3V7TA

Crystal structure of human beta-tryptase complexed with a synthetic inhibitor with a tropanylamide scaffold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPSB2 protein
publication title A beta-tryptase inhibitor with a tropanylamide scaffold to improve in vitro stability and to lower hERG channel binding affinity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v7tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v7tA01
1AKSA 1GI2A 5TJXA 6CHAC 2HWLB 1XUKA 1IQHA 2QXGA 1K1JA 4AFUA 1TGCA 4H42U 1P9SA 2A4OA 3DUXH 4ZUHA 2BXUH 2J92A 1CE5A 1MU8B 1GBHA 1W13U 1V2QT 1SLWB 1TMTH 3TU7H 4GHTA 3NPSA 3VB5A 1O3FA 3GY2A 1P2KA 4Q7ZA 4WVPE 3L6PA 1ETSH 2FWWA 3EA8A 1SGFA 1F0UA 1YKTA 2A7CA 2P93A 5JBBS 3NCLA 3O8DA 5E0JA 2IOTA 1GBBA 3EA7A 4RSPA 1TLDA 1XUJA 2FZZA 3FFGA 2AFQB 1NRNH 1TOMH 2P94A 1ESBA 3ZZ9A 5L30H 1G2LA 3BTME 2B0FA 1RFNA 2FPZA 3SGAE 3RUOA 1DWBH 3RXVA 1EZSC 2TPIZ 3STJA 2XWAA 3RXRA 1PPCE 2ASUB 1SQOA 1YCPK 1BRBE 3QTOH 1TX7A 2BVSH 4HTCH 3VGCB 2RG3A 1SLVB 1BOQA 2ZPRA 1DSTA 3A81A 1NRPH 1GI4A 3RXTA 1IQKA 4AYYB 1Y5BT 2XC5A 1TALA 1KLJH 2AYWA 4CBNA 2ESTE 3SUFA 2CXVA 1XM1A 1BMMH 1O3BA 5FHTA 4K69A 1TABE 1DXWA 4NCYA 3MH5A 1FAKH 4GCHF 4MPWA 4UONA 1O3OA 1ZHPA 3ZVFA 5ESTE 1BT7A 1QQ4A 2FTLE 4IC6A 4F49A 2RCEA 1YPGH 1FQ3A 1SGNE 1THSH 3KQDA 2PGBB 1JMOH 4X2XA 4AYVB 1GHZA 5FCRA 4Y8XA 1MKWK 2J94A 1CGJE 2O8TA 1HAYB 5GPIB 1GVLA 2ZG0H 2SGQE 2WUCA 2BTCE 1KLIH 1ZSKA 1A5IA 1GG6C 4JZ1A 2ANKH 3LU9B 1BMAA 1MKWH 2H9TH 1TOCB 3DFJA 1O30A 2BXTH 4X2WA 1LVOA 4XBBA 1LPGB 2ZGHA 2PLXA 4GCHG 1AVGH 5GCHF 1Y5AT 1FXYA 1NRQH 4K1TA 1VR1H 1MCTA 2BD2A 4ZXYH 1CGHA 1DE7H 1P0SH 1WCZA 4Q2KA 3ZVCA 4ABEA 3M3SA 1NY22 1SMFE 1LO6A 4A1VA 3FANA 3ZZAA 1MCVA 2FI5E 2VVCA 2ZHDA 3M7UA 3RLWH 2BLWA 2WPIS 1GI1A 1NU9A 2BDYA 1AZ8A 1BJUA 1Z8JB 2C93B 1RXPA 1ZTKA 1SLXB 3MU4A 3ZZ5A 3TGIE 2ZI2H 3EYDA 1Z71A 1VZQH 1QRWA 1ZMLA 2QCYA 3TJUA 1PYTD 1C2EA 1W11U 1WBGB 1B5GH 4RN6A 1TRYA 4ABIA 2XBYA 1C5WB 3RXSA 4LZ4B 1T8NA 3S69A 5A0AE 2TGPZ 1BTXA 4GSOA 5GCHG 2ZHWH 1C5LH 3QO6A 1HAVB 3I78A 1O39A 3MO6A 4JZEH 4NSVA 5HMAA 1O2HA 1G37A 1BRCE 4FUIA 1P8VC 1XMNB 3A84A 1CA0B 3BTKE 1O36A 1VGCC 1AN1E 1D6WA 5IYTA 3PTNA 3TH3H 5G4BA 4IBLH 3A82A 4BTUB 2V0BA 3LKWA 1F0RA 3KGPA 2GP9B 5T6DA 1C5SA 1SI5H 3P8GA 3L33A 1EAUA 1QA0A 2FXRA 3HK6B 7ESTE 1V2JT 4R8TB 4O3UA 3Q00A 1GBLA 1H9IE 2OC0A 1K28D 4MNXA 3KF2A 2BOHB 3T26A 4NA8A 1BDAA 1HB0B 1UHBA 1C2KA 1RIWC 1P2NA 3K6YA 4UFDH 4BXSA 5FCKA 1CO7E 2ZFFH 4DVAU 2BD3A 4NGAH 5FPYA 1TFXA 4YOJA 1EJAA 4E06H 1LDTT 1V2ST 2TGTA 3KQCA 1KXFA 3LGWA 3UWJH 2WYJA 4B76A 2SGEE 2A2QH 4AORA 1V2NT 2P8OB 2BX3A 3LJOA 4Z6AH 1L1NA 3PV4A 1RTLA 1UJ1A 1GJDB 3OTJE 3I77A 4I32A 2ZDVH 4IC5A 5EGMA 3QTVH 3UUZA 1DWEH 2J34A 1N1LA 4Y0ZE 2OBOA 3MU5A 4INLA 1ANDA 2XBWA 3NK8A 3TJOA 1EQ9A 4OS6A 4R0IA 1LCYA 1PPBH 4VGCC 1IQGA 3SU0A 1MBQA 1GVZA 3T2NA 2ALVA 5FXLA 1PQ8A 1BTPA 1EJNA 3MNCA 3KL6A 1O3GA 5A0CA 1E36B 3VB4A 4WXIA 1M9UA 4DCDA 1TGNA 3ESTA 1GDNA 1G9IE 1YPHE 4SGAE 1TMUH 1KXAA 4ZHLU 5FX6A 1T8OA 1C4Y2 2HPQH 2H9HA 5HYOA 2QF3A 1O2JA 2ZGXH 2JETB 3BTEE 2QN5T 2QXJA 5I46H 4K8BA 3G01A 4Y10E 1KXDA 1EAIA 1GDQA 1ZSLA 4CR5A 4D9QA 2ZGBH 3JZ2B 4DW2U 1KIGH 2OQ5A 2Z9IA 5HM2A 4I8JA 3RXDA 4O9VA 1Z6JH 2GV7A 5A8YA 1YPLH 4TPIZ 3LGVA 1CBWB 1AO5A 2FMJA 1P05A 2V3OH 3ITIA 4NSYA 1EAWA 1GGDC 3E0PB 1YP9A 1FZZA 2Z94A 1ZTLA 5LPRA 1EOLA 2H6MA 3EQ0H 4ZKRU 2BYAX 2ZC9H 2PW8H 2F9PA 1AVXA 1UO6A 4BNRA 1O32A 3PMJA 4MNVA 1GJ6A 1S0QA 3MI4A 5TCAA 1ESTA 1UVPA 3SOSA 1TNGA 1AUJA 2O9QA 2ZIQH 1DFPA 3LGUA 1QRZA 4GAWA 1S0RA 3ZV9A 2F91A 1HCGA 2AMPA 1SQAA 1UTKA 3UFAA 3KQEA 2ANWA 4AG2A 1C1QA 2BZ6H 4K5ZA 4WJG2 1W0YH 2BVRH 5C5NA 1AI8H 2G4TA 4UDWH 3S0NA 2VGCC 3PMBB 2BDIA 3TPIZ 1ETTH 1D6RA 3PM3A 4ISHH 1TA2A 3VGCC 5JPMH 1DOJA 2Z7FE 4ABAA 1C1TA 1BB0B 1AHTH 1Q31A 3C1KA 4FU9A 1GBJA 2A4RA 1O3CA 1O34A 2OLGA 1FMGA 2NU4E 1ACBE 1BIOA 2WV4A 4YLQH 3LC5A 1S85A 2O8LA 4Y6DA 1C4V2 5EU8A 1ABIH 1Z1IA 1O31A 1OWJA 2ZA5A 2R9PA 2QV1A 4CRFA 3SU5A 1C5VA 1YLCA 2ZGCA 4BXWA 3AVZA 1K22H 2Z9KA 3A80A 3HKJB 3PWBA 1K1MA 1UVSH 1O2UA 2V3HH 1YPJH 2HLCA 1INCA 5DJ7A 5TCCA 2TBSA 3RMMH 1TNKA 1P2JA 3QZQA 2Z9LA 1L1GA 5A2MH 1GHBF 3T62A 1CGIE 3EA9A 1G32B 3QZRA 3QGNB 1HAPH 4B1TA 5A8ZA 2AS9A 1SGRE 2VIVA 3ZZ8A 2NU3E 1DANH 2A5IA 1SGEE 1YPKH 2ZO3H 2ZDLA 2XWBI 1TPPA 2CHAC 4ISOA 2WPJS 1W7GH 3LIWA 1SL3A 3T28A 3SNEA 3TGKE 1BMNH 2AEIH 1TNLA 1YPHC 4UE7H 2IPHA 3SBKA 2C4FH 4DGJA 1Z7KA 3AW1A 1IQEA 1GJ9B 1H8IH 2R0KA 2ZFTA 4Y0YE 5CHAC 4AG1A 1XUIA 3LH1A 4ZKSU 3DA9B 3BTDE 1G30B 4O3TA 1GHBG 3S9CA 3U1JB 4OGXA 1XVMA 2YOLA 3UNRA 4LK4A 4WH8A 1O3NA 2G5VA 2J38A 4X8UH 3TK6A 3MU0A 1JOUB 3BTFE 3E3TA 1HAIH 3UQVA 1HAVA 3UTUH 1EATA 7GCHF 1HXFH 3A87A 2VB0A 1V2MT 2AIQA 4NIYA 1QCPA 3D62A 4CH2B 1P03A 1HV7A 1HJAC 1O3PB 4I8HA 3HGNA 1LQEA 1O2QA 1C9TA 1N8OB 1OWEA 3M5NA 2ZQ2A 4AFSA 1O3DA 4TY7A 4XE4A 5K7RA 3RLYH 2Q6DA 1Q2WA 1C5UA 1A46H 4AB9A 3BIVH 2FS9A 3A85A 4WH6A 4D8NA 1EP6A 1UCYH 1B7XB 1P2MA 1AFQC 5BPEA 3SV2H 4I8GA 4JYTA 1UMAH 1SG8B 6ESTA 2B7DH 4H6SB 1P3CA 2J4IA 7GCHG 3RXJA 4FUHA 4DOQA 4AOQA 1S6FA 4Y8ZA 1O2KA 3SUDA 4MPUA 5DP3A 4LOYH 4IW4E 1A5HA 1FI8A 1IAUA 5EXLA 3BTTE 3QDZB 2HALA 1HAZB 2BQWB 1LVMA 1YCPM 1MTSA 2AGGX 3MNXA 4CHAC 1IOEA 3FAOA 1O2RA 1ZR0A 1F5LA 1TQ7B 4Y11E 4ABGA 2BY9X 3S9AA 1NC6A 1ZJKA 2M5TA 1OXGA 5JB9S 1P06A 6GCHF 1A2CH 3MYWA 5FX5A 1O2PA 1MD7A 3V7TA 1NRRH 5B6OA 2XTTB 1W10U 1HFDA 3TIUA 1K21H 4ISNA 4AFZA 2OBQA 1V2LT 1O5DH 1HXEH 4FUCA 2AERH 3MNSA 4CRDA 1QJ1B 4XBDA 1B0FA 1SHHB 2FS8A 3ZZCA 4HGCA 3LONA 1DSUA 2GTBA 4FU8A 4ZH8A 1Y3UA 2FO9A 4OS5A 4Y71A 1KLTA 1U6QA 1GI0A 1TQ0B 7LPRA 2RDLA 3RP2A 1CA8B 3BEFB 3GCNA 3IWMA 2A4GA 1WU1A 1RTFB 2PR3A 2NU1E 1ANBA 4DJZB 1NFXA 1TMBH 5I25A 1C1SA 6GCHG 4BAOB 2OP9A 1LHEH 2C3SA 2VWOA 2H5CA 1O3LA 3K65B 3SNBA 2K1QA 1SGPE 3RXCA 3ENSB 1O2VA 1LVBA 4YT6H 3NUMA 1ZHMA 2ZPSA 2ZFSA 1O3JA 4JYUH 2ZHQH 5AF9H 3U69H 4GPGA 1GWAA 2BVXH 1EPTA 2FOAA 1AWFH 2PWXA 1DT2A 4AB8A 3GCHB 2FYRA 2GCTB 4X1PU 1EPTC 2HGTH 3SNAA 3FP7E 1DX5M 1PPFE 2ZU5A 4FU7A 3NKKA 1K1NA 1L0ZA 5DP5A 1LPKB 2ZTZA 3M36A 1PYTC 4FUJA 1QBOA 1ARCA 1MU6B 1ZZZA 4RKJB 1C2JA 4NZQA 1O5EH 5DP9A 1XUFA 1SGFG 2VIWA 2F9VA 1HAOH 1HIAA 3JZ1B 1YPMH 3QN7A 3MU8A 1K1PA 3PROA 2ZHFH 4FXGH 4FUBA 1PQ5A 5C3NA 1GCTC 3P70B 1HDTH 1ZPZA 2O8UA 3A7YA 3PO1B 1KYNA 2WINI 1JIRA 1EJMA 3KIDU 3OY6U 4TYDA 1SSXA 3SJIA 1ID5H 2GD4B 1O3EA 1QB1A 4PROA 1TX8A 4KTCA 2F9UA 2Y82A 3SV8A 3A8AA 1FONA 3P17H 4IGDA 2ZFRH 2J2UA 2W3KA 4FUGA 4F4OC 2A45B 1BHXB 1IHTH 3FVFB 2PUXB 3S9BA 5FPSA 1MD8A 1OWKA 2W3IA 2PFEA 2NWNA 2VU8E 4A6LA 4JK6A 2GT7A 3AW0A 3RXIA 4ZXXH 3BTWE 1GVKB 1T8MA 4Y7BA 2BQ7B 2Q6FA 3RC6A 1DWCH 3KHVA 2OXSA 1ABJH 1GBEA 2TIOA 1Y3WA 2QGRA 2V35A 1XUHA 5L2YH 1BQYA 3U9AH 4KGAA 2FEQH 2XXLA 1SFIA 2ZDNA 5GJ4B 1JIMA 1J16A 3ODFA 3SHCH 2FI4E 1K1OA 8LPRA 1T4VH 5H4IB 4BAKB 1XKBC 2LPRA 2OCVB 4Q7XA 1FUJA 1XKAC 3UY9A 2FDAA 3GOVB 2EEKA 1GHWH 1P11E 2ZU2A 4CRGA 2J9NA 1A1RA 1AB9B 3ZVDA 1SLUB 1W8BH 2G00A 5C20A 1SC8U 2FOEA 2VINA 1BBRE 4I31A 1ZRKA 1IQJA 4SGBE 3GY7A 3QGJA 3BG8A 1CT2E 3ZVEA 2CGAA 1WQSA 3LH3A 1P2OA 1MQ5A 3RM2H 1LHCH 3NZIA 3U8TH 4A7IB 4BAQB 1DVAH 3P95A 3SNDA 4H6TA 2AMQA 2ZDMA 3BEIB 1JWTA 2IN2A 1A61H 2QIQA 2HNTC 4X6MA 4Y8YA 1MTUA 1IQMA 2VVVA 1MTNC 1KDQB 4FUDA 2HNTF 4FVDA 2GVFA 2H5DA 2P3UB 4KP0A 3AASA 5DPAA 4I33A 2OTVA 5JB8S 1G3DA 2ZP0H 1OX1A 4FVBA 1C1PA 4JMYA 2UUFB 1CU1A 3H5CB 1QBVH 3E8LA 2UWPA 4H4FA 4K2YA 1ZRBA 2OQUA 2EI7A 3Q3XA 3SV9A 3SU1A 1AFEH 4ABHA 1LKBA 1BTUA 2C90B 2HPPH 4HI3A 4NWLA 1SGQE 1ZTJA 4K1SA 2Y5FA 1Y3XA 3TH2H 1L1JA 3ZZDA 5LGOA 1OWHA 2SNWA 3VXFH 4D7FA 4XDEA 3TLOA 2BLOA 3ZZ6A 1VITH 4TWWA 2FOHA 1TX6A 5GWZA 1K2I1 1A0LA 3SI4H 3SJ8A 2TGDA 1TBQH 5F8ZA 1Q3XA 1CT0E 1MKXK 1SFQB 1GBCA 1V2WT 1QFKH 1GI5A 1GBKA 3URCA 4CR9A 1FN6A 4MQAA 2O8MA 1C5ZB 1YM0A 3BSQA 1MKXH 2EC9H 3N7OA 5SGAE 3OX7U 1GI7B 3K9XB 3S7KB 3VFEA 5T6FA 3O8CA 2ZFPH 1TGBA 1V2PT 1AD8H 6CHAB 4I8LA 2BM2A 3SI3H 1S6HA 3GDSA 2ZU3A 3TK5A 3H7OA 2A0QB 1GJ8B 3EAJA 3A86A 3ZZ4A 3SZNA 1V6DA 4X0WU 1SPJA 1V2UT 1S5SA 1DS2E 1AIXH 1LMWB 4KELA 3T5FH 1TIOA 3RC4A 1FIZA 2Y6TA 2B9LA 5J4SA 2ILNA 1C5QA 1NFWA 1D3QB 1TYNA 1D4PB 3MTYA 2BDHA 3LPRA 1RS0A 1BUIA 1GBDA 1EAXA 1C9PA 3D23A 3MH4A 2WV5A 3MO3A 3PLBA 1C1VH 1W7XH 4TY6A 4CRAA 1CQQA 4OS4A 4DT7B 1J9CH 3A8DA 1O5CB 2KAIB 4E7RG 1O2ZA 1MQ6A 3B8JA 1UVUH 2VWNA 1AE8H 4GLYA 3V3MA 1D3PB 3MMGA 4MTBA 1P2QA 3HK3B 1SVPA 4UEHH 4WWYA 1FY5A 1EP5A 4WF8A 2P3TB 1GJCB 2VWLA 3A7TA 1QBNA 3CP7A 3SN8A 1N6YA 2WPKS 1C5MD 2ODYB 1MZDA 1SQTA 3DD2H 1C2MA 3AAUA 3RXHA 4AN7A 2W7UA 4NFEA 4UFEH 1GI9B 5AFZH 2G52A 1LVYA 5ABWA 3ZZBA 1C1WH 4ZROA 1ELDE 1GJ7B 2PSYA 1VCPA 1GMCG 3BIUH 2GZ7A 5EOKA 1BTZA 2VIDA 2Q1JA 1DWDH 1LHFH 3FP6E 4MG3A 1ORFA 2Z9JA 2W26A 5GXPA 3TJNA 1W0ZU 1Z1JA 1C5PA 1GBTA 4BTIB 1DUAA 4IN1A 3SU3A 3ZVBA 3UWIA 1X7AC 3RMOH 4I8KA 1QGFA 2OINA 1DICA 2BDAA 1C5YB 3PLKA 1OPHB 2WUBA 2XC0A 1J17T 1O2LA 2ODQA 2P59A 2ZECA 2VH6A 3R0FA 1GG6B 1C5RA 1QL8A 1UTPA 1YYY1 3EDXB 2FOBA 1W2KH 1EASA 1EZUC 3UNSA 3RXFA 2SGDE 3C27B 1MMJN 2I6QA 3BN9A 3EGKH 3SGQE 2PTCE 2OD3B 1NFYA 4DIHH 3W95A 3RXLA 3P8FA 4THNH 4JZDH 1O2IA 2QXIA 2HOBA 3ZV8A 2WPHS 3RMNH 4UFFH 3RC5A 1QURH 2G51A 4ISIH 3LT3A 4MPVA 5C1XA 2Y5HA 3MOCA 1QA7A 1GPZA 1A3BH 2XC4A 5EXNA 2RA0A 1DUEA 3M5LA 4DG4A 1FY1A 1P01A 2ZHEH 2BQ6B 1UK4A 1OYTH 4NA7A 5EODA 3AAVA 3F68H 2FODA 2VNTA 1XUGA 1UVOA 2A4QA 4X6NA 1NT1A 3F6UH 3D49H 4JK5A 2VIOA 1TAWA 2FOCA 2QF0A 1C1NA 3RXQA 4YZUA 5EPYA 1ZSJA 2CJIA 2R2MB 1CHGA 2HVXA 1H9HE 2Z9GA 2ZGJA 5C5OA 2XCNA 1HYLA 2BD5A 2QYIA 2C8ZB 1QJ6B 5T3HA 1VGCB 1GBMA 2ZCHP 3HATH 4MVNA 5EQQA 4ESTE 1PPZA 3M7QA 1CT4E 1S84A 1AGJA 3UOPA 1F0TA 1O3AA 4B75A 1H8DH 1HNEE 2A1DB 2BD7A 3QUMP 3BG4B 3B9FH 4I7YH 1BMLA 1MTVA 1O3MA 1CVWH 1NS3A 1WYKA 1AB9C 1C2HA 1CA0C 1BZXE 1GHVH 4ABFA 1ANCA 1ESAA 4ISLA 8GCHF 1VCWA 2TRMA 5ETXA 4YLUA 4WMDA 2VJ1A 3RXBA 3A7XA 4ABJA 3QK1A 1UCYK 1C2GA 1DXPA 2FTMA 3MH6A 4ABBA 5LH8A 3M7TA 3VB3A 2VWMA 1RIWB 2PSXA 3VXEH 2GGVB 2BY5X 1A4WH 1MAYA 2YNAA 1UHBB 4BTTB 3F9HA 5A8XA 1GL1A 1KDQA 1UTMA 3K6ZA 1W14U 2ALPA 3U8OH 3MWIU 2PTNA 4BOHA 3SJKA 3RU4D 5DGJA 4XFQA 5JYIA 5FBIA 1H4WA 1GL0E 4NFFA 2CF8H 2J95A 2RA3A 2A2XH 3ZYEA 3HGPA 4CBOA 1FPHH 5PTPA 1KTSB 2PHBA 8GCHG 2FLRH 1FJSA 3RXPA 3PMAB 1BTYA 1WTHD 2BD9A 5HGGA 3OSYA 3RXAA 4YOIA 1BCUH 1DLEA 2GDEH 2D1JA 1GBAA 2P8OC 2OC8A 4GVUA 1C1OA 1V3XA 1TRNA 3TVJB 5HXFA 2EA3A 2STBE 4VGCB 2BDCA 2F83A 4NZLA 4UFGH 4ZHMU 2XRCA 1SB1H 3MH7A 3RM0H 2Z3EA 1F5KU 1K9OE 3BTGE 1V2TT 2P16A 3SV6A 2XBVA 1YBWA 1BJVA 1QR3E 1GHAF 5FPTA 1PPEE 3WY8A 1Z8RA 2ZTXA 1MH0A 4MPXA 1N6XA 1QRXA 3ODDA 3VB6A 3HPTB 3DT0H 1NTPA 2Y7XA 5FAHA 2BX4A 3LGIA 4D9RA 1T8LA 5JBAS 2BD4A 1YGCH 1RGQA 1MZAA 3CENA 1WAYB 4AGJA 4KTUA 1PQAA 3SGBE 1K1LA 1O38A 3CS0A 3SORA 5J4QA 2XW9A 4OGYA 4DIIH 3A8CA 3SNCA 3ATKA 1L4ZA 1ZJDA 1FV9A 1HLTH 1AZZA 1YF4A 2JETC 3ZYDA 1T4UH 3T27A 3CS7A 1BITA 1G3EA 2OUAA 1GGDB 1C5OH 2ZNKH 2UUYA 4JZFH 2C8YB 1NZQH 2EI6A 1TONA 4RKOB 4M7GA 1Z6EA 1GHAG 3SO3A 3ATMA 1DPOA 2HNTE 4Z0KA 4ZKOU 2AIPA 3RDZA 3M5MA 3P8NA 1MAXA 1C4U2 1EX3A 4QT8C 1GHYH 2ZTYA 3Q76A 1CBWC 2F9NA 1P2IA 3L3TA 4MNYA 1C1UH 1ZPCA 2KAIA 1NESE 1UTNA 2BLVA 3BF6H 2FOGA 4KKDA 1D9IA 1E35B 1L2EA 1KXCA 4AFQA 1KXBA 2I6SA 1SGIB 3QX5H 4OS7A 4U32A 3ZVGA 2ZEBA 1RRKA 1RJXB 3I29A 4YTAA 1XXDA 2DE9A 3TGJE 4X6OA 5AHGH 4UD9H 4INHA 2VGCB 1Z8IB 2STAE 1ARBA 1UTLM 3F9GA 5F6MA 4CRBA 1ELGA 3U1IB 2BY8X 5F8XA 2DE8A 1HAGE 1TNIA 2XCFA 2W5EA 3GY8A 2QA9E 3ELAH 2GMTB 1YCPH 4FUEA 1MUEB 1CSOE 2Z3CA 2A7JA 1K1IA 1ZOMA 1ETRH 3A89A 3DFLA 2VH0A 2WYGA 2ZQ1A 1TPSA 5DP6A 1KTTB 2P3FH 1LQDB 2JH6D 4A5TS 4WMEA 1EUFA 4ASHA 5DO4H 2AGIX 5JBCS 1TNHA 3M35A 5E0HA 2GV6A 3NWUA 1F2SE 3SW2B 1T7CA 3LJJA 3IITA 1IQLA 4X1QU 2FI3E 4BANB 2F9BH 1Y3VA 1O2OA 5LPFA 1TPAE 2XYAA 4INKA 2ZDAH 3GISB 1QB6A 1IQFA 2BY7X 4XSKU 1C2IA 1FPCH 1GBIA 2O8WA 5CE1A 2WPLS 1P04A 1HRTH 1GI3A 3BTQE 1ZGIA 1MTWA 1F0SA 2BB4A 1OYQA 4JYVH 2PKAB 3A7ZA 2ZF0H 1G3BA 1ANEA 1KY9A 2ZDKA 5EW1H 5E0GA 1S81A 1UTOA 3V12A 4WXVA 1A5GH 1FN8A 1E0FD 2CHAB 4WY3A 1HGTH 3UPEA 2Y81A 1WOFA 3VB7A 3Q3YA 3GYMA 4GHQA 4NG9H 5LPEA 1ZMJA 2BDGA 2OC7A 1THRH 1A0JA 4X8SH 1C2FA 2F3CE 2G81E 1ZPBA 5DK1A 1VJ9U 3BV9B 4TWYA 2UWOA 9ESTA 4IS5A 1O3HA 5CHAB 1JXPA 1O2YA 1O2WA 4XOJA 1NN6A 1VCQA 3SU2A 1A7SA 4NA9H 1FDPA 4CRCA 2FX6A 5ESBA 1O33A 3NXPA 3GICB 1SGCA 3PTBA 3RU4T 3RXMA 2ZCKP 4ABDA 4LZ1H 2FM2A 5C2ZA 5DP8A 4NIXA 3M5OA 3PB1E 4U2WA 1QY6A 3K2UA 1Y59T 4Q80A 1C1MA 2FYQA 1P57B 3GYLB 4K1EA 1GMHF 2PGQB 1O2GH 2Q6GA 1TRMA 5C1UA 2W7SA 3FZDA 4X1RU 5A09A 1HJAB 1FAXA 5DP4A 1YPEH 3UREA 3ATWA 3RXGA 2ZFQH 4CH8B 4OS2A 1W12U 5DG6A 2FIRH 1HJ9A 1D3TB 2ZKSA 4J1YA 2GT8A 3F1SB 2ULLA 1SR5C 2D26C 3Q77A 1CHOF 1ELAA 2R0LA 3BG4C 2UUJB 2XBXA 2BLQA 4JCNA 4X8TH 3SU6A 1B0EA 4B2CA 1QL9A 2GX4A 4MLFB 1N8OC 2PUQH 1AFQB 2B5TB 1FY3A 2SGAA 1OP8A 2THFB 1GMHG 5JDUB 1NU7B 1VJAU 4J2YB 1T32A 2GDDA 2PKSB 3ZVAA 3GY4A 3ZZ7A 1WSSH 4KTSA 4X2YA 2G55A 1BRUP 3V0XA 1O3IA 1EZQA 4CHAB 2ZWLH 1S82A 4HFPB 3RU4E 2ANMH 4AX9H 3GDUA 3RMLH 2A5AA 3SHAH 2SFAA 3ZZ3A 5DKMA 5BRRE 1FY4A 4IN2A 1AE5A 1CHOG 1TNJA 1EB2A 2Z6BD 3F9FA 4FUFA 4IMZA 3FP8E 1P9UA 1BTHH 3GY3A 5F03A 2BD8A 3KNXA 1DITH 2SNVA 3F9EA 1JRTA 3QWCH 4YOGA 1QTFA 1C5TA 1J14A 4AZ2B 5E8EH 1AQ7A 3BTHE 2GZ8A 2H1UA 1NRSH 2GZ9A 1H1BA 4U01A 1VITF 1AKSB 3EE0B 4GUXA 3TH4H 3A8BA 1SGTA 1A3EH 4CREA 1E37B 5EXMA 1THPB 1OSSA 2BHGA 3LDXH 3RXUA 3IG6B 4OS1A 1AY6H 2JH0D 3UQOA 1SOZA 4ZHAA 1T31A 2C8WB 2FLBH 4TPYA 3B23B 3M37A 3MFJA 1A0HB 5AFYH 2AGEX 2CF9H 3KCGH 2V6NA 9LPRA 3SUGA 1UTJA 2CV3A 2D8WA 1NPMA 1UVTH 1Y3YA 1Z8GA 1KXEA 1TBZH 1KSNA 3GCTF 1GMCF 1FLEE 1HJ8A 6LPRA 3LGTA 3P8OA 4LXBH 1VITG 1O2TA 1OOKB 4X1SU 2CMYA 1EPTB 1TB6H 1P3EA 4E05H 1BBRK 1TBRH 1DM4B 1ELTA 5GDSH 2H9EH 2FX4A 2OC1A 3P92A 3O8RA 1RTKA 5F8TA 1EXFA 1P09A 2A5KA 3T25A 1C1RA 4YM9A 5T6GA 3A88A 4K8YA 4A1TA 1GI6A 4O97A 4DURA 3E90B 1BBRH 1O5GH 1BTWA 1GJAB 4K3JA 4YESB 1XXFA 2ZU4A 3A83A 5EW2H 3GCHC 2GCTC 1JRSA 1O35A 1LTOA 1GHXH 2ZU1A 3E0NB 4YT7H 1GMDF 4Y76A 1TPOA 1LPZB 1NFUA 4NWKA 1H9LB 5K0HA 2R3YA 3TNSA 1AMHA 2P95A 3TNTA 3GCTG 2UWLA 1HIAB 1DDJA 2A31A 2G5NA 1GCTB 3UNQA 1ELBA 3ATLA 1OWIA 2XNIA 5DP7A 5C1YA 1SGDE 5EPNA 1UCYE 1ELVA 4BAHB 2VIPA 1QJ7B 5FBEA 1SOTA 1XX9A 1G3CA 1WUNH 1ZLRA 3BEUA 1BRAA 2Y7ZA 2FOFA 2QY0B 3MU1A 3ATIA 1QB9A 1V2KT 2G4UA 3PO1C 5AVDA 1GMDG 2GMTC 1QL7A 5EG4A 3SUEA 3URDA 5HM9A 2NU2E 3LC3A 2FP7B 1AWHB 1YC0A 1EOJA 2HRVA 1C5NH 3KEEA 3SJ9A 4B73A 2JH5D 2ZCLP 3TK9A 4HZHA 1HUTH 2LNCA 4ZAEA 3UOUA 1P10A 5GIBA 1W3CA 4Q7YA 4X2VA 1J15A 4AGKA 2EI8A 1O5FH 1QIXB 1UK3A 1ZHRA 2AH4X 4XBCA 3MO9A 2Y80A 2VIQA 1NROH 1HAHH 1HPGA 2GCHF 2G8TA 2FESH 1WV7H 1OWDA 1ZMNA 3R3GB 2A32A 1GDUA 1V2VT 2BMGB 1QHRB 1Y8TA 2R2WU 2F9OA 1EZXC 1O37A 3PWCA 4E7NA 2H2ZA 1BHXF 5EQRA 1SGYE 1C5XB 3P6ZB 3SU4A 1D3DB 3LOXA 1OKXA 1PQ7A 3HKIB 3OY5U 3SJOA 3A7WA 3Q3KA 1JBUH 1DLKB 1E34B 1DY8A 1AU8A 1SHYA 3E16B 2PKAA 3PMHB 1ELEE 1O0DH 3W94A 1O2XA 2Y5GA 4WMFA 1TGSZ 5CMXH 1NO9H 5E2PA 2BZAA 3MHWU 1O3KA 4NIVA 4MDSA 5L2ZH 2C8XB 1HAXB 1C2DA 3D65E 1RD3B 2QC2A 4JZIA 2WPMS 3KQBA 1FIWA 1J8AA 3H7TA 1C2LA 3E1XB 1V2RT 1ELCA 3PLPA 8ESTE 1TE0A 2GCHG 5JBTA 3O8BA 3V13A 2UUKB 1V2OT 1ZGVA 3OYPA 2BY6X 1TGTA 4X6PA 2NU0E 1HBTH 4U30A 2Z3DA 1S83A 1NM6A 3M61U 1G36A 2FOMB 3M3VA 5A0BA 1SBWA 2YNBA 5IDKA 1DY9A 3UR9A 4ZMAH 2B8OH 2R3UA 3U98H 2IJOB 4D7GA 1IQNA 3RXKA 2TGAA 3VPKA 1MTNB 3GCOA 1TWXB 4A92A 1GI8B 1IQIA 2BOKA 8KME2 1YLDA 1XVOA 1GJ4H 1O5AB 3E6PH 1G2MA 2GKVE 1LHGH 2ANYA 3KN2A 3RXEA 1ELFA 5C67A 2A7HA 1L4DA 3SV7A 4BAMB 2VVUA 3TJVA 2SGFE 2QXHA 4A1XA 5L6NH 1AVWA 4Y7AA 1GCDA 3UR6A 3GY5A 1WQVH 1MBMA 2ODPA 1O5BB 4K60A 4ZKNU 1TA6A 3GDVA 3SQHE 3S7HB 1ZYOA 1O2NA 4O03A 4B2BA 1QQUA 7KMEH 4NIWA 1OP0A 1GBFA 1GJBB 3VEQB 3SQEE 3U8RH 4B71A 4MNWA 1IHSH 1O2MA 2DUCA 2JKHA 4B2AA 1Y5UT 3M3TA 3TITA 2PV9B 4D76A 1WTGH 3LGYA 3PYHA 1EB1H 4YO9A 1UK2A 1FNIA 1P12E 4B74A 1OS8A 2PKSC 2ZPQA 4Y79A 1P02A 2BDBA 3RXOA 3MNBA 3FZZA 1FY8E 2CN0H 3QLPH 1PPHE 4DY7B 1UTQA 5EQSA 2SGPE 1LHDH 1PJPA 1AUTC 2D2DA 2AMDA 2ZZUH 3DHKH 1E38B 3T29A 3E91A 3A7VA 1QNJA 2QAAA 4X1NU 1GJ5H 3STIA 1F5RA 3OU0A 3UIRA 1EKBB 1LKAA 4X8VH 1PPGE 1BA8B 1F92A 3GY6A 4IMQA 1F7ZA 1PFXC 1OP2A 5E2OA 1O2SA
chains in the Genus database with same CATH superfamily
1AKSA 1GI2A 5TJXA 3WWBA 6CHAC 2HWLB 1XUKA 1IQHA 2QXGA 1K1JA 4AFUA 1TGCA 4H42U 1P9SA 2A4OA 3DUXH 4ZUHA 2BXUH 2J92A 1CE5A 1MU8B 1GBHA 1W13U 1V2QT 1SLWB 1TMTH 3TU7H 4GHTA 3NPSA 3VB5A 1O3FA 3GY2A 1P2KA 4Q7ZA 4WVPE 3L6PA 1ETSH 2FWWA 3EA8A 1SGFA 1F0UA 1YKTA 2A7CA 2P93A 5JBBS 3NCLA 3O8DA 5E0JA 2IOTA 1GBBA 3EA7A 4RSPA 1TLDA 1XUJA 2FZZA 3FFGA 2AFQB 1NRNH 1TOMH 5GNDA 2P94A 1ESBA 3ZZ9A 5L30H 1G2LA 3BTME 2B0FA 1RFNA 2FPZA 3SGAE 2RFKC 3RUOA 1DWBH 3RXVA 1EZSC 2TPIZ 3STJA 2XWAA 3RXRA 1PPCE 2ASUB 1SQOA 1YCPK 1BRBE 3QTOH 1TX7A 2BVSH 4HTCH 3VGCB 2RG3A 1SLVB 1BOQA 1MABB 2ZPRA 1DSTA 3A81A 1NRPH 1K0HA 1GI4A 3RXTA 1IQKA 4AYYB 1Y5BT 2XC5A 1TALA 1KLJH 2AYWA 4CBNA 2ESTE 3SUFA 2CXVA 1XM1A 1BMMH 1O3BA 5FHTA 4I86A 4K69A 1TABE 1DXWA 4NCYA 3MH5A 1FAKH 4GCHF 4MPWA 4UONA 1O3OA 1ZHPA 3ZVFA 5ESTE 1BT7A 1QQ4A 2FTLE 4IC6A 4F49A 2RCEA 1YPGH 1FQ3A 1SGNE 1THSH 3KQDA 2PGBB 1JMOH 4X2XA 4AYVB 1GHZA 5FCRA 4Y8XA 2QE7D 4YXWD 1MKWK 2J94A 1CGJE 2O8TA 1HAYB 5GPIB 1GVLA 2ZG0H 2SGQE 2WUCA 2BTCE 1KLIH 1ZSKA 1A5IA 1GG6C 4JZ1A 2ANKH 3LU9B 3FN8A 1BMAA 1MKWH 2H9TH 1TOCB 3DFJA 1O30A 2BXTH 4X2WA 1LVOA 4XBBA 1LPGB 2ZGHA 2PLXA 4GCHG 1AVGH 5GCHF 1Y5AT 1FXYA 1NRQH 4K1TA 1VR1H 1MCTA 3WWFA 2BD2A 4ZXYH 1CGHA 1DE7H 1P0SH 1WCZA 4Q2KA 3ZVCA 4ABEA 3M3SA 1NY22 1SMFE 1LO6A 4A1VA 3FANA 3ZZAA 1MCVA 2FI5E 2VVCA 2ZHDA 3M7UA 3RLWH 2BLWA 2WPIS 3OAAD 1GI1A 1NU9A 2BDYA 1AZ8A 1BJUA 1Z8JB 2C93B 1RXPA 1H8HD 1ZTKA 1SLXB 3MU4A 2KCOA 3ZZ5A 3TGIE 2ZI2H 3EYDA 1Z71A 1VZQH 1QRWA 1ZMLA 2QCYA 3TJUA 1PYTD 1C2EA 1W11U 1WBGB 1B5GH 4RN6A 1TRYA 4ABIA 2XBYA 1C5WB 3RXSA 4LZ4B 1T8NA 3S69A 5A0AE 2TGPZ 1BTXA 4GSOA 5GCHG 2ZHWH 1C5LH 3QO6A 4AC9A 1HAVB 3I78A 1O39A 3MO6A 4JZEH 4NSVA 5HMAA 1O2HA 1G37A 1BRCE 4FUIA 1P8VC 1XMNB 3A84A 1CA0B 3BTKE 1O36A 1VGCC 1AN1E 5B6LA 1D6WA 5IYTA 3PTNA 3TH3H 5G4BA 4IBLH 3A82A 4BTUB 2V0BA 3LKWA 1F0RA 3KGPA 2GP9B 5T6DA 1C5SA 1SI5H 3P8GA 3L33A 1EAUA 1QA0A 2FXRA 3HK6B 7ESTE 1V2JT 4R8TB 4O3UA 3Q00A 1GBLA 1H9IE 1WXRA 5EJZA 2OC0A 1K28D 4MNXA 3KF2A 3F0OA 2BOHB 3T26A 4NA8A 1BDAA 1HB0B 1UHBA 1C2KA 1RIWC 1P2NA 3K6YA 1NBME 2WZQA 4UFDH 4BXSA 5FCKA 1CO7E 2ZFFH 4DVAU 2BD3A 4NGAH 5FPYA 1TFXA 4YOJA 1EJAA 4E06H 1LDTT 1V2ST 2TGTA 3KQCA 1KXFA 3LGWA 3UWJH 2WYJA 4B76A 2SGEE 2A2QH 4AORA 1V2NT 2P8OB 2BX3A 3LJOA 4Z6AH 1L1NA 3PV4A 3KQ5A 1RTLA 1UJ1A 1GJDB 3OTJE 3I77A 4I32A 2ZDVH 4IC5A 5EGMA 3QTVH 3UUZA 1DWEH 2IPQX 2J34A 1N1LA 4Y0ZE 2OBOA 3MU5A 4INLA 1ANDA 2XBWA 3NK8A 3TJOA 1EQ9A 4OS6A 4R0IA 1LCYA 1PPBH 4VGCC 1IQGA 3SU0A 1MBQA 1GVZA 3DSGA 3T2NA 2ALVA 5FXLA 1PQ8A 1BTPA 1EJNA 3MNCA 3KL6A 1O3GA 5A0CA 2V7QD 1E36B 3VB4A 4WXIA 1M9UA 4DCDA 1TGNA 3ESTA 1GDNA 1G9IE 1YPHE 4SGAE 1TMUH 1KXAA 4ZHLU 5FX6A 1T8OA 1C4Y2 2HPQH 2H9HA 5HYOA 2QF3A 1O2JA 2ZGXH 2JETB 3BTEE 2QN5T 2QXJA 5I46H 4K8BA 3G01A 4Y10E 1KXDA 1EAIA 1GDQA 1ZSLA 4CR5A 4D9QA 2ZGBH 3JZ2B 4DW2U 1KIGH 2OQ5A 2Z9IA 5HM2A 4I8JA 3RXDA 4O9VA 1Z6JH 2GV7A 5A8YA 1YPLH 4TPIZ 3LGVA 1CBWB 1AO5A 2FMJA 1P05A 2V3OH 1S6LA 3ITIA 4NSYA 1EAWA 1GGDC 3E0PB 1YP9A 1FZZA 2Z94A 1ZTLA 5LPRA 1EOLA 2H6MA 3EQ0H 4ZKRU 2BYAX 2ZC9H 2PW8H 2F9PA 1AVXA 1UO6A 4BNRA 1O32A 3PMJA 4MNVA 1GJ6A 1S0QA 3MI4A 5TCAA 1ESTA 1UVPA 3SOSA 1TNGA 1AUJA 2O9QA 2ZIQH 1DFPA 3LGUA 1QRZA 5HIYA 4GAWA 1S0RA 3ZV9A 2F91A 2PP6A 1HCGA 2AMPA 1SQAA 1UTKA 3UFAA 3KQEA 2ANWA 4AG2A 1C1QA 2BZ6H 4K5ZA 4WJG2 1W0YH 2BVRH 4P02A 5C5NA 1AI8H 2G4TA 4UDWH 3S0NA 2VGCC 3PMBB 2BDIA 3TPIZ 1ETTH 3FOAA 1D6RA 3OEHD 3PM3A 4ISHH 1TA2A 3VGCC 5JPMH 1DOJA 2Z7FE 3WW7A 2KX4A 4ABAA 1C1TA 1BB0B 1AHTH 1Q31A 3C1KA 4FU9A 1GBJA 2A4RA 1O3CA 1O34A 2OLGA 1FMGA 2NU4E 1ACBE 1BIOA 2WV4A 4YLQH 3LC5A 1S85A 2O8LA 4Y6DA 1C4V2 5EU8A 5CDFE 1ABIH 1Z1IA 1O31A 1OWJA 2ZA5A 2R9PA 2QV1A 4CRFA 3SU5A 1C5VA 1YLCA 2ZGCA 3W1EA 4BXWA 3AVZA 1K22H 2Z9KA 3A80A 3HKJB 2KR7A 3PWBA 1K1MA 1UVSH 1O2UA 2V3HH 1YPJH 2HLCA 1INCA 5DJ7A 5TCCA 2TBSA 3RMMH 1TNKA 1P2JA 3QZQA 2Z9LA 1L1GA 1VKYA 5A2MH 1GHBF 3T62A 1CGIE 3EA9A 1G32B 3QZRA 3QGNB 1HAPH 4B1TA 5A8ZA 2AS9A 1SGRE 2VIVA 3ZZ8A 2NU3E 1DANH 2A5IA 1SGEE 1YPKH 1OHHD 2ZO3H 2ZDLA 2XWBI 1TPPA 2J98A 2WPDD 2CHAC 4ISOA 2WPJS 4Q4LA 1W7GH 3LIWA 1SL3A 3T28A 3SNEA 3TGKE 1BMNH 2AEIH 1TNLA 1YPHC 4UE7H 2IPHA 3SBKA 2C4FH 3VG8A 4DGJA 1Z7KA 4XRNA 3AW1A 1IQEA 1GJ9B 1H8IH 2R0KA 2ZFTA 4Y0YE 5CHAC 4AG1A 1XUIA 3LH1A 4ZKSU 3DA9B 3BTDE 1G30B 4O3TA 1GHBG 2WHXA 3S9CA 4OGXA 3U1JB 1XVMA 2YOLA 3UNRA 4LK4A 4WH8A 1O3NA 2G5VA 2J38A 4X8UH 3TK6A 3MU0A 2HLDD 1JOUB 3BTFE 3E3TA 1HAIH 3UQVA 1HAVA 3UTUH 5C0TA 1EATA 7GCHF 1HXFH 3A87A 2VB0A 1V2MT 2AIQA 4NIYA 1QCPA 3D62A 4CH2B 1P03A 1HV7A 1HJAC 1O3PB 4I8HA 3HGNA 1LQEA 1O2QA 1C9TA 1N8OB 1OWEA 3M5NA 2ZQ2A 4AFSA 1O3DA 4TY7A 4XE4A 5K7RA 4ACBA 3RLYH 2Q6DA 4B6FA 3NRLA 3OEED 1Q2WA 1C5UA 1A46H 4AB9A 4M9FA 3BIVH 2FS9A 3A85A 4WH6A 4D8NA 1EP6A 1UCYH 3N99A 1B7XB 1P2MA 4ASUD 1AFQC 5BPEA 3SV2H 4I8GA 4JYTA 1UMAH 1SG8B 6ESTA 2B7DH 4H6SB 1P3CA 2J4IA 7GCHG 3RXJA 4FUHA 4DOQA 4AOQA 1S6FA 4Y8ZA 1O2KA 3SUDA 4MPUA 5DP3A 4LOYH 4IW4E 1A5HA 1FI8A 1IAUA 5EXLA 3BTTE 3QDZB 2HALA 1HAZB 2BQWB 1LVMA 1YCPM 1MTSA 2AGGX 3MNXA 4CHAC 1IOEA 3FAOA 1O2RA 1ZR0A 1F5LA 1TQ7B 4Y11E 4ABGA 2BY9X 3S9AA 1NC6A 1ZJKA 2M5TA 1OXGA 5JB9S 1P06A 6GCHF 1A2CH 3MYWA 1COWD 5FX5A 1O2PA 1MD7A 3V7TA 1NRRH 5B6OA 2XTTB 1W10U 1HFDA 3TIUA 1K21H 4ISNA 4AFZA 2OBQA 1V2LT 1O5DH 1HXEH 4FUCA 2AERH 3MNSA 4CRDA 1QJ1B 4XBDA 2J5UA 1B0FA 1SHHB 2FS8A 3ZZCA 4HGCA 3LONA 1DSUA 2GTBA 4FU8A 4ZH8A 1Y3UA 2FO9A 4OS5A 4Y71A 1KLTA 1U6QA 1GI0A 1TQ0B 7LPRA 2RDLA 3RP2A 1CA8B 3BEFB 3GCNA 3IWMA 2A4GA 1WU1A 2YMSB 1RTFB 2PR3A 2NU1E 1ANBA 4DJZB 1NFXA 3PRBA 1TMBH 5I25A 1C1SA 6GCHG 4BAOB 2OP9A 1LHEH 2C3SA 2VWOA 2H5CA 1O3LA 3K65B 3SNBA 2K1QA 1SGPE 3RXCA 3ENSB 1O2VA 1LVBA 4YT6H 2K8IA 3NUMA 1ZHMA 2ZPSA 2ZFSA 1O3JA 4JYUH 2ZHQH 5AF9H 3U69H 4GPGA 1GWAA 2BVXH 2F4LA 1EPTA 2FOAA 1AWFH 2PWXA 1DT2A 2WV9A 4AB8A 3GCHB 2FYRA 2GCTB 4X1PU 1EPTC 2HGTH 3SNAA 3FP7E 1DX5M 1PPFE 2ZU5A 4FU7A 3NKKA 1K1NA 1L0ZA 5DP5A 1LPKB 2ZTZA 3M36A 1PYTC 4FUJA 1QBOA 1ARCA 1MU6B 1ZZZA 4RKJB 1C2JA 4NZQA 1O5EH 5DP9A 1XUFA 5T1VA 3ZIAD 1SGFG 2VIWA 2F9VA 1HAOH 1HIAA 3JZ1B 1YPMH 3QN7A 3MU8A 1K1PA 3PROA 2ZHFH 4FXGH 4FUBA 1PQ5A 5C3NA 1GCTC 2LP6A 3P70B 1HDTH 1ZPZA 2O8UA 3A7YA 3PO1B 1KYNA 2WINI 1JIRA 1EJMA 3KIDU 3OY6U 4TYDA 1SSXA 3SJIA 1ID5H 2GD4B 1O3EA 1QB1A 4PROA 1TX8A 4KTCA 2F9UA 2Y82A 3SV8A 3A8AA 1FONA 3P17H 4IGDA 2ZFRH 2JJ2D 2J2UA 2W3KA 2KM0A 4FUGA 4F4OC 2A45B 1BHXB 1IHTH 3FVFB 2PUXB 3S9BA 5FPSA 1MD8A 1OWKA 2W3IA 2PFEA 2NWNA 2VU8E 5C17A 1H8ED 4A6LA 4JK6A 2GT7A 3AW0A 3RXIA 4ZXXH 3BTWE 1GVKB 1T8MA 4Y7BA 2BQ7B 2Q6FA 3RC6A 1DWCH 3KHVA 3F2HA 2OXSA 1ABJH 1GBEA 2TIOA 1Y3WA 2QGRA 2V35A 1XUHA 5L2YH 1BQYA 2KCPA 3U9AH 4KGAA 2FEQH 2XXLA 1SFIA 2ZDNA 5GJ4B 1JIMA 1J16A 3ODFA 3SHCH 3N7DA 2FI4E 1K1OA 8LPRA 1T4VH 5H4IB 4BAKB 1XKBC 2LPRA 2OCVB 4Q7XA 2HVYB 1FUJA 1XKAC 3UY9A 2FDAA 3GOVB 2EEKA 3OFND 1GHWH 1P11E 2ZU2A 4CRGA 2J9NA 1A1RA 1AB9B 3ZVDA 2W6ID 1SLUB 1W8BH 2G00A 5C20A 1SC8U 2FOEA 2VINA 1BBRE 4I31A 1ZRKA 1IQJA 4SGBE 3GY7A 3QGJA 1YY3A 1CT2E 3BG8A 3ZVEA 2CGAA 3PRDA 1WQSA 3LH3A 1P2OA 1MQ5A 3RM2H 1LHCH 3NZIA 3U8TH 4A7IB 4BAQB 1DVAH 3P95A 3SNDA 4DT4A 5DSFA 4H6TA 2AMQA 2ZDMA 3BEIB 1JWTA 2IN2A 1A61H 2QIQA 2HNTC 4X6MA 4Y8YA 1MTUA 1IQMA 2VVVA 1MTNC 1KDQB 3PV5A 4FUDA 2HNTF 4FVDA 2GVFA 2H5DA 2P3UB 4KP0A 3AASA 5DPAA 4I33A 2OTVA 5JB8S 1G3DA 2ZP0H 1OX1A 4FVBA 1C1PA 4JMYA 2UUFB 1CU1A 3H5CB 1QBVH 3E8LA 5DN6D 4ACAA 2UWPA 4H4FA 4K2YA 1ZRBA 2OQUA 2EI7A 3EE7A 2IJD1 3Q3XA 3SV9A 3SU1A 1AFEH 4ABHA 5HKKD 1LKBA 1BTUA 2C90B 2HPPH 4HI3A 4NWLA 1SGQE 1ZTJA 4K1SA 2Y5FA 1Y3XA 3TH2H 1L1JA 3ZZDA 5LGOA 1OWHA 2SNWA 3VXFH 4D7FA 4XDEA 3H09A 3TLOA 2BLOA 3ZZ6A 1VITH 4TWWA 2FOHA 1TX6A 5GWZA 1K2I1 1A0LA 3SI4H 3SJ8A 2L6OA 2TGDA 1TBQH 5F8ZA 3N7EA 1Q3XA 1CT0E 1MKXK 1SFQB 1GBCA 1V2WT 5KGOA 1QFKH 1GI5A 1GBKA 3URCA 4CR9A 1FN6A 4MQAA 2O8MA 1C5ZB 1YM0A 3BSQA 1MKXH 2EC9H 3N7OA 5SGAE 3OX7U 1GI7B 3K9XB 3S7KB 3VFEA 5T6FA 3O8CA 2ZFPH 1TGBA 1V2PT 1AD8H 6CHAB 4I8LA 2BM2A 3SI3H 1S6HA 3GDSA 2ZU3A 3TK5A 1UW7A 3H7OA 2A0QB 1GJ8B 3EAJA 3A86A 3ZZ4A 3SZNA 1V6DA 4X0WU 1SPJA 1V2UT 1S5SA 1DS2E 1AIXH 1LMWB 4KELA 3T5FH 1TIOA 3RC4A 1FIZA 2Y6TA 2B9LA 5J4SA 2ILNA 1C5QA 1NFWA 2JDID 1D3QB 1TYNA 3F2GA 1D4PB 3MTYA 2BDHA 3LPRA 1RS0A 1BUIA 1GBDA 4F48B 1EAXA 1C9PA 3D23A 3MH4A 2WV5A 3MO3A 3PLBA 1C1VH 1W7XH 4TY6A 4CRAA 1CQQA 4OS4A 4DT7B 1J9CH 3A8DA 1O5CB 2KAIB 4E7RG 1O2ZA 1MQ6A 3B8JA 1UVUH 2VWNA 1AE8H 4GLYA 3V3MA 1D3PB 3MMGA 4MTBA 1P2QA 3HK3B 1SVPA 4UEHH 4WWYA 1FY5A 1EP5A 4WF8A 2P3TB 1GJCB 2VWLA 3A7TA 1QBNA 3CP7A 3SN8A 1N6YA 2WPKS 1C5MD 2ODYB 1MZDA 1SQTA 3DD2H 1C2MA 3AAUA 3RXHA 1BMFD 2V3MA 4AN7A 4Z1MD 2W7UA 4NFEA 4UFEH 1GI9B 3FKSD 5AFZH 2G52A 1LVYA 5ABWA 3ZZBA 1C1WH 4ZROA 1ELDE 1GJ7B 2PSYA 1VCPA 1GMCG 3BIUH 2GZ7A 2VBCA 5EOKA 1BTZA 2VIDA 2Q1JA 1DWDH 1LHFH 3FP6E 4MG3A 1ORFA 2Z9JA 2W26A 5GXPA 3TJNA 1W0ZU 1Z1JA 1C5PA 1GBTA 4BTIB 1DUAA 4IN1A 3SU3A 3ZVBA 3UWIA 1X7AC 3RMOH 4I8KA 1QGFA 2OINA 1DICA 2BDAA 1C5YB 3PLKA 1OPHB 2WUBA 2XC0A 1J17T 1O2LA 2ODQA 2P59A 2ZECA 2VH6A 3R0FA 1GG6B 1C5RA 1QL8A 1UTPA 2LELA 1YYY1 2QF4A 3EDXB 2FOBA 1W2KH 1EASA 1EZUC 3UNSA 3RXFA 2SGDE 3C27B 1MMJN 2I6QA 3BN9A 3EGKH 3SGQE 2PTCE 2OD3B 1W0JD 1NFYA 4DIHH 2YMSD 3W95A 3RXLA 3P8FA 4THNH 4JZDH 1O2IA 2QXIA 2HOBA 3ZV8A 2WPHS 3RMNH 4UFFH 3RC5A 1QURH 2G51A 4ISIH 3LT3A 4MPVA 5C1XA 2Y5HA 3MOCA 1QA7A 1GPZA 4F55A 3GS9A 1A3BH 2XC4A 5EXNA 2RA0A 1DUEA 3M5LA 4DG4A 1FY1A 1P01A 2ZHEH 2BQ6B 1UK4A 1OYTH 4NA7A 5EODA 3AAVA 3F68H 2FODA 3DCLA 2VNTA 1XUGA 1UVOA 2A4QA 4X6NA 1NT1A 3F6UH 3PV2A 3D49H 4JK5A 2VIOA 1TAWA 2FOCA 2QF0A 1C1NA 3RXQA 4YZUA 5EPYA 1ZSJA 2CJIA 2R2MB 1CHGA 2HVXA 1H9HE 2Z9GA 2ZGJA 5C5OA 2XCNA 1HYLA 2BD5A 3SZEA 2QYIA 2C8ZB 1QJ6B 5T3HA 1VGCB 1GBMA 2ZCHP 3HATH 4MVNA 5EQQA 4ESTE 1PPZA 3M7QA 1CT4E 1S84A 1AGJA 3UOPA 1F0TA 1O3AA 4B75A 1H8DH 1HNEE 2A1DB 2BD7A 3QUMP 3BG4B 3B9FH 4I7YH 1BMLA 1MTVA 1O3MA 1CVWH 1NS3A 1WYKA 1AB9C 1C2HA 1CA0C 1BZXE 1GHVH 4ABFA 1ANCA 5IK2D 1ESAA 4ISLA 8GCHF 1VCWA 2TRMA 5ETXA 4YLUA 4WMDA 2VJ1A 3RXBA 3A7XA 4ABJA 3QK1A 1UCYK 1C2GA 1DXPA 2FTMA 3MH6A 4ABBA 3OTPA 3M7TA 3VB3A 2VWMA 1RIWB 2PSXA 3VXEH 5LH8A 2GGVB 2BY5X 1A4WH 1MAYA 2YNAA 1UHBB 4BTTB 3F9HA 5A8XA 1GL1A 1KDQA 1UTMA 2L74A 3K6ZA 1W14U 2ALPA 3U8OH 3MWIU 2PTNA 4BOHA 3SJKA 3RU4D 5DGJA 3DSPA 4XFQA 5JYIA 1KMHB 3DSOA 5FBIA 1H4WA 1GL0E 4NFFA 2CF8H 2J95A 2RA3A 2A2XH 3ZYEA 2JJ1D 3HGPA 4CBOA 1FPHH 2KFWA 5PTPA 1KTSB 2PHBA 8GCHG 2FLRH 1FJSA 3RXPA 3PMAB 1BTYA 1WTHD 2BD9A 5HGGA 3OSYA 3RXAA 4YOIA 1BCUH 1DLEA 2GDEH 2D1JA 1GBAA 2P8OC 2OC8A 4GVUA 1C1OA 1V3XA 1TRNA 3TVJB 5HXFA 2EA3A 2STBE 4TT3D 4VGCB 1SQRA 2BDCA 2F83A 2RDEA 4NZLA 4UFGH 4ZHMU 2XRCA 1SB1H 3MH7A 3RM0H 2Z3EA 1F5KU 1K9OE 3BTGE 1V2TT 2P16A 3SV6A 2XBVA 1YBWA 1BJVA 1QR3E 3CNRA 1GHAF 5FPTA 1PPEE 3WY8A 1Z8RA 2ZTXA 1MH0A 4MPXA 1N6XA 1QRXA 3ODDA 3VB6A 3HPTB 3DT0H 1NTPA 2Y7XA 3F2FA 5FAHA 3SYJA 2BX4A 3LGIA 4D9RA 1T8LA 5JBAS 2BD4A 1YGCH 1RGQA 1MZAA 3CENA 1WAYB 4AGJA 4KTUA 1PQAA 3SGBE 1K1LA 1O38A 4OM9A 3CS0A 3SORA 5J4QA 2XW9A 4OGYA 4DIIH 3A8CA 3SNCA 3ATKA 1L4ZA 1ZJDA 1FV9A 1HLTH 1AZZA 1YF4A 2JETC 3ZYDA 1T4UH 3T27A 3CS7A 1BITA 1G3EA 2OUAA 1GGDB 1C5OH 2ZNKH 2UUYA 4JZFH 2C8YB 1NZQH 2EI6A 1TONA 4RKOB 4M7GA 1Z6EA 1GHAG 3SO3A 3ATMA 1DPOA 2HNTE 4Z0KA 4ZKOU 2AIPA 3RDZA 3M5MA 3P8NA 1MAXA 1C4U2 1EX3A 4QT8C 1GHYH 2ZTYA 3Q76A 1CBWC 2F9NA 1P2IA 3L3TA 4MNYA 1C1UH 1ZPCA 2KAIA 1NESE 1UTNA 2BLVA 3BF6H 2FOGA 4KKDA 1D9IA 1E35B 1L2EA 1KXCA 3F0PA 4AFQA 1KXBA 2I6SA 1SGIB 3QX5H 4OS7A 4U32A 5FL7D 3ZVGA 2ZEBA 1RRKA 1RJXB 3I29A 4YTAA 1XXDA 2DE9A 3TGJE 4X6OA 5AHGH 3KYGA 4UD9H 4INHA 2VGCB 1Z8IB 2STAE 1ARBA 1UTLM 3F9GA 1WDIA 5F6MA 4CRBA 1ELGA 2CK3D 3U1IB 2BY8X 5F8XA 1W0KD 2DE8A 1HAGE 1TNIA 2XCFA 2W5EA 3GY8A 2QA9E 3ELAH 2GMTB 1YCPH 4FUEA 1MUEB 1CSOE 2Z3CA 2A7JA 1K1IA 1ZOMA 1ETRH 3A89A 2KZ4A 4FOUC 3DFLA 2M2AA 2VH0A 2WYGA 2ZQ1A 1TPSA 5DP6A 1KTTB 2P3FH 1LQDB 2JH6D 1QZ8A 4A5TS 2EY4C 1EUFA 4WMEA 4ASHA 2QF5A 5DO4H 2AGIX 5JBCS 5C94A 1TNHA 3M35A 5E0HA 2GV6A 3NWUA 1F2SE 3SW2B 1T7CA 3LJJA 3IITA 1IQLA 4X1QU 2FI3E 4BANB 2F9BH 1Y3VA 1O2OA 5LPFA 1TPAE 2XYAA 4INKA 2ZDAH 3GISB 1QB6A 1IQFA 2BY7X 4XSKU 1C2IA 5F53A 1FPCH 1GBIA 2O8WA 5CE1A 2WPLS 3MQKC 1P04A 1HRTH 1GI3A 3BTQE 1ZGIA 1MTWA 1F0SA 2BB4A 1OYQA 4JYVH 2PKAB 3A7ZA 2ZF0H 1G3BA 1ANEA 1KY9A 2ZDKA 5EW1H 5E0GA 1S81A 1UTOA 3V12A 4WXVA 1A5GH 1FN8A 1E0FD 2CHAB 4WY3A 1HGTH 3UPEA 2Y81A 5EIYA 1WOFA 3VB7A 2J98B 3Q3YA 3GYMA 4GHQA 4NG9H 5LPEA 1ZMJA 2BDGA 2OC7A 1THRH 1A0JA 4X8SH 1C2FA 2F3CE 2G81E 1ZPBA 5DK1A 1VJ9U 3BV9B 4TWYA 2UWOA 9ESTA 4IS5A 1O3HA 5CHAB 1JXPA 1O2YA 1O2WA 4XOJA 2WSSD 1NN6A 1VCQA 3SU2A 1A7SA 4NA9H 1FDPA 4CRCA 2FX6A 5ESBA 1O33A 3NXPA 3GICB 1SGCA 3PTBA 3RU4T 3RXMA 2ZCKP 4ABDA 4LZ1H 2FM2A 5C2ZA 5DP8A 4NIXA 3M5OA 3PB1E 4U2WA 1QY6A 3K2UA 1Y59T 4Q80A 1C1MA 2FYQA 1P57B 3GYLB 4K1EA 1GMHF 4RT0A 2PGQB 1O2GH 2Q6GA 1TRMA 5C1UA 2W7SA 3FZDA 4B6EA 4X1RU 5A09A 1HJAB 1FAXA 5DP4A 3AK5A 1YPEH 3UREA 3ATWA 5HIZA 3RXGA 2ZFQH 4CH8B 4Q63A 4OS2A 1W12U 5DG6A 2FIRH 1FX0B 1HJ9A 1D3TB 2ZKSA 4J1YA 2GT8A 4P00A 2K0QA 3F1SB 2ULLA 1SR5C 2D26C 3Q77A 1CHOF 1ELAA 2R0LA 3BG4C 2UUJB 2XBXA 4TSFD 2BLQA 4JCNA 4X8TH 3SU6A 1B0EA 4B2CA 1QL9A 2GX4A 4MLFB 1N8OC 2PUQH 1AFQB 2B5TB 3UAIC 1FY3A 2SGAA 1OP8A 2THFB 1GMHG 5JDUB 1NU7B 1VJAU 4J2YB 1T32A 2GDDA 2PKSB 3ZVAA 3GY4A 3ZZ7A 1WSSH 4KTSA 4X2YA 2G55A 1BRUP 3V0XA 1O3IA 1EZQA 4CHAB 2ZWLH 1S82A 4HFPB 3RU4E 2ANMH 4AX9H 3GDUA 3RMLH 2A5AA 3SHAH 2SFAA 3ZZ3A 5DKMA 5BRRE 1FY4A 4IN2A 1AE5A 2XNDD 1CHOG 1TNJA 1EB2A 2XOKD 2Z6BD 3F9FA 4FUFA 4IMZA 3FP8E 1P9UA 1BTHH 3GY3A 5F03A 2BD8A 2GJGA 2KCYA 3KNXA 1DITH 2SNVA 3F9EA 1JRTA 3QWCH 4YOGA 1QTFA 1C5TA 1J14A 4AZ2B 5E8EH 1AQ7A 3BTHE 2GZ8A 2H1UA 1NRSH 2JIZD 2GZ9A 1H1BA 4U01A 1VITF 1AKSB 3EE0B 4GUXA 5EJLA 3TH4H 3A8BA 1SGTA 1A3EH 4CREA 1E79D 1E37B 5EXMA 1THPB 1OSSA 2BHGA 3LDXH 3RXUA 3IG6B 4OS1A 1AY6H 2JH0D 3UQOA 1SOZA 4ZHAA 1T31A 2C8WB 2FLBH 4TPYA 3B23B 3M37A 2YMSC 3MFJA 1A0HB 5AFYH 2AGEX 2CF9H 3KCGH 2V6NA 9LPRA 3SUGA 1UTJA 2CV3A 2D8WA 1NPMA 1UVTH 1Y3YA 1Z8GA 1KXEA 1TBZH 2AHME 1KSNA 3GCTF 1GMCF 1FLEE 1HJ8A 6LPRA 3LGTA 3P8OA 4LXBH 1VITG 1O2TA 1OOKB 4X1SU 5EJ1A 2CMYA 1EPTB 1TB6H 1P3EA 2F43B 4XD7D 4E05H 1BBRK 1TBRH 1DM4B 1ELTA 5GDSH 2H9EH 2FX4A 2OC1A 3P92A 3O8RA 1RTKA 5F8TA 1EXFA 1P09A 2A5KA 2W6JD 3T25A 1C1RA 4YM9A 5T6GA 3A88A 4K8YA 4A1TA 1GI6A 5KECA 4O97A 2J97A 3E90B 1BBRH 4DURA 1O5GH 1BTWA 1GJAB 1SKYE 4K3JA 4YESB 1XXFA 2ZU4A 3A83A 5EW2H 3GCHC 2GCTC 4HG6A 1JRSA 1O35A 1LTOA 1GHXH 2ZU1A 3E0NB 5CHBA 4YT7H 1GMDF 4Y76A 1TPOA 1LPZB 1NFUA 4NWKA 1H9LB 5K0HA 2R3YA 3TNSA 1AMHA 5C0UA 2P95A 3TNTA 3GCTG 2UWLA 1HIAB 3FO8D 1DDJA 2A31A 2G5NA 1GCTB 3UNQA 1ELBA 3ATLA 1EFRD 1OWIA 4ZCNA 2XNIA 5DP7A 5C1YA 1SGDE 5EPNA 1UCYE 1ELVA 1YWUA 4BAHB 2VIPA 1QJ7B 5FBEA 1SOTA 1XX9A 1G3CA 3U28C 1WUNH 1ZLRA 3BEUA 1BRAA 2Y7ZA 2FOFA 2QY0B 3MU1A 3ATIA 1QB9A 1V2KT 2G4UA 3PO1C 5AVDA 1GMDG 2GMTC 1QL7A 5EG4A 3SUEA 3URDA 5HM9A 2NU2E 3LC3A 2FP7B 1AWHB 1YC0A 1EOJA 2HRVA 1C5NH 3KEEA 3SJ9A 4B73A 2JH5D 2ZCLP 3TK9A 4HZHA 1HUTH 2LNCA 4ZAEA 3UOUA 1P10A 3F3BA 5GIBA 1W3CA 4Q7YA 4X2VA 1J15A 4AGKA 2EI8A 1O5FH 1QIXB 1UK3A 1ZHRA 2AH4X 4XBCA 3MO9A 2Y80A 2VIQA 1NROH 1HAHH 1HPGA 2GCHF 2G8TA 2FESH 1WV7H 1OWDA 1ZMNA 3R3GB 2A32A 1GDUA 1V2VT 2BMGB 1QHRB 1Y8TA 2R2WU 2F9OA 1EZXC 1O37A 3PWCA 4E7NA 1YLNA 2H2ZA 1BHXF 5EQRA 1SGYE 5KEDA 1C5XB 3P6ZB 3SU4A 1D3DB 3LOXA 1OKXA 1PQ7A 3HKIB 3OY5U 3SJOA 3A7WA 3Q3KA 1JBUH 1DLKB 1E34B 1DY8A 1AU8A 1SHYA 3E16B 2PKAA 3PMHB 2EQNA 1ELEE 1O0DH 3W94A 1O2XA 2Y5GA 4WMFA 1TGSZ 5CMXH 1NO9H 5E2PA 2BZAA 3MHWU 1O3KA 4NIVA 4MDSA 5L2ZH 2C8XB 1HAXB 1C2DA 3D65E 1RD3B 2QC2A 3OE7D 4JZIA 2WPMS 3KQBA 1FIWA 1J8AA 3H7TA 1C2LA 3E1XB 1V2RT 1ELCA 3PLPA 8ESTE 1TE0A 2GCHG 5JBTA 3O8BA 3V13A 2UUKB 1V2OT 1ZGVA 3OYPA 2BY6X 1TGTA 4X6PA 2NU0E 1HBTH 4U30A 2Z3DA 1S83A 1NM6A 3M61U 1G36A 2FOMB 3M3VA 5A0BA 1SBWA 2YNBA 5IDKA 1DY9A 3UR9A 4ZMAH 2B8OH 2R3UA 3U98H 2IJOB 4D7GA 1IQNA 3RXKA 2TGAA 3VPKA 2KCAA 1MTNB 3GCOA 4FETA 1TWXB 4A92A 1GI8B 1IQIA 2BOKA 8KME2 1YLDA 1XVOA 1GJ4H 1O5AB 3E6PH 1G2MA 2GKVE 1LHGH 2ANYA 3KN2A 3RXEA 1ELFA 5C67A 2A7HA 1L4DA 3SV7A 4BAMB 2VVUA 3TJVA 1NBMD 2SGFE 2QXHA 4A1XA 5L6NH 1AVWA 4Y7AA 1GCDA 3UR6A 3GY5A 4RT1A 1WQVH 1MBMA 2ODPA 1O5BB 4K60A 4ZKNU 1TA6A 3GDVA 3SQHE 3S7HB 1ZYOA 1O2NA 4O03A 4B2BA 1QQUA 7KMEH 4NIWA 1OP0A 1GBFA 1GJBB 3VEQB 3SQEE 3U8RH 4B71A 4MNWA 1IHSH 1O2MA 2DUCA 2JKHA 4B2AA 2OK5A 1Y5UT 3M3TA 3TITA 2PV9B 4D76A 1WTGH 3LGYA 3PYHA 1EB1H 4YO9A 1UK2A 1FNIA 1P12E 4B74A 1OS8A 2PKSC 2ZPQA 4Y79A 1P02A 2BDBA 3RXOA 3KYFA 3MNBA 3FZZA 1FY8E 2CN0H 3QLPH 1PPHE 4DY7B 1UTQA 5EQSA 2SGPE 1LHDH 4RI0A 1PJPA 1AUTC 2D2DA 2AMDA 2ZZUH 3DHKH 1E38B 3T29A 3E91A 3A7VA 1QNJA 2QAAA 1E1RD 4X1NU 1GJ5H 3STIA 1F5RA 3OU0A 3UIRA 1EKBB 1LKAA 4X8VH 1PPGE 1BA8B 1E1QD 1F92A 3GY6A 4IMQA 3UB0A 1F7ZA 1PFXC 1OP2A 5E2OA 1O2SA
chains in the Genus database with same CATH topology
1AKSA 1GI2A 5TJXA 6CHAC 2HWLB 1XUKA 1IQHA 2QXGA 1K1JA 4AFUA 1TGCA 4H42U 1P9SA 2A4OA 3DUXH 4ZUHA 2BXUH 2J92A 1CE5A 1MU8B 1GBHA 1W13U 1V2QT 1SLWB 1TMTH 3TU7H 4GHTA 3NPSA 3VB5A 1O3FA 3GY2A 1P2KA 4Q7ZA 4WVPE 3L6PA 1ETSH 2FWWA 3EA8A 1SGFA 1F0UA 1YKTA 2A7CA 2P93A 5JBBS 3NCLA 3O8DA 5E0JA 2IOTA 1GBBA 3EA7A 4RSPA 1TLDA 1XUJA 2FZZA 3FFGA 2AFQB 1NRNH 1TOMH 2P94A 1ESBA 3ZZ9A 5L30H 1G2LA 3BTME 2B0FA 1RFNA 2FPZA 3SGAE 3RUOA 1DWBH 3RXVA 1EZSC 2TPIZ 3STJA 2XWAA 3RXRA 1PPCE 2ASUB 1SQOA 1YCPK 1BRBE 3QTOH 1TX7A 2BVSH 4HTCH 3VGCB 2RG3A 1SLVB 1BOQA 2ZPRA 1DSTA 3A81A 1NRPH 1GI4A 3RXTA 1IQKA 4AYYB 1Y5BT 2XC5A 1TALA 1KLJH 2AYWA 4CBNA 2ESTE 3SUFA 2CXVA 1XM1A 1BMMH 1O3BA 5FHTA 4K69A 1TABE 1DXWA 4NCYA 3MH5A 1FAKH 4GCHF 4MPWA 4UONA 1O3OA 1ZHPA 3ZVFA 5ESTE 1BT7A 1QQ4A 2FTLE 4IC6A 4F49A 2RCEA 1YPGH 1FQ3A 1SGNE 1THSH 3KQDA 2PGBB 1JMOH 4X2XA 4AYVB 1GHZA 5FCRA 4Y8XA 1MKWK 2J94A 1CGJE 2O8TA 1HAYB 5GPIB 1GVLA 2ZG0H 2SGQE 2WUCA 2BTCE 1KLIH 1ZSKA 1A5IA 1GG6C 4JZ1A 2ANKH 3LU9B 1BMAA 1MKWH 2H9TH 1TOCB 3DFJA 1O30A 2BXTH 4X2WA 1LVOA 4XBBA 1LPGB 2ZGHA 2PLXA 4GCHG 1AVGH 5GCHF 1Y5AT 1FXYA 1NRQH 4K1TA 1VR1H 1MCTA 2BD2A 4ZXYH 1CGHA 1DE7H 1P0SH 1WCZA 4Q2KA 3ZVCA 4ABEA 3M3SA 1NY22 1SMFE 1LO6A 4A1VA 3FANA 3ZZAA 1MCVA 2FI5E 2VVCA 2ZHDA 3M7UA 3RLWH 2BLWA 2WPIS 1GI1A 1NU9A 2BDYA 1AZ8A 1BJUA 1Z8JB 2C93B 1RXPA 1ZTKA 1SLXB 3MU4A 3ZZ5A 3TGIE 2ZI2H 3EYDA 1Z71A 1VZQH 1QRWA 1ZMLA 2QCYA 3TJUA 1PYTD 1C2EA 1W11U 1WBGB 1B5GH 4RN6A 1TRYA 4ABIA 2XBYA 1C5WB 3RXSA 4LZ4B 1T8NA 3S69A 5A0AE 2TGPZ 1BTXA 4GSOA 5GCHG 2ZHWH 1C5LH 3QO6A 1HAVB 3I78A 1O39A 3MO6A 4JZEH 4NSVA 5HMAA 1O2HA 1G37A 1BRCE 4FUIA 1P8VC 1XMNB 3A84A 1CA0B 3BTKE 1O36A 1VGCC 1AN1E 1D6WA 5IYTA 3PTNA 3TH3H 5G4BA 4IBLH 3A82A 4BTUB 2V0BA 3LKWA 1F0RA 3KGPA 2GP9B 5T6DA 1C5SA 1SI5H 3P8GA 3L33A 1EAUA 1QA0A 2FXRA 3HK6B 7ESTE 1V2JT 4R8TB 4O3UA 3Q00A 1GBLA 1H9IE 2OC0A 1K28D 4MNXA 3KF2A 2BOHB 3T26A 4NA8A 1BDAA 1HB0B 1UHBA 1C2KA 1RIWC 1P2NA 3K6YA 4UFDH 4BXSA 5FCKA 1CO7E 2ZFFH 4DVAU 2BD3A 4NGAH 5FPYA 1TFXA 4YOJA 1EJAA 4E06H 1LDTT 1V2ST 2TGTA 3KQCA 1KXFA 3LGWA 3UWJH 2WYJA 4B76A 2SGEE 2A2QH 4AORA 1V2NT 2P8OB 2BX3A 3LJOA 4Z6AH 1L1NA 3PV4A 1RTLA 1UJ1A 1GJDB 3OTJE 3I77A 4I32A 2ZDVH 4IC5A 5EGMA 3QTVH 3UUZA 1DWEH 2J34A 1N1LA 4Y0ZE 2OBOA 3MU5A 4INLA 1ANDA 2XBWA 3NK8A 3TJOA 1EQ9A 4OS6A 4R0IA 1LCYA 1PPBH 4VGCC 1IQGA 3SU0A 1MBQA 1GVZA 3T2NA 2ALVA 5FXLA 1PQ8A 1BTPA 1EJNA 3MNCA 3KL6A 1O3GA 5A0CA 1E36B 3VB4A 4WXIA 1M9UA 4DCDA 1TGNA 3ESTA 1GDNA 1G9IE 1YPHE 4SGAE 1TMUH 1KXAA 4ZHLU 5FX6A 1T8OA 1C4Y2 2HPQH 2H9HA 5HYOA 2QF3A 1O2JA 2ZGXH 2JETB 3BTEE 2QN5T 2QXJA 5I46H 4K8BA 3G01A 4Y10E 1KXDA 1EAIA 1GDQA 1ZSLA 4CR5A 4D9QA 2ZGBH 3JZ2B 4DW2U 1KIGH 2OQ5A 2Z9IA 5HM2A 4I8JA 3RXDA 4O9VA 1Z6JH 2GV7A 5A8YA 1YPLH 4TPIZ 3LGVA 1CBWB 1AO5A 2FMJA 1P05A 2V3OH 3ITIA 4NSYA 1EAWA 1GGDC 3E0PB 1YP9A 1FZZA 2Z94A 1ZTLA 5LPRA 1EOLA 2H6MA 3EQ0H 4ZKRU 2BYAX 2ZC9H 2PW8H 2F9PA 1AVXA 1UO6A 4BNRA 1O32A 3PMJA 4MNVA 1GJ6A 1S0QA 3MI4A 5TCAA 1ESTA 1UVPA 3SOSA 1TNGA 1AUJA 2O9QA 2ZIQH 1DFPA 3LGUA 1QRZA 4GAWA 1S0RA 3ZV9A 2F91A 1HCGA 2AMPA 1SQAA 1UTKA 3UFAA 3KQEA 2ANWA 4AG2A 1C1QA 2BZ6H 4K5ZA 4WJG2 1W0YH 2BVRH 5C5NA 1AI8H 2G4TA 4UDWH 3S0NA 2VGCC 3PMBB 2BDIA 3TPIZ 1ETTH 1D6RA 3PM3A 4ISHH 1TA2A 3VGCC 5JPMH 1DOJA 2Z7FE 4ABAA 1C1TA 1BB0B 1AHTH 1Q31A 3C1KA 4FU9A 1GBJA 2A4RA 1O3CA 1O34A 2OLGA 1FMGA 2NU4E 1ACBE 1BIOA 2WV4A 4YLQH 3LC5A 1S85A 2O8LA 4Y6DA 1C4V2 5EU8A 1ABIH 1Z1IA 1O31A 1OWJA 2ZA5A 2R9PA 2QV1A 4CRFA 3SU5A 1C5VA 1YLCA 2ZGCA 4BXWA 3AVZA 1K22H 2Z9KA 3A80A 3HKJB 3PWBA 1K1MA 1UVSH 1O2UA 2V3HH 1YPJH 2HLCA 1INCA 5DJ7A 5TCCA 2TBSA 3RMMH 1TNKA 1P2JA 3QZQA 2Z9LA 1L1GA 5A2MH 1GHBF 3T62A 1CGIE 3EA9A 1G32B 3QZRA 3QGNB 1HAPH 4B1TA 5A8ZA 2AS9A 1SGRE 2VIVA 3ZZ8A 2NU3E 1DANH 2A5IA 1SGEE 1YPKH 2ZO3H 2ZDLA 2XWBI 1TPPA 2CHAC 4ISOA 2WPJS 1W7GH 3LIWA 1SL3A 3T28A 3SNEA 3TGKE 1BMNH 2AEIH 1TNLA 1YPHC 4UE7H 2IPHA 3SBKA 2C4FH 4DGJA 1Z7KA 3AW1A 1IQEA 1GJ9B 1H8IH 2R0KA 2ZFTA 4Y0YE 5CHAC 4AG1A 1XUIA 3LH1A 4ZKSU 3DA9B 3BTDE 1G30B 4O3TA 1GHBG 3S9CA 3U1JB 4OGXA 1XVMA 2YOLA 3UNRA 4LK4A 4WH8A 1O3NA 2G5VA 2J38A 4X8UH 3TK6A 3MU0A 1JOUB 3BTFE 3E3TA 1HAIH 3UQVA 1HAVA 3UTUH 1EATA 7GCHF 1HXFH 3A87A 2VB0A 1V2MT 2AIQA 4NIYA 1QCPA 3D62A 4CH2B 1P03A 1HV7A 1HJAC 1O3PB 4I8HA 3HGNA 1LQEA 1O2QA 1C9TA 1N8OB 1OWEA 3M5NA 2ZQ2A 4AFSA 1O3DA 4TY7A 4XE4A 5K7RA 3RLYH 2Q6DA 1Q2WA 1C5UA 1A46H 4AB9A 3BIVH 2FS9A 3A85A 4WH6A 4D8NA 1EP6A 1UCYH 1B7XB 1P2MA 1AFQC 5BPEA 3SV2H 4I8GA 4JYTA 1UMAH 1SG8B 6ESTA 2B7DH 4H6SB 1P3CA 2J4IA 7GCHG 3RXJA 4FUHA 4DOQA 4AOQA 1S6FA 4Y8ZA 1O2KA 3SUDA 4MPUA 5DP3A 4LOYH 4IW4E 1A5HA 1FI8A 1IAUA 5EXLA 3BTTE 3QDZB 2HALA 1HAZB 2BQWB 1LVMA 1YCPM 1MTSA 2AGGX 3MNXA 4CHAC 1IOEA 3FAOA 1O2RA 1ZR0A 1F5LA 1TQ7B 4Y11E 4ABGA 2BY9X 3S9AA 1NC6A 1ZJKA 2M5TA 1OXGA 5JB9S 1P06A 6GCHF 1A2CH 3MYWA 5FX5A 1O2PA 1MD7A 3V7TA 1NRRH 5B6OA 2XTTB 1W10U 1HFDA 3TIUA 1K21H 4ISNA 4AFZA 2OBQA 1V2LT 1O5DH 1HXEH 4FUCA 2AERH 3MNSA 4CRDA 1QJ1B 4XBDA 1B0FA 1SHHB 2FS8A 3ZZCA 4HGCA 3LONA 1DSUA 2GTBA 4FU8A 4ZH8A 1Y3UA 2FO9A 4OS5A 4Y71A 1KLTA 1U6QA 1GI0A 1TQ0B 7LPRA 2RDLA 3RP2A 1CA8B 3BEFB 3GCNA 3IWMA 2A4GA 1WU1A 1RTFB 2PR3A 2NU1E 1ANBA 4DJZB 1NFXA 1TMBH 5I25A 1C1SA 6GCHG 4BAOB 2OP9A 1LHEH 2C3SA 2VWOA 2H5CA 1O3LA 3K65B 3SNBA 2K1QA 1SGPE 3RXCA 3ENSB 1O2VA 1LVBA 4YT6H 3NUMA 1ZHMA 2ZPSA 2ZFSA 1O3JA 4JYUH 2ZHQH 5AF9H 3U69H 4GPGA 1GWAA 2BVXH 1EPTA 2FOAA 1AWFH 2PWXA 1DT2A 4AB8A 3GCHB 2FYRA 2GCTB 4X1PU 1EPTC 2HGTH 3SNAA 3FP7E 1DX5M 1PPFE 2ZU5A 4FU7A 3NKKA 1K1NA 1L0ZA 5DP5A 1LPKB 2ZTZA 3M36A 1PYTC 4FUJA 1QBOA 1ARCA 1MU6B 1ZZZA 4RKJB 1C2JA 4NZQA 1O5EH 5DP9A 1XUFA 1SGFG 2VIWA 2F9VA 1HAOH 1HIAA 3JZ1B 1YPMH 3QN7A 3MU8A 1K1PA 3PROA 2ZHFH 4FXGH 4FUBA 1PQ5A 5C3NA 1GCTC 3P70B 1HDTH 1ZPZA 2O8UA 3A7YA 3PO1B 1KYNA 2WINI 1JIRA 1EJMA 3KIDU 3OY6U 4TYDA 1SSXA 3SJIA 1ID5H 2GD4B 1O3EA 1QB1A 4PROA 1TX8A 4KTCA 2F9UA 2Y82A 3SV8A 3A8AA 1FONA 3P17H 4IGDA 2ZFRH 2J2UA 2W3KA 4FUGA 4F4OC 2A45B 1BHXB 1IHTH 3FVFB 2PUXB 3S9BA 5FPSA 1MD8A 1OWKA 2W3IA 2PFEA 2NWNA 2VU8E 4A6LA 4JK6A 2GT7A 3AW0A 3RXIA 4ZXXH 3BTWE 1GVKB 1T8MA 4Y7BA 2BQ7B 2Q6FA 3RC6A 1DWCH 3KHVA 2OXSA 1ABJH 1GBEA 2TIOA 1Y3WA 2QGRA 2V35A 1XUHA 5L2YH 1BQYA 3U9AH 4KGAA 2FEQH 2XXLA 1SFIA 2ZDNA 5GJ4B 1JIMA 1J16A 3ODFA 3SHCH 2FI4E 1K1OA 8LPRA 1T4VH 5H4IB 4BAKB 1XKBC 2LPRA 2OCVB 4Q7XA 1FUJA 1XKAC 3UY9A 2FDAA 3GOVB 2EEKA 1GHWH 1P11E 2ZU2A 4CRGA 2J9NA 1A1RA 1AB9B 3ZVDA 1SLUB 1W8BH 2G00A 5C20A 1SC8U 2FOEA 2VINA 1BBRE 4I31A 1ZRKA 1IQJA 4SGBE 3GY7A 3QGJA 3BG8A 1CT2E 3ZVEA 2CGAA 1WQSA 3LH3A 1P2OA 1MQ5A 3RM2H 1LHCH 3NZIA 3U8TH 4A7IB 4BAQB 1DVAH 3P95A 3SNDA 4H6TA 2AMQA 2ZDMA 3BEIB 1JWTA 2IN2A 1A61H 2QIQA 2HNTC 4X6MA 4Y8YA 1MTUA 1IQMA 2VVVA 1MTNC 1KDQB 4FUDA 2HNTF 4FVDA 2GVFA 2H5DA 2P3UB 4KP0A 3AASA 5DPAA 4I33A 2OTVA 5JB8S 1G3DA 2ZP0H 1OX1A 4FVBA 1C1PA 4JMYA 2UUFB 1CU1A 3H5CB 1QBVH 3E8LA 2UWPA 4H4FA 4K2YA 1ZRBA 2OQUA 2EI7A 3Q3XA 3SV9A 3SU1A 1AFEH 4ABHA 1LKBA 1BTUA 2C90B 2HPPH 4HI3A 4NWLA 1SGQE 1ZTJA 4K1SA 2Y5FA 1Y3XA 3TH2H 1L1JA 3ZZDA 5LGOA 1OWHA 2SNWA 3VXFH 4D7FA 4XDEA 3TLOA 2BLOA 3ZZ6A 1VITH 4TWWA 2FOHA 1TX6A 5GWZA 1K2I1 1A0LA 3SI4H 3SJ8A 2TGDA 1TBQH 5F8ZA 1Q3XA 1CT0E 1MKXK 1SFQB 1GBCA 1V2WT 1QFKH 1GI5A 1GBKA 3URCA 4CR9A 1FN6A 4MQAA 2O8MA 1C5ZB 1YM0A 3BSQA 1MKXH 2EC9H 3N7OA 5SGAE 3OX7U 1GI7B 3K9XB 3S7KB 3VFEA 5T6FA 3O8CA 2ZFPH 1TGBA 1V2PT 1AD8H 6CHAB 4I8LA 2BM2A 3SI3H 1S6HA 3GDSA 2ZU3A 3TK5A 3H7OA 2A0QB 1GJ8B 3EAJA 3A86A 3ZZ4A 3SZNA 1V6DA 4X0WU 1SPJA 1V2UT 1S5SA 1DS2E 1AIXH 1LMWB 4KELA 3T5FH 1TIOA 3RC4A 1FIZA 2Y6TA 2B9LA 5J4SA 2ILNA 1C5QA 1NFWA 1D3QB 1TYNA 1D4PB 3MTYA 2BDHA 3LPRA 1RS0A 1BUIA 1GBDA 1EAXA 1C9PA 3D23A 3MH4A 2WV5A 3MO3A 3PLBA 1C1VH 1W7XH 4TY6A 4CRAA 1CQQA 4OS4A 4DT7B 1J9CH 3A8DA 1O5CB 2KAIB 4E7RG 1O2ZA 1MQ6A 3B8JA 1UVUH 2VWNA 1AE8H 4GLYA 3V3MA 1D3PB 3MMGA 4MTBA 1P2QA 3HK3B 1SVPA 4UEHH 4WWYA 1FY5A 1EP5A 4WF8A 2P3TB 1GJCB 2VWLA 3A7TA 1QBNA 3CP7A 3SN8A 1N6YA