3V7MA

Crystal structure of monoclonal human anti-rhesus d fc igg1 t125(yb2/0) in the presence of zn2+
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Effect of zinc on human IgG1 and its Fc gamma R interactions.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v7mA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v7mA01
4MA3A 5FUCE 3BSZL 4XWGH 3NBNA 5KTEH 3VWJB 2XKNB 2R8SH 5FYKE 4L1HA 2QKIB 1IGFH 2NY5H 5E2VL 4NQVA 4RAVB 3ALXA 3GSQB 3SDYL 2X4UA 3ZKNC 4PRNA 4ZDHB 3CK0L 3FQTA 4FFYH 4IOFD 2OI9B 3QXAA 4P5KA 2ATKB 1QA9B 3QBTB 5K9KB 4WVRA 1ND0B 3QIUA 2VL5A 5HYJA 3BPLC 1P84J 1BQHA 1ORSA 5I1KL 5CZXC 4C83A 4C59B 5C6PB 2WINA 1VGKB 4WWKB 2J88L 3RAJH 2IAMC 4ONGH 1UZ8B 2E7BA 4YHIA 3WL9A 2VSCA 3DRQA 4JFHD 1HNGA 3C08H 3QQ3A 3KAAA 5B39G 5FGBA 5MEPB 1MCEA 2DM7A 3SKOA 3GSXB 1LO2H 1IAOB 1W0VA 3NCBB 5J12C 3O8XB 4NKDB 4P57A 3DYPA 2OJZL 1KB5L 1OAKH 2BSSA 5CEZE 5K9JH 4R7NA 4JQVA 2R0LL 4EQ2A 1LD9B 2ADGB 1MWAH 1IAIH 3WFBH 1DE4A 3IDJA 4XPTH 3S5LA 4J4PD 3MR9A 3VDBA 1M7XA 3I75B 4I2XA 5IMOB 4LDEB 5T1LD 1NBZB 1U91A 2M8XA 1KJMB 3VGGA 2VDOH 3S98A 2E8YA 1T1ZB 3X3GH 3FO2B 1RURL 2GI7A 4XCYA 1FN4B 3TN0D 1HSBA 2JIXD 4BKLB 3QIWB 4OCWL 4CMHC 4EI5B 1NUFA 4OZIE 4ZO8A 4ELKB 4EVNB 4HF5H 1ZGLB 3D0LB 5GGRB 3QDGA 1UH2A 1U0QA 2JCCF 2X1OA 1F4XH 3JXAA 1IT9L 4I48B 4RGND 3B3IA 1QQDA 4M1CC 4G8IB 1MJJB 1KENH 2IJ0C 1GOHA 4X4XA 3ZKQD 5IEKA 2CRIA 1HINL 4PJBE 4HGWB 3U30C 2BMKB 3FZUD 5GRUH 4P59H 35C8H 1G7QA 3BUYB 2DICA 3T65A 5TQ0L 5HPOA 5BVJB 3PDOA 1RZGB 4OZIB 5CHNB 4BZYA 4DZBA 1OL0A 4FQXC 4XHJD 3C09C 1MIEL 1IBGL 5I76B 3RTQD 1DLFL 4GMTL 3TO4A 5HI5C 4JY4A 4K3JL 1TCRB 2HVJB 3MRPA 3PWPE 3SDDD 4KJYB 2ORBL 3AUVA 5BS0A 4HKJB 1G7JA 1EO8L 4N9GA 3ULUH 3E3QC 4ZAKC 1AGEA 1FNGA 1ZMYA 3BZDA 5DRNA 2N56A 3RIFK 4MJ5B 2CIIA 1JWMA 4LEOA 3M45A 2J3SA 1S9WB 3O2WH 3SN6N 3CFBB 4WRLA 3LY6A 5T1KD 4JHAL 3SBWC 1KF9B 3CXHJ 4BQ8A 5IB4A 3WO4B 3D0VA 2J12B 4BZ2L 4O2FA 5I1EL 4NP4L 1KTLA 3E3QE 3MRGA 5IF0B 3RUGA 2HFGH 1YPZF 3JV5A 3GRWA 4G7VL 4FFVD 4TSCL 4FQXB 1Z9MA 1F42A 1OAQH 2W60B 3LRHA 4CJ0A 2E6JA 1YNLL 5F1IB 5I1IH 1T7ZA 2IANE 4UMGA 3GSVB 4XNXH 3L9RB 2OR9H 1AO7A 5I1GH 3U0WL 1R24A 5TH2A 3GMPB 1VKXA 1GGYA 4ZFOA 4L8SA 1I1AD 2DQTH 5GS0C 2APXA 1N7MH 2X44D 2BRQA 2DIJA 2WUCH 2NXYD 3L1OL 4Y4HA 3VI4F 4GRLB 2X4PA 2VLJE 2EE3A 4RWYL 4CRPA 5FYLD 4PS4H 4V2BA 4FQJL 4O9HL 4J4PC 4PJHF 4ZPTA 3WHE1 2QR0A 5JO5A 1N2RB 4NQXA 5AUMB 1PZ5B 5CWSB 5KSVB 4X99A 5EU3A 5A1AA 1U2HA 5EU6A 1KPUB 3LEYL 3HC4L 3LKSA 4WEBH 1MCRA 2X4QA 4J12A 1NEZB 3EDKA 3V6FB 3BKJH 1PQZB 1W72H 2RFXB 4HV8B 4X8JA 2Z8RA 1F97A 1YEGL 2ZPKH 4IRSC 4DZ8A 1MNUH 4X6CB 5DEGA 4ONFH 5HI3D 2FEDC 3VXOB 1MJ8H 1FL3B 3UDWC 5E1HB 1IQWH 5J13C 4XPBL 4Y5XB 1G6RL 1JVKA 4HWNA 5AZEH 2HTKC 3BDBA 4DN3H 4D9RD 5E56A 3D39D 1CVSC 2ARJB 1RIHL 2PYEE 3W11C 1NFIB 4JFQA 5CEYB 4Q58C 1RIVH 3UO1L 1U36A 4XC3H 4GLRI 2HP4A 1LP9B 2EXWC 4XHJC 1OARL 3D2UA 5TDNA 2F74B 1OAXL 1YN7A 3UYRL 5IVNA 4YDVA 4OLZH 5D1ZD 2VAJA 1QLEH 4FXGA 3RTQC 2VZUA 5FKPA 4YIQA 3WD5H 1AKJB 1DBKL 4TVPE 5IMLA 2O5XH 2VIRA 1J87A 2ADIB 4WHYH 3KXFB 5KS9E 2NCMA 3O4OC 3JUYA 4NO2B 2D4DA 3BSZH 4O2EA 1J05A 1MY7A 4YC2B 4GG6E 1QFHA 1WFUA 1FJ1B 3G6DL 4G6KL 5E2VH 4N5EC 2P49B 3SDYH 2JJTA 4LVHC 1HHJB 1EDQA 3CK0H 4U6YB 3ULVC 1HKLL 2E7LA 2DN7A 2NZIA 4UV4L 4A2LA 1RJZB 2HN7A 4NSKB 2XTJB 5FKAB 1OHQA 3DSFL 2BERA 5I1KH 3RWCA 5JW4R 4FG6C 1RMFL 2NY6B 2ZUYA 4RFOL 2J88H 5KSAC 1WZMA 12E8L 3Q6GL 4TNVF 3NOIA 5IW1A 1S7WB 3ULVE 4H25B 3CD4A 4IMLA 4QF1B 2AEIT 2VYRE 1AGBA 2F9BT 5DVOA 4NGHL 2OJZH 1KB5H 2X1PA 4L29A 4Z78A 1RK1B 3C2SA 2BNRD 2R0LH 1EXUB 2B0SL 3N1MC 1B9ZA 3IU3A 1KCRL 3VGAB 1OGAA 2C5DC 1LO0H 2CPCA 4QHNA 3DMMD 1U6AH 2DLIA 3QIBC 4LPTA 1X7QA 4P46D 5B38B 1D5XA 2NR6C 4LPCA 2BVUA 4OCWH 3WIHL 3EUUA 4WU7B 5JW5A 5FA3B 1UG9A 1HOCA 1KJVA 3L3GB 3SE4C 1IT9H 1CXIA 1E27A 2B1AL 2MTPA 2Q76A 5DVNA 3VFOB 5EBMA 5IB1A 2WNGA 2BOCA 2YUZA 3F7QA 2NX5A 1F5WA 4AT6A 5B38G 2NY4C 4U31A 4XNQB 2E3VA 2BSRB 4TTDD 3SPVB 1H8NA 2X4SB 4Y4KB 1HINH 1JUFA 4F37F 5EUKA 2MQ3A 5EBLB 1OSZA 2I27N 3IU4L 4QCIA 5JW4M 4RQQA 4NNXB 1F6AA 2PCPA 3C6LD 5TQ0H 1P4LA 3OKOA 4J2XA 3QUML 3WDJA 3WE6A 1DUYA 1MIEH 3EGSA 1R3LB 4OLEA 1K6QL 1CU4L 43CAB 4BFBD 1CG9B 4ETQA 2FECL 1DLFH 4GMTH 3F62A 1BD2A 4LVEA 2N4IA 4K3JH 4PV8A 4ENEC 4OUOA 1N0LA 1KJ2A 2LAGB 4CMMB 3CZFA 4N68A 4U0QB 2ORBH 5FCSH 4F3FB 4PRPA 5FB8A 5DRZA 2EYSA 4P5TA 1QSEE 1CGWA 5D1QB 1EO8H 3VD9A 2ATPA 2J8UF 2GJZA 5FO8A 4NQDA 1HYSC 5GSVA 4EI6A 1S8DB 1VGEL 3JV6B 1WWBX 4U6HA 3Q2CA 3G04B 5IR1B 5GZOD 1M71B 1T04B 3D5OF 5GGUA 1N6UA 5GS1B 1Q9LA 5FA4B 4D2NA 4RX4A 1UKQA 3SKNB 2EDYA 4CN4A 4BZ2H 3UTZB 3VMOA 5I1EH 4NP4H 4Y19A 3KJ4C 5TDOB 3W5NA 1A9BA 4X6EB 3P4MB 1KULA 2FL5B 1I3RA 2XQYK 5D2NC 1I8KB 1QSEB 4TSCH 5ABDE 4HJ0D 3MRBA 1JMZA 5AZ2L 1YNLH 2VLRA 1Q94A 5F44A 4OFKA 3T4AB 2QSQA 4WJ5A 4Q6IB 1A3QA 1MI5A 3U0WH 3MV9D 1IL1B 4R0LB 4MD5B 1OSPL 4PJ9C 3IYLW 1FQ9C 4K94L 3QUXB 3MA7B 4PJCA 5CLWA 3VCLB 3GSNB 1D5ZA 2NZ9D 5DVMA 3S88L 3L1OH 3O6FB 2ICEA 1X9QA 4N1CA 4RWYH 2YD2A 4UZGA 3T0ED 2XA8L 4FQJH 4O9HH 1NCUA 4YGVB 3VXUE 7FABL 1GZQA 3P4NB 1YJDC 1I7RA 3HE7B 4NCC2 4MNHA 3LEYH 3HC4H 3W81A 4BH7A 5F7MC 2DYPB 5MHSD 5CBEA 5CUSL 3EYQD 1AGCA 5AD0A 1SJEB 4JFFA 3KLSA 1YEGH 5I1LA 4HS6B 4QHKJ 4JY5L 5D2LA 2YD7A 4PRHB 4R9HA 2YUWA 5I15L 1FPTL 3NZ8A 4Y5VC 3OB0H 1Z6JT 3B9AA 4CU6A 2H2PC 4HC1A 3IDMA 4XPBH 5EOCJ 4CDGC 4KFZC 5DA4A 1JFQH 4TTDC 3EDEA 1JRHI 5DJ8B 4AEEA 1RIHH 1G7MA 2SEBA 4IIQA 3I6KB 1PVHA 4DK3A 4X7TA 1OWWA 4G8GA 3UO1H 5BOPA 3E8UL 2X1QA 2BVOA 5JDSA 3DLQR 1T5XA 1KTRL 3MV7D 4QT5A 3SDAA 1K2DB 1OARH 1YMMD 4DCQA 2DWEA 1OAXH 3UYRH 4YAQB 1YPZE 5HHQB 3BMVA 4HWBL 1BREA 1NCDL 1NBYB 5C0RL 3HFML 4G7YL 3WJLA 4YHML 2ZKHL 3KYNA 4GFTB 1UM6L 3DXAE 5EZIL 4I1NB 5C08E 4DWHA 5EU4B 2DQEL 1YEEL 2BNUB 5IUSA 2ZP0T 3RVTD 5EOTA 2WQRA 4YHKL 3UTPD 1NGZA 5I1CL 3G6DH 4G6KH 1IGJA 2PETA 2IQ9L 3VI4E 1HKLH 4RGMB 5F71A 1EUUA 1SVZA 1L6ZA 2ICWJ 4GRMA 1ZLSL 4UV4H 1EHXA 1LE5B 5JUEL 3WHXA 3BRGC 4MJ6A 1HK6A 4MX7A 1CICB 4XP1L 4PJFF 4L3EE 3ZSSA 3DSFH 2H26B 1FV1A 3H7LA 3QEHA 5TDPB 3IVKB 4RFOH 3DXAB 1WBZB 1NQBA 1IILE 4UV7L 3PNWB 4F9LA 3Q6GH 2VE6A 3VGDA 1BFTA 5ERWA 4HJ0C 1WIOA 4D0DA 3BH9A 4XP5L 3RPIB 4GW4A 2Y6SD 1KFAL 2CKBL 1DQQB 4NGHH 3FQWA 1RZIA 4W6YB 2ZUVA 4PYGA 5E5UB 4XZUB 4GXVL 4M5ZL 3QI9B 2B0SH 1YECL 5JPMA 4WY7H 2CLZB 3M17B 3SCMB 4X0KB 4RAUA 3S36X 3U46B 2APTA 1P7QA 5FYJL 4E41A 4FXKA 4X5XB 3O11A 3DUUB 5E8EB 4MWFB 5INDB 4ORZC 3H3BC 2D7OA 4QTHA 5HGAA 4JG0L 4JZJB 4JAMA 4LBEA 4JANA 4N0CD 3WIHH 3OTTA 1DN0B 2X42A 2PXYD 1U8MA 1EAJA 3RGHA 1TXKA 3RX7A 4BM7A 2B1AH 3TCLA 2Q8AL 2P4AB 1PJ9A 5K9OB 2Z31B 3EO0B 4MQ7B 3VGEA 2HLFC 1JCKA 2BOBB 4X6BA 1I7ZA 4CJ1A 4JFDD 1EFXD 2DJ4A 4PGEA 1X5GA 2ESVA 3HPJA 4YNYA 4P4KC 3OG6B 3WYRA 3HG1E 5DVLA 1T6VN 2GT9A 2X89D 2P8MA 3ES6A 4BSVB 5I1AA 4Z8FL 5FV1L 2AK4A 3CZJA 2CLRB 3ROLA 3QUMH 5FM4A 3EHBD 5DJDB 2PTTA 3I6LE 5F93C 3N50A 1K6QH 1CU4H 5A2JH 4M1GL 1X4YA 1HCFX 4PY7B 3SQOL 4UNVA 1DDHB 4YDKL 3HPLB 3ZTNL 4WU5B 3VI3F 4HS3B 1BEYL 5C0GA 4JN2A 1V5JA 4HK0B 2OL3L 1VESA 1S9XA 4Y2DB 5ETUA 1WZ1L 4MCZB 2X1XR 5FGSA 1IKFL 1VGEH 2UWEA 1VHPA 4L8CB 2DM4A 1TTGA 2F54B 3CDYA 3BGMB 4H1LA 5D6CB 1DQJA 1FFRA 2DL9A 1Y18A 5FECA 1Q9WA 3WFHA 4Z9KB 4R97B 1PEWA 4JFOA 3MGOB 5E7FA 4DTGL 3MNZA 4Z7UE 1G9NC 3AAZB 4R4NC 2Q8BL 3TJEL 3KPRD 5AZ2H 4XAWL 4W4OC 2MQ0A 4PGCB 3CGTA 1KIPA 1NGPH 1KB9J 3L3JB 4LU5L 4YHPB 5T3XD 1OSPH 1F3RB 1YUHA 1I1FA 4OV5B 4K94H 3GJFH 4EEEA 1A1OA 1HKFA 4XTRC 1YZZA 3S88H 3W39A 4TUJA 2OMNA 3LPWA 2YA2A 5BVPL 1T4KA 5HGHA 1JGEB 5IOPB 2DMCA 1KXVC 2FGZA 5C0AA 2XA8H 5F88A 1RULL 2OZ4L 1IC1A 4P2OA 2X5PA 1M7DB 3OMZA 7FABH 3DHMA 4PRBA 4G6FD 2H6PA 4NN7C 1MOEA 3B5TA 4ZUSA 1DLHA 5CUSH 2PXYC 3ULSA 3OR7B 3O9WB 4PUBL 4GAFB 1WICA 4JY5H 5DC0A 1MFAL 3BN9C 5I15H 1FPTH 5EO1B 32C2B 5HJ3A 5KSBF 5MEQA 3S96B 3ZTJH 2ZOKB 5DGRA 4XVSL 2YEZA 3MUY1 1N4XL 2VLKE 4K07A 4L3CA 4NJ9L 4P49A 1C08B 1WCQA 1S78C 1IC4L 1IM9B 5CIPA 4NKIL 3NH7H 4JKPL 1IZJA 2DS4A 2Z35A 3OB8A 2BSED 1H9VA 2A6KB 4YDLC 3B8YA 2XG4A 4JZNA 5C0EB 5F6IC 4J6RL 5J56B 4NHUA 4RA3A 4HWBH 3T2PA 1B0RA 1RU9L 1NCDH 5C0RH 3HFMH 4G7YH 4H5SB 1M6OB 3LQAL 2OM5A 2Q3ZA 2ZKHH 2B5IC 1U95A 4LSDA 4YHMH 4KI1A 1MCIA 1UM6H 4PJDB 5EZIH 2VLKB 4J1UB 3RVXD 2DQEH 1YEEH 4LMQI 1JZ7A 1F3DH 4KJWD 3HI1A 5F9DC 1KTDA 3OX8B 4PJAE 4YHKH 3S3JA 5I1CH 3UBXI 1A6PA 4PP2A 1GGBL 3JTTB 2VQTA 5B8CA 4IDJL 4O2CB 2IQ9H 1EMTL 3LPFA 4UTAL 4J8RB 2APWA 3MUGB 1S7VB 2D03L 4X4MA 2GYSA 5JUEH 4CVXB 4ZG1A 1TJHH 2LFGA 4XC1L 4XP4L 3QSKB 3RJQB 4XP1H 1QLFA 3RVUD 1OGTB 3LV3A 4LPUA 1KB9K 3FT2A 1BBDL 4P3DA 1KCSL 2P7TA 4ZPVB 3TIDB 1S7QA 5I1DB 4UV7H 1AGDB 2C4FT 1CT8B 1N5AA 3MRRB 5ANMA 2EDRA 1WC7B 4ODWB 1JNJA 4PJAB 5TPWL 3KPQB 1LWRA 4XP5H 3QUYD 4MLIA 3OKNA 5HHPA 5ICXA 1KFAH 2CKBH 1F6LL 1QSFA 5F9JA 3NIFF 1D9KD 1U3HC 3T0WA 5C09D 4GXVH 4M5ZH 4FQHB 1YECH 2Z93A 3BD5A 4EIZC 4NHCH 2YD8A 1JYNA 1T21A 4LCCB 4MAYA 5L0QC 4UOW1 2VABB 3QUKA 4ZXBB 4LLVA 3QUZB 4JFEE 3KWWA 2EEBA 4QHLB 3VGBA 1OPGL 3VWJD 2OXHA 3QA3A 4JG0H 4PPTA 5DR5L 3RRQA 1JHTB 4JRYB 5CJ8A 3LB6D 1A2YB 5ID1B 1S3KH 4HG4K 4F7MA 1SVCP 3SE9L 5FDWB 4KZDL 3QQ9D 4PREA 2Q8AH 1GC1C 2IBZY 3BP4B 5I66A 2E7HA 4X6CF 4KROB 4ODHH 1A64A 4YO0A 3MV8A 5E6YA 1Q72L 2XZAL 5DUML 5IB3A 2ZSVA 1JF5A 4RFNC 4UQ3A 4TSAL 4WWKD 3LEXB 2J2ZA 1FGNL 1G9EA 3SO3B 3TBTA 1KLGB 1JYWA 3E2HC 1HHGA 1FORL 3EJJX 4X4YB 4Z8FH 1HHIB 1I8IB 2AABL 2O26U 4Y16A 1QBLH 5ESAA 5F9WC 2CLVB 1W0YT 3V5HA 4MJIB 5LG1A 4WW1A 4G6ML 4I18C 5E1AB 5M95B 2Z92B 4IRZL 1ED3A 4CVWA 1UWXH 3HB3D 1KCVL 1FZOA 3ELAT 3WFCH 4M7ZB 4M1GH 3SQOH 1L9NA 3CDGA 3AROA 2PW1A 1ZLUH 3ZTNH 3BOVA 5C0CD 2V2TB 4Z76A 5JIKA 1BEYH 3MLXL 3H6JA 3TYFA 2A77L 3QIWD 4EI5D 1TITA 3QCTL 1WZ1H 3FHQA 2J6EL 2YD6A 3QULA 4WV1C 2VZVA 5GSRB 1Y0LA 5BZWA 2D0GA 1IKFH 2A0LC 3UBXG 2CDGB 4LIQE 4ZYKA 4TSBL 1EZVX 1RZJC 4QRPE 2ZOLA 1B2WL 2OXGA 1JV5B 2HFEA 4XNYL 4OM0L 3O4LA 1IGYA 1CDJA 4QWWD 3IAGC 1DBAL 2BK8A 4KDVA 3GSRA 4DTGH 3RVUC 4R90L 4K9EL 5IM7A 2Q8BH 3TJEH 2HVKB 2VTFA 3W0WB 1X5KA 3PABA 1FZMA 5I74C 2MOVA 3SJVB 4LU5H 3K74B 1AY1L 1CXHA 3TH4T 1C5BL 3MRJB 4NO3A 3UTQB 3H9SA 5IHLB 3E0GA 1HQRB 4G43A 4LGRB 2P5EB 2Z8SA 3MJ8B 4KQ3L 1IMHC 3FQNA 4K71C 5IVOA 1WWCA 2WBJC 3T2QA 1NCWL 4PGBA 1XMWA 3IJHB 2XG5A 3VA2C 2YC1B 1RK0B 3DV6B 4AYFA 4LSQL 4PJXB 4BUGA 1RULH 4LKCB 2OZ4H 5CMAA 3CSYA 3V0VB 2WSKA 1DQML 4Q9BA 4GW5A 4J3OC 1KG0B 3DTXA 4DAGL 4GG8B 1J0HA 5L88L 4ODBD 3VH8A 2XTLA 4OSUL 4PUBH 3TZVB 2YPLE 3HKFA 3U7AA 1CIDA 3R0MA 1MFAH 2NY2B 4FRWA 2G9HA 2IH1B 3N9GL 3KGRA 1T2QH 3FQXB 1H8SA 3PQYD 3RUGF 2MNUA 2ZCLL 3DPBA 3ROOB 4XVSH 1N4XH 4L5FL 4LCUB 1NAKL 1CF8L 4NJ9H 2F8OA 1YYLL 2UVFA 4G5ZL 1IC4H 3K3QA 4RIRB 4C55A 4NKIH 2DQJL 2ED7A 4R4FL 4JKPH 3CFDA 3LEVL 1JYXA 1IEBA 3NFNB 1N64H 4GRLD 3MRIB 2X4OB 4JM2B 4GRWH 3OGOE 1J8HA 3D3VB 2F53D 4HIEB 1RU9H 3G5VB 5K33A 4LHUA 1S7RA 5I1HL 3L95A 5EUOB 3BD3A 3ZYIA 4L8BB 2C4XA 2CXKA 1HHHA 3REVB 3DURB 5GGRY 5DFWH 3PHOA 5JPNB 1ZS8A 1GGBH 4LLWA 1KACB 5FYKL 4IDJH 3FTGB 3HR6A 5SX5K 3LZFL 2AGJL 4UTAH 4UT7L 1U8KB 2CMRL 4HIXH 3LS4L 4WDIA 1NLDL 4LCYB 1A5FL 4ZUWB 4XC1H 5DZOA 1IGTB 4XP4H 1EX0A 1TZHB 2FIRT 4IRJA 2VISA 4AQOA 2H32B 1VB9A 3BJLA 1FVDA 4JCMA 1BBDH 1KCSH 3BEWB 1WT5A 1JE6A 3VWKC 2RCSL 4TQEH 4KI5E 5HHOE 3MLTA 5BZDB 3FN0L 1JI2A 5TPWH 2MFNA 4AMKL 1FZKB 1ZWIB 5KVFL 1Q9KA 4X6DF 1OD7A 3WKML 3LVEA 3EFFB 4JB9L 2BCKB 4YDJA 1IQDB 1NFDF 3DRTA 5F72S 5HYSB 1T83A 5CEZL 3OAZH 5E99L 4WGVB 1NAML 4CL7A 2J5LB 3KXFD 3ARRA 5GGSA 1DR9A 3JBG7 3RBGA 1F3DJ 2Q1EA 5JMOC 5IVZB 4HULB 2APFA 4JDVB 4KKAD 2OK0L 5DR5H 3P77B 4V2CB 3UJIH 3AS1A 4PIRF 3FONB 4KRPB 3SE3C 2CJUL 5L9DL 4KZDH 1BIHA 4FOMA 3CDCA 4OT1H 4HXBL 5JHDE 4CADB 2XTJD 4NBZB 4WUUA 4KKLC 1Q72H 2FO4A 5HTSA 5DUMH 2MHAB 1UKSA 5FAAA 3O45A 3BQUA 4P48A 4TSAH 5DO2D 4UB0L 3GJFK 3GUTA 4Z7NF 1JF6A 2AKRB 5I8CA 1FORH 3ARFA 1B3JA 4AM0B 2AABH 5F21B 1U3YA 5BV7B 3WS3B 4U1GB 4G6MH 3IDIA 3WNLA 1YN6B 5D7LB 2I9LB 4AJ0A 4MZ2A 1XH3A 5T5FL 1KCVH 3MLRL 3F65A 2W0PA 3T3MF 3UJTL 3TO4D 1FFPB 4XBGA 5SWZB 4B53A 1ZT7A 1I7TB 3MLXH 4FFWD 4Y1AA 5D72L 1MFNA 2VR9A 1A1MB 1RJYB 3MJ7B 5JA8B 2L7UA 4CBPA 2A77H 2WMPA 5ISZA 5GHWL 5CJOL 1CGXA 1UEYA 3QCTH 3TA3D 2J6EH 3G6AB 3RWHA 3SGJA 1FBIL 1J8KA 3EJZC 3NIFE 2PR4L 4Y0GA 1NDGA 4TSBH 2FD6L 3DJ9A 3BDXA 1QBAA 4JPIB 3OKMB 1FNFA 3VA6A 2VUOA 4XNYH 4AEIL 4HLJA 4I0PB 4R4BA 4Y4KD 1HNFA 4POZD 1DBAH 3WEXB 2PN5A 3NN8B 3HRZA 2HA1A 3BPCB 5DJAA 4D94A 1F4AA 1QRNB 3MMEA 4R90H 5F3HB 3LKQB 4K9EH 3QIUC 2X4NA 5C0BE 4NO5B 3SQBA 5DUBB 2BNQD 3CFJA 5DMGC 4MVBD 3QEQA 4TUOB 1J5OL 1TZIB 2BVEA 4XNMA 3VH8G 4NRZA 4WFGE 1AY1H 4OCSH 1C5BH 2BVTA 5IB2A 3RWIA 4NUGL 3W9EA 5FGBC 4KQ3H 5JXEA 4KJPD 2P8LB 3T0BA 1CL7L 3V4VL 2VDKL 4QOKB 5J6HA 5HYJE 4HPOL 1NCWH 3QT2A 3VJ6A 3SDXF 1PLGH 4XCCL 1JWSB 4MNGB 5D70L 4JQVC 5D1QD 4KC3B 2X4TB 4LSQH 3QNZB 3STZB 3RWFB 5LJYH 2E27L 5C0BB 1VDGA 3ZE1F 1OAUL 1QZ1A 5D96B 1MVFA 2GK0B 3HZKA 3QISA 4E42B 4MLSA 4FQCL 4DAGH 1XZ0A 4N5UA 3MOAH 5GS0L 3CX5J 4PJ8B 5TGBA 4L9LB 4OSUH 3OKEB 4L4TB 1VERA 5A16B 3G6JA 3V6BR 3TNNB 4CU7A 4OFYA 4LLAA 2VO5A 3N9GH 4I2XE 4LHUG 5KG9A 4XPAL 5B4MD 1IGIL 5CJQL 3CMOL 4U1MB 2ZCLH 1BBJB 3C6SA 2PF6A 3RGVA 1WGOA 1ETZB 4L5FH 1EEZB 1NAKH 1CF8H 4HIIB 1ZT1B 1YYLH 1JPFB 2RAMA 3QDGE 4G5ZH 4TYUA 3QUXD 1G7IB 1MLBA 1A6VL 3EZJB 2DQJH 4R4FH 2QADC 3OF6D 3HUJA 4RMWA 3LEVH 5BMFL 3T77B 1CZ8L 2EEAA 5HHME 1T0MB 3GMQA 1UYWL 3NMEA 4LF3A 3BPOB 2GK2A 4EN3A 1UB5B 4I2XB 1K5NA 3RL1B 3TO4C 1IAII 4WFHE 1VEPA 5I1HH 4ZQKB 3OAYH 5A2KH 3HE7D 4FFWC 1HSBB 2BC4A 4TVPL 3FMGL 4NN6B 3WDHA 2DYPD 1KN2L 2ED8A 4BK4A 5LCVH 4UU9A 3CIQA 3TA3C 3VFRA 2OQJA 1G7LA 1PKQE 3BGFC 3LS5L 4XB7A 4ONHB 2VQ1B 3LZFH 2AGJH 2AEPL 4PRHD 4UT7H 2CMRH 3ARBB 4PJGA 3MRFA 1X5IA 3LS4H 3NTCL 1JIBA 1NLDH 1A5FH 4JLRB 3O3BA 2A6IB 4F9PA 3U7YL 5DRWA 5BS0E 4K7PY 1Q0YL 3BDYL 4XCFL 3VRJB 2RCSH 1QSVA 2AJSL 2E6QA 4KRLB 3FN0H 4CW1B 3AXLA 3ZLQC 3FB8B 3U0PB 4AMKH 5MEOB 4OIAA 1M1SA 3AS0A 1PKQB 4JB9H 5LWYL 3ULVL 5DYOB 4YHNB 4MVBC 5EZJA 3BGAA 3U9PL 5T3ZE 2HTLC 5C8JA 3BZFB 3RWGB 2GQHA 4JM4L 5F7DB 5KW9L 1PEZA 5GRVL 3BO8B 3O3EB 1Z2KA 2ID5A 4H88L 2WZPD 3ZDYE 5MENB 4L4JA 3MBEB 3KPPA 5CEZH 4L8SC 3F12B 1W72A 5E99H 3RUGE 1NAMH 4LSPL 3LMJL 1GGCL 3F7RA 1QPPA 4Y4HC 3CX5K 3RDTB 3P9MB 1AGEB 2I9TB 5DRNB 1QNZL 2UY7A 4U7SA 2NY3D 4OGXL 4OZGB 4DKEH 2OK0H 4FP8L 3D1MC 1RUKL 2QSTA 4YLQT 1AO7E 2ARJQ 2EKJA 4H0GA 2DWDA 4W68A 1I75A 3MYJA 4QHMA 4U1JB 5E4EC 5K93A 3QHFL 4O2FB 1CICD 3VXRB 4OAWA 5L2JA 4HAGA 5DSCA 4NYLB 2D3VA 3M1BA 1TDQA 4HUXB 1EGJA 5IMMA 2X70A 3G5XB 5EO0B 4N0UA 5I2IA 3CPLA 2NTFB 5DK0A 4UB0H 1XF5A 4GW1A 3F7VA 5I6XB 5HGDA 3VE0A 4NO0D 1BHGA 1MWAB 5EU6E 4U0RC 1PYWB 3MNVB 4TNWF 3GMMA 5IESL 3QPQD 5BRZA 2YWZA 4XX1E 3QI9D 5T5FH 3V7MA 4HFWB 3MZTA 3UJTH 2P5WE 2VWEC 5CJXA 1KOAA 1U9KA 2IADA 4MD0B 1R3JB 5D72H 3EYUL 1BFSA 3TBVA 3ZYZA 1SYSB 1FCGA 2K9UA 4NQEB 2VH5L 3ARVA 4PRPD 4YXHL 5GHWH 5CJOH 2IBBA 1RJLB 4QKXB 3W82A 4PFEA 4NQDD 5EN2B 2H3NA 3SKMA 1FBIH 3HE6A 4I4WB 2YBRA 3QNXA 2PR4H 3BJ91 3HZVB 2Z31D 5GJTL 2VWEE 4YX2L 3HS0A 4M62H 1KPRA 1XGQA 3R1GL 4OZ4A 3RHWK 3WSQL 1IAIM 5F1KC 2FEEL 3O3AB 3IJYA 4HPYL 5T5NG 3PWNA 2JJTC 4M7LT 2FJGA 2P5WB 3GSNL 1CD1A 1X5HA 2XWTA 2E7LC 1I9RL 1MFDL 2WK2A 3GHEL 5E8NA 3QJFB 5L2KA 3V5KA 1KT2B 1PG7L 4ZS6D 2JJWA 2VDRL 1ZA3B 3MCKA 3PE9A 2E6PA 1AXIB 4NQCA 1A7RL 4LLMA 3V5DA 4JDZA 3K4DA 3HAEA 3LRSA 3DX8B 3D2UB 4X9HA 4NUGH 3IDNA 4KH2A 4WIQA 1I9EA 2V6HA 1VFBA 2P8PB 1CL7H 1DQDL 2CR6A 2VDKH 3V4VH 1OAZL 4Z7NE 3P40A 4HPOH 2R1XA 4YIQB 2FNBA 4XCCH 4Y2DD 3U1SL 2W92A 1ZHBA 3U4BL 2APBA 5DEZA 4Y7MA 1Q1JL 2E27H 2ZUSA 1T1XA 1ZHLB 2FB4L 5DD6B 1OAUH 3KPNB 2F54D 3MV01 1CXFA 5E8PA 4FQCH 1S9YA 3CX2A 2VRAA 4WFFD 1MCNA 1YMHA 5GS0H 2EDXA 4QNPF 2UWEF 3T3ME 1ERNA 1QFPA 2PO6B 1AIFB 4Y4FD 1AC6A 4G8EA 1TTUA 3PL6B 5DK2B 1ZLWH 3V2AR 5JIIA 5LKNA 1CGYA 4HQQL 2NY7L 2HN7B 2EO9A 1OGAE 5EZLB 3WN5A 4TUKL 3LSOB 4XPAH 5IVXF 4M1DL 4HD9A 5CJQH 1QEWA 4MCYA 3CMOH 5C1MB 1YJDL 2EH8L 3C5SA 3QQ4A 1OVZA 4QEGA 3MJ9A 2WIIB 1LK2A 4HGKC 1AGBB 1U8JA 1DJSA 3OXSB 1A6VH 3HLAA 5EO9A 4OKVB 2IF7A 5SWQB 2IQAB 1I85C 5DJZB 2NX5E 5BMFH 1CZ8H 5F97E 2Y23A 1L0YA 3WNNA 1UYWH 4LPXA 3PGCA 1XGUB 1J1OL 1F6FB 4N1EA 1XGRA 5CGYD 1YC7A 3UROR 3VG9B 4AH2A 1DANT 1RIUH 4TVPH 2WBWB 1OP3K 5DJ0A 4U6VL 4YHZL 3FMGH 1MCSA 2ICWB 3MREB 1KN2H 4P5TC 2IEPA 3LN9A 5DHVA 1UEMA 5FIEA 2FH8A 2GSIA 3O9WD 5GGTA 4H20L 4Y5YB 1E4WL 3LS5H 5TE6L 3D69B 3FT3B 2AEPH 2GSGA 5IT2L 4AT6B 2NLJA 5DD1L 1BD2E 4LNRB 2V5MA 3TVMB 2VLME 3L3KA 3NIGF 3TBYA 3OL2A 3RVWC 3JWOC 2DD8H 3U7YH 2XQBL 1D3CA 4QCIB 3ZE1E 3GSOA 1Q0YH 3BDYH 4XCFH 2V9TA 4LEXL 3EFDL 3O2VL 4P2RB 2AJSH 3U2SB 4N8VB 1MAJA 4F2MA 1IM9D 1AXSA 1DBML 4LLQA 1DUYB 2AXHA 3ULVH 5LWYH 3C8KA 2D7TL 3U9PH 2A6JB 1PFCA 4MAUL 1LEKA 4JM4H 4Q2ZB 1LO4L 4H88H 1NPUA 3L6FA 2H2SD 3X13B 4Y19E 2XWJA 3G5ZB 3WIIL 4R96A 2K7QA 4N8VG 5HDLA 4MA8L 4LSPH 3LMJH 1GGCH 2EYSB 4PJXF 4NQSA 1DSFL 3DUSB 1A3LH 3EOBB 4OZHA 1QNZH 3HZYB 1BQSA 4OGXH 2VLRE 4WHYG 3VFPB 2X2YA 1RHHB 4FP8H 3DBXB 1RUKH 1MI5E 5D7JB 5D1XB 1TQCC 1G7HA 3WXVL 4DGVL 3C9NA 3STLA 4IJ3C 2R15A 4RDQG 4J4PA 4D8PA 4PJCE 3VU2A 4M8QB 5T1LA 4YGAB 3WIFB 1LO5A 2BFVL 1AQKH 4QY8A 1U8NA 3QHFH 4PGZA 3G9AB 4JRXD 3TN0A 5HY9B 2JIXA 4Y4FC 2EDHA 4NN5C 4NPYA 4KGLA 3VDAA 4XI5D 3QG6B 1CLZL 4NC1E 1W8NA 1I1RA 1BOGB 1S9VB 3VFNB 1KB5B 3SHSA 3N0PB 4XCEB 3L3IB 4NT6B 5IG7B 4O5LL 2F19L 4NQTA 1UJTA 5IESH 5C07A 1KEML 3L3OB 1YDPA 4IIQC 4PJCB 3WFDL 2BHYA 1FVEB 4JFFE 4OF7A 5D2LE 1DEEB 5JZ7C 1HN1A 5E9DB 4XXDB 3WHE0 1EK3A 3GIZL 3SDAC 4GBXB 2HRPL 3K8LA 4ZXBD 1NH6A 4D3CL 3EYUH 3FT4A 3UTTB 2DM2A 4LSSL 5J3HD 2VH5H 1ADQA 3PWLB 3I85A 1FGVL 5IW6B 3BZ4A 2V7HA 4JRYD 2AV1B 4YXHH 3HI6L 5CGYC 4MNHB 4JCLA 4YH6A 2JJVA 3WJLC 3HAEG 4JQXA 4G8GE 4XWOC 5LGKA 1QO3A 3VXQB 1I7UA 5GJTH 4YX2H 2FYYB 1H15A 3SDDA 2KL6A 3VXSB 4NOBA 3R1GH 3TPUB 1XFPA 1KCKA 1T6WA 1XR9B 1JN6B 4HPYH 4LNVA 4LVOC 2X6MA 3LQZB 4NBXB 3VRIA 3GSNH 2ERJC 4WW2A 3L7FA 1I9RH 1MFDH 4PYHA 3PWJA 1PG7H 1MJ7H 4JG1L 5T33L 5T1KA 1F13A 2V2XB 4J3SA 1HHKA 2VDRH 2YRLA 4MJID 1DBBL 1JPSL 4UDUA 1EJOL 4OF8A 1A7RH 5TF1L 4GT7A 4ZUVA 5IK3B 3VFSB 5INCA 4Z77B 4PRIB 4POYA 2QLVB 2DMKA 3UZQA 1DQDH 1OAZH 1AD9B 4HUKB 4TOYL 4PP1D 5ALBL 5B3JE 3ZDZF 3AU1A 1G9NL 3ECBA 5CSZA 3U1SH 3U4BH 3MQIA 1I1AA 1Q1JH 2BP3A 1UQSA 1MJUL 2VR4A 3BP7A 4OLYL 4JKKA 1RZFL 4PJEE 1LNUA 2YOCA 4AQ1B 4MQSB 2MKWA 4ELMA 5C7XL 3ARGB 4QXUL 5F96L 3I6GB 3LKNB 3BEVA 2E9IA 3GSWA 3MFFB 3PDDA 2JB6B 3VFTA 5FGCE 1A1NA 4WO4B 3WHXB 5CZVL 2NY7H 3U0TA 4ZFZA 4HK3N 3TCXA 4E41E 4LRNL 4TUKH 4EXKA 2Z4QA 1P2CA 4F57L 4PB9L 5HVHB 3W0WD 1YJDH 5DJXB 2EH8H 1MCLA 1K4CB 5I17B 4IEFB 2RIKA 3SJVD 4D0DB 3BH9B 5BXFA 4PJEB 1R0AL 2P5ED 1NUNB 5KANI 3FQWB 4M6MH 2BDNL 3R06A 1WV7T 3HZMB 3N1FC 2E8ZA 2OS7A 3ARUA 3D39A 4O58L 4NRYA 1XF1A 2ESVE 4JPVL 1J1OH 3A0OA 4OD3L 3RVVC 4JREB 1V7NL 2OX5A 1FZJA 3NCYP 4PLNC 5F3BA 2CD0A 3PGFL 4KWUA 2HLAA 3QWQB 1NUGA 2AK4E 2D31A 3I3EA 2KUTA 4U6VH 4YHZH 5J3HC 2VSDA 4X6FA 3U9UA 2NXZB 4QRQB 4NBYB 5D1ZA 4KDWA 1BF8A 4ZSOA 5IHZB 4ZOEA 1WWAX 4F58L 4LDOB 1G6RB 1XGYL 2I26N 3X11B 4H20H 1F3JA 3TZVD 4RMQA 4X80L 5TE6H 4JN1L 2NY2D 1JZ5A 3RZCA 1A6AA 5IT2H 3FFCB 5DD1H 1I7ZB 2JJSA 4RZCA 1AP2B 5IBLD 4Q97A 4P9MH 1M05A 1S5HB 2JCCA 3NFPB 1A02N 2XQBH 4ZFGL 3KVQA 4LEXH 5HDOA 3EFDH 3O2VH 4GOSA 5GZND 3ARDB 3CFKB 1H5BA 2JB5L 1FFNA 4QNPE 3GZKA 4HHAB 1U8OA 1DBMH 4FZ8L 3JV4A 4UTBL 2D7TH 1R5WA 2C9AA 3KPLB 1JZ2A 3OKLA 4MAUH 2ARWA 2G5BB 2XRAL 4LASL 1LO4H 2QV2A 4F7CA 4JM2D 5A3IC 2R69L 2AERT 2RHEA 4S1DC 4MS8D 3H0TA 3D3VD 5TE4L 3QWOB 3WIIH 3Q48A 1KV3A 1NGWA 3OV6A 5C2UB 2FECI 1XF2A 4MA8H 3RZWA 2A74B 3BKML 1CXLA 1DSFH 2AI0L 5IB5A 1URLA 4PY8J 4WI4A 2BNRA 3BP5B 4BZ1L 4P2QB 3WXVH 4P2OC 1XCTA 2R56L 2P24B 4QGTA 2N7BA 2PTUA 1DQJB 3DMMA 4UNUA 1AH1A 3Q6FA 5FECB 2FR4A 1K8DA 2BFVH 5CJBA 4P46A 3T2NL 5E5MB 4BQ9A 3H7BB 2UVEA 5A2FA 3BN3B 3X3FH 4K2UL 4ORGA 4ETYA 3MRNA 3DVFA 4HX1A 5DHYA 3B9DA 4A6YA 1II4E 1CLZH 5C0AE 1ZV5A 4M6NL 4HWBA 3DETC 4QXTB 4F8TA 4GKZB 4QRRE 1XGPB 3PHQA 4O5LH 1XCQB 2F19H 3K2MC 2X4RA 2ZUQB 4D0BA 3CCHB 3TPKA 3BHBB 3LN5B 1NMCB 2NY0D 4PR5B 5AG9A 5BW7A 2IBZX 5KANG 1GC1L 2Y4SA 1KEMH 3WFDH 4LGSB 4LLYB 2G2RB 5DI8A 1NANH 4M7JL 3C6LA 3NCFB 1S7XB 1UH4A 1A7PH 2HRPH 4BH8B 1HEZA 4D3CH 4PJ7B 1KPVB 2DM3A 1AGFA 1I3GL 4LSSH 2A83B 1FGVH 3ZZ1A 3HI6H 1ZLWK 3PV6B 4KRPD 4FZEL 1CDIA 4Z5RB 4QRRB 3IDYB 3CC5B 4HDIB 1I9IL 2R4SL 1AR1C 3IETB 1ZHNB 3RL2B 2AJZA 1XGTB 4RSVA 4LIQL 5GRWA 4R3SA 4N90D 3TBWB 4JO1L 3CVIL 5CD5C 1CI5A 1U58A 4QRSB 3QUMB 5B8CC 1FVCA 5D5MB 4DFIA 2Y7QA 4LOUD 1HXMB 2V5SA 2OJEA 4D9QD 1FNSL 5ICYA 3VD4A 5SWSE 3FB7B 5T33H 4X98B 4LLDB 2YPKA 2GFBA 1R5IB 5GPRA 4LLUB 3S8WA 2C26A 4YHLL 1DBBH 1JPSH 4UBDC 1EJOH 1ZA6A 1P4BL 1RZJL 5D7LD 3FB6B 4DJMA 3Q3GB 4HEPG 1ULVA 3MRQB 3CVHA 5SWZD 1N59B 1HSAA 3DROB 5D6DA 1ZAGA 3LDBB 5DDHB 6FABL 4TOYH 4WEUD 5ALBH 1G9NH 2R2BA 3MV9A 3FN9A 3GO1L 4FTVB 5F7HA 5SWSB 1N6QL 4O02L 2XACC 4LVNB 5C0ND 1NBQA 4R2GC 4MAYC 5ANME 4OZGF 5E6IB 2GJ6E 3VXNA 1MCDA 2A73B 1MJUH 3F7PC 3ZL4L 4HJGA 2JK5A 4MNQD 4OLYH 1P7KA 2G60L 1RZFH 5C7XH 5IROA 5J6GB 2UZXB 4QXUH 5F96H 2CUMA 3GI9L 1QSFE 1XF3A 1KIQB 5D8JL 1ES0B 4I0PD 3T0EA 4LHJB 4TULL 3QZWB 3UC0L 3FB5A 2FJHA 3DX6A 1QLFB 4QTIL 4PRDA 1KN4H 4TVSa 4P3CL 2OSLA 4LRNH 1QRND 5D7IB 4F57H 4PB9H 3GJFB 3MROB 3OKDA 3MOQA 2ITCB 2GJ6B 5LBSL 5I9QB 1JGUL 4JY6A 1TJIL 3QZWG 2BVPB 5EPMA 5ITFB 1R0AH 3IJSB 3RU8L 4U1IA 1BZ7B 4Y16C 4UQ2A 2BDNH 5F9JB 4PB0L 3PWUB 2NY0C 5A40E 3WLBB 5EBGA 1BP3B 2Q7YA 4QOKD 4X7FC 4OCYL 2Z93B 3MV8E 3KPSE 4H8WL 4EDXB 4O58H 4C4KO 1T21B 5CBAB 2FZ3B 4M8VA 2YN3A 3NA4A 1BWMA 5KAQG 4JPVH 3TIEA 4OD3H 1J8HD 1V7NH 5T5NF 3PGFH 1A4KB 3U6RB 1ACZA 3MV7A 4PRAA 1TMCB 1DN2A 1AHWB 1YMMA 3T1FA 3RFZC 3INUL 5FO7A 4GS7B 3DSNA 2X9XA 4PJ8D 1JK8B 4F58H 1XGYH 3MRLA 1P7HL 4U1SB 3NGBC 1EIBA 4X80H 4AL8L 4L4TD 4JN1H 2IALA 3KPSB 3ZDZE 3MGTA 2IPKA 3OKKA 1BF2A 1MHHA 5F7LB 2HG5B 5EU7C 3O6LL 5IV2B 3T3PE 4ZFGH 4ZMAT 4LOUC 2H1PL 3ZTJG 4PV9A 3G08A 2JB5H 1V3LA 3NCMA 4S2SB 3B2UC 1QLRB 3NACL 2OZ4A 4FZ8H 4N8CL 3AM8A 4UTBH 3S4SA 2JKXA 1T0NA 3QDME 2O61B 5EU7E 3ULUF 1TNNA 2XRAH 3C60D 4LASH 1UADC 1EERB 2R69H 3O4LE 3HUJF 1IEAB 5TE4H 1SEBB 1A9EA 4ZNCD 1UC6A 3IFPB 1T5WA 3IFOB 3BKMH 3OKYA 2AI0H 3U83A 3FFDA 4PTUA 3QDJA 1TVBA 2HJFA 2KPNA 4L8DB 1RZ7H 1JJUA 4BZ1H 3VFUA 1UB6B 3H9SE 4FQ2L 3ARBD 2HT3C 3QDMB 3L7EA 4Z7VB 5A2LH 2JLLA 3PJSB 3T2NH 3LIZL 5I75C 3TJHD 5H2BA 4K2UH 2XKSA 2BHZA 4AY0A 1T1WA 4X9BA 2VC2H 2CKBB 2R0KL 3MRCA 5T1MA 4M6NH 1E6OL 1WFTA 1EEYA 4NUJA 1UWEL 1J0IA 2C7UB 1PGRB 3WUWG 3KS0H 1FHGA 5HSFA 2Y07L 3HTLX 3TNMA 4JFDA 1AD0B 2DLHA 1EFXA 3E6FA 3QNYB 5IGXL 1GC1H 3W5MA 3MGAA 5MEND 3BIKB 8FABA 1UACL 2X89A 3BPNB 3MBED 4DKFL 3ZKXC 2FHFA 4LCWA 4MDIB 1WCBA 3ARQA 1QR1B 3MRHB 5CP7A 4X4ZA 4CN6A 3TM6A 4MMXC 2R2HA 2I60H 4X5WB 1WBYB 3D85B 4ODXA 4V1DE 4X7DC 3RDTD 5C0FB 1GGUA 3RBSA 1I3GH 1ONQB 2VL4A 5ESVA 3BW9A 1P1ZA 5DQJB 4GH7B 2F58L 1O5DT 4FZEH 2V7NB 5KOVC 1I9IH 4M93C 1INEL 2R4SH 4DKDC 4APQB 2IG2H 5IQ9B 1JZ4A 1C16B 4UOJA 4LIQH 3VXRD 3FRUB 1OY3B 1ZT4A 2YK1H 4JO1H 3CVIH 4F7PA 3MJ6A 1L9MA 1C8PA 2DQUH 1NGQL 1RUQL 4V1DB 4GXUM 1IM3A 1FNSH 4PGDB 1NGXB 1FC2D 4IRJC 2WWKT 4BYHA 1G9MH 5E94A 4EUPH 4YHLH 4G9FB 5GIRA 1WT5C 3BZEB 3ZKXB 1BFOA 2E5EA 2VUYA 1P4BH 1RZJH 2YUVA 3GMLB 5JA9A 5JW4N 1O7VA 1J0JA 4BJLA 2OL3B 4U1LA 3B9KB 4PJIB 4B5EA 4I9WE 4C56B 3FO0L 3U79A 3LHPL 3KPRA 3C60C 4MGXA 1XT5A 4I5BA 1EJ6A 1BFVL 4NQED 6FABH 1FYTB 1FL6A 1M7IB 1T83C 3GO1H 3DVIA 4RNRB 2UUDH 1N6QH 5KZCB 1T66C 4O02H 1RD6A 2H9GA 2EIBA 1KEGL 4KK8D 1IGML 1BIIB 2DIAA 3ZL4H 4HAFA 5ADOL 3SGEH 4FABL 3LKPB 2G60H 5I8EB 2VOTA 4KKCD 1IAKB 3UPRB 1A6TB 3NCJL 3QFJE 2GKIA 3CH1B 4KAQL 2AXGA 3REWB 5D8JH 3VFWA 4TULH 3UC0H 1CLOL 4HKZB 4OFVA 3L3HA 4QTIH 4P3CH 3TJHC 5HDBF 4UDTB 1C7TA 2X9WA 4U3CA 2G75B 1XIWB 3MRKB 3HMXH 3BQUC 3RGVD 5I16A 4ACPA 1JGUH 3K2UL 3EDFA 4PJFA 3ARFC 5ENWB 3QFJB 2OTWA 3RU8H 3ULUD 2X09A 2J6EA 3KYOB 4N8PA 5ACZA 4BSWB 4PB0H 1FSKC 4UOW0 4WFED 3IGAA 3KDMA 2AV7B 2AXFA 4WUUE 4OCYH 2IPUG 4H8WH 3RNQA 3TO2B 5KVMC 4LAJH 1U8LB 2NY5C 3U4EA 4F33B 3GSUB 3K1KC 1WTLA 5IEHA 1K4DA 3E6HB 1EV2E 3ZHLA 1A7BA 3V7AG 3C5JA 1YNTA 1V3MA 3C5ZB 2GUOB 5IKCA 3S4SG 4AENB 2PO6D 2R1YA 3IAQA 2Z91B 4GUPB 4CVZA 3PL6D 3SGJC 3VXMB 5K9QI 3BXNB 4AL8H 3BP6A 3T4YB 3WCYA 5HI4D 2R2EB 2DLFL 4Y1AE 3HCVB 3O6LH 5ISZE 2H1PH 2XN9B 3GK8L 3RIAF 5IMKA 4GRWB 1Q9OB 1WF5A 4N8CH 3QJHB 4XMLL 4WHTB 2M26A 1T1YA 1UXWA 3U4AA 4JKWA 4TNVK 1S7SB 5T3ZL 1CYGA 1CIUA 1EBPA 4MD4B 3V6ZB 1MHCB 2A38A 4Y1AB 4O51B 1AJ7L 2XXCB 5JXEC 2XY2A 4YPGA 5M94B 3QUYA 3GRWL 2C3VA 4YBQD 5I18L 4RCAA 1T80A 1D9KA 2P1YA 3QEQE 5C09A 3V6OA 2R23B 1F58L 4OI8A 4KK8C 5FM5O 4FQ2H 4NRXB 4LQ1A 3S37L 4KUCF 4ZFOL 1UM5L 3TVMD 3LIZH 4K3EL 3QAZB 5IQ7L 2DTML 4U4BA 3VWJA 2XKNA 2QKIA 1DANU 5IBTL 4RAVA 5FHBL 4ZDHA 4P2RD 4MXVE 3BVNB 3MMEB 2R0KH 5HYQB 1UWEH 2MCPL 2ATKA 1QA9A 4JJHA 3CFJB 1CN4A 1DVFB 5AG8A 5K9KA 2Y07H 1ND0A 5C9JA 4QRUB 1TQBB 1WLHA 3H42L 5GRXG 3RGVC 4F37K 5IGXH 2A6DA 3DVNB 1SM3L 1VGKA 4WWKA 1J88A 1UACH 4DKFH 1BGXL 5DEFB 5C9KA 3G6JE 1OTTC 1NDMB 5KVEL 1L7TL 5MEPA 3GSXA 4HK3J 1IAOA 1TPXB 3O8XA 4NKDA 3O6ML 4EN3C 4XNZC 1KUMA 1C5DB 4KXZI 4HUUB 1LD9A 5D7JD 5D1XD 2F58H 2ADGA 3H3KA 1Q38A 5JORB 1JPST 4OZHF 1EZVY 1PW3A 3I75A 5IMOA 1NBZA 3WLWD 1INEH 5K9QG 1KJMA 3FOLB 3VD5A 4M4PA 3TP4A 3HUJE 1T1ZA 3FO2A 2G5RA 1MCFA 1FN4A 4BKLA 1KXTB 3QIWA 4HUWA 4EI5A 3MXVL 4PJ5B 1FO0B 4ELKA 4EVNA 1ZGLA 3D0LA 5DS8B 1QP1A 2D4FA 3THML 4Z7WB 1NGQH 2A9NH 4LPWA 1KCLA 1RUQH 5C86A 4I48A 1ZHKB 4MJ4A 1LEIB 1INQB 2PW2B 5DTFB 3KS0J 4N0YL 4B50A 3IXAB 4F9PC 4G8IA 1MJJA 1OCWL 3W9DB 4LGPB 2B4CL 4HGWA 1HH6A 3WXWL 2BMKA 3OG4B 2VDML 4KK6C 5DK3A 1U8PB 2FATH 3BUYA 5E9DD 4PJGE 4XNUL 2OTUB 1I1YB 3FO0H 5D71L 2ADFL 2BRRL 4GBXD 1RZGA 5BVJA 3MV11 5CHNA 4OZIA 3LHPH 5C0IA 4OFIA 4DEPC 2OR8A 1VACB 4M02A 5GRJL 4X8XA 3UTTD 2VDNL 1XR8B 1K5NB 2EYRB 1BFVH 2EO1A 3UTSB 2Q86B 5EIIB 3ZDXF 4HLZH 3BUTA 3VG0L 1TETL 1KEGH 5ILTL 1IGMH 4P3WA 2RGSA 2BX5A 1TCRA 4YPJA 5ADOH 1F4YH 2HVJA 4KJQD 4KJYA 4ALAL 3NCJH 3VXSD 4OBRA 4NZUL 4HKJA 4KAQH 2EDFA 2C3WA 2GTWB 3Q0HA 1OQOA 3UEZA 5D9SB 3AVEA 2B7DT 4L4VB 1CLOH 5D93C 4MJ5A 1WK0A 2Y5TB 1T7YA 2HT2C 1DQTA 1S9WA 4IMKA 3CFBA 4WW2F 4OF3A 4E5XB 5DQ9B 2FO1A 1I1CA 3AXLB 1Z0NA 5HYEA 3K2UH 1NSNL 5IF0A 1UVQB 4XT1C 2YA1A 2AK1L 1NCNA 1JTPA 4PRID 4XVUC 2EICA 5BJTB 1ORQB 2W60A 4F7TB 5F1IA 5DD0L 1CXEA 3GSVA 3L9RA 2OTPA 3HA0A 9CGTA 3GMPA 3O3UN 4GKNB 4PJ7F 4JZOB 4HUVA 4E0RA 5CJXC 1HDMB 2LAAA 4NFDA 1R3HB 5GGQL 1I4FB 4GRLA 5ESQB 4NKQB 3ARGD 2B1HL 1F4HA 3IS0X 5MERB 2ZSWA 1EAPB 1S7UB 5BRZE 4KUCD 3MXWL 3OGCB 4WO4D 4ELMF 2W9EL 5HHVL 3HE6C 3WLWC 1N2RA 5AUMA 1N0XL 1PZ5A 1WBXB 5CWSA 4UAOB 5DSCB 5KSVA 1JYVA 1N5YL 1J12A 1DQLL 2AS5M 1Z9LA 2DLFH 3CPLB 4Z0XB 1PQZA 2QTEA 5FFLA 4HV8A 1A7QL 4I77L 4DOHE 5KBNC 1MUJB 4X6CA 3MUJA 3DNKA 3VXOA 4FQ1L 43C9B 5K59F 4GQ9L 1FL3A 4Y5XA 1CVRA 4KMLB 4XMLH 4C4KT 3ARED 2FRGP 2ARJA 5T3ZH 1K85A 4GLRH 1OTSC 3LQMA 3IRZA 4YHYB 3JWOL 1NFIA 3N1QC 1NGYB 1Y6KR 5CEYA 2NYYD 3KYMB 1AJ7H 5L2KE 1V7ML 1LP9A 3MFGB 5JMRA 3MNWB 4DOHB 2PYFB 2F74A 3GRWH 2NXZD 4M6AA 5DQDH 4Q9RL 4NQCE 1F58H 3IXTB 3I84A 3QNXB 1MVUB 1AKJA 2ADIA 2GCYB 3O3DA 4OCRL 3QHTC 3KXFA 1R3KB 3FFCD 3S37H 3HNVL 3K8MA 3ZKMD 5DFVD 1CTNA 1UM5H 4NO2A 1FIEA 4K3EH 5IQ7H 2DTMH 5JNYB 4DGIL 5IBTH 1A0QL 1DCLA 5FHBH 2VXTL 4TRPL 1HHJA 3KLAA 3WUZA 4U6YA 3ARDD 1EH9A 5EFIB 2DQFB 4BFIA 1A7OL 1R3IL 3WN5C 5JOPD 1WWWX 4HMEA 2MCPH 3NCYS 5DJ2B 4FA8A 5KAQF 4M9PA 1GAFL 3BPLB 4NSKA 5C3TA 5LAXB 2XFXB 5FKAA 5E4IA 1MCHA 1NAMB 4I0CC 3H42H 5E2TL 3P9LB 3JUZA 2IAMB 1J10A 2UUDK 1SM3H 1QKZL 5C07D 1KGCE 1NJ9B 2Y25A 4H0IA 1BGXH 1S7WA 5KVEH 2XKUA 4AIOA 1L7TH 5C92A 5J12B 4H25A 1N6VA 4QF1A 2GTZA 2JE8A 1CL7I 4K3GA 1FDLL 5CJ5A 4RMVA 3ESVF 3O6MH 5I71C 4HC1L 1RK1A 4JO2H 1MCJA 5J0BA 5JIPA 1EXUA 4P2QD 3O41B 3TFKC 3IDXH 1ZGLM 3UJJL 3GIVB 2K7PA 5B38A 4PJBB 1PG7W 4CMHB 4YDIL 4UIKL 3MXVH 2K1MA 4WU7A 3TA3A 3GB7B 3THMH 1D6VL 4PD4J 2R1WB 3L3GA 1DTUA 3PUCA 3UYOD 2VN7A 4TN9A 5F8RC 3DX9B 3VFOA 3C5SB 4XVJL 4N0YH 1F8TL 1CFQB 1MREH 1QD0A 5FF6B 1A7NL 3O6KL 4Q0XL 1ZEAL 4XNQA 2BSRA 3U30B 3M07A 4G6AD 2B4CH 2EZ0D 2X4SA 4Y4KA 4IOFC 5HD8D 3PDGA 3HLAB 3QRGL 3WXWH 1ACYL 2VDMH 4NNXA 4CNIA 3PWPB 4MSWB 1G0XA 5D71H 2ADFH 2BRRH 4NCDA 4W4NA 3EYOB 3AREC 3C09B 5EOCH 2BNQA 2BVYA 5GRJH 2VDNH 4HWZB 4HSQA 5I19L 3QH3B 3RY6A 1R3LA 5J1SC 2NYYC 43CAA 1CG9A 3VG0H 5DJ0B 4X9FA 1TETH 5ILTH 2WANA 1GZPB 1HI6B 4JHWL 5AYQA 1U8IB 5DMKB 4YBLC 4POUB 4CMMA 4XP9L 3L5XL 3K7UA 1Q0XL 4ALAH 5CS7A 4F3FA 2FX9L 1GOGA 4NZUH 4ZAKB 1HH9B 5D1QA 2GSGB 2H41A 4HKBB 1S8DA 2LTQC 3JV6A 3WBDA 4JFHE 5F89B 3G04A 3P30L 5IR1A 1M71A 1T04A 3ZHKA 5GGVY 2IANB 3EYFB 4JGUA 5GS1A 3TN0C 5FA4A 3UPAA 3A67L 2BVQB 3SKNA 4F2MB 1KNOB 3K46A 3UTZA 1V3JA 4Z95L 4QRTB 4K7FB 4XP6L 3GJEB 5TDOA 4X6EA 3P4MA 4NQUA 1GHFL 1NSNH 4RGNC 2FL5A 1A6WL 2E9WA 3S3SA 3K4AA 2VZ3A 2AK1H 1LEKB 2VLJB 3MA9L 5KN5B 1I8KA 1QSEA 1Z0MA 3PP3H 1W2KT 2DTSA 2WUBL 5DD0H 1QTYT 5ACLA 1NEZG 4MQTB 3T4AA 4G9DB 1ZVYA 4Q6IA 1IL1A 4FTVD 4MD5A 4R0LA 4X6DA 3FZUC 3EOAB 2ZJSL 3QUXA 4ZS7L 4RGNE 3MA7A 5E6ID 2VXVL 3VCLA 3VRLF 1NFDA 2VITB 2XZQL 1OOAA 3OF6A 5DUPL 5GGVL 4G3YL 2WWMD 1KELL 2OLDA 4OBSA 5GGQH 2C3XA 1G7HB 2B1HH 1J0YA 4DVRL 1RI8A 4PD4K 3O0RL 3CLFL 4YGVA 3MXWH 3B5HA 2W9EH 2YR3A 4JQXC 5HHVH 1VFAB 1JGDA 1N0XH 1X5LA 3HE7A 4Y88A 1N5YH 3RZCD 1DQLH 1S9KC 2LQRA 3AS3A 3SDDC 2DYPA 2PYEB 3T2OA 4IRSB 4AIXA 1SJEA 3I02B 1GIGL 4KKNA 4WW2C 4HS6A 5B3NA 3ILPB 2L7JA 4PRHA 4Y8AA 3JWNC 4Z18A 1MHEB 5J13B 4FQ1H 4GQ9H 5ACMA 1T22B 3ZE2E 4HKXA 4WEMB 3DVGB 4C57C 4PJIF 2P44B 5DJ8A 1S7TB 3N06B 2HYMA 4U6XA 2W0FB 3WFZA 3V4UL 5KS9B 3I6KA 3JWOH 3CH8A 1SY6A 5DMJB 1T20B 2N1KA 4FFVC 4GG6B 3HC0B 4KK5D 1V7MH 1K2DA 2V7HB 4EDWL 3QEUB 3FCTB 4YBHA 4OCNC 1B6DA 4Q9RH 4YAQA 1B4JL 1F4WL 3RTQB 5GQBA 5HHQA 1YQVL 4IHOA 1MRFL 2DMBA 1J0KA 1D5MB 1I1AC 3O4OB 4OCRH 2HRLA 2NXYC 1P6AB 3HNVH 3MRDB 5EU4A 1T7XA 3NVQA 2BNUA 2YS4A 2DRUA 1RURH 4S1RL 4LVHB 1CDCA 3QG7L 4DGIH 1A0QH 2FEEI 2VXTH 4TRPH 1CBVL 1YEDB 5DJYB 3SDCD 4YK4C 4GAYA 2KQNA 1A7OH 1R3IH 2F5BL 1LE5A 5IWLA 5IW3A 2NNAB 3FAXA 4U33A 1CICA 3PWVB 4RMTA 3X14B 4ELME 2H26A 5E2TH 1RUPL 2GITB 3VXTB 2X1WL 4G80B 5TDPA 5KSAB 3IVKA 5FOJA 1QKZH 1WBZA 5FYLE 4JHZA 3PNWA 5HI3C 1JNHA 3WNOA 3OHXB 1FLTX 4NO0A 4U3XA 4OIIL 3RPIA 1KSRA 5SV4A 4OB5L 1I85A 1DQQA 1FDLH 5H37G 2R4RL 3ALPA 4HC1H 4XZUA 1FFOB 3MO1B 1IBGH 2BXYA 3F6IA 3QI9A 2CLZA 3M17A 3SCMA 4X0KA 2GAZB 1I8LA 1RHFA 3U46A 5I1JL 2CGRL 3QIBB 3BIAX 3SDXA 3UJJH 1YY9D 3DUUA 5E8EA 4MWFA 5INDA 1NCTA 3CNKA 3GSWB 3I2CL 4NNYB 3SKUD 1QPXA 5I30L 5D1ZC 5F1NB 4K8RL 4JZJA 1UXSB 2CKNA 2L4OA 4YDIH 4D9RE 3D39E 4UIKH 1DN0A 3ET9F 4OLUL 4K3HA 5E00B 5DD5L 3RZCC 3B9EA 3WFEL 2JJSC 2ADJB 5K9OA 2Z31A 4XVJH 3EO0A 4MQ7A 4WTZA 3CXDL 2NY4B 2JJUA 2YD1A 2XYCA 1A7NH 2CRYA 4JHAH 5IHUL 4Q0XH 1ZEAH 2BOBA 3NA9L 4GRWF 2I07B 4PLKD 5FYJD 2R9HD 1C12B 4ZSOE 5J57B 1BVLB 4WI8A 1H5BC 3OBAA 1QHPA 3QRGH 1ACYH 3NIDF 4HCRA 5DJ6B 4BSVA 2C1PB 1S5IL 4G7VH 2CLRA 5EBWB 3OSKA 2YPVL 1CFSB 2XNAB 3B9VA 3D85D 1CGUA 5DJDA 2JCCE 4J23A 1CDBA 2RJMA 2OBGA 5I19H 3MLWL 3X12B 2HLAB 2Y72A 5F7YC 1YEIL 4PY7A 2HMID 4MQXD 3CAFA 1DDHA 4X6FB 3HPLA 5FO9B 5D2NE 4WU5A 3MOBL 2BZDA 3P4OB 4HS3A 4KKBD 4U1NB 2R29L 3S6CA 4APQD 4EIGB 4XP9H 3L5XH 5D7KD 1U92B 1Q0XH 4HK0A 2CQVA 2FX9H 4I13B 1YEJL 4WTXA 1BLNB 1LEGB 2MWCA 3GMNB 3OQ3B 4Y2DA 1T2XA 1ODAA 1MPAL 1MCKA 4MCZA 1B0WA 3BE1L 1JGLL 3ALWA 1J0ZA 1BVKB 3DMMC 1I9JL 3VMPA 3P30H 1E4XL 4L8CA 2F54A 3RWJA 2B20A 4P46C 3BGMA 5D6CA 4YR6B 3KNBB 3A67H 1TLKA 1YNKL 3KJ4B 3KR3L 3SDCC 4G9FD 4Y4FA 2BNRE 1FFNB 4XP6H 5D2NB 1MFEL 4OQTA 4JFPB 1GHFH 4QYOB 5E24E 1A6WH 3ZE0F 3CU7A 3VFMB 3MGOA 1LQSR 3LOWA 3MA9H 3B9KD 4C56D 4JJ5B 3CFCL 3AAZA 1FE8L 1G6RH 3GMRB 4RFEB 3IDGB 2WUBH 3H0TB 5BW7C 5EB9A 3VXUB 3MLVL 4PGCA 4OD2B 1FYTD 4PJ9B 3L3JA 4YHPA 3WNPA 1XF2B 4R7DB 5KZCD 1J18A 2ZJSH 3TBSB 4OV5A 4ZS7H 3C6LC 4YWGL 1JHLL 2VXVH 2XZQH 2GY5A 5GGVH 4G3YH 5DZNA 1KELH 3P0YL 2H8PB 1JGEA 1ZANL 5IOPA 3B6SB 2FIKB 3WS6A 1T03L 3QDHA 4DVRH 1WFOA 4LKXB 4XH2B 3QFDB 4HH8A 5IFHL 2VZ1A 1OM3L 3FQUB 3CLFH 1H3XA 4J7RA 1P5VA 1M7DA 1CR9L 5DRXB 2YSSA 1DBKH 3HC3L 1K8IB 1IE5A 4OUUB 2HT4D 4JVWA 5E70A 5IFJB 2ITDB 4A6YB 5J11C 3T0AA 1XAUA 2YKLL 4M3KB 1XIWD 3IS1X 4WI9A 5C0DB 3OR7A 3O9WA 4X7EC 1CTOA 1GIGH 3DO3A 1BX2B 5ADPL 1DFBL 4Y5VB 5GZOC 2XIDA 5EO1A 32C2A 1YEHL 3S96A 3BWAB 1YPZB 4E9LA 1FNLA 2XA3A 2ZOKA 4NKOB 4BQBA 3OAUL 3NABL 1ZVSB 4PJHE 3DO7B 4YUEL 1PSKL 4H1LH 5FK9B 1HXYB 3T04D 3F58L 1CDHA 1RMFH 4KDTA 3V4UH 4IM8A 5C08B 1C08A 3UPCA 1UWGL 4XRCA 12E8H 5IIEB 1IM9A 1NANI 3P3YA 4G42B 2QSVA 2HFFB 2DKUA 1U8QB 3O2DA 5D6DC 2A6KA 4EDWH 2QHLA 3N85L 3OR6B 3C5ZD 5MI0C 5C0EA 1B4JH 1F4WH 3QDJD 1CGTA 1IZKA 1MRFH 4YEFA 4ZOCA 3P73B 1DBJL 2AJXL 3VXMD 3QO1B 4H5SA 1M6OA 3GFUA 1KCRH 2NZ9C 2NY1D 4PJHB 1MF2L 4L3EB 2CDFB 4PJDA 4JFXB 4JGMA 1PKOA 5IJKA 4J1UA 1A6ZB 5IROC 2X7LB 1FVCB 3OX8A 2DQIL 5I73C 1N3NB 2OJEB 3QG7H 1D7FA 5ID0B 2PNDA 3T0EC 1TZGL 2QQLL 3JTTA 3MV9E 1CBVH 4O2CA 2XN9D 4IS6B 4J8RA 4JHBA 3TYGL 3MUGA 1CDGA 1S7VA 4XBPB 2F5BH 1WZLA 1QVOB 4MB4A 4CVXA 4LQFL 5F70A 3RY4A 4JRXA 1SHMA 3EYQC 1UM4L 2J1KA 3AY4A 2BSTB 1BQLL 4ZPVA 3TIDA 5GRYA 5JDJA 3T0EE 1CT8A 3MRRA 3IU4H 1WC7A 1SMOA 4ODWA 3FOMB 4LCWD 5SX5H 3KPQA 2OCFD 4HH9B 2IPTL 4OIIH 3MV9B 3Q5OA 4MXQD 4WTZG 4EXPX 4OB5H 3QXVA 1SJHB 5MHSE 2R4RH 2DBLL 4FQHA 4DK6A 1H3GA 1P7KB 2XWBB 4LCCA 5I1JH 3AB0C 4XGZB 2VABA 4NKMB 4ZXBA 3QUZA 2YWYA 3G5YB 5CIPH 3I2CH 4QHLA 4XMKL 5I30H 3HG1B 1B0GB 4K8RH 2X05A 4U2ZA 3S35L 3T1WA 1JHTA 5HPMB 4JRYA 5AAMA 3MPCA 1A2YA 4MHHI 4OLUH 1IRAY 4ODTL 5ID1A 2OSLB 5DD5H 4M5YL 1XEDA 5FDWA 3WFEH 1VFMA 1W0WB 2ED9A 3C8HA 3D9AL 3PP3K 1OB1B 4YQXL 3AMKA 3BP4A 3RVTC 1DVFD 3MV7E 3CXDH 1YMME 5IHUH 5KVDL 3NA9H 5TFSL 4P4KB 4P99A 3LEXA 5IVXA 1AFVL 3X17A 4X4YA 4CUCA 1S5IH 1JPGB 1HHIA 1I8IA 3AM8C 2QEJA 5E7BA 3OWEA 2CLVA 2YPVH 2Q6WA 4MJIA 2WQ8A 3UTPE 5E1AA 5KJRL 1I8MB 2Z92A 3JWDL 3LD8C 1BWWA 5EORL 2YD5A 3MLYL 3UBXA 4UNTA 3DV4B 3JZ7A 3T1FB 5C6TL 1FL5B 4ZNEA 3V7AE 2V2TA 2Y6SC 5EC1A 3MOBH 3PIQB 1SYVB 2R29H 3DGGB 2XZZA 5BQ7B 1YEJH 3UTOA 3D18B 1JPTL 4PJ5D 1MPAH 5LVEA 3NZHL 3BE1H 4Z7UB 1JGLH 2J7LA 2NY1C 2VAAB 5GSRA 5DLML 1I9JH 2FHBA 3F7YB 4HWEL 1E4XH 2CDGA 4U1HB 5DHXB 3ME0A 5JLZA 3OXRB 5DMIL 5DFTA 4PTTB 4N0CC 4FN0A 2MMXA 2YN5A 1JV5A 1Z5LB 3KR3H 4FFZL 4HIJB 1RVFL 1ZTXL 1P69B 4U2YA 1MFEH 4HG4J 1JL8A 2IH3B 3V79C 1SEQL 3CFCH 3GKZA 2J8UE 2HVKA 1FE8H 3OZ9L 3W0WA 4PGJA 4P23D 2CIKB 4XCNB 3MLVH 1TNMA 4X83A 3UTSD 3SJVA 2V2WB 4OZIF 1T5WB 3MRJA 1Z9OA 3UTQA 1HQRA 2P5EA 1JHLH 4YWGH 4CDHA 3ESUF 3MJ8A 2DJSA 3E8UH 3EHBC 1D5BB 5F1OB 3NIDE 4JFDE 4LDLB 1ZANH 1JZ6A 3RKDD 2YC1A 1T03H 1RK0A 3DV6A 4W70A 3T0XA 4PJXA 1WEJL 2Q7NA 5IFHH 4YXLL 1OM3H 4PJBF 4LKCA 1OLZA 4L4VD 4N0RA 1NLBL 2J8UB 4NN7B 1CR9H 4GKSB 3V0VA 1BZQK 4MHHG 5H2BB 1KG0A 4KZEL 2PXYB 2EDKA 2YKLH 1CE6B 4XAKD 1G0YR 3FJTA 5E8OB 3ABZA 4RMUA 3TZVA 1MEXL 4OZFB 1UZ6F 5ADPH 1DFBH 4Q74A 1XF4B 2W0LA 2IH1A 1ZLSH 3TNMB 3HR5B 5GS2H 3FQXA 4HZLB 1R6VA 3L3DB 3OAUH 3NABH 1RZKC 4YUEH 1NC2B 3ROOA 1PSKH 3PF2A 5H35A 4JQIL 4LCUA 3F58H 3F5WB 4XHQA 3NPSC 4ODXB 4ZFFB 4RIRA 1GSMA 2XICA 4YDLB 3DIFB 1MSPA 1Y6MR 3NFNA 5F6IB 5IJVB 3N85H 3S37X 1CFTB 3MRIA 2I5YL 3ZE0E 3DX7B 3WFBL 1AQDB 4F7EB 4JM2A 4UUJB 3D3VA 4P9HL 4QHUB 1JWUB 2AJXH 2B5IB 4HIEA 3HMXA 4FQQB 3G5VA 1MF2H 5EUOA 5C70A 4L8BA 5FYJH 1OTUD 1ZT4B 3REVA 3DURA 3KPRE 5CKGA 2EYTB 1ZSDB 2DQIH 2BY0A 5JPNA 2J4WL 1TZGH 2QQLH 5T3XE 5TE7L 3FTGA 1MRDL 1YEFL 1U8KA 3TYGH 4I3GA 1KIRA 2VXUL 1DL7L 4LQFH 1IGTA 1TZHA 5MP6L 3CUPB 2H32A 1UM4H 1T2JA 4W81A 3UAJD 3LN4B 3BEWA 4JFYB 5BZDA 2ICCA 1H3WM 4DN4L 5E2WL 4JFEB 3EOYG 1FZKA 5FYKD 1ZWIA 4TNWK 2IPTH 4NDMA 3EFFA 2YD4A 4P23C 1FO0L 2BCKA 3QXUA 1PX3A 5JOEA 4LHQB 2EIEA 1IQDA 1U3HB 3O8XD 1LDPL 5I8OL 4J3TA 1LP9F 5E2UL 5E2JA 2DBLH 5HYSA 2JF1A 5L0QB 3ARSA 4HIHA 4PJFE 4YDKH 3JTSB 1U8HB 1ZXQA 3SGEI 4M6OL 4AIZB 4XMKH 5FXCH 1ITCA 5IVZA 4JDVA 4K9EC 1MLCA 5LGHL 3S35H 3ZKND 2OL3H 3P77A 5FGRA 3FONA 4ODTH 1SJVA 1FAKT 5J9PB 4M5YH 1YY8B 1Z3GL 5DJCB 3D9AH 2MSPA 3RVXC 4YQXH 4KJWC 5L8LB 5CEZD 2EIDA 4CADA 3BH8B 1IFHL 5KVDH 4RFNB 2GY7B 5TFSH 1MH5B 3NAAL 4OLVL 1BZ9B 2IAMD 2MHAA 3SKJL 3E2HB 4ZUTB 2WP3O 1AFVH 1OAQL 2AKRA 5F9WB 1RZ8A 3GHBL 4RISL 3V0WL 5I1IL 4AM0A 3KLHD 5KS9F 4I18B 3U4EB 2B2XL 2FLRT 4XAWH 3WS3A 4GG6F 5KJRH 2P47B 3JWDH 1YN6A 5D7LA 2I9LA 4MA1C 5EORH 3MLYH 4QRPB 5C6TH 3VXPB 2HJLB 3QUYC 4JKMA 1FFPA 5SWZA 2RBLA 3VFVB 2HJKB 1A1MA 1RJYA 3MJ7A 5BVPH 2V9RA 2WW8A 1D9KC 3UXFA 4HBQA 4MDJB 3V6OC 2ZUWA 4WV1B 5FOBB 4XPHL 1JPTH 3PXJA 3NZHH 5E0QA 3G6AA 5JXAL 3FO9A 4EUPB 4IOSD 2NW2B 5DLMH 4HWEH 4ISVB 4MNQA 4M1CD 3ULVF 1W72L 3MC0A 3VWJC 3PGDB 5DMIH 1IVLA 5CGMA 4JPIA 2ZPKL 3OJVC 3D25B 3OKMA 3T8XB 1T7VA 1G7PB 3LB6C 4BFEA 4IOIB 3L5WB 4FFZH 2O5YL 1RVFH 4I0PA 5C09E 3V6OE 3FO1B 3VI3E 2OI9C 1IQWL 1FG2B 3QQ9C 3WEXA 25C8L 4A2MA 3NN8A 1WISA 3QO0B 1T1YB 3BPCA 5AZEL 4YFLI 3PWPD 2AAVA 1QRNA 5F3HA 5EC2B 3LKQA 1SEQH 4FNLL 4K3DL 4FQXD 5B22A 5I74B 3GM8A 4NO5A 3WNKA 1V05A 4Q6YA 3MJGX 1GCFA 4TUOA 1TZIA 4WWKC 3HHRB 3K81A 3B8SA 5C0JB 2A9ML 1EGJL 5HI5D 4K71B 2WBJB 3B4NA 1AC0A 3O8XC 2FJFB 5FEBA 3U36B 4QOKA 3RX5A 1EBAA 2YPLB 1TENA 4ZAKD 1JWSA 4MNGA 4U1KB 4J6RH 2KQMA 3HB3C 1KIUA 2X4TA 3QNZA 3STZA 3RWFA 1WEJH 3EJYD 4YXLH 1R5VB 1NLBH 1NC4B 4M3JA 5C0BA 3RWDB 3LQAH 1YEKL 2GK0A 4HFUL 3IFLL 2IAND 1QR4A 4E42A 3U48A 3H8NA 3R4DA 3CFIC 3U82B 4KZEH 4PJ8A 3CMGA 3KYKL 3QIWC 4P4RB 4AEFA 4BK5A 4EI5C 3WO3B 4L9LA 5B39B 5AWNL 1MEXH 3EO1B 3OKEA 2EIZB 2EDQA 4L4TA 5ICZB 1EMTH 5A16A 3TNNA 5C9JB 1HYRC 1CS6A 2K3TA 2CUIA 2VLJD 2D03H 5C0CE 5EU5B 1U41A 2A6DB 4U1MA 1DUZB 1BBJA 1CFNB 1MFBL 1OLLA 1ETZA 4QWWC 4JQIH 1EEZA 4AEHL 1OF2B 4HIIA 1ZT1A 5GS0D 1JPFA 3KLHC 1G7IA 3KPMB 3DWTA 1FNEB 2UYLB 2E7MA 3T77A 1BECA 1T0MA 2I5YH 3C60A 1HQ4B 3OJDB 2MPAL 1LO0L 1UB5A 5KSBE 1U6AL 5C0CB 4P9HH 3RL1A 2NW3A 1AKJD 2CDEB 4ZQKA 3AMLA 5J7CC 2DAVA 3JVGA 4HUWB 3KPOB 1K9TA 2QQKL 5HHOB 1OPGH 2PYED 3QEGL 4WI6A 2CK2A 2E7CA 1VA9A 2Y06L 2J4WH 4G6JL 3I9GL 4IRSD 2AJYL 5TE7H 5EIQA 4ONHA 1MRDH 2VQ1A 2YHGA 2FEDD 5HYSG 1YEFH 3BX7C 2QSCL 3ARBA 3SE9H 3SY0B 4IMKC 2VXUH 1GXEA 1DL7H 4JLRA 2HTKD 4JPWL 5KSBB 5MP6H 2A6IA 1HH6B 4ZO9A 1OP3H 3TC9A 5J8OA 3WO4C 1TVHB 3VWKB 2A2QT 5L8KB 2XZAH 1KTKE 3ARXA 3W11D 3VRJA 4TVPD 5T1DL 1T3FA 2FHCA 2M2DA 2NY6D 4DN4H 1FGNH 5E2WH 2VLLA 5C0IB 4WCYL 4HUNB 4CW1A 2EXWD 5FDYA 3FB8A 5MEOA 3U0PA 4UIMB 1PKQA 4YHNA 5DYOA 1FO0H 1UZ6E 3BZFA 4OM1L 3RWGA 5F7DA 2Z9TA 4D0CB 1LDPH 5I8OH 1M4KA 3LKRA 3BO8A 3O3EA 5E2UH 1U93B 3RI5F 5MENA 1WSST 4IRZH 3MBEA 1QRKA 3F12A 4I0KA 3M8OL 4YJZL 5JHDB 3MJ9L 3GMOB 3A6BL 4H26B 2LU7A 3RDTA 2XPGB 3P9MA 4GRLC 1LK3L 4M6OH 2I9TA 3PQYE 4ODUB 4N5ED 4OZGA 5LGHH 3EJYC 3ULVD 3VMNA 1LMKA 5F9AC 1P84K 2R0ZL 4U1JA 3BESR 1Z3GH 3QXDB 5AEAA 4S0TD 3VXRA 3A6CL 2X10A 1IFHH 4NYLA 1QUNA 4FG6D 1B2WH 1LHZA 4HUXA 3NAAH 4OLVH 3G5XA 5EO0A 5KSAD 4OM0H 3SKJH 2NTFA 4DVBB 3IF1B 1A4JB 2F53E 3OJMB 3MRMB 5GGTL 3PQYB 3GHBH 4RISH 3V0WH 3LH2L 4Y5XC 1MWAA 4M43L 1PYWA 4PG9B 5C2BL 3MNVA 2B2XH 2GIYA 4MZ3A 4BQ6A 4HUVB 1KLUB 1IC7L 4E0RB 4H0HB 2CXGA 2EKSB 4MYWB 1BVZA 2QQQA 4HFWA 4X6CE 3KPTA 5H94B 2ZUXA 5JOFA 1SBBA 3QIBD 4OIBA 2NR6D 2AVGA 2ZSWB 3BD4A 1LE9A 4MD0A 3RNKB 1R3JA 2C1OB 1RJCA 1N8ZB 1QFUL 1SYSA 2F53B 2FWOB 4NQEA 1F11B 4XPHH 2AJ3B 4G8FB 1RJLA 2W65B 5JXAH 5EN2A 5FB8B 4MA3B 4I4WA 1DQMH 2O93L 3HZVA 1LP9E 4YC2C 4NQVB 2NY4D 5L88H 1PY9A 4KKAC 3LRGA 2X4UB 4PRNB 2AJVL 3FQTB 4FMFA 3O3AA 3BISA 3QXAB 2O5YH 2P5WA 4P5KB 2R39A 2XZCL 4AZ8A 3QJFA 25C8H 2F8XC 1JFQL 3QIUB 1KT2A 2VL5B 5HYJB 1UJ3A 2N7AA 1FP5A 1GPOL 2J8OA 3KXFE 2XTJC 1BQHB 1FNAA 4FNLH 1ORSB 1QSED 4K3DH 4C83B 1A3RL 1ZA3A 2WINB 1LO3L 2DQHL 2WIMA 2NY6C 4YHIB 3WL9B 3DRQB 5DO2C 3QQ3B 4OTXL 2A9MH 4KRMB 1EVUA 1EGJH 3DX8A 3EYVA 1X5JA 3SKOB 3WMSA 4ENED 1W0VB 4P57B 5FM5M 4HLZG 4QXWA 1T89A 2BSSB 1BQHG 2P8PA 2XTJE 2OYPA 4R7NB 4DGYL 1NKOA 3O6FD 1HYSD 1BOYA 2NTSP 1DE4B 3IDJB 3O3DB 3S5LB 3MR9B 1FC1A 3VGAC 3DI2B 1U91B 3CXHK 5DD6A 1ZHLA 3KPNA 1YEKH 5IP4A 3PG2A 4HFUH 4XCYB 3IFLH 1E0OB 2EE2A 3QCUL 4DQOL 3IDUA 3L5JA 3KLAB 5CSGA 3KYKH 5HVFB 1REIA 4N0FA 3QDGB 2PO6A 5AWNH 1AIFA 4BFIB 3PL6A 15C8L 5FYKH 5DK2A 3S5LG 4AG4L 3B3IB 2DI9A 2W9DL 1ADQL 1QQDB 4ZD3L 2YMXL 4ZTPL 1BJ1H 5EZLA 5HHMB 4X9IA 3LSOA 1B90A 2FH6A 2BJML 4X4XB 1ZLVK 5IEKB 4HBCL 1CQYA 1MFBH 2FBOJ 1V8HA 1CK0L 3VXUD 4Y4KC 3PXHA 4PJ9D 3CSBA 4POZC 1GH7A 2WIIA 1G7QB 4AEHH 1EFQA 3T65B 5HGBA 4UINL 1SMAA 2L0DA 1BJ8A 2GTZB 3PDOB 4DZBB 2QADB 3RWEA 3OXSA 1L6XA 5SX4H 5L8JB 4OKVA 5KVFH 5SWQA 2IQAA 1D6EA 3WKMH 5DJZA 5I0DA 1FRGL 2CH8A 4UT6L 4KTDL 4WY7L 2LVCA 2XQYG 3RY6C 4TTGA 1K3IA 4JPKL 2MPAH 2Y5EA 3TO4B 1L0QA 1XGUA 4JY4B 2EDDA 4KJPC 3MRPB 3HAEH 5BS0B 1G7JB 4Z7UF 3KHOA 4N9GB 2QQKH 2ICWA 3MREA 1FNGB 3TA3B 2BNQE 3QEGH 1VEMA 3BGFB 5D1QC 2Y06H 3E1F1 4G6JH 3I9GH 2AJYH 2XOTA 2CIIB 3H3PL 4Y5YA 1JWMB 4LEOB 2COQA 3D69A 3FT3A 2CJUH 5L9DH 2QSCH 2WBKA 2H2PD 1MAKA 4LNRA 3TVMA 5GS1C 5IB4B 3D0VB 4HXBH 4JPWH 4LPVA 1KTLB 3MRGB 3RUGB 5I0ZA 4CNIB 5T1DH 4AK1A 4P2RA 3HI5L 3DXAD 5C08D 3U2SA 4N8VA 4QHKI 2R0WL 5FYLL 4WCYH 2BNQB 5B4MC 4HXAL 1AO7B 2D9CA 5DZLA 2A6JA 1R24B 4OM1H