3V65A

Crystal structure of agrin and lrp4 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
191
Chain Sequence
ALETLAFDGRTYIEYLNAVIESELTNEIPAEKALQSNHFELSLRTEATQGLVLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLRSTVKVNTNRWLRIRAHREHREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDAVTKPELRPCPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Agrin
publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 35
structure length 191
sequence length 191
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3v65A00
2DU1A 3PJQA 4DRVA 2D6LX 1DFQA 4ASMB 2Q5TA 1OQ1A 3JU9A 3DUIA 2D6OX 3HMYA 2ARXA 2GNBA 2DUQA 3WG1A 1SLIA 3O12A 4Y20B 3WDWA 3WUCA 3ZYRA 2YMZA 1QOTA 1DYPA 2P34A 4GXLA 5CNAA 3T1LA 2WQZC 3WNXA 3UK9A 4FPEA 2OW4A 3BODA 3PMEA 3AXEA 3A0NA 2NZ9A 5CA6A 2HYKA 1LULA 4YGEA 2DVFA 2VU9A 1LOFA 5GLWA 2ZGNA 5BYNA 3AFKA 3ZSJA 3RRDA 1ENSA 1CONA 5EYYA 3FFZA 2AR6A 1WBFA 3WG3A 3WDUA 3ZYPA 2I2SA 4Y1YA 1O4YA 1G9DA 5AVAA 1BZWA 4XIOA 2JD4A 1Y7BA 3FBYA 1MS5A 1HDKA 3AP6A 4YG0A 1KJRA 4YLZA 1XQNA 1SACA 4HL0A 4DPNA 1LENA 2W68A 1LOBA 4YM1A 4FOYA 1GBGA 4U36A 1AF9A 4W65A 3VKFC 4YZ1A 3CNAA 2CY6A 4FPOB 4M01A 3SITA 5KXEA 1JYIA 2ZGLA 4DS0A 1CIWA 1AX1A 1WLDA 1V6MA 4FPYA 2DVDA 4NO4A 4YW1A 1S0JA 3VUOA 1EPWA 5E88A 1GANA 2B7YA 1QOSA 3LSEA 2ZACA 1WLCA 1MZ6A 3FUQA 4FQZA 4RL7A 5F9TA 1DHKB 2PHWA 2NP0A 1W6NB 4JC1A 4XTMA 1AJOA 3AZZA 3AZYA 2GN3A 3RMXA 1AX2A 4LBOA 4XOGA 4FPKA 5EWSA 3M1HA 4XHXA 2ZGTA 4FPJA 2AYHA 3OBRA 1JUIA 1CESA 3USUA 5JDBA 4BLJA 1W6QA 4ISQA 2VY0A 5JOZA 3V65A 5GZCA 3VKMA 1ULGA 4LBQA 1UN1A 3V0AB 1G86A 2EIGA 1FNZA 1LEDA 4FP2A 4GWMA 1BJQA 2EXJA 4K1ZA 3T1MA 4Y24A 3WDXA 1H9PA 1KITA 1HLCA 4R9CA 1MS4A 1DLLA 4Q1RA 1VLNA 1JBCA 2ZMLA 3AJZA 3FLRA 1UMZA 3AXDA 5GZFA 1CJPA 4P9WA 1ULCA 3V0BA 1IOAA 1MS1A 5GM0A 1R1ZA 5IK5A 3MW2A 1LODA 1DYKA 4Q1PA 2YV8A 5KXBA 3AK0A 1W6PB 2R49A 1QNYA 2YXSA 2EALA 5T52A 3ENRA 4CRQA 2UU8A 4XILA 5E8AA 3FLTA 3LSDA 2NM1A 1LCLA 4WVWA 4BPZA 1GZ9A 4JRAA 1J1TA 4ATFA 3T2TA 1GNZA 5GLUA 4MYEA 3I8TA 1S0BA 1W6OA 4TYSA 1S0DA 4XJWA 1WW6A 2FHRA 2DTWA 3WDTA 1CPNA 3ILRA 4YM2A 1SBDA 2WJSA 1MZ5A 2ZGUA 2TEPA 1F5FA 1QF3A 3APBA 2D6KA 4GKXA 3OJBA 1A3KA 3WHTA 2DVAA 1BXHA 3AZWA 3RMYA 3C2UA 4XYXA 1GYKA 4YGBA 2ZKNA 5IK8A 4XTPA 5HCBA 3ZSMA 2WSUA 3D6EA 1G9CA 2VUAA 1MVEA 1Q8VA 1WCSA 2A7AA 2GN7A 3NV1A 4UW4A 1BKZA 3INAA 4PBOA 1LHOA 2AH2A 2E53A 2E6VA 3IMNA 4XDQA 3IPVB 1SLTA 1Q8SA 1RINA 1ZA4A 1WUVA 2KM2A 4FPLA 5IT6A 1S0EA 4BQ1A 2D3RA 3ATGA 1LU1A 2UWBA 1DQ2A 5GALA 2PELA 3W58A 2C5DA 4BMBA 3AP9A 2XB6C 5DUXA 2CTVA 3WV6A 5JVVA 4UW5A 4GA9A 2WKKA 4Z8BA 3O0XA 2JE9A 3POSA 4YGCA 1ENRA 2A71A 4XIKA 2W52A 2VW1A 4K1YA 5IK4A 5KXDA 1SFYA 2PHFA 4K21A 1F31A 2UWAA 2WLQA 4FOVA 4XBQA 4C1XA 4DRRA 4YG3A 2A3XA 3Q9OA 4Y20A 3ZXJA 5JLVA 1NLSA 1BQPA 2A6VA 1IKPA 2NMNA 4M3CF 2WT0A 3ZVXA 4XJAA 5SV8A 4ZKTB 3UJOA 5L73A 3M3EA 1UZYA 2D6NA 2ZHNA 2EXIA 1WW7A 4Q26A 1MS9A 1G8WA 3UL2A 4XXPA 3WOGA 3MW4A 3WZ1A 4CZSA 2DVBA 1QKQA 1JW6A 1SLCA 2P3JA 4YZ3A 1JN2P 4H55A 5T50A 3ZPYA 2EF6A 1S0GA 3AP5A 4Q8LA 2DYCA 1VAMA 3D5OA 2PHXA 2A5ZA 3ASIA 3MPPG 3SNMA 2ZABA 5T5OA 5DG2A 3ZXKA 2ZHLA 5JOYA 2WT1A 4FPCA 3ILNA 1KRIA 1N1YA 1CPMA 4M00A 4AVVA 5DZGA 2GMPA 2PHRA 2GNMA 1SBEA 1URXA 1IKQA 1C57A 1UL9A 1GLHA 4FPGA 1JOJA 2A75A 5H9RA 3M3QA 2D6PA 1PZ7A 1FV2A 1QMJA 5T5PA 1N1TA 1H30A 1Z0HA 3WDVA 4M3CA 2G4IA 3SLIA 1ONAA 1MVQA 4Y22B 4Y1VA 1KDKA 1IS3A 4AGRA 2H0BA 2PHUA 4XE9A 4XHBA 3AJYA 3WVJA 3VKLA 1DQ6A 5E89A 5DUVA 1GSLA 2R1DA 2NMOA 3ILFA 1MS8A 3R4SA 4PCRA 1U0AA 4BLIA 3NV4A 2ARBA 3WG4A 3JUUA 2JJ6A 1CQ9A 1DBNA 1GICA 1YI7A 3OYWB 2DV9A 3N7LA 4LBMA 5GZGA 2AGSA 1N3PA 1Q8QA 1LOGA 1UAIA 2NN8A 2VW0A 3USUB 4I30A 4TZDA 1W6QB 3AP7A 4ATEA 2P3KA 5EXOA 3RSJA 1IS5A 1LGCA 4LBQB 3RQ0A 3WHUA 4NOTA 2ZBJA 1AVBA 3V64A 3SISA 3WG2A 1I3HA 1DQ4A 4YM3A 1N47A 3SH3A 2ZGKA 1RITA 2ZGMA 3HN1A 4BOWA 1DQ5A 1V6IA 3R05A 4FOQA 2E51A 1N1VA 3SH4A 3AYAA 1UX6A 1G9BA 3RG0A 5JOXA 1HKDA 2E7QA 1DIWA 1LESA 2A3WA 2A6WA 1C4RA 2EXHA 1V6LA 4XMIA 3BTAA 5JOWA 2DUOA 3M3OA 2DUPA 4LBJA 2ES3A 4AYUA 4XJUA 3N35A 2WNEA 2ERFA 1F9KA 5H9SA 2D3PA 2OVUA 3B3QE 2ZMKA 5DUUA 1W6MA 1HQLA 3ZXFA 3IN9A 2FMDA 3B01A 3AX4A 1D0HA 1GZWA 5DZFA 4AGVA 2DURA 4YW3A 4FVVA 1V6OA 4SLIA 4WZFA 3TAYA 3ZXEA 4XJZA 3HR9A 3N7MA 4F83A 1HQWA 1YYNA 4KBBA 5T55A 4YG6A 2A6ZA 2R0FA 1LEMA 4JCKA 2RHPA 2VH9A 1OFSA 3W59A 3OY8B 1LECA 1LGBA 1LHUA 4YW2A 4HANA 3IM0A 1AX0A 2ZGQA 2CNAA 1N3OA 4UW3A 1FATA 2UWCA 1IS6A 2DWRA 2GNDA 2JDZA 3IKWA 4PBPA 5F5QA 5GJ6A 1C1FA 4PQ9A 2ZGOA 4K20A 1WW5A 4GALA 2GMEA 3R4UA 2NYYA 2ZZJA 1SLLA 1V6NA 2A6YA 2R16A 4ITCA 4ISRA 2CWMA 1W0OA 2ZAAA 2D6MA 4L8QA 2AENA 4P9YA 1NXD1 1ULDA 4YGDA 3D4KA 2D3SA 2YY1A 1H9WA 1SLAA 4FQ4A 2DTYA 1WD4A 1LJ7A 1SLBA 1S1AA 5GZDA 5H9PA 2SLIA 3N36A 4FPFA 4Y26A 5GLVA 4CTEA 2DU0A 2LTNA 3VKNA 3B00A 1V6KA 1DZQA 1SCSA 1C1LA 1LHNA 4Q27A 2CYFA 1FNYA 4XBNA 1W0PA 2VW2A 1LOEA 1MR5A 3I4IA 4XZPA 5GLZA 4XXAA 1S0FA 1LU2A 1JYCA 1G7YA 1Q56A 4OZXA 4YW4A 4Y1ZA 1FX5A 3PVEA 2GNTA 3WCSA 1VAVA 2EXKA 2AREA 3WLUA 1LHWA 1VIWB 2P37A 2V73A 4PF5A 4YZ5A 2OUHA 3NWKA 4XBLA 5CB7A 4DFSA 1QU0A 5CAZA 4FP3A 4DQAA 1YO8A 1GZCA 5DG1A 4YFZA 1LTEA 3M2MA 4GKYA 5DUWA 1QOOA 1APNA 1A8DA 1SBFA 3ZSKA 1AXYA 1AZDA 4D69A 3OPZA 4R9DA 1CN1A 1GV9A 4WVVA 2XG3A 4R9AA 5FRAA 2GALA 3BOPA 1AXKA 5IK7A 4XMAA 1KDMA 5CBLA 5H9QA 2V5YA 2CWSA 1WBLA 3O5SA 2ZGSA 1O4ZA 5FREA 2JECA 4LBQD 3H0OA 2P3IA 4U2AA 4AVSA 3KM5A 4YZ2A 3ZXLA 1TEIA 3AZXA 3N7JA 1W6NA 2ZMNA 1ULEA 1DQ0A 1MS0A 4P9XA 4Y1XA 2ENRA 1DGLA 4Y22A 4M3CB 3WUDA 1N3QA 2BQPA 2SBAA 1G9AA 5LK5A 2WSVA 3LCPA 2EAKA 2JE7A 1ULFA 5T5JA 5T54A 2OUJA 5GZEA 1KQRA 2D43A 2ZGPA 1OKQA 4RA0A 1S0CA 3QLQA 5HCAA 3DGTA 1WLWA 2AUYA 1Q8OA 2UURA 1VALA 2ZHKA 2GDFA 3AP4A 1WD3A 1Z78A 3N3HA 2WT2A 1G9FA 3V0AA 4M3CE 1ENQA 3NV3A 2A70A 3OYWA 3AYCA 3KQRA 1S0IA 3OGGA 4FPHA 4XJ9A 1LOFC 1SCRA 1MS3A 1JXNA 4Q2FA 5DZEA 3UJQA 2ZGRA 3PVNA 1YXWA 4YZ4A 4XJ8A 2ZA9A 1BYHA 2YZ4A 4GWNA 3AYEA 1YIFA 1GKBA 2ZHMA 5IUQA 1Q8PA 1KJLA 3V0BB 4C1WA 5HCFA 1CR7A 3O0WA 4FOWA 4LBKA 4WV8A 3POWA 1JHNA 3VKOA 1AXZA 1W6PA 3A4UA 3MEPA 1PZ8A 4P14A 2D7FA 5KXCA 4YFWA 3TB0A 3WCRA 2W08A 1B09A 5GLTA 3AZVA 2R0HA 1I1EA 2PHTA 2Z42A 3SH5A 1W6OB 4YM0A 4AGGA 4YW5A 2A3YA 4BM8A 2A6XA 3A0KA 3ZSLA 3M3CA 1FV3A 3B69A 1IS4A 1W6MB 2YROA 2W39A 1PZ9A 2VXRA 5DXDA 2LALA 1WW4A 2P2KA 1GZWB 3BIWE 3WDYA 2E7TA 3NV2A 3U4XA 1V6JA 1UKGA 4R9BA 1X50A 1FYUA 1RIRA 1AJKA 3GNEA 3B9CA 3L2YA 2CL2A 3OBTA 4AVTA 3IPVA 1GNHA 3MW3A 3QCWA 4Y1UA 4BMEA 4IQPA 2JKBA 1UPSA 1LOAA 2C9AA 2R1BA 1ZM1A 3OY8A 4UW6A 1CVNA 3O0VA 2DVGA 3AYDA 3GALA 3N7KA 5EYXA 1LGNA 1N1SA 3VV1A 2GMMA 4Q8KA 2D44A 1A78A 1LHVA 1D2SA 5JMCA 3FUOA 3RS6A 1UZZA 4LBLA 1DQ1A 5T5LA 4ZXKA 1QGLA 1MACA 1FAYA 3POYA 4AWDA 4LBNA 1QDCA 1QDOA 3FLPA 3PVOA 1QNWA 1LOCA 1V00A 1YRZA
chains in the Genus database with same CATH superfamily
2BZDA 4DRVA 3DL3A 3VBOA 2D6LX 2E33A 4D6RA 1PNFA 3JU9A 3HMYA 2F4PA 3N9PA 5CADA 3WDWA 1OVPA 1GOHA 1LR5A 2H6CA 2HKXA 4GXLA 3T1LA 4BQ2A 5BNOC 1Q5OA 3UK9A 1DGWA 1Q3EA 4IV1C 3ZYBA 3RZGA 2KA3A 1FXZA 3NJYA 4IL7A 5F6KA 4N43A 5BNNB 5AFEA 4XUNA 2NZ9A 1VBD1 4N90A 1Y43B 2VU9A 4XF0A 5ANNA 1BBT1 1SZBA 2ZGNA 4QPYA 3ZFEC 5BYNA 2JG8A 4JTOA 2QFEA 4CUAA 5IVFA 1ENSA 3HAGA 3QACA 1TNRA 1WBFA 3FBMA 1OC1A 2BRTA 4RQPC 4CU8A 2QDRA 4AEKA 4QPWA 4HOOA 1G9DA 4HKWA 4LMFA 3AMPA 3EBRA 1Y7BA 3FC0A 3FBYA 1MS5A 1HDKA 1QQP2 3ALQA 4YG0A 3WR0A 5LBCA 1SACA 3I2HA 1LENA 2XLAA 2VOVA 3LA3A 4XF4A 4RS5C 2JDHA 4YZ1A 2OQ7A 5DAQA 1NCRB 4DS0A 1PM7A 2Y38A 3GCWA 4LE3A 4AHXA 1WLDA 3VN4A 1POV3 2OQ6A 3MO4A 3GF6A 3M70A 4X6RB 5LK7B 1QEXA 5E88A 3VBRB 1S2BA 5K7PA 2B7YA 2JWPA 4PI0A 2FD8A 3HBKA 2ZACA 4ONUA 1MZ6A 3CBNA 3FUQA 4QQPA 1DHKB 4QB1A 4LLOA 1W6NB 1NYWA 1IG0A 3TWIA 1OOPB 1AYM3 1PK6C 3RMXA 1US2A 3WQBA 2WZPP 1WMEA 4IV3A 3POEA 4LPLA 4Z07A 1A8MA 4FPKA 4JGZA 3WX5A 1QQP1 2AYHA 3OBRA 4N53B 3VBSB 2R063 4BLJA 2JG8C 3MLLA 2XQRA 1XNTA 2VY0A 5EJ1B 4DNYA 5JOZA 3SHRA 3VD9A 4P5YA 5A3WA 5GZCA 2BW8A 4YWAA 2Q1ZB 3KF5A 4K9SA 1TG7A 1Z7S3 3O1TA 2H0VA 1BK1A 2EIGA 3VZKA 3AFGA 1LEDA 3P3PA 4FP2A 2EXJA 4K1ZA 5K4LA 3T1MA 4Y24A 2Y0IA 1XNCA 3TN92 5C4WB 3LOBA 1KITA 1HLCA 1YQ2A 2BGCA 2KR2A 4LO5B 5LEJA 1ZVFA 4ZS3A 3FLRA 1YQCA 3AJZA 4ARXA 2GP5A 4QKFA 5GZFA 1UZWA 3U1XA 4BB3A 2X5IB 1GZTA 3HT1A 3MUY1 2W47A 4O7XA 4Y4RA 4D0QA 4KWUA 3LZZA 4XEZA 3AK0A 1ODMA 5FYYA 1GOFA 2PLV3 3CQOA 5BUVA 2IXIA 3N9OA 1KS5A 2DCKA 2WA3A 1W06A 4Q4W3 5E8AA 2J1AA 5FDBA 1RUJ2 4ZY9A 2XDVA 2IXHA 3ZYFA 2BNOA 1NY72 1TME2 3Q8AA 3I8TA 4YVWA 3DN7A 2EAAA 3DYMA 3AMMA 2PA7A 4XJWA 2XKPA 3R6SA 2G9ZA 3TN91 4NROA 1CPNA 3ILRA 4FFFA 4W6XA 4YM2A 4IEWA 1MZ5A 1WA4A 5FY9A 1QF3A 3TEWA 3AKQA 1A3KA 3AC0A 5C71A 2DVAA 4DY3A 1HV0A 1GYKA 2XUEA 3BVCA 2VVDA 4J25A 2AACA 5J96B 5HCBA 5HXMA 4YSFA 3MI8A 5FKBA 2WSUA 3HQUA 4XFBA 2VUAA 1MVEA 1Q8VA 1WCSA 3ABZA 3JXSA 4HKOA 5L19A 4NIDA 1ODNA 3IMNA 4XDQA 3ELNA 4AAPA 2K9ZA 1BEV3 3U10A 3ST7A 5FQ0A 1RUJ1 4XACA 1ZA4A 1WUVA 1NY71 3CHXA 1TME1 2V09A 5IT6A 1ZNPA 5FZ7A 2BOJA 2D3RA 2VMDA 5I93A 1POQA 2XLGA 3W58A 1XXNA 5FY5A 5BNQA 4GJYA 4A3XA 4BMBA 2WNOA 2XB6C 4NRQA 2CTVA 3FE5A 4M0HA 5F5CA 1VJ2A 4Q0PA 3LA2A 1OH3A 4XIKA 1QJU3 5EP9A 3UKNA 2VAUA 2W1UA 3MUZ1 5IK4A 1H6YA 3PIGA 4FOVA 3URFA 2ADDA 3CU7A 5C9AC 3U75A 1PMJX 2A3XA 3Q9OA 3ZXJA 1KS4A 4HKLA 1UO9A 4CEYA 1NLSA 1W9WA 4AOCA 4PLMA 4DZGA 1GMMA 3U4SA 2NMNA 3TRSB 3WNLA 3W5MA 5L73A 4L11A 5FYSA 2D6NA 2ZHNA 1L7LA 1G8WA 4CPBD 4PDWC 3H3ZA 3J7LA 2DVBA 2R073 5FY1A 5KHJA 1JW6A 1SLCA 4H55A 1A6CA 1ALYA 1S0GA 3AP5A 4C0BA 1XRUA 1WCQA 3BU7A 3OBZA 5CFDB 1UWWA 2ZABA 1CAVA 4EJRA 4V2VA 3ZXKA 1MZFA 1KRIA 4FPCA 3ACLA 5L9BA 5JAXA 3OOXA 1JZ8A 1AL23 1URXA 2VM9A 4QX5A 3ZR5A 2RDQA 4P9JA 3VHOA 5FBZA 4RFRB 5A3PA 3GYDA 1HB1A 4A41A 2A75A 3K51A 4YZ5A 5AVPA 2WNUA 1ND3B 4OZOA 1XYNA 4RR3B 2OZ6A 1NE4A 4MADA 4C91A 2VR4A 1W8WA 2G4IA 5JZGB 1H1AA 3PUHA 3WF0A 1OXCA 4OCTA 1KDKA 1HN0A 4JAAA 2H0BA 2PHUA 4XHBA 4BXSV 3N4MA 1RJ7A 4FBFA 1OBNA 2R7EB 1ASJ2 1UCXA 2VOTA 2ZEYA 3D0JA 3IAQA 5DUVA 5E89A 4CDXC 3ZFGC 2NMOA 4BHPA 1MS8A 4DEVA 4CU7A 3KZ4C 5FZKA 1U0AA 3J8F2 1WMDA 2Y6GA 2ARBA 3NKTA 4RD7A 3ZXDA 4HK8A 1JZ5A 1DBNA 2HLEA 2FBEA 1F2NA 3N7LA 2J42A 1ZZCA 4A6OA 1UOBA 1AR63 2YPJA 2RS33 1UQXA 3G6JB 4IERA 4CDQB 5EXOA 1NAEA 1IS5A 2XOMA 3RSJA 3Q8CA 5B4NA 2JIJA 3GZUC 2DBNA 1AVBA 5FUPA 2BPA2 4IE7A 1W9TA 4KG0A 5HCHA 1N47A 4B3NA 2ZGKA 3HN1A 4K6BA 3SCFA 3SC7X 2VMIA 3E5QA 3IIIA 4QHOA 3WW1A 2CSGA 2P17A 2ZOEB 4YVSB 1ASJ1 3SH4A 1YHFA 1UX6A 2Q4SA 3ACFA 1G9BA 4AFMA 5FZ6A 3S7EA 5A32A 4JRLA 2E7QA 5C8CA 3J8F1 5D8AC 1FMD3 3CJIB 2XGXA 3I59A 5DABA 2YPDA 4Q4Y3 4MXWB 2XPJA 5CFCC 4NVPA 3Q8BA 5BV6A 2C26A 3E6BA 5HI0A 4AYUA 1VBB3 4XJUA 2WNEA 5FO7B 3O1UA 5H9SA 2CGPA 5BNOB 2VUDA 1RL3A 1HQLA 4PQQA 4S2HA 3RYPA 3IN9A 4IV1B 2VZSA 3C7FA 2W1SA 1ZZ7A 1BHGA 1IGOA 1ULOA 1PGW2 5LA1A 5DZFA 2VTXA 3VBHA 4FVVA 5FAXA 4E9KA 3ZFEB 3HR9A 4XETA 4F83A 1HQWA 1YYNA 1ZZBA 2R0FA 4FT8A 4JCKA 4H2AA 2RHPA 5CISA 4J1XA 3OY8B 3RYKA 2XJUA 4RQPB 3N9QA 1LHUA 4HANA 4KU8A 1RMU3 3FHQA 3NAPC 5LRRA 2WN2A 5D1IA 2XLFA 4OHWA 5FLHA 5FMOS 1RUOA 1UY0A 1IS6A 1H8TC 2RS52 2RDNA 2WDBA 4QU2A 5GJ6A 4CXYA 1W3VA 4AFDA 2VECA 3OUHA 5EHDA 5FZIA 1W2UA 5CEHA 3C7OA 4K20A 1WW5A 4MV2A 5A1AA 4RS5B 2WINB 3JBG2 2NYYA 3MV11 1VMHA 1CWPA 3UGFA 4CDUA 4GH4A 1TMF3 4W6WA 1PGW1 3OD4A 4JGYB 4QDQA 3MLJA 3EMRA 4TWTA 1SLAA 1H9WA 1DP0A 1PGSA 2EIDA 1ZA7A 1R092 1SLBA 1VBE3 1NKGA 1SQ4A 1UXXX 1WD4A 2VUJA 4OMCA 4Y26A 3CEWA 3JQXA 2Y6FA 3KV9A 3VKNA 4E4SA 1DZQA 3ORJA 2BYVE 3MYXA 3WF2A 5GLZA 4XZPA 1MR5A 3TEZA 5JXJA 1PK6B 1JYCA 1Q56A 3PU8A 4MZUA 4IGQA 1FX5A 2RS51 2O8QA 4DIQA 1QJEA 1W8FA 3AMHA 2XUMA 5FUNA 1RXGA 4O9EA 1LHWA 1VIWB 2P37A 2WFF2 5JMOA 5L9RA 1V9U2 2W5FA 3JBG1 2JG8B 5CB7A 2PN5A 1JHJA 1RUH3 3RPQA 4QWNA 4DFSA 3EQEA 1J58A 1SFNA 1EV13 3GDBA 4LNVA 2OYZA 4B4QA 3LPFA 1R091 3ZSKA 4AFBA 1AXYA 5FZ8A 2VJXA 1H2MA 1CN1A 1GV9A 2VVEA 5T3NA 2LRPA 4PIZA 4JDMA 1XYOA 2V4AA 3GBWA 3PUIA 3ZYHA 1NCRA 1AXKA 4ASKA 4IE4A 1XE7A 4HVQA 1RC6A 2BP6A 1UIKA 3HD8B 4CDUC 3BPZA 2V5YA 1VBE2 2DBIA 2VCMA 1MQTA 5FMCA 2ZGSA 3GBFA 1NA1C 1RUI3 1VB2A 2WFF1 5FREA 1WA6X 1W90A 4Q4V2 4MSVA 3VBRA 2ZEXA 1V9U1 3H0OA 4U2AA 4AVSA 3OUJA 5FOBB 4LUKA 3ZXLA 1TEIA 2ATFA 3N7JA 4MG2A 1W6NA 2WS92 5FYTA 1DG6A 4BJ0A 5LY1A 2BV4A 1DQ0A 1W9SA 2J7MA 4BXFA 3FZ3A 5FPAA 2ENRA 4XUQA 2Y6JA 2R6QA 3WUDA 1C8NA 1QY4A 2WO7A 3LCPA 5T54A 1RUH2 2BNNA 4N53A 4LA2A 5B4XA 1TZOA 2D43A 1S0CA 4K7JA 1RHI2 2Y6LA 4KQ7A 3UNPA 2VMFA 3WEZA 5FPUA 4B7KA 2UURA 1WMXA 2GDFA 3B02A 3TEYA 4BQ5A 5JCTA 1VBE1 1G9FA 3W9AA 4M3CE 1JODA 4Q4V1 1KFUL 1SCRA 5C4WA 4EN0A 2OIIA 1POV0 5FUIA 1EYBA 4YZ4A 3ZR6A 4BU2A 2WS91 2YZ4A 3MIGA 2Y26A 1SEFA 4MUVA 3MFAA 2ZHMA 4Z92B 2VBBA 4QPGC 2VZVA 4OI1A 1NG0A 1YFXA 3WNPA 1CR7A 3POWA 4IDZA 1RUH1 3N9MA 4Q4X2 3C7EA 1PZ8A 3HT2A 1RHI1 2D7FA 4P14A 1L7RA 4YFWA 1YQ5A 2XVKA 4GIQA 2YBKA 4JTNA 4QMAA 1REEA 5E6HA 4ES8A 3I3MA 1J59A 1Y9QA 2WWUA 2PHTA 2JIGA 2UY8A 1CZVA 1PO13 5I0UA 1QJZA 5C9AB 4XAEA 1D0GA 2MPFA 4XURA 4XUOA 4AQTA 4BIOA 4CSWA 4FTSA 1ZRRA 3HNBM 4BM8A 2EIBA 3QOPA 4Q5OA 1QJY3 3ZSLA 2YROA 1UPIA 1W6MB 4FAHA 2W39A 1HB4A 2VCBA 4KI5M 4LTAA 2VXRA 3OCPA 3BPSA 4QGNA 4BYYA 4DO0A 3PIJA 4D7SA 1O8PA 4PDWB 1IQAA 1GZWB 2Y60A 2PAMA 1U5ZA 1V6JA 4LEJA 2CAUA 2IFWA 3IWZA 3H1WA 1QJX2 4Q4X1 3NNMA 5EFUA 2PYTA 1GNHA 5FYIA 2DCYA 2PHLA 4UOJA 4CU6A 3RZMA 1ZM1A 3K4AA 5FQ0B 3ZYIB 4AFCA 2WAAA 2DVGA 3AYDA 5FPZA 1X9TA 2B9VA 3VL9A 3WINE 1PNGA 4PT6A 1ACCA 1N1SA 2VZPA 3DPRA 4DXSA 2V72A 3KS7A 4GMP1 5C5UA 3OGVA 3ITQA 1D2SA 5FMOL 4D7YA 1UY2A 4Z2WA 5A7SA 4EE2A 3ETQA 1YCIA 4LBNA 4G9SB 1QDOA 4CCNA 5FYMA 2G1MA 4D8MA 1RUD3 1HIXA 1YRZA 1EP0A 1OLQA 3PJQA 4E2GA 4XVHA 1DFQA 1QJX1 5FP7A 1PHMA 5ACA3 1TVGA 2D6OX 2VG9A 3WG1A 1COV3 2Q30A 1JYVA 4C8DA 3ZXAC 2YMZA 1OA3A 1DYPA 1QOTA 5F8PA 2BERA 1K3IA 2BJSA 1HRI2 4QB2A 4FPEA 3ZFGB 2OW4A 1MEC3 3MF9A 3BODA 1HV1A 4DXZA 1PMIA 3Q8EA 4KWKA 1AR92 3AXEA 4HPKB 1S2KA 1U5IA 3A0NA 4AI2A 3VD7A 4YARA 5CA6A 1LULA 1LOFA 3PVBB 1WWYA 2VVFA 1AYN3 2Z2SB 5J3UA 1W2OA 4UBGA 3RRDA 4AEDC 4TLGA 1H8VA 5CZKA 1CONA 5LB6A 3T0AA 5C8WA 5FYZA 1UNBA 4NHXA 2I2SA 4WVZA 2FDJA 4Y1YA 3UYJA 2ZZQA 2VOWA 4ZU7A 3AP6A 4YLZA 4QQ2A 3P6BA 4HL0A 3ROUA 3T09A 2W68A 1F5JA 4CCMA 1LOBA 4DPNA 1HRI1 2JDMA 1ZZ9A 2Z69A 1T6BX 3MICA 4W65A 1Y3TA 2CY6A 3IIAA 3OD0A 5D8AB 2C24A 1ND3A 3POGA 4GB32 1AR91 3WT3A 4MGKE 1CIWA 3OG2A 4RR3A 5CFCB 1AX1A 2BUKA 2WFPA 4HN0A 1F4AA 2DVDA 4YW1A 3VUOA 2HWE2 5KHHA 4HK9A 1GANA 4BDVB 4XFAA 3WDTA 1ZZ8A 5IVYA 1DZRA 2I45A 3BTZA 2IUWA 4FQZA 2RJKA 1PO23 3JD72 2EVXA 1AJOA 1OLME 5IW0A 3AZZA 2GN3A 3RZZA 3L2HA 2W0XA 2DCZA 2Q1MA 3LIHA 4Q0VA 5C3QA 1D7PM 1X9PA 3EXUA 3GJBA 2QQWA 2QQOA 4FPJA 4A42A 5FZHA 1HB3A 1GR3A 4ISQA 4GB31 1JU4A 3NAPB 4CDQA 1ULGA 4RHV2 2C9KA 2NPIA 1H8TB 3PURA 1UN1A 2HWE1 3ZYGA 1UU4A 4P9GA 1FNZA 3KHCA 4GWMA 3GGLA 2QNKA 1MS4A 3JD71 4BA6A 3IAPA 4YVSA 4EWAA 3WNKA 2ZMLA 1YFWA 1VBD3 1UU6A 3S57A 2BNMA 1CJPA 1BBT3 1XE0A 3I3QA 1IOAA 1MS1A 3E1F1 1R1ZA 4CA9A 4CXXA 5FO8B 2D5FA 2Y64A 4E8CA 5C8CB 4MXWA 3EHKA 4Q1PA 1JYNA 3I59B 1CAUA 1PVC2 4KH9A 1US3A 3ACGA 2YXSA 2FDIA 2JDKA 4OUSA 3ZX7A 4QD2A 2NM1A 4AHWA 2VQTA 4KMQA 4QQHA 4JRAA 4RHV1 1GNZA 4MYEA 2CHHA 1NLQA 3CL1A 2Q8CA 5K0UA 1S0BA 2RS12 1S0DA 4L0PA 1WW6A 5BXXA 2E63A 2FHRA 3SEPA 2WQ8A 3VBHB 3D0SA 2ARCA 4HN1A 3IDCB 3JQWA 4OI2A 5FZAA 3NNGA 2Y34A 4AEMA 4WZCA 4LLFA 3AZWA 3LEIA 3RMYA 3C2UA 5JI7A 4YGBA 5FZ3A 2O14A 3LAGA 1SFPA 4FTEA 1G9CA 3EB7A 3I2OA 3NV1A 1PVC1 4S2GA 4UW4A 5A7NA 2AH2A 2E6VA 5J09A 3WNOA 4AQ2A 3RVHA 1SLTA 1Q8SA 2C0ZA 4RS5A 4YW6A 2KM2A 4FPLA 5FMBA 1QQP3 1UY3A 5FXWA 1QIQA 2RS11 2G9GA 4ZS2A 4AFAA 4CDUB 2UWBA 3NRUA 2QQIA 5FXXA 1VMFA 5J37A 1NA1B 4A3ZA 3O1MA 4B8EA 4LORA 1C8M2 3E6DA 5JVVA 5C5TA 3AL5A 3M7AA 1YQ8A 2WKKA 3POSA 4YGCA 1QWRA 4QKBA 2WYFA 3WP5A 1PK6A 2VW1A 3B9IA 4AF9A 5BPXA 1SFYA 4NIAA 1YWKA 2WLQA 3PTRB 4MGYE 5K0UC 4YG3A 2P3YA 2WUHA 2VBPA 1VP6A 3FJSA 4KGGA 4Y20A 2O1QA 4ZONA 4GJZA 1UOFA 4Y4YA 4LR4A 2VL4A 1IKPA 5IAVA 4LE4A 3KT4A 3ZVXA 1RUE2 3ETPA 3IMMA 4XJAA 3MV01 5SV8A 3M3EA 4NPRA 2WA4A 3PLQA 4Q26A 2GC3A 5F37A 1WW7A 3WOGA 3WZ1A 4HFSA 3MDPA 4XXPA 4W4ZA 1CX1A 1W05A 1QKQA 2P5BA 2YUEA 4QXHA 5J1XA 3ZPYA 1JN2P 4XFCA 3DYPA 2EF6A 1C8M1 1UX7A 3D5OA 5FK8A 5EJZB 2A5ZA 3SNMA 3TN93 3K46A 3NVCA 5DPNA 4AXOA 4EN7B 2TUNA 2WRAA 5DG2A 4AHZA 4QPGB 2WT1A 3ILNA 4QM9A 1K42A 2HBTA 3BB6A 2RR12 1DDLA 2E32A 4OFGA 4SBVA 2X8KA 2PHRA 4JKLA 2GNMA 1BMV2 1SBEA 4FI9A 4H7MA 1MQTB 1NQDA 3VD3A 3POJA 4BWOA 1GLHA 1UW8A 5FTTC 5APAA 1Q43A 4OUMA 3J26N 1RUE1 1W2NA 3VLBB 5H9RA 1FPN2 5CKMA 4XABA 1JZ7A 2X05A 3NKGA 2D6PA 1FV2A 2QCSB 3H3UA 3NJZA 1QMJA 2XJTA 3K3OA 5FPLA 1HJGA 1RUJ3 2VQUA 5LW9A 4QX8A 1Z0HA 1FI2A 1TME3 3SLIA 4E4HA 1ONAA 2XHNA 3RZJA 4IEXA 2ZKLA 4EYUA 1IS3A 1JMUB 4LT5A 3MIBA 2VNRA 1DQ6A 2DCTA 4QX7A 2VD7A 2VOKA 2AEYA 2R1DA 3ZFFC 2RR11 2ILMA 1ZRDA 1NUKA 4BLIA 3T3YA 4LULA 1E5HA 1QXPA 4KG8A 3WG4A 1BMV1 2JJ6A 5LWBA 1CQ9A 1YI7A 4WM8C 3ZDSA 1PIV2 2PMWB 2AGSA 4EV0A 1Q8QA 1UAIA 2R30A 2NN8A 2VZQA 3ZN4A 3USUB 1FPN1 4URAA 2JDPA 2YHJA 5KR7A 2FZ2A 1NZCA 1XNKA 1LGCA 4LBQB 4UFJA 1W8TA 3WQ0A 4Y5Z0 2ZBJA 2IXLA 3V64A 4BK4A 3SISA 4YM3A 5A7WA 3SH3A 1WKYA 5KHKA 4X8NA 1QXRA 1DQ5A 3NNFA 3R05A 4IE0A 4FOQA 4OVEA 1JU3A 5FYBA 3UKTA 1N1VA 4MGZE 3I3EA 5LASA 3LIGA 4XFIA 2F4LA 3R4DB 5FZEA 2PAKA 2QUOA 3RG0A 1W8NA 1HKDA 3KVAA 5JR7B 1H1IA 5JOXA 2A3WA 2A6WA 1DZTA 1V6LA 4XMIA 4AR2A 5C9AA 4Q0UA 1PIV1 2DUPA 1EAH2 2YFZA 1CX4A 2R042 2ZX2A 3N35A 5ANQA 5A1LA 2OVUA 4UBHA 3NJVA 1W6MA 4Q29A 4QGLA 3BYWA 3ZXFA 1W03A 3ZKYA 1W8UA 3VBUA 3AVRA 4QX3A 4PDWA 1GZWA 5ISLA 4QAWA 1X8MA 2OZJA 3PJYA 4AGVA 3ZXGA 2XMLA 1V6OA 4W50A 4QT6A 3TAYA 3I54A 3ZXEA 4XJZA 3S6PA 5FZ1A 3WF4A 3ZYJB 2WAOA 3T30A 2A6ZA 1LEMA 2ZX3A 1W39A 3GHMA 2Y8KA 3VHNA 3W59A 2WO3A 1LECA 1UXZA 4G4FA 3D8CA 1LGBA 3CDZB 1H2NA 4NAMA 4YW2A 2ZGQA 2CNAA 2PTMA 3IKWA 4XQDA 2DWRA 3O7OA 2JDZA 4PBPA 2QQMA 4NHKA 5F5QA 1C1FA 4MGQA 4ZHNA 1EAH1 3DPRB 3KWVA 2R041 5FBJA 5FZFA 3SXWA 4M4PA 4DY5A 5IAXA 1RUG2 5KC6A 5FFOC 5A6YA 4LKDA 4MGSA 3WF3A 5J48A 5DAPA 1SLLA 1V6NA 2RMU2 4ISRA 2CWMA 4DUVA 2AC1A 2D6MA 4GULA 4L8QA 2AENA 4GWIA 4YGDA 4EROA 4LKEA 4RSUA 4O9GA 2B42B 3B5LB 1OD3A 3LF7A 2FDHA 3THCA 3E5XA 5GZDA 3N36A 4XCAA 1XPWA 3BN6A 2DU0A 2LTNA 3KV6A 4CDWC 4CTEA 3B00A 2VMGA 1SMVA 4Q27A 1SCSA 1C1LA 4PLNA 4Y1UA 5F1RA 3LFIA 2VW2A 3T0BA 4CDXA 3I4IA 3ZFGA 1S0FA 3KCYA 3SCGA 1E5RA 4HETA 3VBUC 2GNTA 4LK7A 4HPKA 2L9LA 1ASJ3 1X7NA 2BFUS 3E5UA 4OI4A 4C0HA 5L7OC 5FZBA 2EXKA 1RUG1 2AREA 2CDPA 2IFRA 5KHIA 2V73A 5IVJA 3J8F3 5LA0A 3TNQA 1VB4A 2QQJA 3D82A 4P9LA 4XBLA 3WY6A 4AQSA 3D3AA 2YFUA 4WBBA 2RMU1 1E5SA 4L2NA 5DG1A 4YFZA 3C8XA 3VDDC 1APNA 2W92A 1UIJA 3PUAA 2FDKA 1C3HA 3VHRA 3DXUA 4TXWA 3FMGA 1WGPA 2G19A 4COWA 2JB8A 3VL8A 1U5XA 1CJDA 4LQRA 1GWLA 3WW2A 2XG3A 3T4VA 2BEOA 3THPA 1UY1A 5D8AA 4ES9A 4NUBA 4XMAA 3UGGA 5H9QA 1S4CA 5CFCA 1E57A 2Y6HA 5FPXA 1WBLA 3C3VA 1O4ZA 1YUDA 4LO6B 4LBQD 1XU2A 4MLOA 2ZCWA 3VZNA 3WNNA 4HXCA 4YZ2A 2RDSA 2VQ0A 5JSRA 3NNLA 2ZMNA 2X10A 4N8MA 4HT1T 3JCIA 4P9XA 4BQXA 1AL0G 3FWEA 3ZN5A 4YRDA 1DGLA 3POIA 5IJRA 4Z82A 3MFCA 4COZA 2SBAA 1G9AA 2WSVA 1NE6A 3HEIA 4CP9B 2VMHA 1W9YA 3BI3A 3U78A 3LDKA 3OSDA 3J9SA 2A1XA 3QLQA 5FZDA 3DGTA 1L7QA 3ZKUA 1Q8OA 3NAPA 1VALA 2Y33A 2ZHKA 3IB3A 4XDOA 5FZLA 5A6ZA 5LBFA 1O5LA 1H8TA 2WT2A 2Q8DA 2ZX1A 2GC0A 2P6HA 2QQUA 5LA9A 2A70A 2DFBA 4QDSA 4B4RA 1OPOA 5DZEA 1MS3A 1JXNA 2VGDA 4Q2FA 3VDAA 3KT7A 2ZGRA 4HLTA 2RS53 1VRH2 1NZIA 4EN6B 2XQXA 1IZ3A 1YIFA 2WZR2 2W46A 3JB8A 4CP1A 2BWCA 5IUQA 5JUVA 5K8SA 2C1FA 3KLSA 3JBG3 4C1WA 4A4AA 2Z79A 5DAWA 4WV8A 4UI9L 3VKOA 1JHNA 2E31A 2OXBA 1S55A 5J7MA 1CAUB 3RWKX 4COUA 1R093 3I97A 3TB0A 2W08A 1NT0A 4QX0A 3ES4A 4IE5A 1K5MC 2Z42A 5CVRA 3SH5A 3DEMA 5K0UB 3THTA 2HWB3 3DF0A 4LOTA 4YM0A 4AGGA 3RZLA 2A6XA 1DYOA 1XNDA 3A0KA 1VRH1 3M3CA 3QH7A 1IS4A 3HN3A 3PUQA 3A22A 5FXVA 2PQQA 1DLCA 2WZR1 4UWDA 3EO6A 5DXDA 2WFF3 1G6NA 4IE6A 4LA3A 2J1EA 4LIVA 2LALA 1V9U3 1RTVA 1C5HA 4CVUA 3NV2A 1ZZ6A 3RDIA 1UKGA 1X50A 3HWJA 1FYUA 1RIRA 3GNEA 3OBTA 3B9CA 5A70A 2D97A 3PTYA 3QCWA 2GH2A 4NJ4A 3OTFA 4IEOA 2RE9A 4OYUA 1B35A 1OUXA 1YC61 4TTGA 3MIEA 3K4ZA 4QXKA 4BQYA 2J22A 4EZHA 3LEMA 4JHTA 1TE1B 2PXJA 4IXLA 3N7KA 2HEYF 1DGRN 1LGNA 1OHFA 4B29A 1NA1A 2Q1FA 3POBA 5FYUA 1KD7A 2GMMA 4AI9A 1LHVA 5FZ9A 2XL9A 5A3NA 5JMCA 1OUSA 3FUOA 1VMJA 3RS6A 3ZIWA 1UZZA 4LBLA 5T5LA 4ZXKA 2WO1A 1XB9A 5F2WA 4Q4V3 4AWDA 5D21A 3TYJA 3PVOA 5KWRA 4IEUA 2HWB2 2G9FA 1LOCA 4IESA 2DU1A 2VMEA 2OT7A 2WS93 4DXTA 3ZDVA 2BDRA 2HWD2 4LXLA 3X29B 2ARXA 2GNBA 2DUQA 3BGAA 3WUCA 4Y20B 4KL1A 2VULA 3WNXA 5CNAA 2YYOA 3JZVA 2WQZC 3ZFFB 2JDAA 1IPKA 1ZBE3 4QQOA 4YPJA 3JB4C 3ZMNA 5C3OA 5FYHA 1O91A 3M3IA 1RHI3 5FZMA 1RYYA 2HYKA 3LWCA 3MIHA 2DVFA 4YGEA 5CYYA 1ND2C 3HJRA 5GLWA 1OFNA 5IHRA 4ZU4A 1W2TA 3AFKA 4CCKA 1F4HA 2YB7A 4XCBA 3BU0A 1VAKA 3FFZA 3KT1A 3OF1A 4CYDA 2EICA 1B35C 2HWB1 4JX0A 5FLIA 2RJLA 1F35A 1PMHX 4QPGA 3WDUA 3ZYPA 1RUC2 5HV4A 4QGMA 2VC9A 4ARYA 2HWD1 2JD4A 4CE8A 2GC2A 5C3RA 4X8PA 1KJRA 4A7ZA 1XQNA 2QJVA 3OEBA 3HBZA 3VBOB 2N7GA 1GBGA 4U36A 5KXEA 4EWEA 2DCJA 1OA2A 4FPOB 4M01A 4Q4X3 3SITA 2JG9C 5C6CA 2ZGLA 4UAPA 1FOD2 3VDCA 4DUWA 4NO4A 1D4M2 3WD5A 1JOPA 4AQ6A 5CKNA 3LSEA 2CAVA 1WLCA 3MZHA 1HRV3 1ZBE2 5F7UA 2PHWA 4P02B 2NP0A 4GMP3 2QQLA 4JC1A 4XTMA 2JKXA 2MEV2 4DB5A 1RUC1 3AL6A 3H8OA 4HVRA 4LBOA 4XOGA 3K2OA 4QHBA 2VZTA 2Z4FA 5FZCA 2W95A 3KV4A 1CESA 3CIHA 3USUA 1RXFA 2XJSA 4BK5A 5C3PA 3AKSA 1QJX3 1XNAA 1BK0A 3DXTA 4B7EA 1H0BA 3V65A 1FOD1 3VKMA 2YC2A 5BNNC 5BNPA 4LBQA 4KBZA 3O1RA 3RJRA 5JXGA 3IZOA 4FAGA 5L9VA 2QQVA 4PI2A 1OH4A 1H9PA 5A7WB 3VB9A 1ZBE1 2IXCA 5M0TA 3CZJA 3RFRA 5A7QA 1VLNA 1JBCA 2MEV1 3ECQA 4OHVA 4UFHA 1UMZA 3AXDA 3WP6A 4UFMA 1YJKA 1ULCA 3HNMA 4C90A 3J4UH 5GM0A 3V0BA 1RB8G 1LODA 1DYKA 4BISA 2YV8A 3VHPA 1O3QA 1A34A 4AAXA 4E4DX 2R49A 1HRV2 3R0RA 1QNYA 5DDJ2 4CDWB 2EALA 5T52A 4CRQA 2VXJA 2UU8A 4D6SA 1LCLA 2FCVA 4WVWA 4BPZA 1JYXA 3KGLA 3VBFC 3T2TA 3N9LA 4I0BA 4I02A 4K40A 3VBUB 4V2WA 2WC2A 4A44A 4TYSA 3NW4A 1HRI3 2DTWA 1JUHA 4R4ZA 4UT5A 2ZGUA 2TEPA 3APBA 3GM8A 2D6KA 3OJBA 1AR93 3WHTA 4AEDA 2OPWA 1BXHA 5D2AA 3ZN6B 4ORFA 1OOPC 5I8YA 1WLTA 4XZUG 5EPAA 4H14A 3D6EA 4CP2A 2A7AA 5I0RA 5BNPC 1BKZA 1YLLA 1HRV1 3INAA 1LHOA 2E53A 4HSJA 4PBOA 5DDJ1 2TBVA 3IPVB 2XBO2 5FP9A 3VBSC 3I7DA 5C3SA 4EN8B 2ET1A 3KCXA 4NRPA 2JD9A 4TSVA 4JKKA 3MF6A 1S0EA 3EYPA 4ZU5A 4INDA 2FDFA 5FK7A 3GXUA 4LIUA 4WM7A 5GALA 2PELA 4WVMA 4BIFA 5A3UA 1REDA 5I91A 2YGMA 2JDNA 4GB33 3AP9A 4IEQA 5FJKA 1RJ8A 3MPBA 2JXAA 3WV6A 2XHKA 4UW5A 2ETEA 4F8AA 1HB2A 1I6XA 4AL9A 2HWE3 3H9AA 5CU1A 2JE9A 1ENRA 2CGNA 3LFMA 3KVBA 4I09A 4J1WA 4L92A 3ZSEA 2W52A 2X5IC 4CDXB 1H1MA 4CU9A 1UZVA 3JD73 4K21A 1F31A 3ZO0B 4L99A 4C1XA 5FJHA 3NNJA 4XAAA 1RUF2 2HWF2 2XBO1 4I0AA 4XDPA 1V0AA 4CCJA 4UF0B 1BQPA 4IGPA 3VZMA 1W9FA 4YW7A 4M3CF 5AFBA 2WT0A 4NHMA 4QKNA 1UZYA 2EXIA 5F32A 3ZM8A 3UL2A 5L36A 3NMBA 4URTA 5DN2A 2P3JA 4YZ3A 4Q8LA 4RHV3 3A21A 1ST8A 5EV7A 3ON7A 1VAMA 2PHXA 2Y6KA 4PJYA 2VZ3A 3K4DA 3MPPG 1LKNA 3QBQA 2ZHLA 4ZZ5A 5FXZA 3VZJA 1N1YA 2FMYA 1RUF1 1CAXA 2HWF1 2XJRA 1UOGA 3BALA 2GMPA 3FHIB 3LD8A 3M4FA 4AVVA 4CUBA 3LQCA 1NOVA 4WM7C 3W5NA 1IKQA 4CCCA 1UL9A 3IDEA 4XUPA 4FPGA 2BGOA 4N9HA 1JOJA 3S7IA 3HQXA 1PVC3 2IXKA 3M3QA 3DV8A 3PL0A 5AC93 1QH7A 1K5MB 2B9UA 4LHLA 5FY8A 2VNOA 4PIYA 1GNYA 2WL1A 1N1TA 4JV4A 4X6QB 3WDVA 3WW3A 2GC1A 1QH6A 2IVIB 2K46A 2W87A 4FCAA 3PUSA 5I0SA 5JIAA 4CP9A 5IFPA 2RS13 4OLLA 4LUMA 4R8HA 4AGRA 3BOWA 4HBNA 3AJYA 2P4EA 2DF7A 4XQ4A 2VUCA 3ILFA 3K48A 3R4SA 4PCRA 3WQ7A 1JZ3A 4NIHA 1AR72 3NV4A 1R082 1I9RA 1OQEA 3DECA 4MVTA 1AR82 1MZEA 2J1UA 1UYZA 2DV9A 4JDNA 4LBMA 4IEPA 1N3PA 2P6CA 1LOGA 4E2QA 2VW0A 4TZDA 1VBA3 1W6QB 4ATEA 1OF4A 4FFHA 4GQ7A 4D94A 3H8RA 2YC0A 3WHUA 2IZWA 4NRMA 5FY7A 5TSWA 1I3HA 1DQ4A 4QXBA 3ZOIA 4CCOA 1UYYA 2LS6A 2ZGMA 4L9BA 3WXPA 5CFDC 3LGRA 3T2OA 4BOWA 1V6IA 3LA7A 4BQ3A 2GSYA 2WNVC 4XQWA 5DMYA 5AC92 2HEVF 1X36A 4PHZA 1J3RA 1C8M3 2WR9A 3ACIA 2FDGA 1AR71 1DIWA 1LESA 1R081 2P1BA 1WCUA 2CU5A 1AR81 2Q8OA 4A45A 5DAXA 5JOWA 2C4XA 3ACHA 1HXS2 2ES3A 1O5UA 4PF1A 2ERFA 4BQ4A 3T0DA 4QPIC 4JQRA 2ZMKA 5DUUA 1J3PA 3NJXA 4TN7A 1T6GC 1D4VB 3ZLIA 2WWJA 3AX4A 1D0HA 3GZTB 1RUE3 1PM4A 4FFGA 4YW3A 4Z2AA 3SMHA 1ND2B 1XYPA 4SLIA 5JZGC 2QBXA 5FY4A 3N7MA 2B8MA 2AZ5A 1VBA2 4KBBA 1XOYA 2XVLA 5FIXA 5T55A 1L3JA 5AC91 3FHAA 3M8LA 5CKQA 1M06G 5FCCA 2RM22 2VH9A 4FXGB 3CF6E 5LA2A 4DXRA 1B35B 1VBC2 4IEZA 2LUWA 3IM0A 1DU3D 1FATA 1GQHA 1RVF2 1YEWA 1W0NA 3A23A 3LKJA 3RWNA 4B4PA 1HXS1 2XWBB 2ZGOA 2CGOA 1PVXA 2Y0OA 5FP4A 3SEEA 2RR13 3KV5A 5A1FA 5A33A 3IDBB 1OURA 4XPVA 1U12A 2QE3A 3R4UA 5A3TA 4GZ9A 4XUTA 5ABJC 5HPOA 3FFQA 5FY0A 2R16A 4RGKA 4A7KA 5JWPA 3O1OA 1W0OA 3BCWA 2ZPXA 4P9YA 1FPN3 1ULDA 3LE0A 5FWEA 3RGBA 4FQ4A 1VBA1 2DTYA 1MPXA 1LJ7A 1D2QA 3BTYA 4FPFA 4Y3OA 5GLVA 2RM21 4KNCA 1JS9A 4YNIA 1AUYA 1STMA 2QQNA 1ENXA 2PFWA 4Y5SA 3SKJE 2CYFA 1FNYA 4E4ZA 4Q8KA 1LOEA 3ZFFA 3CJIC 4OZXA 4YW4A 1RVF1 2R32A 3CLPA 4IEVA 4Y1ZA 3WCSA 3PVEA 1VAVA 4ZXEA 1JZ2A 4WM8A 4E8DA 1HQNA 2BGPA 1GQGA 4CP0A 2OUHA 5CG9A 1F15A 4N9IA 3TBDA 5CAZA 4FP3A 1PIV3 3GZAA 4DQAA 4V1PA 1LTEA 1W3XA 2K0GA 4QX1A 4AVCA 4YYOA 4Q0QA 1Y9GA 2J1SA 2FCTA 1SBFA 2XXZA 2TNFA 1AZDA 4MO3M 3OGJA 4D69A 5I8TA 3K3NA 4WVVA 3BKZA 3Q8FA 3AVSA 3OPTA 4TLFA 4R9AA 3RI9A 2GALA 5FWJA 1U5YA 1ULPA 1X8EA 3FL7A 1JYTA 1E5IA 3E97A 2B39A 2IVJA 3POFA 3HIFA 3UT0A 3VBFB 3AZXA 1EAH3 1R1A3 3QH6A 1ULEA 2R043 1MS0A 4JGYC 2B5HA 5KHGA 2NLRA 2EIEA 3VBOC 4Y22A 4M3CB 1N3QA 2BQPA 2W3JA 2WYSA 4NMIA 1OVSA 2GH8A 2OS2A 4R4XA 4JQTA 5T5JA 2EAKA 5IVEA 1ULFA 2QTWB 3HNYM 4OI0A 1JZ4A 4EWDA 4EZ4A 1KQRA 2ZGPA 4RA0A 1OKQA 4ZPIA 5HCAA 2HEWF 1WLWA 1YJLA 3HVDA 2QZ3A 3AP4A 3N3HA 5FO9B 5A7PA 1Z78A 5KBFA 1YFYA 5FZGA 1JYWA 4P00B 3OGRA 4N43C 5BNPB 3OYWA 4R52A 3KQRA 1UZ0A 3TEXA 1J1LA 2W1QA 1K45A 4B1MA 4XJ8A 2ZA9A 4GWNA 3AYEA 1RUG3 1GKBA 4P5HA 1Q8PA 1KJLA 1OSGA 4GMP0 3V0BB 4AG4A 2WZ8A 5HCFA 4LBKA 2RMU3 3H50A 4FFIA 2O8OA 1AXZA 4MGIE 2OKXA 3I3BA 3A4UA 4CDWA 1S2EA 1ZYBA 3MEPA 4CCEA 5A6QA 5F2SA 2XONA 1R1A2 1IQDC 3UESA 3E6CC 1C5IA 3PMSA 4KWJA 2W91A 5KXCA 5FKCA 1CAWA 1OQDA 3KCCA 5I0DA 4F7ZA 4MGTA 5L7OA 2VZRA 1GU3A 4H7LA 2YC4A 4CEWA 1XU1A 3CMGA 4YW5A 1UMIA 2A3YA 3VZLA 1AYM2 4K8RB 2NQYA 4AZZA 1GUIA 5A80A 2ARAA 4AEDB 3ZN6A 3VDDA 4AI3A 3UKVA 5JXIA 1J83A 1W04A 5JXHA 5HXVA 3U4XA 2R062 1C28A 4IV3C 3G7DA 1OT5A 4R9BA 5FR3A 1AJKA 4JGZC 2CL2A 4AVTA 2VCCA 3IPVA 3MW3A 1R1A1 3P1IA 2A73B 4IQPA 1XE8A 1UPSA 1LOAA 2C9AA 4LO4B 4UW6A 4HVOA 1H6XA 1POV1 1Z7S2 3I2JA 4Q0SA 3UV9A 4KU7A 3WP3A 4BCUA 3O0VA 1T2XA 3DKQA 4FXKB 2D40A 2VMCA 5EYXA 3C7HA 3L9JT 4WM7B 2VZOA 4WVMB 1A78A 4I3PA 5LRSA 5HBAA 1AYM1 2YGLA 1HX6A 4F3JA 3IBMA 1QGLA 2QQPA 4LKFA 1MACA 4K3UA 3FLPA 4ASLA 1XJAA 1V00A 2PLV2 2R061 2WQ4A 4Q4W2 1LB2A 4ASMB 2Q5TA 1OQ1A 3P5BA 2YG0A 3DUIA 3DKWA 1SLIA 1Z7S1 3O12A 4UF0A 2MHFA 3ZYRA 4MOAA 2WZEA 4CEWC 2P34A 3PNAA 2GU9A 3AMQA 1WCKA 4NIIA 4YVWC 3PMEA 1VE0A 1VRBA 3S30A 1AHSA 4XF1A 2JEMA 4HMZA 3MIDA 2O0OA 3ZSJA 4OHYA 1PGL2 5JSPA 4IUGA 4Y33A 3W20A 5EYYA 3GJAA 3GHNA 4BE3A 2AR6A 3WG3A 1XSRA 2PLV1 1JH5A 4D6QA 1YQ6A 4OULA 1BEV2 1KXGA 1VRH3 4Q4W1 1O4YA 5AVAA 2JDUA 1BZWA 4XIOA 2WZR3 5FLJA 1CAXB 2X09A 5EQUA 2H6BA 2WNVB 1W8ZA 3U37A 4GAZA 5JR2A 4NAOA 2JE8A 4YM1A 1NX9A 4FOYA 1ZRFA 1AF9A 1EUTA 2KXLA 3VKFC 3CNAA 1JYIA 5C7GA 1OPMA 1HN1A 1K5MA 4AHYA 4CUGA 4JKMA 4FPYA 1V6MA 1UYPA 1S0JA 1EPWA 3F95A 4RGAA 5JIUA 3AMNA 3VZOA 1K5JA 3N9NA 1PGL1 1QOSA 4QPIB 1QJU2 1VPHA 1SPPB 2XJPA 5C70A 4RL7A 5F9TA 3RI8A 4O65A 4NHYA 4N7IA 1BEV1 3AZYA 4DEQA 4NIGA 2W1WA 1ZX5A 1AX2A 4MXVA 2OPKA 2E9QA 5EWSA 3M1HA 4XHXA 2ZGTA 3OEAA 2I74A 3KGZA 1W99A 1JUIA 3OBAA 1EY2A 3DCQA 3J7MA 4CEYC 5JDBA 5GKAC 4AI8A 1W6QA 2R072 3LEGA 1W28A 3I3DA 1O4TA 5LZ6A 2XWJB 4LHKA 4DINB 4W6YA 1OA4A 5FP8A 3V0AB 4QU1A 1G86A 2PAEA 2VNGA 3J7HA 4AW7A 4XFHA 2HJIA 1BJQA 4CCLA 1QJU1 3WDXA 3OUIA 3FN9A 4R9CA 2BVBA 1DLLA 5ABJB 4LHNA 4Q1RA 3THDA 4P9WA 2ZEZA 1AL22 3KF3A 5IK5A 5A3MA 3MW2A 2WABA 4CCDA 5LBEA 1P8JA 2AEZA 4OQ9A 5KXBA 2VBDA 4DMIA 3CZUA 1XC6A 1W6PB 5JI9A 2Q0AA 3ENRA 1GQPA 3NQHA 4XILA 3FLTA 2R071 3LSDA 2BWAA 3WW4A 5G04L 3IDAA 1GZ9A 1YNAA 2HWD3 1J1TA 4ATFA 2ORZA 2WNUC 5GLUA 3TOJA 1W6OA 2VE1A 1NCQA 3AKTA 4KWLA 2IWGB 1EPZA 1ND2A 1SBDA 2B46X 1W8OA 2JB4A 2LM3A 1F5FA 2WJSA 1CGPA 2DDUA 4GKXA 2F17A 5DAVA 3UETA 5SV5A 1H2KA 2QVSB 3B7MA 4XYXA 3ZIXA 1AL21 2ZKNA 4XW3A 4D7TA 1W2AX 5IK8A 3KSCA 2GAUA 4XTPA 1HW5A 1JI6A 3ZSMA 2XR4A 1LRHA 2FZ1A 1AR62 2GN7A 4JVAA 3HOBA 4Y5TA 4NWVA 5FV3A 5A7OA 5I8SA 3KB5A 1I5ZA 1RUC3 2B4KA 2E7AA 2RS32 4XC9A 3DYOA 5FZOB 2V4VA 1OLRA 1RINA 2D98A 4A2UA 3S5AA 5A33B 1O3TA 3C7GA 3F2ZA 1GOGA 1KFXL 2JG9A 5DQ0A 4NPMA 4BQ1A 5F3EA 3LOIA 3V56A 3ATGA 1LU1A 3BUCA 1DGWX 1DQ2A 3OGSA 2VCAA 2VPVA 3AKPA 2QKDA 3LDBA 4HZFA 5FYVA 2C5DA 3GBGA 5FOJB 1FOD3 5DUXA 4MX3A 2JENA 5FZ0A 1BVVA 1UU5A 1D4M3 1FMD2 2UY9A 4GA9A 4Z8BA 3O0XA 2HWC3 4Q4Y2 2A71A 1PX4A 1UY4A 1Y9MA 4AVAA 5JPMB 1ZRCA 4K1YA 4OQ8A 1UOJA 2IXJA 1AR61 5C8CC 1VBB2 2J1TA 2PHFA 5KXDA 2J1RA 2UWAA 4XBQA 1F8VA 5EJ3A 4DRRA 2MEV3 3PDQA 2RS31 5IYYA 1NCQC 2F6BA 3NSTA 1GWMA 5I0TA 4NWWA 5IVVA 4WM8B 3HPNA 5JLVA 2A6VA 5EIYB 2WIIB 3AB0A 2YBPA 2BFUL 5F39A 1QJFA 1V70A 4A7YA 3UJOA 4ZKTB 5BNNA 2RV9A 1MS9A 4CZSA 3ME2A 4N43B 3MW4A 3FX3A 3SQOA 1DGRA 3T08A 3P3NA 3VBHC 2VQAA 5T50A 1R64A 1OI6A 1DF0A 1H4HA 2BOIA 3W21A 2VO5A 5F5IA 5J36A 1FMD1 2DYCA 2HBUA 1RMU2 3ASIA 4QDRA 4Q4Y1 4UFKA 5A3OA 3QD6A 5T5OA 1K12A 3SKVA 5IATA 1BCXA 5FZ4A 1VBB1 5JOYA 4N7UA 1CPMA 4M00A 5DZGA 2XJQA 2ZS6B 5ERLA 5J98B 4I01A 2OA2A 1C57A 2PQSA 1TMF2 2HWC2 1O3RA 1KEXA 2ZXQA 4LHSA 1JZ6A 1OF3A 2JDYA 3VBFA 2RJ2A 1SDDB 1O3SA 5DDJ3 1PZ7A 2BBAA 5IFTA 4GH4C 1NXMA 2YU2A 5T5PA 1H30A 4PIXA 3KQ4B 3KD4A 4M3CA 4AK3A 1MVQA 4LKSA 4RN5A 1RMU1 4Y22B 4Y1VA 1CIYA 5F3IA 2LW8A 3WSOA 4XE9A 4CPBA 4G3YC 3WVJA 4EN9B 1FT9A 4UXAA 3VKLA 1OOPA 3J7NA 3HQRA 3O1PA 1GSLA 1SDWA 2J1VA 4CXWA 2YU1A 4QQLA 4L97A 2V5DA 4IV3B 3JUUA 4JGZB 1D4M1 1GICA 3RZHA 3WQ1A 5BY5A 1TMF1 2HWC1 3OYWB 3VBSA 4QX2A 5GZGA 2QQKA 1NQJA 2GZWA 2QDNA 2CDOA 3RYRA 1EV12 4I30A 5LATA 4Z1VA 3AP7A 2P3KA 2WO2A 2WN3A 4KGQA 5FPBA 2XBO3 1O7FA 5FPVA 3S5QA 4BH9A 2FQPA 3NO8A 3RQ0A 4NOTA 2XKOA 1J84A 2PHDA 4S2FA 3WG2A 2KD7A 2ORXA 1RITA 2RDRA 2ADEA 2E51A 1DCSA 3EJKA 1JTZX 3O1SA 3AYAA 4AE2A 4OUEA 2E26A 2X5IA 2RG4A 1TNFA 1RUI2 1NCRC 3GZEA 5JSOA 1C4RA 4UYBA 2EXHA 2VZUA 1CAWB 3BTAA 2DFCA 2VTFA 1MQTC 3LEKA 2DUOA 2FCUA 1XBFA 3M3OA 4I3GA 3I2GA 4LBJA 3O14A 4MHRA 4AI1A 3CO2A 5L7OB 4CEWB 1EV11 3VBRC 1LAJA 1F9KA 2D3PA 3B3QE 4JZRA 1O6UA 1RUF3 2HWF3 5LY2A 1O59A 4RYDA 2FMDA 4H3WA 2UYAA 1M4WA 2W9XA 3B01A 2CV6A 1WMFA 1CD3G 4YVWB 3VDDB 2C6SA 3LPGA 3T2QA 4COVA 5FP3A 2DURA 1KGYA 5E1RA 4WZFA 3AM2A 3ES1A 1HJFA 4AI0A 4YG6A 2WLPA 4N53C 5FYCA 1OFSA 2HYXA 3I2KA 1RUI1 3B94A 4IW3A 4M4RA 4W8JA 1UF2C 3I49A 1AX0A 3H7YA 1N3OA 4UW3A 1H4GA 3T4HB 2UWCA 2GNDA 5LBBA 4A6SA 3OPWA 3PU3A 4PQ9A 4QM8A 4E27A 2LROA 3A7QA 1GP6A 1LNSA 5C4WC 2VTXJ 4JDOA 4HSLA 4XF9A 4GALA 2GMEA 3H42B 3IT8A 1UD1A 4BZ4A 2ZZJA 2Z5WA 3K75B 2A6YA 4ITCA 4QB6A 3O1VA 2ZAAA 3RNSA 1QHDA 2HH9A 4P9IA 5FMDA 1NXD1 1SHWB 5A3LA 3D4KA 2D3SA 2YY1A 5LEKA 1NLRA 4IEYA 5H9PA 1S1AA 2SLIA 5C33A 5G05L 3H1YA 2QZ2A 4LOSA 1V6KA 3H3LA 1PO12 1LHNA 4XBNA 3AKRA 1W0PA 4LK6A 2X53S 4XXAA 1LU2A 4M0NA 1G7YA 2ZAHA 4GD4A 1CZSA 1QJY2 3LB9A 5HV0A 3SCHA 3ZPOA 1GFF2 2XVGA 3CJXA 5E16A 3WLUA 4B1LA 4NR1A 1AR73 2D93A 4CEYB 4PF5A 1R083 5B2GB 3NWKA 4EQVA 1AR83 1QU0A 3ZMOA 1X82A 2IC1A 1YO8A 1GZCA 3U07A 2VOXA 3M2MA 4GKYA 2ZEWA 2JICA 5DUWA 5F5AA 4ET7A 1QOOA 1A8DA 1CZTA 1YIPA 4DUXA 3KHBA 1OD5A 1RGSA 4P08A 2VNVA 5CFDA 2K2SA 3MLKA 3BTXA 1BVP1 4RGGA 2WNVA 3OPZA 4R9DA 1GP4A 1PO11 1RUNA 3RZKA 1CAVB 2W2IA 1UYXA 5FRAA 3BOPA 4OHXA 5IK7A 1KDMA 5CBLA 4PLOA 1OLMA 1QJY1 5KC5A 1PX3A 2CWSA 4MH0E 1JOBA 3O5SA 3DPRC 4CUCA 1ZRIA 1SG3A 2JECA 4QHZA 4ZZ8A 5F3GA 3I2IA 4HG6B 1QXJA 2P3IA 4QPIA 1SPPA 2OX0A 1RUD2 3KM5A 4OMDA 4I2OA 1HXS3 5ACA2 2WNUB 3I2DA 2GP3A 4NE9A 4Y1XA 4NHLA 1COV2 5JZGA 2WWSA 1IPJA 5LK5A 3BIEA 3MBWA 2JE7A 4IETA 1MEC2 1ZBA3 3S0MA 3USSA 2OUJA 3VGIA 4UFLA 1WCDJ 5GZEA 3VD4A 5EZWA 2EA7A 4UFIA 4XFGA 1REFA 2AUYA 3H8UA 1WD3A 2RM23 5JPNB 2BBVA 1AYN2 3V0AA 1ENQA 2UYBA 2B45X 1VBC3 3NV3A 4AVBA 3UGHA 2BVVA 3AYCA 3TNPB 1S0IA 1XSQA 3OGGA 4FPHA 2ZX0A 1LOFC 2ET7A 4XJ9A 1EUUA 3UJQA 4COYA 4LO8A 1RUD1 1RVF3 2BU9A 2XJVA 3PVNA 1YXWA 2YDEA 2ZJCA 3H7JA 3MIFA 2ZX4A 1BYHA 1UKRA 3NL1A 3OB8A 4NPLA 4E2SA 5ABJA 3WP4A 5ACA1 3H8XA 1O8SA 1VR3A 3KMHA 4FSJA 3U11A 1GWKA 1COV1 3VD5A 1BLZA 3I2FA 1XNBA 1H2LA 3O0WA 4FOWA 2W94A 4META 1MEC1 1W6PA 4LITA 4D3WA 5F3CA 3GCXA 2XH6A 3T2PA 3VDBA 4JHZA 1OKOA 2ZTNA 2I07B 5A32B 3WCRA 1B09A 3WF1A 3CJIA 3B93A 1YI9A 5GLTA 3AZVA 3PHMA 1AYN1 2R0HA 2RVAA 1ND3C 3MGUA 1UMHA 2VZ1A 1I1EA 4RR3C 5F6LB 3K77A 1W6OB 1PO22 1NCQB 1ZBA2 2Q8EA 4O61A 5BNOA 5IVCA 1W8HA 1TQ5A 1FV3A 3B69A 3LDRA 4OHZA 5CIRA 5IVBA 4IV1A 2JX9A 5A6XA 1X33A 1J3QA 4QXCA 1PZ9A 4I0WB 5CG8A 2P2KA 1WW4A 2X29A 4RFT0 3BIWE 3WDYA 2E7TA 2ID4A 3U14A 5IWFA 4GWJA 4J6GA 4LJHA 3ZFEA 4MHUA 1ZREA 3L2YA 1I5PA 4HONA 3CKHA 1Y4WA 1OMIA 4K8FA 4FTBA 4FO9A 5FZOA 3RJ2X 4BMEA 2XL7A 2JKBA 2R1BA 3OY8A 2YBSA 1CVNA 1IHMA 4RQPA 5LCWL 2D5HA 4XF3A 3GALA 1GP5A 4XFFA 2BTVC 4AEJA 4CDQC 2JG9B 4BQWA 4IGOA 3MHZA 3U0ZA 1PO21 1ZBA1 3VV1A 4S2DA 2MNGA 2D44A 4QKDA 1VBD2 1IG3A 1BBT2 1DQ1A 5K9YA 3H1MA 4LO7A 2WBKA 4YVSC 3POYA 1FAYA 3WNMA 4DOUA 1WZXA 1QDCA 1VBC1 4GH4B 4JGYA 1YFUA 1IPSA 1QNWA 4NN0A
chains in the Genus database with same CATH topology
4DRVA 3DL3A 3VBOA 2D6LX 1PNFA 3JU9A 3HMYA 2F4PA 5CADA 3WDWA 1LR5A 2H6CA 2HKXA 4GXLA 3T1LA 5BNOC 1Q5OA 3UK9A 1DGWA 1Q3EA 4IV1C 2KA3A 1FXZA 4IL7A 5F6KA 5BNNB 4N43A 5AFEA 2NZ9A 1VBD1 4N90A 1Y43B 2VU9A 4XF0A 1BBT1 2ZGNA 3ZFEC 4QPYA 5BYNA 2JG8A 4JTOA 2QFEA 1ENSA 3HAGA 3QACA 1TNRA 1WBFA 3FBMA 4RQPC 2QDRA 4AEKA 1G9DA 4HKWA 3AMPA 3EBRA 1Y7BA 3FC0A 3FBYA 1MS5A 1HDKA 1QQP2 3ALQA 4YG0A 3WR0A 1SACA 1LENA 2XLAA 2VOVA 3LA3A 4XF4A 4RS5C 4YZ1A 1NCRB 4DS0A 1PM7A 2Y38A 4LE3A 4AHXA 1WLDA 3VN4A 1POV3 3GF6A 3M70A 4X6RB 5LK7B 5E88A 3VBRB 1S2BA 5K7PA 2B7YA 4QQPA 2ZACA 4ONUA 1MZ6A 3FUQA 1DHKB 4LLOA 1W6NB 1NYWA 3TWIA 1OOPB 1AYM3 1PK6C 3RMXA 2WZPP 1WMEA 4IV3A 4Z07A 1A8MA 4FPKA 4JGZA 3WX5A 1QQP1 2AYHA 3OBRA 4N53B 3VBSB 2R063 4BLJA 2JG8C 3MLLA 4DNYA 2VY0A 5JOZA 3SHRA 5GZCA 2BW8A 2Q1ZB 4K9SA 1Z7S3 2H0VA 1BK1A 2EIGA 3VZKA 3AFGA 1LEDA 3P3PA 4FP2A 2EXJA 4K1ZA 3T1MA 3TN92 4Y24A 2Y0IA 1XNCA 5C4WB 3LOBA 1KITA 1HLCA 4LO5B 2BGCA 5LEJA 1ZVFA 3FLRA 3AJZA 5GZFA 2X5IB 3HT1A 3LZZA 4XEZA 3AK0A 5BUVA 2PLV3 2IXIA 1KS5A 2DCKA 2WA3A 4Q4W3 5E8AA 5FDBA 1RUJ2 2IXHA 2BNOA 1NY72 1TME2 3I8TA 4YVWA 3DN7A 2EAAA 3AMMA 2PA7A 4XJWA 2XKPA 3R6SA 3TN91 3WDTA 1CPNA 3ILRA 4W6XA 4YM2A 5J7MA 4IEWA 1MZ5A 1WA4A 1QF3A 3AKQA 1A3KA 2DVAA 4DY3A 1HV0A 1GYKA 2VVDA 5J96B 5HCBA 4YSFA 3MI8A 2WSUA 4XFBA 2VUAA 1MVEA 1Q8VA 1WCSA 4HKOA 5L19A 3IMNA 4XDQA 3ELNA 2K9ZA 1BEV3 3U10A 3ST7A 5FQ0A 1RUJ1 1ZA4A 1WUVA 1NY71 1TME1 2V09A 5IT6A 1ZNPA 2D3RA 2XLGA 3W58A 1XXNA 5BNQA 4A3XA 4BMBA 2XB6C 2CTVA 3FE5A 4M0HA 1VJ2A 4Q0PA 3LA2A 3UKNA 4XIKA 1QJU3 5IK4A 4FOVA 3URFA 5C9AC 3CU7A 2A3XA 3Q9OA 3ZXJA 1KS4A 4HKLA 4CEYA 4DZGA 1NLSA 4PLMA 2NMNA 3TRSB 5L73A 4L11A 2D6NA 2ZHNA 1G8WA 4PDWC 3H3ZA 5KHJA 2DVBA 2R073 1JW6A 1SLCA 4H55A 1A6CA 1ALYA 1S0GA 3AP5A 4C0BA 1XRUA 3BU7A 5CFDB 2ZABA 1CAVA 4EJRA 3ZXKA 1MZFA 1KRIA 4FPCA 3ACLA 5JAXA 1AL23 1URXA 4QX5A 4P9JA 3VHOA 5FBZA 3GYDA 2A75A 3K51A 5AVPA 2WNUA 1ND3B 1XYNA 4RR3B 2OZ6A 1NE4A 4C91A 2G4IA 5JZGB 1H1AA 1KDKA 4JAAA 2H0BA 2PHUA 4XHBA 3N4MA 1RJ7A 4FBFA 1ASJ2 1UCXA 3D0JA 5E89A 5DUVA 4CDXC 3ZFGC 2NMOA 4BHPA 1MS8A 3KZ4C 1U0AA 3J8F2 1WMDA 3NKTA 2ARBA 4RD7A 3ZXDA 4HK8A 1DBNA 2FBEA 1F2NA 3N7LA 1ZZCA 1AR63 2YPJA 2RS33 3G6JB 4IERA 4CDQB 5EXOA 3RSJA 1IS5A 3GZUC 2BPA2 1AVBA 4KG0A 1N47A 4B3NA 2ZGKA 3HN1A 4K6BA 3SCFA 5I93A 2VMIA 3E5QA 3WW1A 2P17A 2ZOEB 4YVSB 1ASJ1 3SH4A 1YHFA 1UX6A 2Q4SA 1G9BA 4AFMA 3S7EA 5A32A 4JRLA 2E7QA 5C8CA 3J8F1 5D8AC 1FMD3 3CJIB 2XGXA 3I59A 2XPJA 4Q4Y3 4MXWB 5CFCC 4NVPA 5BV6A 3E6BA 5HI0A 4AYUA 1VBB3 4XJUA 2WNEA 5FO7B 5H9SA 2CGPA 5BNOB 1RL3A 1HQLA 4S2HA 3RYPA 3IN9A 4IV1B 1ZZ7A 1IGOA 1PGW2 5DZFA 3VBHA 4FVVA 5FAXA 4E9KA 3ZFEB 3HR9A 4XETA 4F83A 1HQWA 1YYNA 1ZZBA 2R0FA 4FT8A 4JCKA 2RHPA 4J1XA 3OY8B 3RYKA 2XJUA 4RQPB 1LHUA 4HANA 4KU8A 1RMU3 3NAPC 5LRRA 5D1IA 5FLHA 2XLFA 4OHWA 5FMOS 1RUOA 1IS6A 1H8TC 2RS52 5GJ6A 4QU2A 4AFDA 2VECA 1W2UA 4K20A 1WW5A 4MV2A 4RS5B 2WINB 3JBG2 2NYYA 4CDUA 4GH4A 1TMF3 4W6WA 1PGW1 3OD4A 4JGYB 3MLJA 4TWTA 1H9WA 1SLAA 1PGSA 3VBOB 1WD4A 3WP5A 1R092 1SLBA 1VBE3 1SQ4A 2VUJA 4Y26A 3CEWA 3JQXA 4E4SA 3VKNA 1DZQA 2BYVE 3MYXA 5GLZA 4XZPA 1MR5A 1PK6B 1JYCA 1Q56A 4MZUA 1FX5A 2RS51 2O8QA 3AMHA 2XUMA 4O9EA 1LHWA 1VIWB 2P37A 2WFF2 1V9U2 3JBG1 4YZ5A 2JG8B 5CB7A 2PN5A 3RPQA 1RUH3 4DFSA 3EQEA 1J58A 1SFNA 1EV13 4LNVA 2OYZA 4B4QA 1R091 3ZSKA 4AFBA 1AXYA 1H2MA 1CN1A 1GV9A 2VVEA 5T3NA 4PIZA 4JDMA 1XYOA 3GBWA 1NCRA 1AXKA 1XE7A 4HVQA 1RC6A 3HD8B 1UIKA 4CDUC 3BPZA 2V5YA 1VBE2 1MQTA 2ZGSA 3GBFA 1NA1C 1RUI3 1VB2A 2WFF1 5FREA 4Q4V2 3VBRA 4MSVA 1V9U1 3H0OA 4U2AA 4AVSA 5FOBB 4LUKA 3ZXLA 1TEIA 2ATFA 3N7JA 1W6NA 2WS92 1DG6A 1DQ0A 3FZ3A 2ENRA 2R6QA 3WUDA 1C8NA 1QY4A 3LCPA 5T54A 1RUH2 2BNNA 4N53A 4LA2A 2D43A 1S0CA 4K7JA 1RHI2 4KQ7A 4B7KA 2UURA 3B02A 2GDFA 5JCTA 1VBE1 1G9FA 3W9AA 4M3CE 4Q4V1 1KFUL 1SCRA 5C4WA 4EN0A 2OIIA 1POV0 1EYBA 4YZ4A 2WS91 2YZ4A 3MIGA 2Y26A 1SEFA 4MUVA 3MFAA 2ZHMA 4Z92B 4QPGC 4OI1A 1NG0A 1YFXA 1CR7A 3POWA 1RUH1 4Q4X2 1PZ8A 3HT2A 1RHI1 2D7FA 4P14A 4YFWA 2XVKA 4GIQA 4JTNA 4QMAA 1REEA 4ES8A 1J59A 1Y9QA 2PHTA 2UY8A 5I0UA 1PO13 1QJZA 5C9AB 1D0GA 2MPFA 4AQTA 4BIOA 4FTSA 1ZRRA 4BM8A 3QOPA 1QJY3 3ZSLA 2YROA 1UPIA 1W6MB 4FAHA 2W39A 4LTAA 2VXRA 3OCPA 4QGNA 4BYYA 4D7SA 4PDWB 1IQAA 1GZWB 2PAMA 1U5ZA 1V6JA 4LEJA 2CAUA 2IFWA 3IWZA 3H1WA 1QJX2 4Q4X1 5EFUA 2PYTA 1GNHA 2DCYA 2PHLA 1ZM1A 3ZYIB 5FQ0B 4AFCA 2DVGA 3AYDA 5FPZA 3VL9A 3WINE 1PNGA 1N1SA 3DPRA 3KS7A 4GMP1 1D2SA 5FMOL 4D7YA 4Z2WA 3ETQA 1YCIA 4LBNA 4G9SB 1QDOA 1RUD3 1HIXA 1YRZA 1EP0A 1OLQA 3PJQA 4E2GA 1DFQA 1QJX1 5ACA3 1PHMA 2D6OX 2VG9A 3WG1A 1COV3 2Q30A 3ZXAC 2YMZA 1OA3A 1DYPA 1QOTA 1HRI2 4FPEA 3ZFGB 2OW4A 1MEC3 3MF9A 3BODA 1HV1A 4DXZA 1PMIA 4KWKA 1AR92 3AXEA 4HPKB 1S2KA 1U5IA 3A0NA 4AI2A 4YARA 5CA6A 1LULA 1LOFA 3PVBB 2VVFA 1AYN3 2Z2SB 5J3UA 4UBGA 3RRDA 4AEDC 1H8VA 1CONA 5C8WA 2I2SA 4WVZA 4Y1YA 2ZZQA 2VOWA 4ZU7A 3AP6A 4YLZA 4QQ2A 3ROUA 4HL0A 4DPNA 2W68A 1F5JA 1LOBA 1HRI1 2Z69A 1ZZ9A 3MICA 4W65A 1Y3TA 2CY6A 3IIAA 3OD0A 5D8AB 1ND3A 4GB32 1AR91 3WT3A 4MGKE 1CIWA 4RR3A 5CFCB 1AX1A 2BUKA 2WFPA 4HN0A 2DVDA 4YW1A 3VUOA 2HWE2 5KHHA 4HK9A 1GANA 4XFAA 1ZZ8A 1DZRA 2I45A 4FQZA 2RJKA 1PO23 3JD72 2EVXA 1AJOA 3AZZA 2GN3A 3RZZA 3L2HA 2W0XA 2DCZA 2Q1MA 4Q0VA 3EXUA 4FPJA 1GR3A 4ISQA 4GB31 3NAPB 4CDQA 1ULGA 4RHV2 2NPIA 1H8TB 1UN1A 2HWE1 3ZYGA 1UU4A 4P9GA 1FNZA 4GWMA 2QNKA 1MS4A 3JD71 4BA6A 4YVSA 4EWAA 2ZMLA 1YFWA 1VBD3 1UU6A 2BNMA 1CJPA 1BBT3 1IOAA 1MS1A 1R1ZA 5FO8B 2D5FA 5C8CB 4MXWA 3EHKA 4Q1PA 3I59B 1CAUA 1PVC2 4KH9A 2YXSA 4OUSA 3ZX7A 4QD2A 2NM1A 4AHWA 4QQHA 4JRAA 4RHV1 1GNZA 4MYEA 3CL1A 5K0UA 1S0BA 2RS12 1S0DA 5BXXA 1WW6A 2E63A 2FHRA 3VBHB 3D0SA 4HN1A 3IDCB 3JQWA 4OI2A 4AEMA 4WZCA 4LLFA 3AZWA 3RMYA 3C2UA 5JI7A 4YGBA 3LAGA 4FTEA 1G9CA 3NV1A 1PVC1 4S2GA 4UW4A 2AH2A 2E6VA 5J09A 4AQ2A 1SLTA 1Q8SA 2C0ZA 4RS5A 2KM2A 4FPLA 1QQP3 2RS11 2G9GA 4AFAA 4CDUB 2UWBA 5J37A 1NA1B 4B8EA 1C8M2 3E6DA 5JVVA 3M7AA 2WKKA 3POSA 4YGCA 1QWRA 1PK6A 2VW1A 3B9IA 4AF9A 5BPXA 1SFYA 1YWKA 2WLQA 4MGYE 5K0UC 4YG3A 1VP6A 3FJSA 4KGGA 4Y20A 2O1QA 4Y4YA 4LR4A 1IKPA 4LE4A 3KT4A 3ZVXA 1RUE2 4XJAA 5SV8A 3M3EA 4NPRA 2WA4A 3PLQA 4Q26A 2GC3A 1WW7A 3WOGA 3WZ1A 4HFSA 3MDPA 4XXPA 1QKQA 2YUEA 3ZPYA 1JN2P 4XFCA 2EF6A 1C8M1 3D5OA 2A5ZA 3SNMA 3TN93 3NVCA 4AXOA 2TUNA 5DG2A 4AHZA 4QPGB 2WT1A 3ILNA 4QM9A 3BB6A 2RR12 1DDLA 4SBVA 4OFGA 2X8KA 2PHRA 2GNMA 1BMV2 1SBEA 4H7MA 1MQTB 1NQDA 4BWOA 1GLHA 1UW8A 5FTTC 1Q43A 4OUMA 3J26N 1RUE1 3VLBB 5H9RA 1FPN2 3NKGA 2D6PA 1FV2A 2QCSB 3H3UA 3NJZA 1QMJA 2XJTA 1RUJ3 1Z0HA 1FI2A 1TME3 3SLIA 1ONAA 4IEXA 2ZKLA 1IS3A 4LT5A 3MIBA 2VNRA 1DQ6A 2DCTA 2VOKA 3ZFFC 2R1DA 1ZRDA 2RR11 2ILMA 4BLIA 4LULA 1QXPA 3WG4A 4KG8A 1BMV1 2JJ6A 1CQ9A 1YI7A 4WM8C 3ZDSA 1PIV2 2AGSA 4EV0A 1Q8QA 2R30A 1UAIA 2NN8A 3ZN4A 3USUB 1FPN1 2YHJA 2FZ2A 1NZCA 1XNKA 1LGCA 4LBQB 3WQ0A 4Y5Z0 2ZBJA 2IXLA 3V64A 3SISA 4YM3A 3SH3A 5KHKA 4X8NA 1QXRA 1DQ5A 3R05A 4FOQA 4OVEA 3UKTA 1N1VA 4MGZE 4XFIA 3R4DB 2PAKA 2QUOA 3RG0A 5JR7B 1HKDA 5JOXA 1H1IA 2A3WA 2A6WA 1DZTA 1V6LA 4XMIA 5C9AA 4Q0UA 1PIV1 2DUPA 1EAH2 2ZX2A 1CX4A 2R042 3N35A 2OVUA 4UBHA 3ZXFA 1W6MA 4Q29A 4QGLA 3VBUA 4PDWA 1GZWA 1X8MA 2OZJA 3PJYA 4AGVA 3ZXGA 1V6OA 4QT6A 3TAYA 3I54A 3ZXEA 4XJZA 3S6PA 3ZYJB 2A6ZA 1LEMA 2ZX3A 1W39A 3GHMA 3VHNA 3W59A 1LECA 4G4FA 3D8CA 1LGBA 4YW2A 1H2NA 2ZGQA 2CNAA 2PTMA 3IKWA 4XQDA 2DWRA 3O7OA 2JDZA 4PBPA 4NHKA 5F5QA 1C1FA 1EAH1 3DPRB 2R041 3SXWA 4DY5A 5KC6A 1RUG2 5FFOC 5J48A 1SLLA 1V6NA 2RMU2 4ISRA 2CWMA 2D6MA 4L8QA 4GULA 2AENA 4YGDA 4EROA 4RSUA 4O9GA 2B42B 3B5LB 3E5XA 5GZDA 3N36A 4CTEA 2DU0A 2LTNA 4CDWC 3B00A 2VMGA 1SMVA 4Q27A 1SCSA 1C1LA 4PLNA 4Y1UA 5F1RA 2VW2A 4CDXA 3I4IA 3ZFGA 1S0FA 3KCYA 3SCGA 4HETA 3VBUC 2GNTA 4HPKA 1ASJ3 1X7NA 2BFUS 3E5UA 4OI4A 4C0HA 5L7OC 2EXKA 1RUG1 2AREA 2IFRA 5KHIA 2V73A 3J8F3 3TNQA 1VB4A 3D82A 4P9LA 3WY6A 4XBLA 4AQSA 4WBBA