MEV2 4W6XA 1B09A 3I2HA 4MV2A 2J1VA 1ZYBA 1W8UA 2R042 4HONA 3IAQA 3V0AB 3ZYFA 4E4HA 1CIWA 5KXCA 4TTGA 4Q8KA 3USSA 4Q29A 4Y1ZA 4ZU5A 4I02A 3M4FA 2C6SA 4YG6A 4O65A 1JOJA 1IHMA 4QM8A 4BLJA 4Y22B 4AGRA 3OY8A 1NXD1 4CP1A 4RGKA 4DRRA 1S1AA 2DTYA 2HWF1 3VD3A 1UCXA 3BB6A 2NLRA 1W6QB 4YFZA 3VD9A 2JENA 1BMV1 1AYN3 1VMJA 1Z7S2 5IT6A 1G6NA 3O1RA 4AVAA 1I6XA 4MHUA 4XUQA 2EICA 1DQ4A 1KITA 5A6ZA 3O1TA 1J3RA 4HANA 1YLLA 4CUAA 3WG1A 3M1HA 1SLLA 2D93A 3Q8CA 2QFEA 1RVF3 4HVOA 1ZM1A 5A7OA 2H0BA 1S0DA 3RZMA 2DVAA 3JZVA 2DVGA 2XR4A 3SCFA 5A1LA 3VDCA 2WT0A 3CL1A 4BHPA 4KGQA 4LEJA 1W6NA 2PHWA 2NZ9A 4NRPA 3O7OA 1D7PM 3DN7A 3EO6A 5HI0A 1S0JA 1WWYA 5FMDA 4ZPIA 5EZWA 3MPBA 5FRAA 3UETA 3S5AA 1RUH3 2ZEXA 3ZPOA 1ULEA 1D2QA 2JG8A 4PHZA 1RUD1 2Y6FA 1OA2A 3LCPA 4XETA 2XQRA 2Z4FA 5KWRA 1MR5A 1ULDA 3ZYRA 5FXVA 5C3OA 3UGHA 1D4M2 2ZKNA 5JZGB 3MIEA 1LENA 1RUE1 5BYNA 5JOZA 3WQBA 4R9DA 1WLWA 4ZONA 4D6RA 3CJIC 1W03A 1CN1A 1ZX5A 2JJ6A 1YIPA 3PU3A 5K0UA 2PAKA 3FC0A 4C91A 3FZ3A 3I3QA 3ITQA 3AMNA 2VOVA 3QH6A 2DCTA 3L2YA 5FY8A 5A33B 3M2MA 2W1UA 1X36A 1LOFC 3RRDA 1A3KA 1ZNPA 2O0OA 2WO3A 4IE6A 5FP4A 5BNNC 1MPXA 4HPKB 4GULA 3OEAA 3PHMA 2QQNA 4N7UA 5D8AC 3FHQA 5I0TA 1GQHA 1UAIA 3H0OA 3FFZA 3IB3A 5GLVA 3W5MA 3VBUB 1UMHA 4BWOA 1TMF1 4B29A 4NIHA 5ABJC 1UN1A 3GNEA 4AEMA 1PGL1 5HCHA 1POV3 5GZDA 5E89A 1LRHA 3KWVA 3U4SA 5L9VA 2W94A 2WNVA 2WA3A 1FV2A 2Q4SA 5IWFA 3PVBB 1Q8QA 1VE0A 3I3DA 4LT5A 1GUIA 3HT2A 4RQPB 3ILRA 1XE8A 3LIHA 1MS9A 3GHNA 2VJXA 1Y9QA 1A6CA 4KMQA 2ZBJA 5JMCA 2ZAHA 1HQLA 1OUXA 5KHHA 1HJGA 4CCKA 2WQ8A 2D6OX 3PDQA 1JU4A 4DY3A 1I9RA 4JDMA 3SCGA 4AZZA 3ZFFC 1DGRA 3OEBA 1ZA7A 3FL7A 3UKTA 2K2SA 5FXZA 1WCQA 4Q4Y2 1QJX1 2JIGA 5GKAC 1H30A 4Q0PA 5F3GA 4A7KA 5ACA3 1R093 4LK6A 2WT1A 4XVHA 1AXZA 2GN7A 5L7OC 1COV3 2WYFA 4MGIE 5C9AA 3WW4A 2P2KA 4WM8B 3AZVA 5FZEA 2Q8CA 1RUJ3 2HWC3 2WYSA 4XBLA 1VALA 5JOWA 2CAUA 3W5NA 3RZHA 4XW3A 4NR1A 4FAGA 2FZ2A 1JYTA 3T4HB 4UT5A 1CAWB 1NA1B 2DBNA 4R9CA 5L9BA 3WW3A 2R32A 2RHPA 4LO6B 4DY5A 5IATA 2Y0OA 3BOPA 1E57A 1Z7S1 1QH6A 4CUGA 1CX1A 4CEWB 3C7GA 2UURA 2WRAA 2PLV1 4KBBA 4A45A 1KD7A 3A0KA 5KXEA 4WVVA 4OMDA 3M3QA 4IUGA 4QQHA 5FBZA 4AVCA 2JG8C 2JDUA 1TE1B 4GKYA 3H50A 3RZZA 2B7YA 1SLTA 3L9JT 2RS33 2EVXA 2VQ0A 2WT2A 1BXHA 3RQ0A 4XJWA 2A7AA 2IUWA 4BDVB 2AYHA 1MACA 1MQTC 1KS5A 2HWB3 2Z69A 2AACA 2HJIA 2XJUA 4CCDA 1S0IA 4C0BA 4QDRA 3EHKA 3WUCA 1UPIA 5K0UC 3WNKA 4F3JA 1SQ4A 5DUWA 4NO4A 2R1DA 3TWIA 1W2OA 5FXWA 3OPWA 3GJBA 1ULOA 3ZO0B 1OPOA 3VBOC 1E5RA 1RMU2 3VBSA 5FUNA 5IK4A 2XJPA 3P1IA 3T08A 5JCTA 3PVEA 2YFZA 1LHWA 2XDVA 2VBDA 1NCRA 2A6XA 4N43B 5F1RA 1OSGA 5EJZB 2ZTNA 2ZMNA 3A23A 4TSVA 4AFMA 3ZDSA 1JZ5A 2XBO3 4NWVA 5T5JA 3I2JA 5GLTA 5CG8A 3U4XA 1NCQC 3ALQA 3JBG3 3RJRA 4Q4Y3 2XVKA 2VZPA 1Q56A 4ONUA 4Y26A 1GZ9A 1HXS2 4QD2A 4B7KA 3D3AA 4OI2A 3JD73 3MBWA 4KG8A 1CPNA 4R9AA 1Z0HA 4JKLA 2R063 5FV3A 4PI0A 4TXWA 2RR12 2D7FA 2OIIA 2VZRA 1BVP1 2GALA 4MYEA 2OPWA 4M00A 4HL0A 4NRMA 2UYBA 2XG3A 5JR7B 1OOPB 1ONAA 4QQLA 4NHXA 1DLCA 2VG9A 4XFHA 3KLSA 1W6MB 2VQTA 2GP5A 4AWDA 5JPNB 4I0BA 1IS6A 3T2OA 2XWJB 2OA2A 5FZ3A 1GP4A 3H3ZA 1NT0A 5A32B 5FOBB 3MIGA 1WW6A 2ID4A 3LSDA 3OY8B 4GA9A 4LR4A 1XNAA 1QGLA 3KQRA 2VM9A 4XIOA 1ZBA2 4D6QA 1MQTB 2D5FA 2HYXA 4DO0A 4JZRA 4MHRA 2GH2A 3MIBA 1V6LA 4XZPA 1J3QA 4XUOA 4XJUA 2C26A 1EAH3 4CCMA 1BYHA 3S57A 4JRLA 2DCJA 2HWD2 2TEPA 2Y60A 2JB8A 3M7AA 4LBLA 4MXVA 2WZR2 4WZFA 4FFFA 3SEPA 4WM8C 1RUOA 3ZKUA 2VY0A 3UNPA 3I2OA 1FOD1 1H4GA 2ZGLA 1BZWA 5G04L 3ZFEC 4EN8B 4YM1A 4RR3A 5DN2A 4ES8A 1RYYA 1UYXA 2VUJA 4LXLA 3FHIB 1LU1A 1W6QA 1PK6A 3POYA 3PMEA 3IZOA 5FBJA 1ZZCA 2HEVF 2EXHA 2CV6A 1MZFA 2RG4A 1RUI3 2X5IC 4L92A 3LEKA 2WWSA 1VBB1 1X7NA 1YHFA 2D6PA 3EQEA 4JTNA 3LSEA 4RN5A 4Y1VA 1VBB3 4URAA 5DMYA 2CL2A 1ENXA 1TG7A 2GC2A 4LBQD 1U0AA 4DS0A 2FCUA 1ZBE2 1RUH1 3N7MA 2E51A 1AUYA 1LKNA 1Y7BA 4LQRA 4Y4RA 4A42A 4BM8A 4JQTA 4XF9A 1OT5A 1CAXA 1TME3 5A3TA 1ASJ2 3OGJA 4XE9A 5JZGA 2JDZA 2P6HA 1DGWA 4J1XA 5C7GA 4FT8A 4CEYB 3IBMA 2PFWA 2RDSA 2RV9A 1R082 2R062 2LM3A 2XMLA 1AF9A 2DWRA 2NMNA 1DYOA 1WZXA 3OJBA 4FP2A 4YGEA 2CGOA 1Y9MA 4NAOA 4AEDC 1NCRC 1UMZA 4Y24A 2H0VA 3MGUA 2YY1A 1L7RA 5JSOA 3GCWA 4IESA 1WCDJ 2WNUC 4QDSA 2ETEA 4LE4A 4CDQC 2CHHA 4ZZ5A 5JIUA 2QVSB 1JZ3A 4Q8LA 3IIAA 4XIKA 5K9YA 1YQ5A 2D44A 2AZ5A 2VCBA 4EZHA 2XLFA 4CDXA 1R1A2 3NJYA 4DUWA 1JZ2A 4F83A 1J83A 1FMD1 1GNHA 4Y5Z0 3WF0A 4N53A 4JC1A 2BNNA 3P3NA 4RSUA 5D8AB 4MH0E 1W9YA 4ZZ8A 2DUPA 2PQQA 2MHFA 2X53S 1DGWX 2A6ZA 2EIEA 4R9BA 4XCBA 4XHXA 4AL9A 2QJVA 2EAKA 1CAVB 1QDOA 2WL1A 3HEIA 4NHMA 1LOFA 4FPKA 5TSWA 5LZ6A 2PN5A 2WFPA 1W06A 3I4IA 3HT1A 3VBFC 2GC1A 2W9XA 5L9RA 2W3JA 2QQJA 4UYBA 4FPGA 4GB33 4MGYE 3T0AA 4DXTA 1VRH3 5KHKA 1PIV1 1AR93 1G9AA 2HWD1 1GR3A 4QU2A 3TYJA 1C5IA 2FZ1A 2ZMKA 2V4AA 1VRBA 3W58A 4ARYA 1ND2A 1DHKB 3WNNA 3VZOA 1O8PA 4DRVA 4JDNA 4LBNA 2G4IA 1NY72 3POJA 4A4AA 2ARXA 2WFF2 2WNVC 5APAA 4AR2A 3K4ZA 1H2KA 3Q8FA 3TEYA 3IWZA 2ZGPA 1UOBA 1IS4A 4MUVA 3R4DB 5CZKA 4BZ4A 1WLCA 4S2DA 1ODNA 1K45A 1QNWA 2JD4A 2DURA 1SBFA 4Q2FA 4NWWA 4RR3C 5C9AB 2XPJA 1H1AA 4TLFA 2RM21 4IGOA 2P4EA 1W6NB 2QCSB 5GLWA 3PUHA 4GH4C 1WBFA 4BQ3A 3ZR5A 4GMP0 5D2AA 4AI9A 4Z92B 4AFDA 4KU7A 4LULA 5FZBA 3BGAA 1UY0A 3KVAA 2WFF1 2W1QA 3GGLA 2VULA 2VQUA 2JE7A 2E9QA 2VW1A 3B3QE 2YPJA 4CDUB 3RZKA 2HWF3 1DQ2A 2CNAA 3ZN6A 4GJZA 2LROA 4PIYA 2I45A 4FO9A 1HQNA 1LULA 1TMF3 3IN9A 4UXAA 4D6SA 4P9YA 3AYEA 4XYXA 3UKVA 2UWCA 2IXHA 4IEZA 3O1OA 2R072 3H1WA 3LPFA 3H8XA 2RS13 4LITA 4AYUA 4YVWB 4COYA 2HKXA 4LOTA 4HKWA 5DQ0A 4RGGA 3DPRA 4PDWC 3Q9OA 5LWBA 2QQIA 1UNBA 3I59A 4WVZA 1J84A 2ARCA 1UYPA 5L73A 4BE3A 3HNMA 1PGSA 1OKQA 3B93A 3DCQA 3DYOA 3WT3A 1DLLA 4GJYA 4CEWA 4DOUA 3ME2A 4DNYA 1AXYA 1EP0A 2AR6A 4QGMA 3VD7A 3DF0A 2XVLA 1RUD3 3AKRA 4KWLA 5C33A 1CONA 2CY6A 2DCYA 4MADA 5HV4A 2CDPA 2J1UA 4OHYA 5CKNA 1AJOA 4YZ2A 2VR4A 1O59A 1ZZ9A 4M3CB 1P8JA 3O1SA 1HRV2 3B01A 4Q4W1 5T54A 4Z1VA 5K4LA 4OYUA 1OQDA 1GMMA 4NIDA 1SDDB 4N53C 2XOMA 1UIKA 4LLOA 3VKNA 2B8MA 1QJU1 3W9AA 3WW1A 3ZMOA 2VVEA 2WZEA 1O4TA 5FMOL 3VHNA 4NN0A 3POWA
chains in the Genus database with same CATH topology
4BOWA 1Q8SA 2GZWA 3HMYA 4KQ7A 1PVC2 1OOPC 2FMYA 3VBFA 5GLZA 1FOD3 4E27A 3GBWA 2ZHKA 4P9IA 2VOKA 3ZN6B 2DVDA 3VDDB 1XQNA 2YGMA 2HWE1 1YFXA 2ZGTA 4LBQA 3LWCA 3J9SA 5LRRA 1ND2C 4P9JA 2JEMA 3I54A 4Q27A 1YI9A 4Z82A 3V65A 3NO8A 2QQPA 1X33A 1ZBE3 1LB2A 3SH5A 5KHGA 2XWBB 2Q0AA 4YLZA 3VZKA 3B5LB 4BMEA 1C5HA 1YNAA 3NAPA 1BVVA 1R083 3MLKA 3MW4A 2VOWA 3VBRB 2ZABA 3JB8A 4S2HA 4WV8A 2RMU2 1XE7A 2ERFA 3WCRA 1H2LA 4DXZA 1Z78A 4GWNA 5FLIA 3PTYA 1CESA 1DZQA 1BCXA 1KDKA 1IS3A 4LHKA 2TNFA 2GC0A 3WV6A 4FOWA 1QOSA 1O91A 1AHSA 2Q5TA 1FMD3 5SV8A 1EAH2 5T5LA 1ZBE1 2Z5WA 4RHV2 4QM9A 1GZWB 1GZCA 1HRV3 4UW5A 3DPRC 4PDWA 2JE9A 4INDA 4XXAA 1AL0G 1LOAA 4LE3A 4YGCA 1COV2 4S2FA 5E1RA 2CTVA 3INAA 1ZZ7A 3VBFB 3VL9A 4AK3A 3JD72 3B94A 3NV2A 5CFDC 5GZCA 3IDCB 3EJKA 5BXXA 1AR62 4K1ZA 1H0BA 1WW4A 3R4SA 3I7DA 4COVA 4EV0A 1NCRB 4N43A 4K8FA 1VIWB 1YJKA 1VR3A 4YFWA 3RG0A 4CYDA 2XJQA 2R6QA 4PLNA 3VGIA 2JG9C 4AHXA 3AP6A 4ES9A 1MEC2 3BU7A 4IL7A 4Y20A 4ATFA 1PVXA 1MZEA 4LO4B 3ZX7A 3D0SA 1TEIA 4ORFA 2BEOA 3IPVB 2ZGRA 1ND3B 1V6IA 1OOPA 3KSCA 4W6YA 4RHV1 4N53B 3ZYIB 1RUG3 2ZAAA 4Y22A 2IWGB 3SMHA 5H9PA 5HCBA 2O8OA 2Z2SB 1NQDA 1GANA 1HLCA 2XB6C 1EYBA 5C6CA 2BBVA 1WD3A 5JIAA 5BY5A 1GZWA 3M3CA 4NHKA 4J6GA 1OA3A 3J8F2 3VBUC 4EWAA 3AM2A 4YW2A 4FTEA 3VKLA 1AX0A 3R4UA 4CZSA 2EF6A 2BUKA 3GHMA 4URTA 4KWKA 4OI0A 5CB7A 4ISQA 5JOXA 3I8TA 1GYKA 5JLVA 2RS52 3NWKA 4L97A 2X29A 2CWMA 2ZKLA 3CO2A 4Q4X3 2ZJCA 2HEYF 1PVC1 4PBPA 5C8WA 4SLIA 4RS5C 3ZIXA 3O0VA 4IETA 2N7GA 1URXA 4RGAA 3HD8B 2B5HA 2P3KA 4CDUA 4EWDA 2IXIA 3UJOA 2DYCA 1J1TA 2VH9A 2XLGA 5DZGA 5K0UB 1N1VA 1A8MA 3E97A 1QOTA 4QQ2A 4OHXA 4KNCA 3HN1A 5T52A 3AXEA 4H14A 2W08A 4N43C 1VAKA 1LR5A 3KMHA 1VBA1 5GALA 3WOGA 2YUEA 1KFXL 5J36A 4AI3A 4AVVA 1W6OA 1RUC3 2Q8OA 5FPXA 5CG9A 1WW5A 3B9IA 3WDTA 2BWCA 4XILA 1O3SA 4LHLA 1PNGA 3VHRA 5KXDA 2MEV3 4EN9B 3FLTA 1OD5A 1BEV3 4M01A 5I0UA 4R52A 1MS1A 3WDXA 3M3IA 4JAAA 1AYM2 1F5FA 1W6PB 4PBOA 1V6KA 4Q4W3 2PYTA 1C4RA 3IKWA 3ILFA 4RD7A 1YFWA 4EJRA 1ND2B 1QQP1 2BGCA 3ZXGA 1QQP3 1QXRA 1U12A 4JGYB 2X5IB 1ZBA3 5EV7A 1LECA 1CJDA 4LBMA 4I2OA 2Q30A 1OPMA 2ZGNA 2DTWA 2OVUA 4CDQB 1R092 5FO7B 2WNEA 3R6SA 1NQJA 3N7LA 2RS11 4LBJA 4BQ1A 1HXS1 4YVSA 4JRAA 3T1MA 3AKSA 1RUC1 2E7TA 4AHZA 4FAHA 4RQPC 1KFUL 2ZGMA 2YGLA 2ZZJA 3NV4A 2D40A 4XJ9A 3MFCA 1EAH1 2PHXA 3AP4A 1ZRDA 3MIDA 3H1MA 3PVOA 1AR72 4LNVA 1O4YA 3J4UH 4UBGA 1Y3TA 2D3PA 2E7AA 3PLQA 4JV4A 2RR13 4JQRA 1I5ZA 4HETA 4XFCA 3KB5A 2R041 1CVNA 1HV0A 3JUUA 2RJLA 4IV3C 4OFGA 4FP3A 4XQ4A 5K7PA 1XYPA 4Q0VA 3W59A 1RC6A 1C57A 1SBEA 1SCRA 4IEXA 4JGYA 4B7EA 2MNGA 4Q4W2 1XNCA 5I8SA 4IEPA 4FBFA 5C8CA 3KT1A 1J1LA 3DL3A 1EPWA 3B00A 5E16A 1PMIA 1M06G 1SFYA 5HBAA 1JN2P 2X8KA 1REFA 3WY6A 4Z2WA 5FAXA 4MSVA 4A7YA 1UU4A 1MZ6A 1UX6A 1DQ1A 3X29B 3LZZA 2WSUA 1OA4A 2R30A 2R043 5H9QA 3WLUA 2Z79A 4OHVA 4Y1XA 1FI2A 2WZR1 3H9AA 1Q8VA 3M3OA 4Q1PA 1VBE1 4UBHA 4R8HA 2ZS6B 4YG3A 3VBSA 2D6KA 1RUI2 3ZPYA 4AFCA 1JUIA 2ZGKA 1ZVFA 1YYNA 1LHUA 4QQOA 3E5QA 5BNNA 1RJ8A 3AFGA 5FTTC 1HRV1 4FPHA 4C1XA 1RITA 1CD3G 4K1YA 2NMOA 2YC0A 2R0HA 2YV8A 2XGXA 1O7FA 2XJRA 3ROUA 4XF4A 3S0MA 4E9KA 1BK1A 3VBRA 5BPXA 2UY9A 4A7ZA 5ABJA 4XEZA 4YZ3A 3USUA 1FPN1 4U36A 1Q43A 2DV9A 2PLV3 5C4WB 1FNYA 4XBNA 3ZXFA 2ZGQA 1AR63 1HQWA 3THPA 4N90A 3U07A 2P3JA 1RUI1 5I0SA 3IMNA 1C8M1 1V9U3 1LEDA 4AGVA 5L19A 2ZCWA 2HYKA 4WVWA 4BLIA 3SHRA 5JPMB 2P3IA 1QOOA 4XFBA 1WW7A 1ND3C 4S2GA 1CQ9A 3NKTA 3R05A 4AFAA 2XVGA 1PVC3 1VLNA 1A8DA 3FBMA 1N1YA 1XNBA 1AR81 2V09A 1LODA 5BNOC 3WG2A 4NOTA 4AVBA 3RI8A 1S2BA 1D0HA 1UZZA 2C1FA 3SLIA 4GWMA 4I01A 3RNSA 4AEJA 2QUOA 4KGGA 2AH2A 4XJZA 2BNMA 3EXUA 4D7TA 4KL1A 1PIV2 2R061 1LU2A 3WP6A 5J37A 1S0GA 4PLOA 2YXSA 4BA6A 1XNDA 5DUVA 1XNKA 2WZR3 5CADA 3VZLA 2WKKA 2D98A 2HWE2 1VBD1 1F9KA 3VBSC 3AP9A 1VB4A 1OQ1A 3OBTA 2UYAA 3H1YA 5FOJB 1GQGA 4L9BA 3VBHC 1LOBA 3O14A 1H8TA 2CYFA 1X50A 2YDEA 1CJPA 4XFGA 1ULCA 1GLHA 4LUMA 5E88A 1QU0A 4E4ZA 4WVMB 1BMV2 4W6WA 4PIZA 1K5MB 3N3HA 4SBVA 3VBRC 5F6KA 5C4WC 4FQ4A 1VAMA 2Y26A 4BCUA 1B35B 2WA4A 5FREA 2R0FA 1ZREA 1IS5A 4Q4V2 1EV13 4CDWB 4NHLA 4EROA 1EV11 1WMFA 2I74A 4HFSA 4FQZA 1ZZBA 1RHI1 3WCSA 2GMMA 1UU6A 3K51A 1SLAA 1NXMA 4E2SA 2AENA 2A3WA 4Y1YA 4OI1A 2C9AA 3WHTA 5CBLA 3MLLA 2BVBA 1U5YA 1DU3D 1SMVA 5D8AA 2IFRA 4D69A 4WZCA 3O0XA 1WBLA 3PJQA 4OHWA 1TMF2 3DGTA 4ZU4A 1UU5A 1SLBA 1U5IA 1VBD3 4YM0A 2D6MA 4K3UA 1SACA 2R1BA 4I3GA 5L36A 4LTAA 1V9U1 3MLJA 3RYPA 3H8UA 5JI7A 1NE4A 5H9SA 4YVSC 4TWTA 5FLJA 1XRUA 4OHZA 4WM8A 4WM7C 1YO8A 3H3UA 1AR61 5ACA1 4AHYA 2EA7A 1OFSA 4LO5B 1UL9A 4CEYC 1RUG1 3ZFEA 1OHFA 4AHWA 4DINB 1D4VB 2ZGUA 2RS53 4Q0UA 1XU1A 5I91A 1K5MA 2VNRA 1KQRA 3ES1A 5CVRA 3WDWA 2QZ3A 1B35A 2RM22 5CFCB 5EYYA 5KXBA 3ZFGC 1YUDA 4IV1C 4CDWA 1RJ7A 1S0CA 3G7DA 3AYCA 3VL8A 3V0BA 2EXKA 4AW7A 2EXJA 3FWEA 1JXNA 3RWNA 2HWE3 2ZOEB 1RUJ2 2HWC2 4KU8A 1N1SA 2PHRA 3RYRA 2Y38A 2KXLA 4P5HA 2IFWA 2ZHNA 1AXKA 4LBQB 3JBG1 1AL23 3VBHA 4IV3B 3WD5A 2DCZA 3LA2A 1FAYA 2ZHLA 4GXLA 3QLQA 2EXIA 2ZA9A 3ZSJA 4LO8A 4N7IA 1VRH1 1QHDA 3TRSB 2A70A 3LA3A 5EJ3A 1N3PA 4CDQA 1FMD2 3AZYA 3LAGA 4K9SA 3FLRA 3PJYA 2VVDA 2D97A 4MLOA 3RMYA 4EWEA 5AC93 1VBD2 4Z07A 3I2DA 4M3CE 3ZYGA 2DU0A 3AKQA 5IK5A 1QDCA 1QWRA 5ABJB 3RS6A 1G9FA 1X82A 4GH4B 1JUHA 4YW4A 1O5UA 5FMOS 3E5UA 5CFCA 4FPLA 2OZ6A 3FLPA 3IDBB 2EAAA 4FOQA 1ENRA 4NPRA 3TB0A 5GZGA 1POV0 2QZ2A 3SNMA 4ASMB 1RUH2 1UKGA 1V00A 3VN4A 3AZWA 1JYCA 1VBA3 5CIRA 5A32A 4IEUA 1Z7S3 4FTSA 4NVPA 1H9PA 1HKDA 5GZFA 4A3XA 1GKBA 3TN93 5I0RA 5J96B 4N9IA 1OI6A 5KHJA 2E6VA 2YROA 4QPGA 2WS93 2E63A 2PLV2 5AVAA 3WP3A 1RGSA 4META 2XL7A 4HBNA 3VKMA 3AYAA 4MX3A 3WQ7A 4UW3A 1GBGA 4EN7B 2XJSA 3WQ1A 4LO7A 3MF6A 2A6VA 1LHVA 1MS0A 1QJX3 1HV1A 1DQ0A 3OYWB 1RUF1 3OTFA 1C8M3 3VZNA 2ZX4A 3BODA 1QJU3 4H7MA 1AYN2 3SXWA 1PK6B 3NSTA 3NW4A 1CGPA 2P34A 1GNZA 3N7JA 4W65A 3J8F3 3TN92 1ND3A 1KDMA 2XBO1 1V6JA 4M3CF 4GQ7A 4K20A 4YZ5A 4OI4A 4Q1RA 5BNOA 4L2NA 4JTOA 3AJYA 4RFT0 2ES3A 1SFNA 5I8YA 1LHOA 3FE5A 4E4DX 3V0AA 3T1LA 2RE9A 4PCRA 2XUMA 1W39A 1QQP2 2FBEA 3A0NA 1OLRA 5L7OB 1NLRA 3GZAA 1AR73 2P37A 4XHBA 1LCLA 1D0GA 4QPGB 2D6NA 4E2QA 5CU1A 3WP4A 2IXKA 2GDFA 1FNZA 2G9GA 2VNOA 2WQ4A 3M3EA 3CJIA 1QH7A 1OLQA 3AK0A 1CAVA 2VECA 4P9LA 4YGBA 1R1ZA 1AR83 5AVPA 2RJKA 4FPYA 5IK7A 1F8VA 4JVAA 5CA6A 2SBAA 3V64A 5CFCC 2JICA 2JX9A 4KG0A 4X8PA 4FXGB 1GICA 3CF6E 3LGRA 2PHDA 3NJZA 1DYPA 4AXOA 1QJZA 3C3VA 3M70A 5GM0A 5GZEA 3UL2A 1X8MA 4YZ1A 3PNAA 1JW6A 4IV1B 4CDXC 4HSLA 4BIFA 1N3QA 1DYKA 5IUQA 4AF9A 1HX6A 3MEPA 2D5HA 2BQPA 1VBE2 4HKOA 1WD4A 4XDQA 1DIWA 3MICA 3S7EA 3ZSEA 3VV1A 5KHIA 1GFF2 2RMU3 4PQ9A 3D5OA 3AKPA 3ATGA 3ZMNA 5SV5A 3ZFFA 4LBOA 5A3LA 4L99A 1AR71 4XF0A 3E5XA 4E4SA 2WS91 4WM7B 1OQEA 1VB2A 4QPIB 2D43A 1PNFA 5FLHA 5T50A 3LA7A 4FPJA 2RS12 2JECA 1RUC2 5C9AC 4JGZA 5GJ6A 1HXS3 2RM23 1N47A 1J58A 2W52A 4I30A 1WUVA 3OCPA 2Z42A 3WINE 1DGLA 2XJTA 4OZXA 5DG2A 1C8NA 1RHI3 4IEYA 3DPRB 4Q4Y1 3ENRA 1FX5A 4P14A 1R091 2NYYA 2DCKA 3J8F1 1YWKA 1ZBA1 2NPIA 4R4ZA 1BJQA 3JQXA 1TNFA 3AX4A 4BPZA 1QNYA 4L11A 4Q0SA 4COWA 1G9BA 4BMBA 1G9CA 4OUSA 4IV1A 4CDWC 5JOYA 3V56A 4BYYA 3HQXA 3IDEA 4XMAA 4M3CA 1QJY2 1A78A 5DZEA 1FPN3 3ZYPA 1WA4A 2UY8A 3KCXA 3VHPA 4B4PA 1CPMA 3MZHA 2A5ZA 4QQPA 1WMEA 4AVTA 3VUOA 4EN0A 3FUOA 4FCAA 4MXWA 4CEWC 5KBFA 2WLPA 1LOCA 1PGL2 3B9CA 5KC5A 5BNPC 1RINA 2IXJA 4AEDB 1NA1C 1Q3EA 3ZXEA 4QPIC 2B9UA 4GIQA 4YW1A 4YM3A 4X6QB 3ZN4A 1NCQA 3AMPA 1AX2A 5DDJ3 3AZXA 2R073 3KT4A 2ZPXA 4QGLA 1DQ5A 1G8WA 1ALYA 2F4PA 1C1LA 1IQAA 5AC92 3B69A 1VBA2 4P9XA 1JHNA 5DZFA 3RJ2X 1D4M1 2PELA 1YI7A 2DFCA 1W0PA 1DQ6A 4N9HA 3BCWA 3UV9A 1EV12 5FPZA 4HKLA 2AREA 2VOXA 1HW5A 3TBDA 1RHI2 1YRZA 1LOGA 4XPVA 3LOIA 1AYM1 2ZX0A 3LKJA 1MVQA 3DKWA 3TNQA 5BNPB 4K7JA 4ZU7A 2VQAA 4GMP1 4H55A 1DG6A 4JGZC 2GNTA 3AB0A 3GYDA 3DV8A 1PO12 3E6DA 1PO22 2XBO2 2HWD3 4HVRA 2AGSA 5FQ0B 1BEV2 2NQYA 1LGBA 2GN3A 1PZ9A 4F8AA