3V7TA

Crystal structure of human beta-tryptase complexed with a synthetic inhibitor with a tropanylamide scaffold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A beta-tryptase inhibitor with a tropanylamide scaffold to improve in vitro stability and to lower hERG channel binding affinity
pubmed doi rcsb
molecule keywords TPSB2 protein
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v7tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v7tA01
5B6OA 3H5CB 1ELTA 1O2LA 1Z6JH 3SV9A 1FY5A 3ELAH 1TMUH 1DM4B 2J95A 1TMBH 1C2IA 2V6NA 3QWCH 1HRTH 1BTXA 4B71A 5DP5A 5AFZH 3I29A 1QFKH 3LJJA 1O2JA 2ZQ1A 2FZZA 2RA3A 1LMWB 4NA8A 1FV9A 2A45B 1FLEE 4X1NU 1HAOH 3UFAA 3N7OA 3ZZCA 1TGBA 4ISHH 1RGQA 2H9TH 2IOTA 2PLXA 5I46H 4ZKNU 3U8OH 1GJCB 2GX4A 3GY7A 3RXMA 4OGYA 1JBUH 1PPFE 1LPKB 2BD4A 2FM2A 1TOMH 1Y59T 1G36A 2BY7X 1K1OA 2GTBA 4FUEA 4DY7B 1P10A 3BSQA 3K9XB 2AIPA 1O32A 1SGQE 4LZ4B 2A7CA 2UUJB 5E2OA 1GBIA 1DPOA 3MOCA 2FDAA 3IITA 3RU4E 4GPGA 3UOUA 3K2UA 4KKDA 3BTGE 2AGEX 5I25A 2VINA 3P8OA 1BTYA 2HOBA 3GCHB 3TK9A 1DANH 3Q77A 3DHKH 1HV7A 2Z9IA 1ZPZA 5G4BA 2VGCB 3O8BA 1IQKA 1IHSH 5HYOA 3WY8A 2GCHF 3PMHB 1P3EA 2ZDVH 2O8MA 3CS7A 4ZKSU 4ABHA 1TX8A 1GJAB 1J9CH 1RTLA 2PKAA 3SU2A 1J17T 1IQMA 4AG2A 1EOJA 4CH8B 3UTUH 5C67A 1C1PA 2GT7A 3PM3A 3T2NA 4B75A 1ELCA 1GHWH 2DUCA 2B7DH 1PQ7A 3RXTA 4HI3A 1F92A 3LIWA 5EGMA 4B76A 1UTJA 4AGJA 1MKXK 4IC6A 4FUCA 3SI3H 5CE1A 4BAQB 4ABFA 1ZSLA 2FXRA 2OC1A 3OU0A 4XSKU 1NFUA 1ZMJA 1O3HA 4DOQA 4FU8A 4HFPB 1IQNA 4NIYA 2VIDA 2BQ7B 1GHBF 1BTHH 1EJMA 1K1MA 4OS4A 3FP8E 2XW9A 1UO6A 3MI4A 5HMAA 1E38B 4E7NA 2Y7XA 1ELFA 1GHVH 1GHZA 2W7UA 3V3MA 4K3JA 3A7XA 1VITG 2O8UA 4U32A 4AORA 5JPMH 1W0YH 1GI8B 3MNBA 1S81A 1TALA 1S6HA 2SGPE 4B2BA 1SGFG 1ANEA 2VH0A 3GY6A 1UVTH 2PTCE 1C2JA 4FUHA 3T5FH 1ZRBA 2CF8H 3T62A 3DFLA 1UVPA 4WF8A 4WH8A 2A5IA 5EW1H 1GDUA 4GCHF 4E05H 2XC0A 3K6ZA 1YCPM 2F9BH 1PPBH 3RDZA 3M36A 5L2ZH 2XBXA 3NPSA 5F6MA 1BB0B 2OCVB 1GBLA 3M5LA 4K60A 3E16B 5EQSA 5J4SA 3PYHA 3GCTF 4JK6A 1ANDA 2WUCA 1WCZA 4ZH8A 1GBAA 1MAXA 1LHCH 1Y8TA 2XTTB 1SQOA 2XC4A 3TITA 1SQTA 2G81E 2J94A 3A7YA 1XUHA 4NFEA 2VJ1A 1SFIA 1O2HA 3MTYA 4XE4A 2R2MB 3F9GA 1O30A 4ZROA 2PKSB 4INHA 2ZQ2A 1LPZB 3LPRA 1S0RA 4NA9H 1WUNH 1AIXH 2FS8A 2EC9H 3SV7A 2GKVE 3DA9B 2Q6DA 1C4U2 4Y71A 1AFEH 5GDSH 1YKTA 2PUQH 1ANBA 1JMOH 4BAMB 3M7UA 2FOFA 1E34B 1P05A 1C1MA 1C5UA 1F2SE 3U8TH 2TGTA 1EP5A 4YM9A 1LHFH 1O3EA 1O5AB 2BLOA 4OS2A 5DP9A 2ODQA 3TIUA 2GCHG 1JIRA 1O3DA 3AVZA 3BF6H 2WV5A 1TNIA 2RDLA 1RIWC 2SNWA 1LKBA 2XC5A 3H7OA 3LC5A 1C5VA 1ZTJA 5J4QA 2FI4E 1Z6EA 2C8WB 1SGTA 4I8KA 1CGHA 3CENA 4ZHLU 4H4FA 3SNDA 5A0BA 2EI7A 1MAYA 4UFFH 1EPTA 1MTSA 3RC5A 3QTOH 3O8CA 1BTZA 2WPLS 3A8BA 1T32A 3GYLB 1A46H 1KSNA 1YPKH 1ZPCA 1GBBA 4I32A 1HAVA 3RC4A 3M5OA 3EYDA 2A7JA 3TNTA 3MH6A 1FY3A 4MQAA 5DP6A 2ZU1A 4FVBA 1TQ7B 1K1PA 3FZDA 1GHBG 1A5IA 3RXGA 1HJ9A 1FIZA 2H9HA 1WBGB 1KLIH 1J15A 3BN9A 1QR3E 1EAIA 1LHEH 1UVOA 3PLBA 3AASA 1E35B 3D49H 2ZKSA 5LH8A 1BQYA 2CMYA 2C8YB 3MFJA 1B0FA 4JZEH 5A0AE 3FANA 3KGPA 3VXFH 1A7SA 3V7TA 1FUJA 1WQVH 2FTLE 1Y3VA 1Z1IA 1ZTKA 1KXBA 1SFQB 2ZGHA 1SHHB 3PLKA 5JBAS 3TH4H 1QQ4A 3HKJB 1H8IH 1QRXA 3RXOA 7ESTE 4KELA 4GCHG 2ZGCA 1C5TA 1GHAF 1BIOA 4FUFA 3HPTB 2BTCE 4F49A 1RIWB 1YPGH 4BTIB 1LTOA 1DSTA 4ISLA 2B5TB 4X1SU 1E36B 3ZYEA 2YOLA 1LVOA 1K1NA 5EXLA 1C1VH 2ZNKH 2ZO3H 1LQDB 1KXAA 1SGYE 2GMTC 3RU4T 1XX9A 2ZCLP 1QCPA 3UNSA 1ZHRA 4CR9A 6CHAB 4IGDA 4H6TA 1P11E 1T4VH 1C5RA 1D9IA 1SGFA 2R0LA 2RCEA 2Y5FA 3LH1A 8KME2 1AN1E 4IN1A 5DPAA 1O2SA 4XBCA 8LPRA 4BNRA 2BD2A 1XKBC 1JWTA 4DT7B 1QL8A 4D7FA 1MBMA 1DXWA 3VB7A 4BTTB 3SGBE 2G5VA 3FAOA 3E6PH 3GY8A 1C9PA 1C2GA 1D3PB 2BX4A 1CHGA 2Y5HA 1IOEA 1G2LA 2VVUA 2HVXA 3M7TA 5HM2A 2C3SA 2ZC9H 5EOKA 3RMOH 5FXLA 1T8NA 5EQQA 1O2RA 1BBRH 4ISNA 4CH2B 5GWZA 2JKHA 2XBVA 1RJXB 1ZZZA 1F7ZA 1JXPA 1NTPA 1K22H 2A31A 4DVAU 4JZDH 2OINA 2GD4B 1D3QB 3UY9A 1FDPA 1ZJKA 1AHTH 3P8GA 1SLXB 2B9LA 1O2ZA 1DWDH 1O3OA 2ZFTA 2DE8A 1BA8B 4I33A 3TJOA 1P2JA 1HUTH 2WINI 3RC6A 2PKAB 3URCA 1BTPA 1HXFH 2Z3CA 1MMJN 1O3NA 3SQEE 3U69H 1AWHB 1O5GH 1HAXB 1CVWH 1Q2WA 4NFFA 3RXSA 1C5ZB 5A8XA 4ZXYH 1CBWC 1QBVH 4Q7YA 4U01A 2F83A 1CT4E 3FZZA 1IQFA 3SUDA 1C1TA 4Y0YE 1ANCA 5F8TA 5EPNA 3EE0B 4K1EA 2PV9B 2F9UA 2PGQB 1FY4A 1LCYA 1O3IA 4IS5A 3E0PB 1AFQC 4X2WA 2PTNA 1W12U 2EI6A 2QN5T 1EAXA 5DP4A 3L33A 3VPKA 2BVRH 3F1SB 1DDJA 1NRPH 2QGRA 3TNSA 3EAJA 1AB9B 1HBTH 3AW1A 2GZ9A 1G3CA 1PPEE 2GZ8A 2W5EA 3DT0H 3RXKA 3E1XB 4HTCH 2V35A 3SGQE 4MG3A 1V2MT 1O3LA 1KTSB 3ZV9A 2R3UA 1OWEA 4A6LA 1GDQA 2AYWA 3EA7A 3VB5A 1W14U 1PQAA 2Z9JA 2BDIA 1GHXH 1ELEE 1KYNA 2HWLB 2C93B 1WSSH 1QIXB 3R0FA 1CSOE 2XNIA 1ACBE 2WPJS 1GG6C 2BY6X 1MU8B 1ELBA 1GHAG 4MPVA 1AU8A 3SJIA 4FUBA 5C1YA 2BY5X 2Y5GA 4ISOA 1O3CA 4Z0KA 1BTUA 1O2GH 1MU6B 2GGVB 4FXGH 1SLWB 1VR1H 2G5NA 1XMNB 2FLRH 1JRSA 1P57B 2H1UA 1FJSA 2VIOA 1EPTC 4MNWA 2FOAA 3MO6A 5FPTA 1W7XH 2FMJA 1F5LA 1K1JA 3HKIB 2PFEA 3ZZ4A 2HRVA 2P3FH 1TLDA 2UWLA 2ALVA 1VJAU 2BXUH 4XBDA 5C20A 1MCTA 5DG6A 1FZZA 3R3GB 5L30H 9LPRA 1BHXB 1L1JA 1HIAA 1P2NA 2P93A 4TPYA 2ZDMA 1RTFB 5HGGA 2FESH 1TGCA 4GUXA 5TCCA 2J2UA 2VNTA 3SQHE 1SSXA 4NIVA 1O3BA 4X6NA 3VGCB 2GCTC 5EODA 1V2PT 4YT6H 3QGNB 1N6XA 1SGEE 1TPAE 3SOSA 4KTSA 2GT8A 4ZKOU 1O2QA 4NIWA 4UFDH 1GMCG 1GBKA 3PWBA 3AW0A 1MUEB 4Z6AH 1EATA 2EEKA 4JZ1A 4FUGA 1W7GH 1AE5A 4DG4A 1NESE 5GCHF 1P06A 2OBOA 2ZGBH 3NWUA 2UUFB 2F3CE 1O2VA 1MH0A 1U6QA 1OKXA 1YLCA 3STIA 4AB8A 2FOCA 1SGRE 3KN2A 3RP2A 3V13A 1WTGH 2B0FA 1EZXC 2ZWLH 3SW2B 3SHCH 1X7AC 2XRCA 1A0LA 3URDA 2ZTXA 1EPTB 1QGFA 1SOZA 5E0JA 1TB6H 2WPIS 1YYY1 1DY8A 2HNTF 1YF4A 3JZ2B 1L1NA 3UQOA 3SBKA 1HAVB 1L1GA 2OQUA 1INCA 4UE7H 4BAHB 1O3JA 2HALA 3T27A 3U98H 4MNXA 1GWAA 1CQQA 1AKSA 3SU3A 1FPHH 3LGVA 4HZHA 1A4WH 3VB6A 4ABDA 3P70B 3ITIA 5FAHA 5K7RA 3BTTE 2C90B 2R2WU 3D65E 1SGCA 5FCKA 3SHAH 4YOIA 3UNRA 2HGTH 3NK8A 3C1KA 2AGGX 1O5BB 2HPQH 3SU1A 1YPMH 2GCTB 1NN6A 2J4IA 1C5WB 4D9QA 1O5EH 4ESTE 5SGAE 2BLVA 4BOHA 1GPZA 1HGTH 3SI4H 1KXDA 1BRUP 3A87A 2OQ5A 4HGCA 4R8TB 4AZ2B 1PFXC 3PV4A 3C27B 1GVZA 3TK6A 1FONA 2ZZUH 1ZTLA 4A7IB 2H2ZA 2ZTZA 2P95A 1C1WH 1BTWA 2ZFFH 1AE8H 2OC7A 3GYMA 3RM2H 2D1JA 2ZDNA 3RMNH 2BD5A 3NKKA 2TGDA 3QZQA 1DWCH 1P3CA 2V0BA 3UWIA 1IHTH 1TGSZ 1WYKA 3KQBA 2NU2E 1LKAA 1JRTA 1K9OE 1V2RT 1TWXB 2V3HH 1JIMA 4B2CA 1O5CB 1YPEH 1VITH 3DD2H 3SJ9A 2R3YA 2NWNA 2ANWA 1ZSKA 2A4OA 1UVSH 3LU9B 2IJOB 3A7ZA 1NRSH 5FX5A 5LPFA 3ODFA 4UD9H 3KIDU 1P2QA 3PMAB 5EXNA 3RU4D 1QB1A 3BEIB 1HAHH 4IN2A 3RLWH 3MO3A 1C2LA 1YP9A 2ANKH 1TGTA 4BANB 1S85A 4Y79A 4NSVA 4LK4A 3OY6U 1ARBA 3SU5A 2Z94A 3PTNA 3ZVAA 1BBRE 1A5HA 3E90B 4YESB 1ZOMA 1EAWA 1ZSJA 2ZPSA 5FBIA 1EKBB 3BTWE 2J38A 3ENSB 5JYIA 1BMMH 1QJ6B 2PKSC 1DUAA 1ZJDA 2TGPZ 4MPWA 3I78A 5GCHG 1TBZH 3FVFB 2Q1JA 3PMJA 3SO3A 4D76A 4BXSA 2PWXA 2VB0A 2XYAA 3T28A 2AEIH 3TJVA 4ZUHA 5H4IB 3ZVFA 3GY5A 1SL3A 7LPRA 1OWHA 5AVDA 8ESTE 1C1SA 5DJ7A 5T6FA 2UUYA 1C9TA 3Q3XA 1MQ6A 3L3TA 1OXGA 2QA9E 1KLTA 1YCPH 3OX7U 4MPUA 2AFQB 3Q3YA 1ESAA 1NROH 1ELVA 1OP8A 2ZGJA 4X8VH 1HDTH 1V2JT 1XUFA 1GBEA 1C2KA 4SGAE 4INKA 1GL0E 1MQ5A 4WVPE 2F9VA 1WAYB 3RXEA 4X8SH 2R0KA 2FIRH 3RLYH 2NU0E 4YZUA 1G9IE 1IQHA 3A86A 2ZCHP 1BZXE 4I8HA 1ZPBA 3T25A 5DP7A 4E7RG 4AOQA 1N8OC 1GCTB 2VU8E 1F0RA 1C1OA 3PMBB 4ZXXH 4YOJA 3NUMA 3ZYDA 2O8WA 1PYTD 3HK3B 3HGNA 4CR5A 4D9RA 1J8AA 1NRRH 1UTKA 2BD3A 3STJA 3OYPA 3AAVA 3MU8A 1V2ST 2Z9LA 1W11U 5C5OA 2BX3A 1NC6A 2RG3A 1HCGA 1HB0B 4K2YA 1Y5AT 3UWJH 1P2MA 3QO6A 1J14A 4CREA 3K65B 1CO7E 4CBNA 4X2VA 1NFYA 1C5MD 2ALPA 3F68H 3ZZ5A 3ZVGA 3RM0H 3QZRA 3RUOA 1O35A 1XUKA 3CP7A 2FWWA 1SI5H 2XWAA 3A8CA 2FX4A 1UTOA 4X6PA 2F91A 1C4V2 1GMHF 2F9PA 1KY9A 1OSSA 1BUIA 4WMFA 3GDVA 1BT7A 1GJ7B 5ESTE 2H5DA 1MKWK 1C2DA 1NFWA 2ULLA 1SPJA 3FP6E 1O39A 3UIRA 4BXWA 2DE9A 3ZZBA 3BTHE 4B73A 2VIVA 4DW2U 1Y5BT 4K1SA 1GCDA 1TNKA 3E8LA 6GCHF 3U9AH 3GDUA 1HIAB 3DFJA 7KMEH 2M5TA 1T4UH 2B8OH 1Q3XA 4ABGA 2BQWB 1CA0C 2EI8A 1N8OB 1AO5A 1NRQH 3ODDA 3ZZ3A 2JH5D 1MD7A 4Y8YA 2A2QH 6CHAC 2FO9A 5JDUB 5DGJA 1GBHA 1TGNA 1W10U 2PW8H 4E06H 4Y10E 2OD3B 1C5SA 1OWDA 1LO6A 3A84A 4NG9H 3K6YA 5F03A 3RXIA 2BY8X 1QA7A 1A2CH 2XXLA 2G4TA 3KL6A 1V6DA 3AAUA 1GBJA 1RXPA 3F6UH 5JBBS 3MWIU 1V2VT 3IG6B 2Z3DA 1O3GA 1QHRB 1KDQA 1ESTA 1E37B 1Z8GA 1FPCH 2ODPA 2VIPA 2WYJA 1NT1A 1O2PA 3QDZB 1P9SA 1G32B 1DT2A 4O3TA 1FIWA 4YOGA 4BTUB 1E0FD 5FBEA 2ESTE 1XUGA 3U1JB 3PWCA 1G37A 1P01A 1QRWA 5GJ4B 3TU7H 1Z8IB 8GCHF 2ZI2H 2SGEE 1FY8E 2C4FH 4NIXA 3GY4A 2BD7A 1QJ1B 1UHBA 4THNH 2AS9A 1O0DH 4Y0ZE 2BOKA 4NSYA 3TK5A 2ZF0H 1XVMA 1AKSB 3E91A 3P95A 3RXCA 3BTFE 4GHQA 3GCTG 1UTLM 1EAUA 4O9VA 3LDXH 2QXHA 2BDGA 2A7HA 1CA0B 3QUMP 3TPIZ 3A81A 3B8JA 1C5YB 3P17H 4O3UA 1Y3WA 3VB3A 4MTBA 1OYQA 5E2PA 1C4Y2 3RMLH 1O37A 4I8GA 1CU1A 4X6OA 2D8WA 2IN2A 1V2OT 1GVKB 1H9IE 2VWLA 1QJ7B 1H8DH 3RXLA 1SR5C 4RSPA 1SGPE 3BV9B 3O8DA 3O8RA 1AB9C 2QIQA 3CS0A 1QRZA 1O31A 1ABJH 4GVUA 1HAYB 3PO1C 1TOCB 5L2YH 1AGJA 2A5KA 2FI5E 2BHGA 2BXTH 3H7TA 1A1RA 1GMHG 2GP9B 1TRMA 2FI3E 2UWPA 1PPGE 4KP0A 5PTPA 4XBBA 1QL9A 1YPHC 1O2UA 2HLCA 1H9LB 1V2QT 1BJUA 3PROA 1AZ8A 1GGDB 4A1VA 2BQ6B 4IW4E 1GBDA 1FN6A 5EU8A 1O2NA 1D3DB 3GCNA 1HJAB 2D26C 2VIQA 4CRCA 1GBTA 6GCHG 2THFB 2QF0A 3ATMA 3M37A 1TX7A 1TPSA 1V3XA 1QTFA 2JETB 4X1QU 1VCWA 1V2LT 1TRNA 1DWBH 1GJ5H 1C5QA 2PHBA 4Y76A 3SJKA 1EXFA 4FU7A 3LH3A 1QURH 1Z8JB 2G4UA 1D3TB 1MZAA 1EJNA 2W3KA 3SU6A 2Z9GA 3EA8A 1O3MA 3MU0A 3GY3A 5HM9A 2ZP0H 4ABEA 3KQCA 2NU1E 1YCPK 4FVDA 1BMAA 1F5RA 1V2KT 4O03A 2OUAA 1MKXH 2QCYA 5ESBA 3S69A 3KQDA 3UR9A 3W95A 2Z9KA 3GCOA 1O36A 2AMQA 1RFNA 2CHAB 5F8ZA 4X6MA 3SU0A 2C8ZB 2J92A 3VGCC 3LOXA 1T31A 4DURA 1EZSC 3ZVBA 1F0SA 2BYAX 3BTME 3M5MA 3U8RH 2F9OA 1NM6A 3PO1B 1EB1H 4I8LA 1H9HE 1TNLA 1AY6H 3F9HA 1XXFA 2VWOA 1LPGB 1XKAC 3E0NB 4AX9H 4OGXA 2P3TB 1C1NA 1S83A 4UFEH 3SUGA 2W3IA 1Y3XA 1XVOA 1ESBA 1NPMA 2SFAA 4OS7A 3TJNA 1NS3A 2KAIA 2AH4X 3S9AA 3RXDA 2ZCKP 4FUJA 2P16A 7GCHF 2ZEBA 2AIQA 1PQ5A 4B74A 4AFUA 3VB4A 1XUJA 1Y5UT 3S7KB 4ZHAA 1EJAA 4MNVA 1O2KA 1AWFH 3V12A 1FAKH 2A4QA 2A4GA 4VGCB 4WXVA 1L2EA 3EGKH 1SG8B 5C2ZA 3UR6A 1TBRH 2BOHB 1VJ9U 1G2MA 3UPEA 3UNQA 1DOJA 1UTNA 2ZU2A 2BDBA 4X2XA 1GI9B 3T26A 1HAGE 2NU3E 4JZIA 4X2YA 3GDSA 4MDSA 3M3VA 1V2WT 4YLUA 4FUIA 2FOHA 4K5ZA 1C5XB 1OWJA 5F8XA 2BDYA 1C5PA 2FOMB 1NU9A 1TAWA 5FPSA 5TCAA 4A92A 5LPRA 3ZZDA 5DK1A 1O2YA 3BIUH 1O5FH 1QBOA 2CJIA 2G52A 3QTVH 1ETSH 6LPRA 2ZDKA 4INLA 1VGCB 4AN7A 1MTUA 1V2NT 2BDCA 3GOVB 5FCRA 3I77A 4X1RU 2CXVA 3RXVA 1P8VC 2STBE 4Y7AA 3TGIE 3PLPA 2LPRA 5A2MH 1SOTA 2H5CA 2ZHQH 3UOPA 4I7YH 1MZDA 4WH6A 1KXEA 2TBSA 2CGAA 1RD3B 4NA7A 2OXSA 1FMGA 2QYIA 1ELAA 1HAIH 1TNHA 5TJXA 4TY7A 1ELDE 1YPJH 2BVXH 2WPKS 3HK6B 1FY1A 1WQSA 3P6ZB 1V2TT 4H42U 1Z7KA 3EA9A 1BRCE 3MMGA 1FAXA 3ATIA 5A8YA 5IYTA 2QXIA 1TIOA 2P3UB 2VVVA 2BLWA 3D23A 1VITF 5DKMA 4OS6A 4D8NA 1GI4A 1BRAA 2H9EH 3MHWU 1BMLA 2HNTC 3BG8A 3A89A 1P2IA 2ZG0H 3A88A 4JZFH 4TYDA 1AI8H 3LONA 5CHAC 3KCGH 5C1UA 1C1RA 1F0TA 3ZZ8A 2ILNA 4RKOB 1OP2A 5FPYA 3U1IB 1O2XA 1C2FA 4DGJA 4YO9A 3LT3A 1KDQB 2O8LA 3NCLA 1SB1H 2FX6A 1IAUA 2VWNA 3M61U 1QL7A 1MTNC 3LC3A 1P2OA 3NXPA 2R9PA 1LVYA 4YTAA 3S7HB 2TGAA 3PTBA 2G8TA 1ZGIA 4CHAB 1D4PB 4OS5A 2K1QA 3OTJE 7GCHG 4NWKA 2WV4A 1GJDB 2OC8A 1LHGH 3MNSA 1UHBB 1XUIA 1DLEA 3MU4A 1ZLRA 1DS2E 3MH5A 1GJ8B 1T7CA 3SNAA 3VEQB 2SGFE 5JB9S 2GVFA 3RXFA 4RN6A 3A83A 1O2IA 1G3BA 4IBLH 1H1BA 1B5GH 4AFQA 1AMHA 1TMTH 4OS1A 1P02A 1CE5A 3ATWA 2Y80A 3RXQA 1HFDA 3GY2A 2AMPA 2BZAA 2HPPH 1ZRKA 1BBRK 1GJ9B 1P03A 1B7XB 1BRBE 3LGWA 1TBQH 1EQ9A 2A5AA 1N6YA 3BEUA 1W0ZU 2BZ6H 1GCTC 2QY0B 2FOBA 2WUBA 4CRBA 3Q00A 1DSUA 1T8OA 3B9FH 3ZZ7A 1K28D 1W13U 5FHTA 4AYYB 1C5OH 5CHAB 5AFYH 1A0JA 2TPIZ 1F0UA 1Z8RA 2WPMS 1SQAA 2QAAA 1IQGA 1AVWA 2FPZA 3MH4A 3QN7A 4LXBH 3A7VA 2FYQA 2A4RA 5JBTA 3A80A 3ZZ9A 1RRKA 1IQJA 4Y7BA 2P8OC 1AQ7A 1MTNB 4Q7ZA 1BDAA 4NWLA 1EB2A 1JOUB 5T6DA 4GHTA 3M35A 3TLOA 2YNBA 3KEEA 1MD8A 2H6MA 2FLBH 4SGBE 1SGIB 3D62A 4IMQA 2ODYB 1DXPA 1GHYH 1WV7H 3KHVA 4Q80A 4DIIH 3LGYA 2JH0D 5AF9H 9ESTA 1SVPA 4ABAA 4MPXA 4IC5A 3UQVA 1QNJA 1TNJA 5DP3A 1CHOF 1GBMA 3Q3KA 1GI5A 4ZKRU 1VZQH 3ATLA 2QF3A 4AYVB 1OS8A 1TRYA 2G00A 4Y8XA 2G55A 3VFEA 1UCYH 2LNCA 3OSYA 3PB1E 3A8AA 1ARCA 4JMYA 1LQEA 1SLVB 1EZUC 3MU5A 1GDNA 1DFPA 3RMMH 5ETXA 1Z1JA 3BTDE 3RXHA 1K1IA 3SN8A 1GI1A 1EZQA 5EW2H 5C5NA 4TWWA 5BRRE 1UTMA 5JBCS 2RA0A 1THRH 1F5KU 3ZVDA 1MCVA 1YPHE 1OWIA 2ZHEH 1GI2A 3M3SA 4XOJA 4ABBA 1DY9A 2P59A 4U2WA 5L6NH 3V0XA 3SGAE 4DIHH 2Q6FA 1GJ4H 2BLQA 3SNCA 2CF9H 1P2KA 1P0SH 1TNGA 1YPLH 2SGAA 2ZFQH 1CT0E 1NY22 3QGJA 3SU4A 1O34A 1AUJA 2P8OB 2BM2A 4H6SB 5C3NA 2J34A 1J16A 1BCUH 2UWOA 2ZPQA 1MTVA 3BEFB 4Y8ZA 2OP9A 3A8DA 4LZ1H 2BY9X 2KAIB 2ZGXH 1UJ1A 2QC2A 4TY6A 2V3OH 3MU1A 4IMZA 1CA8B 5E0HA 1ETTH 2ASUB 5ABWA 4UEHH 2OC0A 2XBYA 1Z71A 3SUEA 3SUFA 4GAWA 4LOYH 3BTQE 1HYLA 1IQIA 2ZTYA 1UVUH 4WMDA 3P8FA 1M9UA 4CRDA 1UTPA 4WY3A 1ID5H 1TA2A 1LVMA 5EQRA 1TX6A 2WYGA 1QY6A 1O3AA 3EQ0H 1YBWA 1NFXA 2ZFSA 1HAZB 3SV2H 1O3KA 3P8NA 2GZ7A 4AFZA 2GDEH 2PSXA 5LGOA 1C1QA 1TONA 3S9CA 1BJVA 4K8YA 3RXPA 2VIWA 1D6WA 2Z7FE 4WMEA 2NU4E 3T29A 2ZHWH 1AD8H 3BTEE 5T3HA 1T8MA 1CT2E 4U30A 2Q6GA 2CN0H 4NZLA 2EA3A 3ZVEA 3MO9A 4MLFB 1PPZA 1OOKB 5HXFA 1ZYOA 5GIBA 5EXMA 1G3EA 3LJOA 3BIVH 4ASHA 3GICB 3QK1A 1IQLA 1TYNA 1DICA 3MYWA 4ABJA 1SLUB 3MH7A 1C2HA 1ZMNA 3A7WA 1GJ6A 4X0WU 1DVAH 2YNAA 2FP7B 1HPGA 2PGBB 2ZIQH 4AFSA 5GXPA 2F9NA 4ZHMU 2Y82A 2I6SA 3M7QA 1CHOG 1K21H 1G30B 1GGDC 1S82A 4DJZB 5AHGH 5A09A 1QQUA 2A0QB 1QB6A 3ZVCA 2Y6TA 4Y6DA 1O33A 4AB9A 1HJAC 3GISB 3LGUA 1W3CA 3VXEH 2G51A 1DX5M 4Q2KA 3IWMA 1C2MA 2VH6A 1KLJH 1FQ3A 2ZDAH 1FXYA 1MBQA 1P12E 2Y81A 1D6RA 2JETC 1AZZA 4JYUH 4A1XA 1V2UT 3QLPH 2PUXB 1QB9A 4I8JA 1GMDF 1CGIE 1GVLA 1C1UH 1Q31A 2ZDLA 1EASA 4XDEA 5LPEA 3KNXA 3ZZ6A 3EDXB 3F9FA 3QX5H 4NCYA 4R0IA 4K8BA 3W94A 2QV1A 2SGDE 1SHYA 4CRGA 3SNBA 1VCQA 3S0NA 1ZGVA 3SV8A 1W8BH 1EX3A 2ANMH 3LGIA 1HXEH 5JB8S 3SORA 1UMAH 5T6GA 1YGCH 2WPHS 5EG4A 3KF2A 1TFXA 1B0EA 4CRAA 5K0HA 1O3PB 2CHAC 1ZHPA 4F4OC 1KXCA 1A61H 1AUTC 1GI0A 2GV7A 3L6PA 2FYRA 1FNIA 1FI8A 2FEQH 4YT7H 1ELGA 1HJ8A 2IPHA 1DITH 1EUFA 4ISIH 1XXDA 2XWBI 4I31A 4NGAH 4ZAEA 3RXUA 5BPEA 5A8ZA 3SZNA 3LGTA 4CRFA 2FOGA 3MNXA 2ZA5A 3DUXH 4BAOB 1T8LA 1O2OA 2QXJA 1TABE 2VVCA 1S0QA 4KTCA 1L4ZA 4AGKA 1ZR0A 1PYTC 2HNTE 2SNVA 4X8TH 2Y7ZA 2VWMA 2W7SA 2ZPRA 1WTHD 5FX6A 1HNEE 1O2MA 3ESTA 1CGJE 1QA0A 4Y11E 1L4DA 1SGDE 4O97A 4PROA 1KIGH 3ZZAA 1P04A 1RTKA 1GMCF 4K69A 3BTKE 1S6FA 3RXJA 4Q7XA 2JH6D 4KTUA 1BMNH 3M5NA 4A5TS 4VGCC 3OY5U 2FOEA 2A32A 5E8EH 2A1DB 1UK4A 3E3TA 3HATH 2AERH 3BG4C 2BMGB 3A7TA 4WWYA 1GBFA 2BD8A 4FUDA 1DUEA 2O9QA 1P9UA 2OLGA 1SGNE 3FP7E 2J9NA 4XFQA 1UCYK 1O2TA 1BHXF 4B2AA 2I6QA 5EPYA 1MTWA 1EP6A 2FODA 4WJG2 2GMTB 3TJUA 4J2YB 1A3EH 1G3DA 4UONA 3MNCA 1WOFA 1O38A 1W2KH 1WU1A 2P94A 1THSH 1OYTH 2BD9A 1O3FA 1H4WA 1QBNA 1UCYE 2CV3A 2SGQE 4RKJB 1VGCC 1LVBA 1THPB 4WXIA 1C5LH 2XBWA 2STAE 1OP0A 1TA6A 2XCFA 3JZ1B 4TWYA 1FN8A 1NU7B 3A85A 8GCHG 1GJBB 1L0ZA 4JYVH 1YLDA 4ZMAH 2OBQA 2AMDA 3A82A 3B23B 1TPPA 1K1LA 2FS9A 3NZIA 2ZHFH 1Y3YA 3TH2H 1GMDG 1GI6A 2ANYA 4X1PU 1LHDH 2BDHA 4JCNA 2C8XB 3KQEA 5CMXH 1K2I1 3TGKE 2OTVA 1XM1A 2D2DA 1VCPA 3P92A 1P09A 2A2XH 2PSYA 1BOQA 1SBWA 2BVSH 5DP8A 4AG1A 1KXFA 2UUKB 1SMFE 2ZU3A 2BDAA 2TIOA 3BG4B 2XCNA 4M7GA 4ABIA 4NZQA 2PR3A 1A0HB 4J1YA 3S9BA 2W26A 5IDKA 3ATKA 1UTQA 1OX1A 1YM0A 1TQ0B 2GV6A 4KGAA 2AGIX 1CBWB 3SJOA 1PQ8A 1S5SA 1HLTH 2GDDA 3G01A 2O8TA 4UFGH 1OPHB 1NZQH 1DLKB 3RXRA 4JYTA 1HAPH 2ZU5A 4GLYA 1UK2A 1AFQB 4K1TA 1AVXA 4CHAC 1GI7B 1LDTT 2ZECA 1Y3UA 4BAKB 4A1TA 1IQEA 1DWEH 2ZHDA 4TPIZ 5E0GA 1YC0A 1GBCA 1O2WA 1PJPA 1DE7H 1EOLA 2Z6BD 2ZU4A 3FFGA 1MKWH 4FU9A 1ORFA 4MVNA 2QXGA 1SC8U 4B1TA 5C1XA 1GI3A 3RXAA 1PPCE 4X8UH 2ZFPH 1A5GH 3Q76A 6ESTA 4D7GA 4CBOA 3ZV8A 5DO4H 3TGJE 1ETRH 1UK3A 1GG6B 4MNYA 1TPOA 1S84A 3TVJB 4QT8C 3RXBA 3UREA 1AVGH 1RS0A 4GSOA 1KTTB 2BB4A 1NRNH 1C2EA 4UDWH 3TH3H 1C5NH 5GPIB 3SV6A 3UUZA 4JK5A 1BITA 4YLQH 3SJ8A 5A0CA 3GCHC 3SNEA 3M3TA 3HGPA 2ZFRH 2TRMA 1ZHMA 1ZMLA 1NO9H 4DCDA 1N1LA 1A3BH 2VGCC 3F9EA 1ABIH 2Z3EA 1TE0A 3LKWA 1OWKA 2FTMA 1PPHE 1O5DH 1GL1A
chains in the Genus database with same CATH superfamily
5B6OA 3H5CB 1ELTA 1O2LA 1Z6JH 5KEDA 3SV9A 1FY5A 3ELAH 1TMUH 1DM4B 2J95A 1TMBH 1C2IA 2V6NA 3QWCH 1HRTH 1BTXA 4B71A 5DP5A 5AFZH 3I29A 1QFKH 3LJJA 1O2JA 2ZQ1A 2FZZA 2J97A 2RA3A 1LMWB 4NA8A 1FV9A 2A45B 1FLEE 4X1NU 1HAOH 3UFAA 3N7OA 3ZZCA 1TGBA 4ISHH 1RGQA 2H9TH 2IOTA 2KFWA 2PLXA 5I46H 4ZKNU 3U8OH 1GJCB 2GX4A 3GY7A 3RXMA 4OGYA 1JBUH 1PPFE 1LPKB 2BD4A 2F4LA 2FM2A 1TOMH 1Y59T 1G36A 2BY7X 1K1OA 2GTBA 4FUEA 4DY7B 1P10A 3BSQA 3K9XB 2AIPA 1O32A 1SGQE 4LZ4B 2A7CA 2UUJB 5E2OA 1GBIA 1DPOA 3MOCA 2FDAA 3IITA 3RU4E 2QE7D 4GPGA 3K2UA 3UOUA 4KKDA 3BTGE 2AGEX 5I25A 2VINA 3P8OA 3OEED 1BTYA 2HOBA 3GCHB 3F2GA 3TK9A 1DANH 3Q77A 3DHKH 1HV7A 3OE7D 2Z9IA 1ZPZA 5G4BA 2VGCB 3O8BA 1IQKA 1IHSH 5HYOA 3WY8A 2GCHF 3PMHB 1P3EA 2ZDVH 2O8MA 3CS7A 4ZKSU 4ABHA 1TX8A 1GJAB 1J9CH 1RTLA 2PKAA 2YMSD 3SU2A 1J17T 1IQMA 4Q4LA 4AG2A 3NRLA 1EOJA 4CH8B 3UTUH 5C67A 1C1PA 2GT7A 3PM3A 3T2NA 4B75A 1ELCA 1GHWH 2DUCA 2B7DH 1PQ7A 3RXTA 4HI3A 1F92A 3LIWA 5EGMA 4B76A 1UTJA 4AGJA 1MKXK 4IC6A 4FUCA 3SI3H 5CE1A 4BAQB 4ABFA 1ZSLA 2FXRA 2OC1A 3OU0A 4XSKU 1NFUA 1ZMJA 1O3HA 4DOQA 4FU8A 4HFPB 1IQNA 4NIYA 2VIDA 2BQ7B 1GHBF 1BTHH 1EJMA 1K1MA 4OS4A 3FP8E 2XW9A 1UO6A 5EJ1A 3MI4A 5HMAA 1E38B 4E7NA 2Y7XA 1ELFA 1GHVH 1GHZA 2W7UA 3V3MA 4K3JA 3A7XA 1VITG 2O8UA 4U32A 4AORA 5JPMH 1W0YH 1GI8B 3MNBA 1S81A 1TALA 1S6HA 2SGPE 4B2BA 1SGFG 1ANEA 2VH0A 3GY6A 1UVTH 2PTCE 1C2JA 4FUHA 3T5FH 1ZRBA 2CF8H 3T62A 3DFLA 1UVPA 4WF8A 4WH8A 2A5IA 5EW1H 1GDUA 4GCHF 4E05H 2XC0A 3K6ZA 1YCPM 2F9BH 1PPBH 1NBME 3RDZA 3M36A 5L2ZH 2XBXA 3NPSA 5F6MA 1BB0B 2OCVB 1GBLA 3M5LA 4K60A 3E16B 5EQSA 5J4SA 3PYHA 3GCTF 4JK6A 1ANDA 2WUCA 1WCZA 4ZH8A 1GBAA 1MAXA 1LHCH 1Y8TA 2XTTB 1SQOA 2XC4A 3TITA 1SQTA 2G81E 2WZQA 2J94A 3A7YA 1XUHA 4NFEA 2VJ1A 1SFIA 1O2HA 3MTYA 4XE4A 2R2MB 3F9GA 1O30A 3FO8D 4ZROA 2PKSB 4INHA 2ZQ2A 1LPZB 3LPRA 1S0RA 4NA9H 1WUNH 1AIXH 2FS8A 2KR7A 4P02A 2EC9H 3SV7A 2GKVE 3DA9B 2Q6DA 4YXWD 1SKYE 1C4U2 4Y71A 1AFEH 5GDSH 1YKTA 2PUQH 1ANBA 1JMOH 4BAMB 3M7UA 2FOFA 1E34B 2QF5A 1P05A 1C1MA 1C5UA 1F2SE 3U8TH 2TGTA 1EP5A 4YM9A 1LHFH 1O3EA 1O5AB 2BLOA 4OS2A 5DP9A 2ODQA 3TIUA 2GCHG 3KYFA 1JIRA 1O3DA 3AVZA 3BF6H 2WV5A 1TNIA 2RDLA 1RIWC 2SNWA 1LKBA 2XC5A 3H7OA 3LC5A 1C5VA 1ZTJA 5CDFE 5J4QA 2FI4E 1Z6EA 2C8WB 1SGTA 1VKYA 4I8KA 1CGHA 3CENA 4ZHLU 4H4FA 3SNDA 5A0BA 2EI7A 1MAYA 4UFFH 1EPTA 1MTSA 3RC5A 3QTOH 3O8CA 2RFKC 1BTZA 2WPLS 3A8BA 1T32A 3GYLB 1A46H 1KSNA 1YPKH 1ZPCA 1GBBA 4I32A 1HAVA 3RC4A 3M5OA 3EYDA 2A7JA 1QZ8A 3TNTA 3MH6A 1FY3A 4MQAA 5DP6A 2ZU1A 4FVBA 1TQ7B 1K1PA 3FZDA 1GHBG 1A5IA 3RXGA 1HJ9A 1FIZA 2H9HA 1WBGB 1KLIH 1J15A 3BN9A 1QR3E 1EAIA 1LHEH 1UVOA 3PLBA 3AASA 1E35B 3D49H 2ZKSA 5LH8A 1BQYA 2CMYA 2C8YB 3MFJA 1B0FA 4JZEH 5A0AE 3FANA 3KGPA 3VXFH 1A7SA 3V7TA 1FUJA 1WQVH 2FTLE 2L74A 1Y3VA 1Z1IA 1ZTKA 3WWBA 1KXBA 1SFQB 2ZGHA 1SHHB 3PLKA 5JBAS 3TH4H 1QQ4A 3HKJB 1H8IH 1QRXA 3RXOA 7ESTE 4KELA 4GCHG 1E1RD 2ZGCA 1C5TA 1GHAF 1BIOA 4FUFA 3HPTB 2BTCE 4F49A 1RIWB 1YPGH 4BTIB 1LTOA 1DSTA 2WV9A 4ISLA 2B5TB 4X1SU 1E36B 3ZYEA 2YOLA 1LVOA 2J5UA 4OM9A 1K1NA 5EXLA 1C1VH 2ZNKH 2ZO3H 1LQDB 1KXAA 1SGYE 2GMTC 3FOAA 3RU4T 1XX9A 2ZCLP 1QCPA 3UNSA 1WDIA 1ZHRA 4CR9A 6CHAB 4IGDA 4H6TA 1P11E 1T4VH 1C5RA 1D9IA 1SGFA 2R0LA 2RCEA 2Y5FA 3LH1A 8KME2 1AN1E 4IN1A 5DPAA 1O2SA 4XBCA 8LPRA 4BNRA 2BD2A 1XKBC 1JWTA 4DT7B 1QL8A 3H09A 4D7FA 3UAIC 1MBMA 1DXWA 3VB7A 4BTTB 3SGBE 2G5VA 3FAOA 3E6PH 3GY8A 4TT3D 1C9PA 1C2GA 1D3PB 2BX4A 1CHGA 2Y5HA 2YMSB 1IOEA 1G2LA 2VVUA 2HVXA 3M7TA 5HM2A 1SQRA 2C3SA 2XNDD 2ZC9H 5EOKA 3RMOH 5FXLA 1T8NA 5EQQA 1O2RA 1BBRH 4ISNA 4CH2B 5GWZA 5C0UA 2JKHA 2XBVA 1RJXB 2KCYA 1ZZZA 1F7ZA 1JXPA 1NTPA 1K22H 2A31A 2PP6A 4JZDH 2OINA 2GD4B 4DVAU 1D3QB 3UY9A 1FDPA 1ZJKA 1AHTH 3P8GA 1SLXB 2B9LA 4I86A 1O2ZA 2WSSD 1DWDH 1O3OA 2ZFTA 2DE8A 2M2AA 1BA8B 4I33A 3TJOA 1P2JA 1HUTH 2WINI 3RC6A 2PKAB 3URCA 1BTPA 1HXFH 2CK3D 1MMJN 1O3NA 2Z3CA 3SQEE 3U69H 1AWHB 1O5GH 1HAXB 1CVWH 1Q2WA 4NFFA 3RXSA 1C5ZB 5A8XA 4ZXYH 1CBWC 1QBVH 4Q7YA 4U01A 2F83A 1CT4E 3FZZA 1IQFA 3SUDA 1C1TA 4Y0YE 1ANCA 5F8TA 5EPNA 3EE0B 4K1EA 2PV9B 2F9UA 2PGQB 1FY4A 1LCYA 5C94A 1O3IA 4IS5A 3E0PB 1AFQC 4X2WA 2PTNA 1W12U 2EI6A 2QN5T 3OAAD 1EAXA 5DP4A 3L33A 3VPKA 2BVRH 3F1SB 1DDJA 4RI0A 1NRPH 4ZCNA 2QGRA 3TNSA 3EAJA 1AB9B 1HBTH 3AW1A 2GZ9A 1G3CA 1PPEE 2GZ8A 2W5EA 3DT0H 3RXKA 3E1XB 4HTCH 2V35A 3SGQE 4MG3A 1V2MT 1O3LA 1KTSB 3ZV9A 2R3UA 3DSOA 1OWEA 4A6LA 1GDQA 2AYWA 3EA7A 3VB5A 1W14U 1PQAA 2Z9JA 2BDIA 5T1VA 1GHXH 1ELEE 1KYNA 2HWLB 4HG6A 2C93B 1WSSH 1QIXB 1WXRA 3R0FA 1CSOE 2XNIA 1ACBE 2WPJS 1GG6C 2BY6X 1MU8B 1ELBA 1GHAG 4MPVA 1AU8A 3SJIA 4FUBA 5C1YA 2BY5X 2Y5GA 4ISOA 1O3CA 4Z0KA 1BTUA 1O2GH 1MU6B 2GGVB 4FXGH 1SLWB 1VR1H 4RT0A 2G5NA 1XMNB 2FLRH 1JRSA 1P57B 2H1UA 1FJSA 2VIOA 1EPTC 4MNWA 2FOAA 3MO6A 5FPTA 1W7XH 2FMJA 1F5LA 1K1JA 3HKIB 2PFEA 3ZZ4A 2HRVA 2P3FH 1TLDA 2UWLA 2ALVA 1VJAU 2BXUH 4XBDA 5C20A 1MCTA 5DG6A 1FZZA 3R3GB 5L30H 9LPRA 1BHXB 1L1JA 1HIAA 1P2NA 2P93A 4TPYA 2ZDMA 1RTFB 5HGGA 2FESH 1TGCA 4GUXA 5TCCA 2J2UA 2VNTA 3SQHE 1SSXA 4NIVA 1O3BA 4X6NA 3VGCB 2GCTC 5EODA 1V2PT 4YT6H 3QGNB 1N6XA 1SGEE 3N7DA 1TPAE 3SOSA 3DSGA 3WW7A 4KTSA 2GT8A 4ZKOU 1O2QA 4NIWA 4UFDH 1GMCG 1GBKA 3PWBA 3AW0A 1MUEB 2EQNA 4Z6AH 3AK5A 1EATA 2EEKA 4JZ1A 2KX4A 4FUGA 1W7GH 1AE5A 2WPDD 4DG4A 1NESE 5GCHF 1P06A 2OBOA 2ZGBH 3NWUA 2UUFB 2F3CE 1O2VA 1MH0A 1U6QA 1OKXA 1YLCA 3STIA 4AB8A 2FOCA 1SGRE 3KN2A 2RDEA 5KECA 3RP2A 3V13A 1WTGH 1COWD 2B0FA 1EZXC 2ZWLH 3SW2B 3SHCH 1X7AC 2XRCA 1A0LA 2JDID 3URDA 2ZTXA 1EPTB 1QGFA 1SOZA 5E0JA 1TB6H 2WPIS 1YYY1 1DY8A 2HNTF 1YF4A 3JZ2B 1L1NA 3UQOA 3SBKA 1HAVB 1L1GA 2OQUA 1INCA 4UE7H 4BAHB 1O3JA 2HALA 3T27A 3U98H 4MNXA 1GWAA 1CQQA 1AKSA 3SU3A 1FPHH 1H8ED 3LGVA 4HZHA 1A4WH 3VB6A 4ABDA 3P70B 3ITIA 5FAHA 5K7RA 3BTTE 2C90B 2R2WU 3D65E 1SGCA 5FCKA 3SHAH 4YOIA 3UNRA 2HGTH 3NK8A 3C1KA 2AGGX 1O5BB 2HPQH 3SU1A 1YPMH 2GCTB 2KM0A 1NN6A 2J4IA 1C5WB 4D9QA 1O5EH 4ESTE 5B6LA 3N7EA 5SGAE 2BLVA 4BOHA 1GPZA 1HGTH 3SI4H 1KXDA 1BRUP 3A87A 2OQ5A 4HGCA 4R8TB 4AZ2B 1PFXC 3PV4A 3C27B 1GVZA 3TK6A 1FONA 2ZZUH 1ZTLA 4A7IB 2H2ZA 2ZTZA 3F0OA 2P95A 1C1WH 1BTWA 2ZFFH 1AE8H 2OC7A 3GYMA 3RM2H 2D1JA 2ZDNA 3RMNH 2BD5A 3NKKA 2TGDA 3QZQA 1DWCH 1P3CA 2V0BA 3UWIA 1IHTH 1TGSZ 2OK5A 1WYKA 3KQBA 1LKAA 1JRTA 1V2RT 1K9OE 2NU2E 1TWXB 2V3HH 1JIMA 4B2CA 1O5CB 1YPEH 1VITH 3DD2H 3SJ9A 2R3YA 2NWNA 2ANWA 1ZSKA 2W6JD 2A4OA 1UVSH 3LU9B 2IJOB 3A7ZA 1NRSH 5FX5A 5LPFA 3ODFA 4UD9H 3KIDU 1P2QA 3PMAB 5EXNA 3RU4D 1QB1A 3BEIB 1HAHH 4IN2A 3RLWH 3MO3A 1C2LA 1YP9A 2ANKH 1TGTA 4BANB 1S85A 4Y79A 4NSVA 4LK4A 3OY6U 5DN6D 1ARBA 3SU5A 2Z94A 3PTNA 3ZVAA 1BBRE 1A5HA 3E90B 4YESB 2K8IA 1ZOMA 1EAWA 1ZSJA 2ZPSA 5FBIA 1EKBB 3BTWE 2J38A 3PV5A 3ENSB 5JYIA 1BMMH 3MQKC 1QJ6B 2PKSC 1DUAA 1ZJDA 2TGPZ 4MPWA 3I78A 5GCHG 1TBZH 3FVFB 2Q1JA 3PMJA 3SO3A 4D76A 4BXSA 2PWXA 2VB0A 2XYAA 3T28A 2AEIH 3TJVA 4ZUHA 5H4IB 3ZVFA 3GY5A 1SL3A 7LPRA 2QF4A 1OWHA 5AVDA 8ESTE 1C1SA 5DJ7A 5T6FA 2UUYA 5EJZA 1C9TA 3Q3XA 1MQ6A 3L3TA 1OXGA 2QA9E 1KLTA 1YCPH 3OX7U 4MPUA 2AFQB 3Q3YA 1BMFD 1ESAA 2XOKD 1NROH 1ELVA 1OP8A 2ZGJA 4X8VH 1HDTH 1V2JT 1XUFA 1GBEA 1C2KA 4SGAE 4INKA 1GL0E 1MQ5A 4WVPE 2F9VA 5C17A 1K0HA 1WAYB 3RXEA 4X8SH 2R0KA 2FIRH 3RLYH 2NU0E 4YZUA 1G9IE 1IQHA 3A86A 2ZCHP 1BZXE 4I8HA 1ZPBA 3T25A 5DP7A 4E7RG 4AOQA 1N8OC 1GCTB 2KCOA 2VU8E 1F0RA 1C1OA 3PMBB 4ZXXH 4YOJA 3NUMA 3ZYDA 2O8WA 2LELA 1PYTD 3HK3B 1NBMD 3HGNA 4CR5A 4D9RA 1J8AA 1NRRH 1UTKA 2BD3A 3STJA 3OYPA 3AAVA 3MU8A 1V2ST 2Z9LA 1W11U 5C5OA 2BX3A 1NC6A 2RG3A 1HCGA 1HB0B 4K2YA 1Y5AT 3UWJH 1P2MA 3QO6A 4B6FA 1J14A 4CREA 3K65B 1CO7E 2KCPA 4CBNA 4X2VA 1NFYA 1C5MD 2ALPA 3F68H 3ZZ5A 3ZVGA 3RM0H 3QZRA 3RUOA 1O35A 1XUKA 3CP7A 2FWWA 1SI5H 2XWAA 3A8CA 2FX4A 1UTOA 4X6PA 2F91A 1C4V2 1GMHF 2F9PA 1KY9A 1OSSA 1BUIA 4WMFA 3GDVA 1BT7A 1GJ7B 5ESTE 2H5DA 1MKWK 1C2DA 1NFWA 2ULLA 1SPJA 3FP6E 1O39A 3UIRA 4BXWA 2DE9A 3ZZBA 3BTHE 4B73A 1YWUA 3CNRA 2VIVA 4DW2U 1Y5BT 4K1SA 1GCDA 1TNKA 3E8LA 6GCHF 3U9AH 3GDUA 1HIAB 3DFJA 7KMEH 2M5TA 1EFRD 1T4UH 2B8OH 1Q3XA 4ABGA 2BQWB 1CA0C 2EI8A 1N8OB 1AO5A 1NRQH 3ODDA 3ZZ3A 2JH5D 1MD7A 4Y8YA 2A2QH 2VBCA 6CHAC 2FO9A 5JDUB 5DGJA 1GBHA 1TGNA 1W10U 2PW8H 4E06H 4Y10E 4ACBA 2OD3B 1C5SA 1OWDA 1LO6A 3A84A 4NG9H 3K6YA 5F03A 3VG8A 3RXIA 2BY8X 1QA7A 5EIYA 1A2CH 2XXLA 2G4TA 3KL6A 1V6DA 3AAUA 1GBJA 1RXPA 3F6UH 5EJLA 5JBBS 3MWIU 1V2VT 3IG6B 2HVYB 2YMSC 2Z3DA 1O3GA 1QHRB 1KDQA 1ESTA 1E37B 1Z8GA 1FPCH 2ODPA 2VIPA 2WYJA 1NT1A 1O2PA 3QDZB 1H8HD 1P9SA 1G32B 1DT2A 4O3TA 1FIWA 4YOGA 4BTUB 1E0FD 5FBEA 2ESTE 4FETA 1XUGA 3U1JB 3PWCA 1G37A 1P01A 1QRWA 5GJ4B 3TU7H 1Z8IB 8GCHF 2ZI2H 2SGEE 1FY8E 2C4FH 4ACAA 4NIXA 3GY4A 2BD7A 1QJ1B 1UHBA 4THNH 2AS9A 1O0DH 4Y0ZE 2BOKA 4NSYA 3TK5A 2ZF0H 1XVMA 1AKSB 3E91A 3P95A 3RXCA 3BTFE 4GHQA 3GCTG 1UTLM 1EAUA 4O9VA 3LDXH 2QXHA 2BDGA 2A7HA 1CA0B 3QUMP 3TPIZ 3A81A 3B8JA 1C5YB 3P17H 4O3UA 1Y3WA 3VB3A 4MTBA 1OYQA 5E2PA 1C4Y2 3F0PA 3RMLH 1O37A 4I8GA 1CU1A 4X6OA 2D8WA 2IN2A 1V2OT 1GVKB 3PRBA 1H9IE 3F3BA 2VWLA 1QJ7B 1H8DH 3RXLA 1SR5C 4RSPA 1SGPE 3BV9B 3O8DA 3O8RA 1AB9C 2QIQA 3CS0A 1QRZA 1O31A 1ABJH 4GVUA 1HAYB 5F53A 3PO1C 1TOCB 5L2YH 1AGJA 2A5KA 2FI5E 2BHGA 2BXTH 3H7TA 1A1RA 1GMHG 2GP9B 1TRMA 2FI3E 2UWPA 1PPGE 4KP0A 5PTPA 4XBBA 1QL9A 1YPHC 1O2UA 2HLCA 1H9LB 1V2QT 1BJUA 3PROA 1AZ8A 5GNDA 1GGDB 4A1VA 2BQ6B 4IW4E 1GBDA 2KCAA 1FN6A 5EU8A 1O2NA 1D3DB 3GCNA 1HJAB 2D26C 2VIQA 4CRCA 1GBTA 6GCHG 2THFB 2QF0A 3ATMA 3M37A 1TX7A 1TPSA 1V3XA 1QTFA 2JETB 4X1QU 2V3MA 1VCWA 1V2LT 1TRNA 1DWBH 1GJ5H 5DSFA 1C5QA 2PHBA 4Y76A 3SJKA 1EXFA 4FU7A 3LH3A 1QURH 1Z8JB 2G4UA 1D3TB 1MZAA 1EJNA 2W3KA 3SU6A 2Z9GA 3EA8A 1O3MA 3MU0A 3GY3A 5HM9A 2ZP0H 4ABEA 3KQCA 2NU1E 1YCPK 4FVDA 1BMAA 1F5RA 1V2KT 4O03A 2OUAA 1MKXH 2QCYA 5ESBA 2HLDD 3S69A 3KQDA 3UR9A 3W95A 2Z9KA 4TSFD 3GCOA 1O36A 2AMQA 1RFNA 2CHAB 5F8ZA 4X6MA 3SU0A 2C8ZB 2J92A 3VGCC 3LOXA 1T31A 4DURA 1EZSC 3ZVBA 1F0SA 2BYAX 3BTME 3M5MA 3U8RH 2F9OA 1NM6A 3PO1B 1EB1H 4I8LA 1H9HE 5CHBA 1TNLA 1AY6H 3F9HA 2K0QA 1XXFA 2VWOA 2V7QD 1LPGB 1XKAC 3E0NB 4AX9H 4OGXA 2P3TB 1C1NA 1S83A 4UFEH 3FN8A 3SUGA 2W3IA 1Y3XA 1XVOA 1ESBA 1NPMA 2SFAA 4OS7A 3TJNA 1NS3A 2KAIA 2AH4X 3S9AA 3RXDA 2ZCKP 4FUJA 2P16A 7GCHF 2ZEBA 2AIQA 1PQ5A 4B74A 4AFUA 3VB4A 1XUJA 1Y5UT 3S7KB 4ZHAA 1EJAA 4MNVA 1O2KA 1AWFH 3V12A 1FAKH 2A4QA 4DT4A 2A4GA 4VGCB 4WXVA 1L2EA 3EGKH 1SG8B 5C2ZA 3UR6A 1TBRH 2BOHB 1VJ9U 1G2MA 3UPEA 3UNQA 1DOJA 1UTNA 2ZU2A 2BDBA 4X2XA 1GI9B 3T26A 1HAGE 2NU3E 4JZIA 4X2YA 3GDSA 4MDSA 3M3VA 1V2WT 4YLUA 4FUIA 2FOHA 4K5ZA 1C5XB 1OWJA 5F8XA 2BDYA 1C5PA 2FOMB 1NU9A 1TAWA 5FPSA 5TCAA 4A92A 5LPRA 3ZZDA 5DK1A 1O2YA 3BIUH 1O5FH 1QBOA 2CJIA 2G52A 3QTVH 4AC9A 1ETSH 6LPRA 2ZDKA 4INLA 1VGCB 4AN7A 1MTUA 1V2NT 2BDCA 3GOVB 5FCRA 5IK2D 3PV2A 3I77A 3OFND 4X1RU 1FX0B 2CXVA 3RXVA 1P8VC 2STBE 4Y7AA 3TGIE 3PLPA 2LPRA 5A2MH 1SOTA 2H5CA 2ZHQH 3UOPA 4I7YH 1MZDA 4WH6A 1KXEA 2TBSA 2CGAA 1RD3B 4NA7A 2OXSA 1FMGA 2QYIA 1ELAA 2JJ1D 1HAIH 1TNHA 5TJXA 4TY7A 1ELDE 1YPJH 2BVXH 2WPKS 3HK6B 4F55A 1FY1A 1WQSA 3P6ZB 1V2TT 4H42U 1Z7KA 3EA9A 1BRCE 3MMGA 1FAXA 3ATIA 5A8YA 5IYTA 2QXIA 1TIOA 2P3UB 2VVVA 2BLWA 3D23A 1VITF 5DKMA 2WHXA 4OS6A 4D8NA 1GI4A 1BRAA 2H9EH 3MHWU 1BMLA 2HNTC 3BG8A 3A89A 1P2IA 2ZG0H 3A88A 4JZFH 1OHHD 4TYDA 1AI8H 3LONA 5CHAC 3KCGH 5C1UA 2L6OA 1C1RA 1F0TA 3ZZ8A 2ILNA 4RKOB 1OP2A 5FPYA 3U1IB 1O2XA 3SYJA 1C2FA 4DGJA 4YO9A 3LT3A 1KDQB 2O8LA 5C0TA 3NCLA 1SB1H 5HIYA 2FX6A 1IAUA 2VWNA 3M61U 1QL7A 1MTNC 3LC3A 1P2OA 3NXPA 2R9PA 1LVYA 4YTAA 4P00A 3S7HB 2TGAA 3PTBA 4RT1A 2G8TA 1ZGIA 4CHAB 1D4PB 4OS5A 2K1QA 3OTJE 7GCHG 4NWKA 2WV4A 1GJDB 2OC8A 1LHGH 3MNSA 1UHBB 1XUIA 1DLEA 3MU4A 1ZLRA 1DS2E 3MH5A 1GJ8B 1T7CA 3SNAA 3VEQB 2SGFE 5JB9S 2GVFA 3RXFA 2F43B 4RN6A 3A83A 1O2IA 1G3BA 4IBLH 1H1BA 1B5GH 4AFQA 1AMHA 1TMTH 4OS1A 1P02A 1CE5A 3ATWA 2Y80A 3RXQA 1HFDA 3GY2A 2AMPA 2BZAA 2HPPH 2J98A 1MABB 1ZRKA 1BBRK 1GJ9B 4ASUD 1P03A 1B7XB 1BRBE 3LGWA 1TBQH 1EQ9A 2A5AA 1N6YA 3BEUA 1W0ZU 2BZ6H 1GCTC 2QY0B 2FOBA 2WUBA 4CRBA 3Q00A 1DSUA 1T8OA 3B9FH 3ZZ7A 1K28D 1W13U 5FHTA 4AYYB 1C5OH 5CHAB 5AFYH 1A0JA 2TPIZ 1F0UA 1Z8RA 2WPMS 1SQAA 2QAAA 1IQGA 1AVWA 2FPZA 3MH4A 3QN7A 4LXBH 3A7VA 2FYQA 2A4RA 5JBTA 3A80A 3ZZ9A 1RRKA 1W0KD 1IQJA 4Y7BA 2P8OC 1AQ7A 1MTNB 4Q7ZA 1BDAA 4NWLA 1EB2A 1JOUB 5T6DA 4GHTA 3M35A 3TLOA 2YNBA 3KEEA 1MD8A 2H6MA 2AHME 2FLBH 4SGBE 1SGIB 3D62A 4IMQA 2ODYB 1DXPA 1GHYH 1WV7H 3KHVA 4Q80A 4DIIH 3LGYA 2JH0D 5AF9H 9ESTA 1SVPA 4ABAA 4MPXA 4IC5A 3UQVA 1QNJA 1TNJA 5DP3A 1CHOF 1GBMA 3Q3KA 1GI5A 4ZKRU 1VZQH 3ATLA 2QF3A 4AYVB 1OS8A 1TRYA 2G00A 4Y8XA 2G55A 3VFEA 1UCYH 2LNCA 3OSYA 3PB1E 3A8AA 1ARCA 4JMYA 1LQEA 1SLVB 1EZUC 4FOUC 3MU5A 1GDNA 1DFPA 3RMMH 5ETXA 1Z1JA 3BTDE 3RXHA 1K1IA 3SN8A 1GI1A 1EZQA 5EW2H 5HIZA 5C5NA 4TWWA 5BRRE 1UTMA 5JBCS 2RA0A 1THRH 1F5KU 3ZVDA 1MCVA 1YPHE 1OWIA 2ZHEH 1GI2A 3M3SA 4XOJA 4ABBA 1DY9A 2P59A 4U2WA 5L6NH 3V0XA 3SGAE 4DIHH 2Q6FA 1GJ4H 2BLQA 3SNCA 2CF9H 1P2KA 1P0SH 1TNGA 1YPLH 2SGAA 2ZFQH 1CT0E 1NY22 3QGJA 3SU4A 1O34A 1AUJA 2P8OB 2BM2A 3KQ5A 4H6SB 5C3NA 2J34A 1J16A 1BCUH 2UWOA 2ZPQA 1MTVA 3BEFB 4Y8ZA 2OP9A 3A8DA 4LZ1H 2BY9X 2KAIB 3FKSD 2ZGXH 1UJ1A 2QC2A 4TY6A 2V3OH 3MU1A 4IMZA 1CA8B 5E0HA 1ETTH 2ASUB 5ABWA 4UEHH 2OC0A 2XBYA 1Z71A 3SUEA 3SUFA 4GAWA 4LOYH 3BTQE 1HYLA 5FL7D 1IQIA 2ZTYA 1UVUH 4WMDA 3P8FA 1M9UA 4CRDA 1UTPA 3DCLA 4WY3A 1ID5H 1TA2A 1LVMA 5EQRA 1TX6A 3W1EA 2WYGA 1QY6A 1O3AA 3EQ0H 1YBWA 1NFXA 2ZFSA 1HAZB 3SV2H 1O3KA 3P8NA 2GZ7A 4AFZA 2GDEH 2PSXA 3WWFA 5LGOA 1C1QA 1TONA 3S9CA 1BJVA 4K8YA 3RXPA 2VIWA 1D6WA 2Z7FE 4WMEA 1E1QD 2NU4E 1KMHB 3T29A 2ZHWH 1AD8H 3BTEE 5T3HA 1T8MA 1CT2E 4U30A 2Q6GA 2CN0H 4NZLA 2EA3A 3ZVEA 3MO9A 4MLFB 1PPZA 1OOKB 5HXFA 1ZYOA 5GIBA 5EXMA 1G3EA 3LJOA 3BIVH 4ASHA 3GICB 3QK1A 1IQLA 1TYNA 1DICA 3MYWA 4ABJA 1SLUB 3MH7A 1C2HA 1ZMNA 3A7WA 1GJ6A 4X0WU 1DVAH 2YNAA 2FP7B 1HPGA 2PGBB 2ZIQH 4AFSA 5GXPA 2F9NA 3DSPA 4ZHMU 2Y82A 2I6SA 3M7QA 1CHOG 1K21H 1G30B 1GGDC 1S82A 1UW7A 4DJZB 5AHGH 5A09A 1QQUA 2A0QB 1QB6A 3ZVCA 2Y6TA 4Y6DA 1O33A 4AB9A 1HJAC 3GISB 3LGUA 1W3CA 3VXEH 2G51A 1DX5M 4Q2KA 3IWMA 1C2MA 2VH6A 1KLJH 1FQ3A 2ZDAH 1FXYA 1MBQA 1P12E 2Y81A 1D6RA 2JETC 1AZZA 4JYUH 4A1XA 1V2UT 3QLPH 2PUXB 1YY3A 1QB9A 4I8JA 1GMDF 1CGIE 1GVLA 1C1UH 3KYGA 1Q31A 2ZDLA 1EASA 4XDEA 5LPEA 3KNXA 3ZZ6A 3EDXB 3F9FA 3QX5H 4NCYA 4R0IA 4K8BA 3W94A 2QV1A 2SGDE 1SHYA 4CRGA 3SNBA 1VCQA 3S0NA 1ZGVA 3SV8A 4F48B 1W8BH 1EX3A 2ANMH 3LGIA 1HXEH 5JB8S 4Q63A 3SORA 1UMAH 5T6GA 1YGCH 2WPHS 5EG4A 3KF2A 1TFXA 1B0EA 4CRAA 5K0HA 1O3PB 2CHAC 1ZHPA 2EY4C 4F4OC 1KXCA 1A61H 1AUTC 1GI0A 2GV7A 3L6PA 2FYRA 1FNIA 1FI8A 2FEQH 4YT7H 1ELGA 1HJ8A 2IPHA 1DITH 1EUFA 4ISIH 3F2HA 1XXDA 2XWBI 4I31A 4NGAH 4ZAEA 3RXUA 5BPEA 5A8ZA 3SZNA 3LGTA 4CRFA 2FOGA 3MNXA 2ZA5A 3DUXH 4BAOB 1T8LA 1O2OA 2QXJA 1TABE 2VVCA 1S0QA 3N99A 4KTCA 1L4ZA 4AGKA 1ZR0A 1PYTC 3F2FA 2HNTE 2SNVA 4X8TH 2Y7ZA 2VWMA 2W7SA 2ZPRA 1WTHD 2J98B 5FX6A 1HNEE 1O2MA 1YLNA 3ESTA 1CGJE 1QA0A 4Y11E 1L4DA 1SGDE 4O97A 4PROA 1KIGH 3ZZAA 1P04A 1RTKA 1GMCF 4K69A 4Z1MD 3BTKE 1S6FA 3RXJA 4Q7XA 2JH6D 4KTUA 1BMNH 3M5NA 4A5TS 4VGCC 3OY5U 2FOEA 2A32A 5E8EH 2IPQX 2A1DB 1UK4A 3E3TA 3HATH 2AERH 3SZEA 1S6LA 3BG4C 2BMGB 3GS9A 3A7TA 4WWYA 1E79D 1GBFA 2BD8A 4FUDA 1DUEA 2O9QA 1P9UA 3EE7A 2OLGA 1SGNE 3FP7E 2J9NA 4XFQA 1UCYK 1O2TA 1BHXF 4B2AA 2I6QA 2KZ4A 5EPYA 1MTWA 1EP6A 2FODA 4WJG2 2GMTB 3TJUA 4J2YB 1A3EH 1G3DA 4UONA 2IJD1 3MNCA 1WOFA 1O38A 1W2KH 1WU1A 2P94A 1THSH 1OYTH 2BD9A 1O3FA 1H4WA 1QBNA 1UCYE 2CV3A 2SGQE 4RKJB 3U28C 1VGCC 4XD7D 1LVBA 1THPB 4WXIA 1C5LH 2XBWA 2STAE 1OP0A 1TA6A 2XCFA 3JZ1B 4TWYA 1FN8A 1NU7B 3A85A 8GCHG 1GJBB 1L0ZA 4JYVH 1YLDA 4ZMAH 4B6EA 2OBQA 2AMDA 3OTPA 3A82A 3B23B 1TPPA 1K1LA 2FS9A 3NZIA 2ZHFH 1Y3YA 3TH2H 1GMDG 1GI6A 2ANYA 4X1PU 1LHDH 2BDHA 4JCNA 2C8XB 3KQEA 5CMXH 1K2I1 3TGKE 2OTVA 1XM1A 2D2DA 1VCPA 3P92A 1P09A 2A2XH 2PSYA 1BOQA 1SBWA 2BVSH 5DP8A 4AG1A 1KXFA 2UUKB 1SMFE 2ZU3A 2BDAA 2TIOA 2GJGA 3BG4B 2XCNA 4M7GA 4ABIA 4NZQA 2PR3A 5HKKD 1A0HB 4J1YA 3S9BA 2W26A 5IDKA 3ATKA 1W0JD 1UTQA 1OX1A 1YM0A 1TQ0B 2GV6A 3PRDA 4KGAA 2AGIX 1CBWB 3SJOA 1PQ8A 1S5SA 1HLTH 2GDDA 3G01A 2O8TA 4UFGH 1OPHB 1NZQH 1DLKB 3RXRA 4JYTA 1HAPH 2ZU5A 4GLYA 1UK2A 1AFQB 4K1TA 1AVXA 4XRNA 4CHAC 1GI7B 1LDTT 2ZECA 1Y3UA 4BAKB 4A1TA 1IQEA 1DWEH 2ZHDA 4TPIZ 5E0GA 2W6ID 1YC0A 1GBCA 1O2WA 1PJPA 1DE7H 1EOLA 2Z6BD 2ZU4A 3FFGA 1MKWH 4FU9A 1ORFA 3ZIAD 4MVNA 2QXGA 1SC8U 4B1TA 5C1XA 1GI3A 2JJ2D 3RXAA 1PPCE 4X8UH 2ZFPH 1A5GH 3Q76A 6ESTA 4D7GA 3UB0A 3ZV8A 5DO4H 4CBOA 3TGJE 1ETRH 1UK3A 1GG6B 4MNYA 1TPOA 1S84A 2JIZD 3TVJB 4QT8C 3RXBA 3UREA 1AVGH 1RS0A 4GSOA 1KTTB 2BB4A 1NRNH 1C2EA 4UDWH 3TH3H 3OEHD 1C5NH 5GPIB 3SV6A 3UUZA 4JK5A 1BITA 4YLQH 3SJ8A 5A0CA 3GCHC 3SNEA 3M3TA 4M9FA 3HGPA 2ZFRH 2TRMA 1ZHMA 1ZMLA 1NO9H 2LP6A 1N1LA 4DCDA 1A3BH 2VGCC 3F9EA 1ABIH 2Z3EA 1TE0A 3LKWA 1OWKA 5KGOA 2FTMA 1PPHE 1O5DH 1GL1A
chains in the Genus database with same CATH topology
5B6OA 3H5CB 1ELTA 1O2LA 1Z6JH 3SV9A 1FY5A 3ELAH 1TMUH 1DM4B 2J95A 1TMBH 1C2IA 2V6NA 3QWCH 1HRTH 1BTXA 4B71A 5DP5A 5AFZH 3I29A 1QFKH 3LJJA 1O2JA 2ZQ1A 2FZZA 2RA3A 1LMWB 4NA8A 1FV9A 2A45B 1FLEE 4X1NU 1HAOH 3UFAA 3N7OA 3ZZCA 1TGBA 4ISHH 1RGQA 2H9TH 2IOTA 2PLXA 5I46H 4ZKNU 3U8OH 1GJCB 2GX4A 3GY7A 3RXMA 4OGYA 1JBUH 1PPFE 1LPKB 2BD4A 2FM2A 1TOMH 1Y59T 1G36A 2BY7X 1K1OA 2GTBA 4FUEA 4DY7B 1P10A 3BSQA 3K9XB 2AIPA 1O32A 1SGQE 4LZ4B 2A7CA 2UUJB 5E2OA 1GBIA 1DPOA 3MOCA 2FDAA 3IITA 3RU4E 4GPGA 3UOUA 3K2UA 4KKDA 3BTGE 2AGEX 5I25A 2VINA 3P8OA 1BTYA 2HOBA 3GCHB 3TK9A 1DANH 3Q77A 3DHKH 1HV7A 2Z9IA 1ZPZA 5G4BA 2VGCB 3O8BA 1IQKA 1IHSH 5HYOA 3WY8A 2GCHF 3PMHB 1P3EA 2ZDVH 2O8MA 3CS7A 4ZKSU 4ABHA 1TX8A 1GJAB 1J9CH 1RTLA 2PKAA 3SU2A 1J17T 1IQMA 4AG2A 1EOJA 4CH8B 3UTUH 5C67A 1C1PA 2GT7A 3PM3A 3T2NA 4B75A 1ELCA 1GHWH 2DUCA 2B7DH 1PQ7A 3RXTA 4HI3A 1F92A 3LIWA 5EGMA 4B76A 1UTJA 4AGJA 1MKXK 4IC6A 4FUCA 3SI3H 5CE1A 4BAQB 4ABFA 1ZSLA 2FXRA 2OC1A 3OU0A 4XSKU 1NFUA 1ZMJA 1O3HA 4DOQA 4FU8A 4HFPB 1IQNA 4NIYA 2VIDA 2BQ7B 1GHBF 1BTHH 1EJMA 1K1MA 4OS4A 3FP8E 2XW9A 1UO6A 3MI4A 5HMAA 1E38B 4E7NA 2Y7XA 1ELFA 1GHVH 1GHZA 2W7UA 3V3MA 4K3JA 3A7XA 1VITG 2O8UA 4U32A 4AORA 5JPMH 1W0YH 1GI8B 3MNBA 1S81A 1TALA 1S6HA 2SGPE 4B2BA 1SGFG 1ANEA 2VH0A 3GY6A 1UVTH 2PTCE 1C2JA 4FUHA 3T5FH 1ZRBA 2CF8H 3T62A 3DFLA 1UVPA 4WF8A 4WH8A 2A5IA 5EW1H 1GDUA 4GCHF 4E05H 2XC0A 3K6ZA 1YCPM 2F9BH 1PPBH 3RDZA 3M36A 5L2ZH 2XBXA 3NPSA 5F6MA 1BB0B 2OCVB 1GBLA 3M5LA 4K60A 3E16B 5EQSA 5J4SA 3PYHA 3GCTF 4JK6A 1ANDA 2WUCA 1WCZA 4ZH8A 1GBAA 1MAXA 1LHCH 1Y8TA 2XTTB 1SQOA 2XC4A 3TITA 1SQTA 2G81E 2J94A 3A7YA 1XUHA 4NFEA 2VJ1A 1SFIA 1O2HA 3MTYA 4XE4A 2R2MB 3F9GA 1O30A 4ZROA 2PKSB 4INHA 2ZQ2A 1LPZB 3LPRA 1S0RA 4NA9H 1WUNH 1AIXH 2FS8A 2EC9H 3SV7A 2GKVE 3DA9B 2Q6DA 1C4U2 4Y71A 1AFEH 5GDSH 1YKTA 2PUQH 1ANBA 1JMOH 4BAMB 3M7UA 2FOFA 1E34B 1P05A 1C1MA 1C5UA 1F2SE 3U8TH 2TGTA 1EP5A 4YM9A 1LHFH 1O3EA 1O5AB 2BLOA 4OS2A 5DP9A 2ODQA 3TIUA 2GCHG 1JIRA 1O3DA 3AVZA 3BF6H 2WV5A 1TNIA 2RDLA 1RIWC 2SNWA 1LKBA 2XC5A 3H7OA 3LC5A 1C5VA 1ZTJA 5J4QA 2FI4E 1Z6EA 2C8WB 1SGTA 4I8KA 1CGHA 3CENA 4ZHLU 4H4FA 3SNDA 5A0BA 2EI7A 1MAYA 4UFFH 1EPTA 1MTSA 3RC5A 3QTOH 3O8CA 1BTZA 2WPLS 3A8BA 1T32A 3GYLB 1A46H 1KSNA 1YPKH 1ZPCA 1GBBA 4I32A 1HAVA 3RC4A 3M5OA 3EYDA 2A7JA 3TNTA 3MH6A 1FY3A 4MQAA 5DP6A 2ZU1A 4FVBA 1TQ7B 1K1PA 3FZDA 1GHBG 1A5IA 3RXGA 1HJ9A 1FIZA 2H9HA 1WBGB 1KLIH 1J15A 3BN9A 1QR3E 1EAIA 1LHEH 1UVOA 3PLBA 3AASA 1E35B 3D49H 2ZKSA 5LH8A 1BQYA 2CMYA 2C8YB 3MFJA 1B0FA 4JZEH 5A0AE 3FANA 3KGPA 3VXFH 1A7SA 3V7TA 1FUJA 1WQVH 2FTLE 1Y3VA 1Z1IA 1ZTKA 1KXBA 1SFQB 2ZGHA 1SHHB 3PLKA 5JBAS 3TH4H 1QQ4A 3HKJB 1H8IH 1QRXA 3RXOA 7ESTE 4KELA 4GCHG 2ZGCA 1C5TA 1GHAF 1BIOA 4FUFA 3HPTB 2BTCE 4F49A 1RIWB 1YPGH 4BTIB 1LTOA 1DSTA 4ISLA 2B5TB 4X1SU 1E36B 3ZYEA 2YOLA 1LVOA 1K1NA 5EXLA 1C1VH 2ZNKH 2ZO3H 1LQDB 1KXAA 1SGYE 2GMTC 3RU4T 1XX9A 2ZCLP 1QCPA 3UNSA 1ZHRA 4CR9A 6CHAB 4IGDA 4H6TA 1P11E 1T4VH 1C5RA 1D9IA 1SGFA 2R0LA 2RCEA 2Y5FA 3LH1A 8KME2 1AN1E 4IN1A 5DPAA 1O2SA 4XBCA 8LPRA 4BNRA 2BD2A 1XKBC 1JWTA 4DT7B 1QL8A 4D7FA 1MBMA 1DXWA 3VB7A 4BTTB 3SGBE 2G5VA 3FAOA 3E6PH 3GY8A 1C9PA 1C2GA 1D3PB 2BX4A 1CHGA 2Y5HA 1IOEA 1G2LA 2VVUA 2HVXA 3M7TA 5HM2A 2C3SA 2ZC9H 5EOKA 3RMOH 5FXLA 1T8NA 5EQQA 1O2RA 1BBRH 4ISNA 4CH2B 5GWZA 2JKHA 2XBVA 1RJXB 1ZZZA 1F7ZA 1JXPA 1NTPA 1K22H 2A31A 4DVAU 4JZDH 2OINA 2GD4B 1D3QB 3UY9A 1FDPA 1ZJKA 1AHTH 3P8GA 1SLXB 2B9LA 1O2ZA 1DWDH 1O3OA 2ZFTA 2DE8A 1BA8B 4I33A 3TJOA 1P2JA 1HUTH 2WINI 3RC6A 2PKAB 3URCA 1BTPA 1HXFH 2Z3CA 1MMJN 1O3NA 3SQEE 3U69H 1AWHB 1O5GH 1HAXB 1CVWH 1Q2WA 4NFFA 3RXSA 1C5ZB 5A8XA 4ZXYH 1CBWC 1QBVH 4Q7YA 4U01A 2F83A 1CT4E 3FZZA 1IQFA 3SUDA 1C1TA 4Y0YE 1ANCA 5F8TA 5EPNA 3EE0B 4K1EA 2PV9B 2F9UA 2PGQB 1FY4A 1LCYA 1O3IA 4IS5A 3E0PB 1AFQC 4X2WA 2PTNA 1W12U 2EI6A 2QN5T 1EAXA 5DP4A 3L33A 3VPKA 2BVRH 3F1SB 1DDJA 1NRPH 2QGRA 3TNSA 3EAJA 1AB9B 1HBTH 3AW1A 2GZ9A 1G3CA 1PPEE 2GZ8A 2W5EA 3DT0H 3RXKA 3E1XB 4HTCH 2V35A 3SGQE 4MG3A 1V2MT 1O3LA 1KTSB 3ZV9A 2R3UA 1OWEA 4A6LA 1GDQA 2AYWA 3EA7A 3VB5A 1W14U 1PQAA 2Z9JA 2BDIA 1GHXH 1ELEE 1KYNA 2HWLB 2C93B 1WSSH 1QIXB 3R0FA 1CSOE 2XNIA 1ACBE 2WPJS 1GG6C 2BY6X 1MU8B 1ELBA 1GHAG 4MPVA 1AU8A 3SJIA 4FUBA 5C1YA 2BY5X 2Y5GA 4ISOA 1O3CA 4Z0KA 1BTUA 1O2GH 1MU6B 2GGVB 4FXGH 1SLWB 1VR1H 2G5NA 1XMNB 2FLRH 1JRSA 1P57B 2H1UA 1FJSA 2VIOA 1EPTC 4MNWA 2FOAA 3MO6A 5FPTA 1W7XH 2FMJA 1F5LA 1K1JA 3HKIB 2PFEA 3ZZ4A 2HRVA 2P3FH 1TLDA 2UWLA 2ALVA 1VJAU 2BXUH 4XBDA 5C20A 1MCTA 5DG6A 1FZZA 3R3GB 5L30H 9LPRA 1BHXB 1L1JA 1HIAA 1P2NA 2P93A 4TPYA 2ZDMA 1RTFB 5HGGA 2FESH 1TGCA 4GUXA 5TCCA 2J2UA 2VNTA 3SQHE 1SSXA 4NIVA 1O3BA 4X6NA 3VGCB 2GCTC 5EODA 1V2PT 4YT6H 3QGNB 1N6XA 1SGEE 1TPAE 3SOSA 4KTSA 2GT8A 4ZKOU 1O2QA 4NIWA 4UFDH 1GMCG 1GBKA 3PWBA 3AW0A 1MUEB 4Z6AH 1EATA 2EEKA 4JZ1A 4FUGA 1W7GH 1AE5A 4DG4A 1NESE 5GCHF 1P06A 2OBOA 2ZGBH 3NWUA 2UUFB 2F3CE 1O2VA 1MH0A 1U6QA 1OKXA 1YLCA 3STIA 4AB8A 2FOCA 1SGRE 3KN2A 3RP2A 3V13A 1WTGH 2B0FA 1EZXC 2ZWLH 3SW2B 3SHCH 1X7AC 2XRCA 1A0LA 3URDA 2ZTXA 1EPTB 1QGFA 1SOZA 5E0JA 1TB6H 2WPIS 1YYY1 1DY8A 2HNTF 1YF4A 3JZ2B 1L1NA 3UQOA 3SBKA 1HAVB 1L1GA 2OQUA 1INCA 4UE7H 4BAHB 1O3JA 2HALA 3T27A 3U98H 4MNXA 1GWAA 1CQQA 1AKSA 3SU3A 1FPHH 3LGVA 4HZHA 1A4WH 3VB6A 4ABDA 3P70B 3ITIA 5FAHA 5K7RA 3BTTE 2C90B 2R2WU 3D65E 1SGCA 5FCKA 3SHAH 4YOIA 3UNRA 2HGTH 3NK8A 3C1KA 2AGGX 1O5BB 2HPQH 3SU1A 1YPMH 2GCTB 1NN6A 2J4IA 1C5WB 4D9QA 1O5EH 4ESTE 5SGAE 2BLVA 4BOHA 1GPZA 1HGTH 3SI4H 1KXDA 1BRUP 3A87A 2OQ5A 4HGCA 4R8TB 4AZ2B 1PFXC 3PV4A 3C27B 1GVZA 3TK6A 1FONA 2ZZUH 1ZTLA 4A7IB 2H2ZA 2ZTZA 2P95A 1C1WH 1BTWA 2ZFFH 1AE8H 2OC7A 3GYMA 3RM2H 2D1JA 2ZDNA 3RMNH 2BD5A 3NKKA 2TGDA 3QZQA 1DWCH 1P3CA 2V0BA 3UWIA 1IHTH 1TGSZ 1WYKA 3KQBA 2NU2E 1LKAA 1JRTA 1K9OE 1V2RT 1TWXB 2V3HH 1JIMA 4B2CA 1O5CB 1YPEH 1VITH 3DD2H 3SJ9A 2R3YA 2NWNA 2ANWA 1ZSKA 2A4OA 1UVSH 3LU9B 2IJOB 3A7ZA 1NRSH 5FX5A 5LPFA 3ODFA 4UD9H 3KIDU 1P2QA 3PMAB 5EXNA 3RU4D 1QB1A 3BEIB 1HAHH 4IN2A 3RLWH 3MO3A 1C2LA 1YP9A 2ANKH 1TGTA 4BANB 1S85A 4Y79A 4NSVA 4LK4A 3OY6U 1ARBA 3SU5A 2Z94A 3PTNA 3ZVAA 1BBRE 1A5HA 3E90B 4YESB 1ZOMA 1EAWA 1ZSJA 2ZPSA 5FBIA 1EKBB 3BTWE 2J38A 3ENSB 5JYIA 1BMMH 1QJ6B 2PKSC 1DUAA 1ZJDA 2TGPZ 4MPWA 3I78A 5GCHG 1TBZH 3FVFB 2Q1JA 3PMJA 3SO3A 4D76A 4BXSA 2PWXA 2VB0A 2XYAA 3T28A 2AEIH 3TJVA 4ZUHA 5H4IB 3ZVFA 3GY5A 1SL3A 7LPRA 1OWHA 5AVDA 8ESTE 1C1SA 5DJ7A 5T6FA 2UUYA 1C9TA 3Q3XA 1MQ6A 3L3TA 1OXGA 2QA9E 1KLTA 1YCPH 3OX7U 4MPUA 2AFQB 3Q3YA 1ESAA 1NROH 1ELVA 1OP8A 2ZGJA 4X8VH 1HDTH 1V2JT 1XUFA 1GBEA 1C2KA 4SGAE 4INKA 1GL0E 1MQ5A 4WVPE 2F9VA 1WAYB 3RXEA 4X8SH 2R0KA 2FIRH 3RLYH 2NU0E 4YZUA 1G9IE 1IQHA 3A86A 2ZCHP 1BZXE 4I8HA 1ZPBA 3T25A 5DP7A 4E7RG 4AOQA 1N8OC 1GCTB 2VU8E 1F0RA 1C1OA 3PMBB 4ZXXH 4YOJA 3NUMA 3ZYDA 2O8WA 1PYTD 3HK3B 3HGNA 4CR5A 4D9RA 1J8AA 1NRRH 1UTKA 2BD3A 3STJA 3OYPA 3AAVA 3MU8A 1V2ST 2Z9LA 1W11U 5C5OA 2BX3A 1NC6A 2RG3A 1HCGA 1HB0B 4K2YA 1Y5AT 3UWJH 1P2MA 3QO6A 1J14A 4CREA 3K65B 1CO7E 4CBNA 4X2VA 1NFYA 1C5MD 2ALPA 3F68H 3ZZ5A 3ZVGA 3RM0H 3QZRA 3RUOA 1O35A 1XUKA 3CP7A 2FWWA 1SI5H 2XWAA 3A8CA 2FX4A 1UTOA 4X6PA 2F91A 1C4V2 1GMHF 2F9PA 1KY9A 1OSSA 1BUIA 4WMFA 3GDVA 1BT7A 1GJ7B 5ESTE 2H5DA 1MKWK 1C2DA 1NFWA 2ULLA 1SPJA 3FP6E 1O39A 3UIRA 4BXWA 2DE9A 3ZZBA 3BTHE 4B73A 2VIVA 4DW2U 1Y5BT 4K1SA 1GCDA 1TNKA 3E8LA 6GCHF 3U9AH 3GDUA 1HIAB 3DFJA 7KMEH 2M5TA 1T4UH 2B8OH 1Q3XA 4ABGA 2BQWB 1CA0C 2EI8A 1N8OB 1AO5A 1NRQH 3ODDA 3ZZ3A 2JH5D 1MD7A 4Y8YA 2A2QH 6CHAC 2FO9A 5JDUB 5DGJA 1GBHA 1TGNA 1W10U 2PW8H 4E06H 4Y10E 2OD3B 1C5SA 1OWDA 1LO6A 3A84A 4NG9H 3K6YA 5F03A 3RXIA 2BY8X 1QA7A 1A2CH 2XXLA 2G4TA 3KL6A 1V6DA 3AAUA 1GBJA 1RXPA 3F6UH 5JBBS 3MWIU 1V2VT 3IG6B 2Z3DA 1O3GA 1QHRB 1KDQA 1ESTA 1E37B 1Z8GA 1FPCH 2ODPA 2VIPA 2WYJA 1NT1A 1O2PA 3QDZB 1P9SA 1G32B 1DT2A 4O3TA 1FIWA 4YOGA 4BTUB 1E0FD 5FBEA 2ESTE 1XUGA 3U1JB 3PWCA 1G37A 1P01A 1QRWA 5GJ4B 3TU7H 1Z8IB 8GCHF 2ZI2H 2SGEE