3V7UA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with mta
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
261
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 75
structure length 261
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v7uA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v7uA01
3VZBA 3VZDA 3V8NA 2I29A 4L02A 5EJGA 2I1WA 3V8PA 1Y3IA 1Z0UA 5DHUA 4HAOA 3AFOA 5EJFA 2I2BA 3V7YA 3V7WA 3V8QA 3V80A 3V8MA 4V24A 2I2AA 4DY6A 5DHQA 5DHPA 5DHTA 2QVLA 3S40A 5EJHA 1U0TA 1Z0ZA 2JGRA 1SUWA 2P1RA 5EJIA 2I2DA 2AN1A 1U0RA 2I2FA 4WERA 4WRRA 2BONA 1Z0SA 1Y3HA 5DHSA 3V7UA 3PFNA 2QV7A 2Q5FA 5DHRA 3VZCA 1YT5A 2I2CA 3T5PA 3V8RA
chains in the Genus database with same CATH superfamily
2YN0A 5EWLA 4IFTA 4M89A 4R2IA 1K7XB 1KEEB 1EFTA 4E70A 1UM9A 2Y0DA 1P1IA 1OHHA 1N34B 3DEIA 1XHFA 4QO7A 2GVDC 2J0SA 3GB9A 3R9XA 4MS4B 2A59A 2FP3A 3NHBA 4F7DA 3TWOA 3KJNA 5TVGA 4UCQA 2VK4A 2DY1A 2QN7A 3S2ZA 2D8MA 4GI3A 3I2FA 4MJXA 1S7GA 4CI0B 1XQ9A 4AKIA 2GS9A 2I33A 5HKBA 4CCYB 2YZ2A 2VN8A 2UV8A 1H2XA 3BXXA 2MT9A 5C3UA 1M1YA 3W05A 3C6KA 5I4CA 2PPLA 4H7KA 3C1AA 2YZNA 1BD4A 1ODFA 4X90A 1NLYA 3K6SB 2HRZA 2XLBA 3O4IA 1KFEB 4EHNA 2GZHA 2YWJA 2C2WA 3KVNA 1Z56C 4FNOA 1QWTA 2WE8A 3NT5A 5CVDA 1P6XA 1TT5A 3T1OA 2R6DA 3I2KA 4GGOA 3PQ6A 2OAQ1 2BHTA 4TM7A 3ZH9B 1O9HA 4TV8F 3PLNA 4ITRC 1QKKA 5JH7F 4K81B 4NDAA 3GLSA 3M5WA 2QG4A 3IOMA 3CLTD 3JAWB 3WO1A 4Y2RA 4RA6B 3Q6IA 3LD9A 2ZULA 3CEMA 1WSAA 3TO5A 2ACWA 2AG6A 2ZJ0A 3N2KA 2CL7X 2JL1A 5CXUA 2GWHA 1R0RE 2EP7A 5DM70 4X54A 1UBSB 3FWZA 5JERA 1PGPA 5LCXA 4QQKA 4ZOAA 1KI7A 5A9RA 3A3KA 3MWDB 4ND8B 3T7KA 1KJYA 1QZUA 3R3XA 1ZA2A 1CEEA 1R6VA 1KZ1A 2Q1YA 3M9XA 3DE0X 2PA0A 4QLAA 4RZ2A 1K2WA 2IPLA 3VPCA 3C48A 4AO6A 3EYWA 2H8KA 4A6DA 2HK9A 5DASA 1COZA 2A9FA 4UMVA 3OPQA 1E79D 5CLJA 2XCOA 2Q3LA 4EG4A 1IPEA 3IVXA 4XA8A 1FMLA 4LWPA 3DEJA 4XCXA 3L7BA 5EVCA 1NLFA 1KJWA 3KAPA 3NFRA 3TLAA 1E3MA 3OWOA 2GM9A 4JC0A 2P9HA 1SKMA 2ZCJA 1WRBA 4W1RA 5C8VA 1QVZA 2FFHA 2GAJA 1YCFA 2H5EA 3JQQA 4FFRA 2HO4A 4P7GA 2QKYA 1EIZA 2G5PA 3D2AA 2A4MA 1G66A 1EGVB 3ZHSA 2RC6A 2SKEA 3F6BX 2JANA 4QOHA 3JW8A 1YDFA 2H16A 2Z0MA 4O4JF 4FPXA 1NZFA 3KWLA 3OWHA 4LZJA 4OI1A 4CM7A 4RLHA 4JLJA 1EH5A 3KYDA 4GX1A 3E61A 2Z58A 2A9PA 4IH4A 4XUEA 4ZRDA 4UVHA 5F21A 5DHPA 3FGOA 4R83A 2PUVA 4ZQIA 4CKCB 3OLYA 1EE1A 1SKAA 2PS1A 3F3MA 2V5AA 2L17A 4EK9A 1OFUX 3DJYA 3K72B 3KHTA 3KYBA 1A9OA 3BPSA 4PE5B 1LPOA 3LX4A 4RJJA 1IRXA 4DILA 2EGUA 1ECGA 3ZLTA 5C3MA 4HDSA 1VLMA 3BE8A 5GVRA 4FLEA 3UVEA 5CURA 5HJ7A 3BERA 4IL5A 4AFNA 1IAVA 3E4CA 1UC4B 5J5AA 3Q0EA 1LX7A 4JBNA 1YDWA 4HNUA 2JBWA 5K5EA 1X1QA 2RKWA 1M7BA 2X4GA 4L5BA 1P5JA 1GKLA 4KFRA 2HSZA 5C51B 1ODCA 3NEYA 4H2DA 1UPAA 2AJLI 3DMPA 3KYIB 4UARA 2V7PA 3E35A 3KQLA 4GPD1 1SELA 2V7EA 1FSPA 4MDHA 4MPRA 4D0GA 4DCTA 2B2NA 2ZREA 3TJRA 3G5UA 1QF6A 3PHCA 3DLHA 3LTNC 1ZSNA 3T3MB 2QRPA 4Q9JA 3OM9A 1SIBE 5JS1A 2O07A 4HQKA 4KAJA 4OHOA 5E9WA 4FR2A 2D06A 2PV7A 4L08A 1H9AA 2O0JA 3KQTA 3Q11A 2PWZA 5HGJA 5MGNA 1FDTA 2AMJA 4U4AA 4URHA 1LDBA 2WF8A 2ZYDA 1UKAA 4FFSA 2PS0A 2B1RA 2EX1A 4CI9A 3HA5A 5FH9A 1P77A 1L7QA 3QTBA 3CNEA 1FNMA 2XIQA 1XZKA 2BFFB 2GD1O 4AXXA 4HVTA 5FL7A 3OO1A 2VHUA 1ETUA 3GOHA 3DE2X 5TPZD 2OFWA 2FPIA 2JPEA 3BAFA 1HK7A 3HKDB 2QY6A 2VZ9A 4UD6A 5COAA 4H27A 3SE7A 1APBA 1VE9A 2IXFA 1VM6A 3ADBA 3MWDA 2R6JA 3HZRA 4PG8A 2EBWA 4LG1A 1E4EA 1C4XA 2C61A 4M87A 4NAUA 3SMQA 5AHWA 4O2AF 5E6UB 1QVAA 3CNBA 4LOKA 5B7QA 4HLDA 3QU4A 1D03A 5YASA 1XZPA 2PQ6A 1ISMA 1TEVA 2C5FA 4XRGA 1SQ5A 2XDQB 3G2PA 3I2JA 4OGGA 2Y1KA 4PYOA 2QNIA 2GVNA 3CN7A 3N75A 1PQYA 4GVPA 4F71A 4U7FA 4MYRA 2Q9UA 3HB4X 5E9AA 5FNVA 5H70A 1T15A 3TBHA 2VP9A 3ORHA 4NABA 1U6JA 1NG9A 2QZJA 2HRRA 4HLCA 5A9TA 3R8CA 2XA9A 3N8KA 2V97A 1ZVKA 3EGDB 3OAAA 5L3RA 4C07A 4D4IA 2AJDA 1P9OA 2OHIA 4QAJA 1CZKA 1NUUA 3AJ9A 3MMNA 4I1OA 3H9GA 1UWVA 4MV5A 4PXAA 4XOIA 5FR2A 3T4XA 4BP3A 3UYLA 3ECCA 5AI0A 3NTXA 1YMQA 4YUZA 4NCJA 4MINA 1ZPDA 4A5OA 5A6SB 1HNZB 5HWSA 3SDBA 3T0IA 2FFAA 1QHHB 2JJ8A 3PQEA 3TVYA 3W9SA 1U9JA 3C4JA 4WKBA 3ORFA 2J3LA 4DMKA 4NCAA 1CUCA 3DLPX 1YJCA 3OHSX 2B8EA 3RT9A 2PZJA 3EVTA 1E8DA 2X2PA 3KU4A 2FZCA 3LVBA 3DONA 4QQ8A 1KNQA 4JBIA 5PNTA 3ORSA 3R3SA 1U0NA 1KWKA 2X5KO 2PMEA 1QU2A 4HNSA 3TTVA 2BI8A 1IB6A 2PWBA 3OZ7A 2JJYA 1RWPA 3SMVA 4R71A 1QV6A 1BHJA 1CPYA 4MVJF 4XSHA 2BFFA 2A3RA 3FBTA 4D74A 3ADDA 1TQ6A 2ADFA 2R65A 3GZTB 1YIDA 4AQDA 1QU5A 4RD3A 1YGSA 2GN8A 2IYTA 1M6VA 3DMYA 1INLA 1G9TA 3CB4A 2J3HA 4DF3A 2XF8A 3HNPA 4B7XA 1W29A 1HEIA 4O4HF 3LXXA 4C30A 1HLGA 3HVHA 4GMKA 4QJBA 1Q95A 1CJCA 4ZRMA 1MA0A 2EKQA 1I5RA 1KO7A 3M34A 1FLDA 1SKYB 4NI5A 1GXSB 1E2UA 1T8PA 1Z6PA 4P33A 3P0EA 5E1BA 4BE9A 5EPUA 1BOFA 5D3MB 2LPMA 4R1OA 3HUEA 2DTDA 5DNDA 2WYVA 4ZVSA 3ZOZA 2HA7A 4OQZA 4HN9A 4F0JA 4G0PA 1IFXA 4N0DA 5GIOE 2G6TA 2Z04A 1HE8B 2MINB 3OY2A 5I9MA 2NGRA 3RKSA 4X65B 3HUUA 3CO0S 4LRUA 3T41A 3WYNA 3U5TA 1SUIA 4JLPA 4ON9A 4EJSA 4H6XA 3T9EA 4CE6A 3NTQA 4E5MA 1ZICA 3ZW8A 5IJAA 2NUTA 4TTPA 3AJ8A 4K28A 1H1LA 3NBMA 4QOSA 3T7SA 3GN1A 1WDLA 1G0NA 3AHIA 4JBHA 1SUAA 1TD1A 2WWGA 1BFKA 5CITA 2H2AA 3CIOA 1UJ4A 1RHQA 1P5RA 3NVAA 2GYWA 1MRZA 1GR0A 4JLKA 1M83A 4F8EA 3K70D 2GJ8A 4CF7A 1K4YA 3K0SA 4FONA 3LDAA 3EUFA 2H11A 1JDZA 2HF7A 3D3EA 3UMRA 4IZOA 3ZYZA 1SKUA 2Q27A 1BMQA 2E49A 4Y6QA 2GJKA 3FVWA 5FUMA 4WCFB 1VCMA 5CT8A 3G8AA 1YS9A 4QULA 3J7AC 5KNCH 2X9GA 1KQNA 1B15A 2KBFA 3A9WA 4RVDA 3R5XA 4NZ9A 3SEZA 1FW6A 1UPFA 3A37A 4GS5A 13PKA 1SHUX 3IMFA 1BDHA 2IVFA 2ZSBA 1QLWA 4PO9A 3K8ZA 2GKGA 1YJ8A 2I6TA 4WESA 1MPTA 4X85A 1C41A 1WF3A 2H0QA 2OKGA 2VK1A 3G89A 1U90A 3OFKA 5BO5A 3CB2A 4AG5A 4HZIA 2F9FA 4GBGA 5T6BA 5BMVA 1ZOQA 5IVDA 1A9XA 3SZUA 2R97A 4FSHA 2FX3A 2FSVC 1TTQB 4ND7A 4MR7B 4ECAA 2VYFA 2WD8A 4HAZA 2J7PA 1L8OA 1I7LA 3O93A 3BL6A 3NCHA 1F20A 1GAJA 3C43A 3PX3A 5EE0A 3TIXB 1CU1A 3I23A 1J0DA 4NYJQ 3TL2A 3WV4A 1LTKA 1N2JA 4HMPA 3BORA 5AVUA 2WICA 3HN7A 3OF2A 5AXBA 4LFBB 3JYOA 1YI8A 3NEJA 3F6YA 1IQ0A 2VLIA 3NHKA 4CMBA 2J9FB 4MWCA 2Q45A 1NBMD 3NM5A 4PX5A 2C4MA 4ARZB 4EZEA 2R25B 4ND8A 5TEWA 3A1DA 4AKHA 2AZDA 3CS3A 3CR8A 4I1SA 5CIYA 5DSXA 3DF7A 1UJMA 5AKEA 5E2AA 1NXWA 3AEKA 2J9RA 1JEEA 1OA1A 1EBUA 2SHKA 4JROA 1E1YA 3FYUA 3OHMA 4LGMA 4E2ZA 3PCXA 1MQ8B 4RACA 3NR2A 1U7TA 4G26A 4GWKA 2I4TA 2W2OA 3TLZA 2WD7B 2A2ZA 3BFJA 4OTZA 2IY7A 4POAA 4ZO6A 1JT2A 1BZYA 5FORA 2ZJ5A 5JXWA 2EYQA 2W2TA 1EHCA 2G5CA 4W9MC 3HNOA 2LWIA 4N3NA 5FBLB 4B2LA 1ORIA 5IDQA 4GZ5A 1WB4A 2EJCA 3EWIA 4O4HA 2ZYWX 1HR0B 2IU0A 1GVHA 3VHLB 3N58A 4P3OA 4Q9HA 3A3PA 3A26A 4ZT3A 4YCNA 5ERGB 3NHRA 2ZBRA 1CZOA 4D6XA 1FYDA 5AW9A 2G1AA 1G8PA 4YJ3B 4QE3A 1V6CA 4HBZA 1MRNA 1P1CA 1QUFA 3M6VA 1KQFA 1PWXA 2TS1A 1XZIA 3SR4A 4EUKA 1MNAA 5EMMA 4HFJA 1EAMA 1K2MA 1HRDA 1LJ8A 4RDIA 2WG2A 3Q9SA 2NXCA 2ZZMA 2WSSA 1K89A 5JV5A 1E1LA 2WYUA 5DGTA 1I3MA 1ECJA 3VR3D 1F0KA 5TT1A 4JI1B 3C8UA 1G7TA 4MQ4A 4MYHA 3TRIA 4D4JA 2O8FB 1T36B 1O54A 3EMDA 3M5PA 5L3ZA 3LHFA 4PFQA 3MJEA 4IJVA 4CV0A 5JNRA 2WTUA 2DKOA 4NR0A 4LYJA 3I9LA 5BYJA 1G8MA 2V4ZA 2Y9PB 2D62A 1T1EA 3GFSA 3LCCA 4LBYA 4EFNA 4L8VA 4PO1A 1ZJ5A 3L1VA 4BQQA 4KVZA 1FUYB 4TQAA 3D5EA 4BQNA 2WG1A 3GU3A 4Q7LA 2WR8A 4RY8A 2HLNA 4G8CA 3D8NA 4OQEA 3V2HA 2VJMB 2A94A 4MTLA 3ZHZA 3NONA 5I5EA 2YIMA 4WOPA 1JXQA 1WBJB 2G5GX 3V1NA 3Q6MA 1BJKA 3CLKA 2D0IA 3OJOA 1WEHA 2OHVA 4I50F 1NHGA 1N32B 2IUSA 2DYKA 2EIXA 1I32A 1IVNA 3L0PA 4FGUA 3ZLUA 4C14A 3GLIE 3QVSA 3RHZA 2IOHA 3AF4A 3UJDA 1D6NA 4DXHA 1PGQA 1Z13A 3A1VA 1G3RA 5IJXA 3TQQA 5JR3A 5ED0A 4HTFB 4CM4A 4OMFG 4MR7A 5KTRA 2FDRA 3SQDA 1ORDA 4ETWA 3K5HA 4FP9A 1Y1KE 4KQWA 1EI9A 2FOIA 4PFSA 1TA9A 3G6WA 3HU3A 4X1YB 4ZEMA 3LX8A 5IXYA 1K98A 1TFUA 4DLVA 3RUPA 2YICA 1QAOA 1YS2X 2OZPA 2QQ5A 1R6AA 4UULA 1TK3A 4ZO8A 4BQPA 3UH0A 1AGYA 4NWIA 3ZHQA 3B2NA 1TKAA 1X7XB 3ZU5A 5A1JA 1X42A 2YYZA 4YRJA 3REQA 4Z4EA 2IZ5A 4RV5A 5KJCA 2F7SA 4EI8A 4BRSA 2VP5A 3BD9A 5LSAA 1C3JA 3RS0A 1BIFA 2RC5A 2HIMA 5JMWA 1Z8HA 3LY8A 1X14A 2ZWVA 3RADC 1JAHA 2C98A 1M34B 3JD0A 5LNK1 3NP7A 2Y99A 2O1XA 3FUWA 3P2OA 5GONB 3PO8A 3RVDA 5DGCA 4AC9A 2D0OB 5H02A 4TTAA 1YWGO 4H4EA 3FMVA 3LLVA 4GYKA 5IBQA 5JNTA 3WBKA 3HFRA 4FC7A 1GKIA 1X3LA 1CRWG 1A96A 2L18A 1IZ7A 4A0RA 3NGLA 1Z62A 4NOKA 4XR9A 1UM9B 4P2BA 2OPHA 1JHUA 3JRNA 1JWAB 1OYOA 1SFRA 2IPMA 3AEZA 3M49A 5AM4A 5G0WA 3UWOA 1IBSA 1MU0A 3WRWA 1IG0A 2V98A 1AUXA 2ZRBA 4MDYA 4PHGA 3WJ2A 5CEFA 2VDNB 5GP1A 2D5AA 2IX9A 2VP3A 1J9EA 2PAAA 5AR1A 1YJBA 3AM4A 2O5RA 2PH5A 2ZB7A 4RPCA 5CJJA 3RSLA 4CUJA 4H1WA 3Q3GE 3BH6A 2GHIA 1QH1A 1NU6A 1UDAA 1QP0A 1H2YA 5F2OA 4MV7A 5BSUA 4REQB 3ROGA 1L5SA 1UDXA 3E70C 4QHYA 1OUMA 2Z95A 3B6MA 2X6RA 4L02A 2A5LA 1LBQA 2IC5A 2RH5A 1GU1A 3MJTA 3P5SA 1Z8NA 5TNXA 1CR0A 2CZCA 3BWYA 1SXPA 1M1NA 2R6HA 1GTVA 4X97A 5FBHA 3HA3A 4R0VA 3B6KA 2VPWA 1UMKA 1QGZA 3F8WA 3FMIA 2BCGY 2PS9A 3SC3A 4ZEVA 4EY4A 2XB4A 1EG7A 4OXYA 4KR2A 2CL0X 3HJTA 2OHFA 2YV2A 5IW8A 5JS8A 2OWDA 3GBPA 4YJHB 1O6FA 1K0UA 3A8TA 1SG9A 3E8XA 4K1XA 4R05A 4DHWA 1N0UA 1XDZA 3QYFA 4P6VF 1CNMA 4M0KA 4HAXA 2GR9A 4NMHA 4BNMA 1RZRA 4NONA 2GKOA 3H5IA 1UT6A 1C4WA 3AR6A 3C70A 1GXSA 3KKEA 2O8DB 4OK5A 2DBZA 4EJQA 4G0YA 4OJMX 3SHOA 3IH5A 2ZBQA 1JB1A 2H85A 2V0NA 5L3SB 5FTMA 4P0QB 4RD1A 3C5HA 4DV3B 1VECA 1EQUA 1JR2A 3PB3A 5T57A 4TTTS 2YVKA 1K68A 2SCUB 3JQAB 1A8SA 3LUDA 2FQYA 2F67A 3IR6A 2XNJA 2AOUB 4LYHA 2PCJA 1CUHA 3S2FA 3J81k 1NXPA 2CD7A 2O05A 1LU9A 1G5QA 3OJ0A 5E7QA 2FUCA 3NW9A 4ND2A 2NPFA 5HVNA 3HDYA 4V0ME 3HR8A 2AXQA 4F1WA 3VZSA 5C32A 2AMVA 3Q1KA 3I72A 3LRTA 3K9QO 4FXOA 3M8KA 4OQPA 2F4VB 4A0GA 4JI2B 4UXIA 3GG2A 4HMQA 1XZQA 4NJMB 2NSJA 5F1PA 3BXPA 4UEWA 2KE5A 3KAQA 2DTXA 4CKBB 1R1DA 4IEEA 2GCNA 3EFHA 1ZQ1A 2IK8A 3OFNA 4QBIA 4U8GA 3TW0A 4BFZA 2QUZA 3BRQA 4YT8A 2OCKA 3W4IA 4WACA 3KWJA 4CM3A 2BI7A 3JZDA 5HCIA 3NUQA 5NULA 5DH9A 2LD4A 4WK4B 1VRVA 4MWEA 2WKWA 4YH1A 1TOAA 1T5BA 1YRHA 1TJ3A 2PLNA 3FCAA 4Z99A 3ROPA 3RUFA 2Z57A 4E5VA 5BN4A 3DQZA 4K46A 4DLBA 2PGXA 5DCWA 3CPHA 4FMPA 4PLPA 1O94C 3WMGA 7MDHA 2JDIA 3RU2A 3AIKA 4X3OA 3UK1A 2ERCA 3IAUA 3WP1B 3DQQA 4F38A 3GK3A 2UVPA 5K3BA 2JBAA 4GVLA 5KHAA 3EPHA 3R0IA 1TJ5A 2QPAA 5TC4A 3D4OA 1UBJS 1OGJA 1E0AA 3DVLA 5BSGA 2VAMA 1M6VB 1KVSA 3H1FA 1KH3A 4HRVA 5LPNA 5E3JA 1QO9A 2YC2C 4O02B 1F5NA 4JBWA 4ONEA 1CZRA 5F4ZA 3FTFA 2ZWOA 2QMYA 3SIRA 1Z38A 3LBHA 3I6BA 4XQEA 4BGEA 2I8AA 5B7NA 4KIGA 4TSFA 3AR3A 5H0IA 5LFAA 3WNBA 2HU2A 1RLMA 1EVZA 5IJ0B 2I1LA 4BFYA 4LKOA 4JJ4A 4XDZA 4OP3A 4EHFA 5IDWA 5CU7A 5HF8A 3R76A 5JARA 2XUKA 3ESQA 1QFMA 4C6RA 4CG1A 1TE2A 5DYTA 4ZT5A 5JEKA 1OLXA 3K8YA 2H5JA 1YULA 3GDHA 4KIJA 4FX2A 1RFGE 4NX2A 2R00A 4IVQA 1SVMA 4M7WA 1ZW6A 3NBAA 2C9BA 3RWOA 3VSBA 4N41A 1SCAA 3PX7A 4V0NA 1GCIA 1IBKB 1DJMA 3TGLA 1FVOA 4HLQB 1BXGB 1VXOA 3HGTA 2Q6IA 3T3EA 1G2QA 3IXMA 1QIFA 4UNSA 4BLOA 4JLBA 1DBPA 4MR8A 1Q77A 4G2NA 4UD2A 1JLKA 4GLBA 3LTEA 5EHIA 3RYTC 3AONB 1GLGA 3OAAD 3THRA 2C9ZA 2Z3VA 2VNSA 3KBBA 4M0LA 5J4HA 3NVKI 2Q0HA 2GJSA 2JGEA 3FNFA 5CYPA 3WYFA 3TCKA 3X2EA 3YASA 1G20E 1D6MA 3R0JA 4Q00A 2VOJA 1ZEJA 1IK4A 2XPCA 2XZDA 4HGPA 5JJBA 3CZMA 3KHUA 4N3GA 1EINA 3WFZA 3POAA 5A9SA 5ECYA 3GI1A 2WVAA 4M0DA 1UQTA 4Y7CA 1IYZA 5BWOA 1DB3A 3LUKA 4WK6A 2HB6A 4B31A 1T29A 3INYA 1KMNA 5KDOA 2WP0A 4RNDB 1CULC 3AM5A 1YK0A 2W90A 2ZUDA 4GKBA 5AHXA 1V8BA 1I0LA 2WZCA 3RU3A 3IEVA 1TA4A 1MC8A 3GLHA 4URXR 1XC7A 3RAGA 4E13A 4Z7QB 3QJ5A 5ALKA 2WC1A 4CKEB 2R7LA 4MW0A 3NNDA 3MHPA 3UEOA 4R2KA 5A04A 3SJCA 3KZMA 1C9MA 4RM2A 3SZRA 2WY2D 1YO6A 4LECA 4AG3A 3NEAA 4U2GA 3KD3A 3VMFA 2HDHA 4CKYA 1NG1A 3EBPA 1Y0BA 3JR7A 4AZVA 4ZVKA 2YXDA 3V7YA 1I13A 4DLZA 3CUEF 4S04A 2DUNA 4PRYA 3TUJC 2PFGA 3BL5A 2O2EA 2CDRA 3IUNA 2M6RA 2VFAA 4JKOA 4E5UA 3S8EA 2ZVPX 1QTNA 3VA1A 1S2NA 1L7MA 4FVTA 2XT6A 4OK3A 2C4TA 2OQIA 3LSTA 4EKGA 3WGNA 2B3TA 2DCUA 2JCXA 1VCHA 2WM8A 4P7JA 1XNQB 5KTTA 4MUKA 4PFJA 1NW3A 2Q0QA 1T9AA 4YAWA 3UJCA 3W90A 4AJ9A 5M34A 1EX6A 5L53A 3AXSA 2FWAA 1ML3A 1NBHA 2WHQA 4H7PA 2OCIA 3N8GA 3E05A 4UBLA 3R23A 4CR7A 3RYIA 1N6NA 4WVLA 1PR1A 3ZCXA 1A8PA 1OXXK 2QYSA 4QUDA 1YA4A 1ISGA 1LTHR 3L1KA 3OCCA 1UP6A 2FEKA 3USCS 3KU1A 3WSTA 2PSJA 2X40A 1KI6B 4B44A 4BLSA 3BEDA 1CE8B 1T8UA 4N3CA 4QEKA 4W8GA 4CTOA 4EI2A 5I7OA 2CJFA 3K4PA 4FGSA 1P2UA 4BU0A 3BXEA 3G2IA 2G1KA 3QYJA 5HZHA 1NRIA 2O14A 1ZSYA 1RI1A 5JD4A 3ITEA 1WPXA 2VRWA 2B9EA 5JH7A 3R3JA 1E7YA 3ZUGA 3TGPA 1KJQA 1L5FA 3U0BA 2PKQP 3U3OA 3GQBA 3B7WA 1V6SA 5KPJA 1RVV1 2BTQB 2FG6C 2XQJA 1NVEA 1TL7C 3QBTA 4H7DA 3AC0A 4MS1B 4RE5A 1P2TA 3DHVA 4NNPA 4ALLA 1HFJA 4X1IB 1KEEA 3FPBA 1DJNA 4H3KB 2IRWA 1U8ZA 1Z7WA 4K1LA 2IUEA 2O2ZA 3U60B 4OBXA 4KX5A 2XZLA 1QC5B 4UJ3A 2QD2A 4NZPA 1SR8A 2FCRA 2A67A 1TYBE 2QORA 4GC5A 1SCBA 3HHEA 1O95D 1ZM9A 2QAIA 3CA8A 1GWNA 2ZLBA 3WQSB 3AR9A 3HB5X 4YRRA 3VISA 4Y0NA 2CXUA 2ZCUA 2O2HA 5HFJA 2AXNA 2XODA 5D01A 5JWRA 1YV9A 4YP5A 4OGFA 4D9JA 3UQZA 1DUSA 4MROA 1YQ9A 2CK3A 3B6IA 5KKNB 4NP6A 4KV9A 2Z5VA 1IY1A 4QUIA 3RK4A 5BSVA 1O57A 1OKKA 2WWRA 2GBPA 4QJ4A 3S6JA 1ZVVA 3A2MA 4J76A 3GLKA 3DXZA 2C57A 2VQDA 3QHAA 3GDOA 1CFZA 3W5HA 2D5CA 3STTA 3FROA 3H3JA 3UK6A 3LUFA 1C9KA 1DAGA 2DH6A 2WJHA 2BN4A 1XJ0A 3MJSA 4NE7A 3UO8B 1Y1RA 1SVNA 1B8UA 3FWHA 4Q3BA 5BYBA 2E5LB 2UUAB 3TG2A 1JLHA 2GEKA 3GDFA 1GNRA 3DB1A 3BCRA 3IJ5A 4LDZA 4O4JA 5DE3A 3CZ9A 4AJNA 6REQB 1GZ4A 4Z5XA 1VB3A 1ZW1A 2H31A 2FEMA 4QTUB 2XKBA 4K87A 2IELA 2WTMA 3LA8A 1FDWA 4HNTA 3AUFA 3A9VA 4YCAA 1R6DA 4CF5A 3I8OA 3E5MA 5DV9A 1VKRA 3U9LA 4MPTA 3CURA 1KDOA 5L6LB 4J2TA 4IKEA 4R7TA 4REOA 3UJHA 1G8FA 1DG3A 3NYWA 4RENA 4KWEA 4TSKA 1F8YA 1QZZA 1UHTA 1E2EA 4IZIA 3OP4A 2X1HA 1XDGA 4R8VA 2QN3A 3EC2A 1V5FA 2X2FA 3EH2A 3RVMA 1IY9A 2RBEA 4U3JB 5EZSA 3CBQA 2V7VA 3SI7A 3QVKA 1ZL2A 4EG8A 2A35A 3IAAA 2O52A 1YVEI 2P7HA 1C3OA 3ZWOA 3P0JA 2V74B 3V7UA 4UPEA 1Z3IX 4KRXA 1V8PA 1Z07A 4LUCA 4B3TB 2PBZA 4HB3A 4BO8A 3PLAE 4MQEA 3UUEA 3SYRA 2P3OA 5CDUA 1P8JA 3B1WA 3TRJA 2HSDA 1O95C 4L0QA 3A14A 3DEKA 2Q07A 3SFVA 1U0EA 1IDOA 3PA8A 2C2YA 5EZ6B 4EJSC 3KVOA 5ALIA 3NHUA 2P4HX 5JCJD 2ONKA 1NBOA 4U5QA 4WINA 4ZMBA 1ZRMA 3OEHD 2CBGA 1DCFA 1QIJA 2E4YA 4LV5B 2D6FA 4G09A 3A6JA 5GAJA 5WRFA 1I94B 3RROA 3ZTYA 1R4ZA 4TT8A 1H0KA 1WSDA 2C2XA 5AM2A 2V5UA 2VTVA 2ZI4A 4RD2A 2R4TA 1ZG3A 4RS3A 3DDNA 4R69A 1JHMA 5B3LA 2WTNA 2FLWA 2CXSA 3FUTA 3DE3X 3DVRX 1GN9A 4L1KA 3R09A 4GLOA 1QFXA 4D2IA 5LWQA 2PX2A 1R5NA 3IPRA 4G01B 5JVDA 1DNPA 4C7OA 2XNSA 3O8RA 3BG5A 1S8FA 3AHCA 4KVGA 3RD5A 3UT0A 1HDRA 3WGZA 1P7CA 4NCIA 3SSOA 4ZAZA 3IQHX 3IIKA 4YRSA 1JEJA 3OMLA 4Y2XA 5C4IA 1T0UA 3QQPA 3V4LA 2VXOA 4XIYA 3VPXA 2CE2X 1QCDA 1VJ0A 3OPNA 3OKAA 4XASA 3GLIB 3C7DB 3GY0A 5DTRA 2H7YA 1ENYA 4OI2A 5F9HA 1DFIA 2WF5A 2E6KA 1WUHS 2UUOA 2OHOA 3A0RB 4OFWA 2HHHB 1SHTX 1KAMA 3EXG1 3I30X 2M6LA 2VH2A 1ZRSA 1VJTA 5GV8A 4AZ0B 3X1JA 4Z3KA 4LSZA 1VMKA 3OJFA 5FUYA 3DBLA 1Y1SA 2NACA 2O8NA 1H6AA 3V4SA 5LYJB 5AW1A 1BSVA 3AVYA 1WDKA 2QMOA 1WNFA 5IAKA 4UOZA 4S2UA 6YASA 2ZXEA 4NOLA 1CFJA 1GCAA 1MX5A 2W0MA 2XYHA 4RFSA 4BS9A 4ZCQA 3O8NA 4R5HA 1MR3F 1XTKA 1YB5A 4GKJB 4JEHA 1H3EA 3L0OA 2GBLC 4OOEA 4BIMA 4D92A 3CW9A 4CMGA 4RTLA 5A62A 1V8DA 1JEOA 4YLYA 1OFVA 5DTEA 2IZ0A 3T4PA 2OXCA 1X2EA 4R1QA 1C29B 1JW9B 1CR6A 2P2ZA 3MAAC 1F0YA 2PU7A 4DREA 1O97D 2ZYIA 3MWFA 2CMGA 3VKHA 1IZ8A 5KHOC 2FF7A 1ULTA 3NJRA 1F0PA 4YLGA 3NBUA 3DOEA 4C7JA 5LA6A 3BJRA 4DZTA 5ICCA 5F9MA 5KU7A 4YP0A 3CRW1 3PIDA 3WV5A 5DZSA 1K8QA 3UATA 3KELA 4B6EA 4DMRA 1L5VA 3WADA 2Q46A 3EZLA 2RK4A 4GI2A 1P39A 1XB2A 3O2JA 2FSFA 1YR3A 5CLQA 1JN0A 4P22A 3MTQA 1Z4PX 2GCOA 3AHDA 4RPIA 5HSGA 4AB1A 1ZVMA 1ZN8A 2G0NA 2JGRA 3G5AA 4H31A 5LKAA 1XWFA 2Y9MB 3EF0A 3GEHA 3I28A 3H05A 2VF8A 1F6WA 1KETA 4B4OA 3IL2A 2G9ZA 3A32A 5DCUA 1ATIA 1OGIA 4IKPA 2DHCA 2Y05A 1VGVA 2ODTX 3SNKA 4PANA 2VOEA 3OMXA 3PRHA 4UQLA 2P0AA 2ZYGA 2C0CA 3IJEB 5TS3A 3D7MA 3PC3A 4HUTA 2YJNA 3FPAA 3PFCA 3N9IA 2GSDA 2WTEA 1GPBA 4V0QA 3V8PA 5BSWA 2ZTSA 3A7EA 1OPRA 3LQ2A 5H4HA 1A71A 1RE1A 3F2VA 4ACBA 4GQIA 5K8JB 3FNHA 3NT2A 1JMVA 1GKUB 2WJ3A 3B51X 5F23A 3BKXA 1U63A 4E7PA 4EVRA 1O5IA 1T1SA 2N1BA 3JU3A 1C7ZA 4GWLA 4ZVVA 5IJWA 1CBUA 2Z2IA 3GFQA 1TEHA 3NHYA 4UU1A 1OXVA 1XLTA 2EW8A 2ZI6A 3K9BA 3L1UA 4GGMX 5EJMA 1CCWA 3L2OB 3D9QX 1U7VB 3Q8MA 1Y3HA 4C7OB 3VBEA 5PGMA 4BGIA 4WKPA 1VL5A 4EFMA 1GTZA 3FNRA 3WQRA 2X42A 1H94A 3GZNA 1N3YA 4L3VA 2AKEA 3A25A 2O8CB 3HCCA 3G82C 4IPTA 5K3FA 1MFZA 1R4AA 4X41A 1NQXA 1TVEA 5EMKA 1T1JA 4L50A 4Z4FA 2NO6A 2MIIA 4MUNA 5JYBA 3KQKA 1NV9A 5E9QA 1JKJB 1K0FA 1LY1A 5A3JA 1ISIA 2YVLA 2ZS8A 1LKZA 2W22A 3PV0A 1CY4A 2HX1A 4KQCA 4LJKA 4RYLA 4TWZA 2I6SA 3E2PA 2VI5A 3A1UA 4QQNA 1PG2A 1SUCA 4Q3KA 2WUVA 4BFWA 5AQ1A 2YZKA 1X7DA 1M6YA 2COEA 2HMSA 4HFNA 4JP2A 2O7VA 2EXXA 1U8UA 4YMSA 3A6HA 3VKGA 3HU2A 1O97C 1SBQA 5C1PA 5KIAA 1TLLA 2IODA 3DKKA 4YS6A 4KREA 2Q49A 3F3SA 4OXKA 1VPTA 2FJ0A 2DUUA 3BWDD 4IJUA 1PL0A 1C7FA 3WB2A 4YMGA 5DM60 5FP0A 2H57A 4BDSA 3IAM1 8ABPA 2A92A 1PJLA 1SCUB 2O2GA 4Q24A 2WNIA 3GRPA 5EQTA 5A6VA 1V16B 1U5CA 1X7YA 2GK6A 3ENNA 2OTCA 3R40A 4KPUA 4Y6OA 5DDIP 1YRLA 3GOQA 2MMGA 4MWDA 3SX0A 4YMHA 3M33A 1U4SA 2UZ4A 3M1LA 2ZTUA 1YA6A 3FN4A 4U7PB 1E6MA 4JI4B 3PI6A 2YDXA 4I9UA 1DBRA 4RQBA 1QYDA 1CUJA 2D1FA 4FE7A 1TEXA 2QU8A 2YHSA 2EHJA 2ZRQA 3L5OA 3GPDG 3F5DA 4X60A 5DMHA 5H4GA 1T24A 1A98A 3GJ8A 2P4UA 3KQYA 4R3UC 3CW2A 3H99A 3RTGA 1MH9A 3JZMA 2HIGA 5IK2D 4ZYUA 4BO2A 4KR9A 4O4JB 1I1NA 3IAS1 4ENQA 1NNI1 5C5EA 1LJUA 4N6OA 4Q0MA 4N7MA 9ABPA 3LLUA 4TOIA 2AEEA 3ZHOA 1SHKA 1FLAA 4HMOA 4YROA 4UJ5A 2JAQA 3GEIA 1VE1A 2PM8A 4XD7D 1HTWA 3LFTA 3A4LA 3UTCA 1QDEA 4HH4A 2ONCA 1PP4A 3P0RA 4HX9A 3C3MA 3W77A 4Y6RA 3RV4A 2PT6A 2VSQA 3A6LA 4JXXA 2W2QA 4YRZA 3D3WB 2I2CA 3JQDA 3GFPA 4OLHA 3TIIA 1MTZA 1SIWA 2IYXA 3PKZA 3VVBA 4IXDA 5J4VA 1Q91A 3CT6A 4ZQFA 2XGGA 5C7OO 3K0HA 2ZAIA 3GGOA 1EB9A 2PNJA 4XWOA 5FAKA 1CLUA 1L7PA 1AT1A 4LMBA 2Q4EA 4PPGA 1CUEA 4BPBA 1AURA 2XVAA 1M66A 3Q3IA 1C9YA 3IEXA 4K26A 1N5MA 2D1SA 2CDAA 2PPVA 3A6KA 3KTAA 3A1CA 5JAZA 2J6CA 3IKTA 2FMTA 2I76A 1II8B 3RRFA 1XMQB 4B33A 3AFMA 5CUQA 2RCNA 2QROA 3BFKA 1D2AA 2DU8A 2P2LA 4QO8A 3KR1A 4X1IA 1FK8A 2AFIE 2IYPA 1HLDA 2WTAA 3KPUA 3QTTA 5ENDA 1KQ3A 4PLVA 1G41A 1EYZA 3ZKWA 1K75A 4L27A 4ZK2A 3H1BA 5E1OA 4D0RA 5HQTA 3MS4A 1K3UB 1W19A 1U11A 2HAEA 1NL3A 3WLOA 1EPUA 1QIHA 1EE2A 3TB6A 5M2QA 4Y0VA 1V7CA 4MV6A 1EK6A 4MKRA 4IGKA 1YUBA 1RWNA 1FTSA 2ZS7A 3H0EA 3AJAA 2PBRA 3RS8A 4N49A 3GH1A 3OF5A 1OWNA 3C6QA 3MMZA 1ZRNA 2IIBA 4BNDB 1OC2A 4C2UA 3UB2A 2D2FA 5EVJA 4DCGA 2B1QA 2QLNA 4ZVRA 2BKEA 5IYZA 4LDQA 1O9GA 1XZ8A 3F5FA 4NFYA 4K9OA 3SGLA 2FFRA 5EWMB 2JKVA 2DB3A 1KQPA 1VBMA 3R7FA 1JA1A 1XTIA 2GPNA 2P2DA 1VCIA 3MJHA 3B2QA 2P0EA 4QUAA 2VTBA 2AJ8A 1E98A 1FDIA 3QEBZ 3WFJA 4M22A 3UUGA 3TAUA 3VPGA 3MBOA 4KYIB 1FLVA 3BZWA 2DJ5A 1EQAA 4YAFA 4JIVD 3LL4A 2GAOA 1Y8ZA 3FM9A 1G5RA 4NECA 3OF3A 2C1XA 1KSGA 1Y4DE 2R96A 1A04A 3C1TA 2ZT5A 2IH4A 1NSFA 4H1UA 4F21A 4X64B 1K5GA 3HR7A 2Z1NA 3DNFA 3P94A 4PGHA 3R3UA 1MOZA 1U3TA 5AKZA 1IXZA 2W2MA 1UK8A 2P6RA 5B6JA 1WV1A 4GOJA 3UHPA 1KI3A 3CTMA 4FTWA 5SY4A 1UJ5A 1V1MB 4BQEA 2JCGA 1KHTA 2BMWA 7REQB 1JNYA 1RKXA 3TOCA 5F5NA 1JQEA 1J4OA 2ZR7A 4WCDA 5FWDA 1EEXB 4PZPA 2JVJA 5I9NA 1W5BA 2WI8A 1ZBDA 2FEZA 4G0MA 4YAIA 5GJCA 4FHZA 1ODJA 3U49A 1A5BB 4CKWA 1DIBA 1PR6A 4GLFA 3WAGA 4J4HA 1U3CA 2X1VA 1NQWA 5FPQA 2KFUA 2BM9A 3IQDB 4CFYA 4OQQA 3ZZUA 4PQEA 3T5CA 4KNWA 4IIHA 2JIZD 2ATEA 1KI9A 5IKMA 5LN1A 3RHSA 2EJVA 1Z17A 1MW9X 2IOYA 2N42A 2X3YA 3OCWA 1PJZA 2YBDA 1V2HE 1UC8A 3RC2A 3T5GA 5T4BA 3T7CA 3C16C 1IEWA 1QUEA 1ZONA 3PP8A 2E7ZA 1SBCA 3UXHA 3FKSD 4BNXA 1QDUA 2HNAA 4AZWA 3MM4A 2QYOA 1U2TA 5HRAA 1SEVA 5TQ2B 3VX4A 1ZX1A 3L4SO 3WBBA 3PR1A 2OK8A 3IP7A 2YV4A 4NDNE 2HBYA 1U0TA 2X2OA 3GRKA 3JARA 1IATA 3PG5A 4B9AA 4HZGA 3RVRA 4NLLA 2PTHA 1NU8A 3ISVA 3M9WA 4QRIA 4EUSA 5EIBC 4DCJA 2N0SA 1UXKA 2Q7OE 3T94A 3L7CA 5MN5A 1X19A 5CK5A 1WABA 3WRYA 3HFGA 4CIYA 1R6XA 2Z2KA 4IS2A 1UKBA 1I24A 2PMKA 3AKEA 3MC1A 5CA1B 3EZFA 1CG6A 3M82A 3ZE0B 1OAOC 5ES4B 3OLXA 3IBFA 1YR1A 3V6LA 4KW7A 2R11A 5DLYA 2ENUA 4FB4A 1YL6A 4N5NA 1ZH2A 2DWOA 1OXUA 3MQFA 3OG9A 4LC1A 4LJ8A 1T4CB 4R41A 4ZT7A 1NYRA 3RFFA 4CW7A 7REQA 1OBFO 1ZWKA 3OC0A 2HJGA 3A2LA 3WGJA 2O48X 2R7KA 3HYCA 1U7VA 1IAQA 2I7CA 4L7VA 5LYJF 1A76A 3P9NA 4UVIA 4HBGA 3IDZA 1JBQA 3AK4A 1LSSA 3BJEA 3R3ZA 2FVXA 5G0SA 4EMTA 3R41A 1CNFA 4QDKA 2QAJA 1LI5A 1V8ZA 4MV3A 1AUQA 2ID8A 3H9UA 3R5FA 3V5NA 1P5FA 2FZGA 3AYZB 5BW5A 3TFWA 1T34A 1KA9H 2EWVA 3F97A 3U7EB 5MN6A 1MO4A 4JP5A 1VI2A 1HRKA 3PIIA 1P5HA 4BO3A 2INGX 4C2TA 3WJ1A 2PO7A 1I7QB 3F4BA 1AGRA 1QRRA 3OP1A 4U7WA 2PVPA 3RLIA 1L5YA 4OPMA 1DU4A 5KKCA 4P54A 3I62A 1NTOA 2MHCA 1PFVA 4G8JA 2BBWA 1P0CA 3QITA 2UZ0A 2H63A 4B4DA 3PNLA 1SQ6A 1DG9A 1Z73A 3K2QA 3DEYX 4Y1EA 1E8NA 2Q6VA 5JUWA 2EP5A 4HS9A 1JDBC 4GE3A 5J5CA 4WFKA 4MIYA 5JNUA 1R4NB 4PVDA 3WIEA 2PAFA 4LTMA 3CRQA 3GHHA 3R7WB 5B5SA 5JCOC 1H6DA 2CCKA 1LLDA 4RMNA 4HPJB 5LKRA 2BF7A 4CPDA 1VI6A 3L7KA 4NPAA 3ZD8A 2JLUA 1QCZA 3QVVA 5DOVA 1FFAA 2QBYA 3SF8B 1XK6A 3JPWA 1E7MA 1G3IA 1QS0B 4GRAA 1JQ5A 3HPQA 3C3WA 4NE2A 3EGIA 1AS0A 4WLEA 2A7QA 4PNHA 2D13A 4TV9B 5I5GA 1QHSA 3E5NA 4P35A 1YJXA 3UJ8A 2QTZA 3ANTA 3NMUF 3H2SA 3LPNA 4H6WA 5K0JA 3GJ5A 5F7OA 4KQ2A 1LDYA 2AG0A 2RHJA 1H2HA 3FLEA 4G1CA 3JYPA 3AOGA 4KMRA 4TKLA 4XTRA 1DC5A 5G4KA 4KE9A 5BUQA 5G1NA 5J4LA 1WTCA 4N8DA 2Z56A 3UKOA 3C1UA 3V00A 2QNBA 4P4UA 5KQGA 1QCYA 5FJIA 2W11A 3IQIX 3M0EA 4BYGA 1AUVA 1LH0A 4M9UA 2EKBA 2RHLA 3Q8XB 5CXSA 2VAPA 4FT4A 3AEQA 4CGYA 3C6XA 2XQIA 2AQHA 1PV4A 3W34A 3G9ZA 1DO8A 4PSAA 1Y6QA 2PGDA 1L3CA 3H9CA 4DC9A 1RM4A 3R5JA 2HWYA 3U44B 3E0QA 2CNWA 3LT0A 4JB8A 3T7JA 1PJ2A 1A97A 5I9LA 4UUNA 1QDLB 4WH0A 1ZOLA 2R6ZA 3B9QA 1Y3FE 4EY8A 3ND9A 1LSUA 1BW9A 3QFRA 2PT9A 5LWHA 3I01M 3T35A 4F9EA 5DK6A 3U3MA 2BEVB 3I6UA 1H23A 1PT5A 3DTVD 4XSGA 3QNUA 4XKJA 3A4MA 2XIJA 3ILVA 3KJIA 4J49A 4J9UE 4NY1A 5JZBA 5EESA 5DBFA 1WCV1 1R9JA 4C4ZA 3G9UA 1R0LA 3KVYA 3DSRA 3NIBA 1UJBA 3LW8A 4I0WB 5JC8A 4BY9E 2NN3C 2SICE 1E9CA 4GMXA 1VE7A 4DB2A 2ZPUA 1N8KA 2LW7A 3UZUA 1C4OA 1GCOA 2OQRA 3HI4A 1USIA 2NV0A 2PIEA 1A69A 2Y6VA 1WUIS 5SZJA 4BNKA 5A0TA 2JRLA 4E14A 2BE7A 1JXMA 1PUJA 3QA3E 4M9QA 3MOGA 1NZJA 1D0SA 3SE0A 3E9YA 5CLLA 3C98A 3AFGA 3FE2A 1QS0A 1S8OA 2Q3EA 1J0BA 4MB6A 3C41J 3OPYB 4XDGA 5LQCA 1E5QA 1XIVA 4QRDA 4RTNA 3RYHA 2PLRA 4EKDA 2IA5A 5JJIA 4N0EA 3FPEA 3VOSA 4KB5A 1AIPA 3KQQA 1RU3A 5EKDA 1N25A 3BA6A 1UJ2A 5BN5B 1WJGA 2XNDD 1GTL1 1TJNA 1AK1A 2DPGA 3BQNB 3A4TA 2FGJA 1OBCA 1V16A 1I7PA 1X7YB 3I12A 2PFKA 4ZOBA 4ZJUA 3RIYA 1T0HB 3ZI0A 4AKSA 2BCJQ 1P2BA 2AOVA 1GUFA 1A5ZA 2YJTD 3P2JA 3P0HA 4MI1A 1S2OA 4NBKA 5F1YA 2P68A 2OFFA 1MOSA 2YHAA 4H16A 4H7HA 3EXG2 4B4VA 4N40A 3C5EA 4F56A 4EKNB 3NM6B 1U8FO 1IUNA 3V9AA 4CQMD 4DBLC 3T1YB 2UAGA 1ZM3A 3CNQS 4IEIA 3OQPA 3PXUA 4KR0A 4MEAA 1Z4MA 2HRBA 2RAFA 221PA 1E92A 2QRVB 2V1UA 2NNWB 3AJRA 4X91A 1QGYA 3UV3A 5BMVF 3ZCPA 5AMXA 2XZOA 2XMBA 3E3OA 2GN4A 1CJUC 1SU4A 2WSLA 1EWTA 2Q4RA 3FZNA 4IM7A 1PYGA 3RI3A 1A82A 1K86A 3OIWA 4M21A 4QTYA 4NJEA 4RDXA 1ML4A 5I51A 1CKEA 2I55A 3HYNA 1YJQA 3F4LA 3PXGA 5C37A 1KQGA 1CUYA 1GTRA 4REQA 1UMCB 4FGJA 3T9DA 3NXKA 1FMCA 3OLVA 1DKMA 4M1WA 1FA9A 2CXPA 4KPGA 4M1KA 1XTQA 5IUKC 3W8FA 1DAFA 4EQ6A 4NCBA 3N86A 3KOMA 2AFFA 1ADCA 3GDWA 5JFGA 2ADOA 4A9AA 4J90A 3TPFA 2JFGA 4BB6A 3A6FA 4M0MA 1Y5IA 3GAZA 4GC9A 1H85A 2CB0A 5DGIA 4UUAA 3A2NA 5DCLA 5DN9A 3QWFA 5J63A 1UMBB 1MQ9A 3ZE1B 4IZHA 5C4VA 2Q3BA 4O8ZA 4OAOA 2W42A 1KSFX 3ID6C 5DTJA 4RM3A 3RC8A 2HWKA 1NN0A 4OQXA 2OZEA 4KWIA 4BVBA 2X0EA 2JATA 1UPTA 3W2TA 1K8ZB 1D9ZA 5IMBA 5GVSA 4QGBA 3RRNA 1B8NA 1NSYA 4K2AA 1F8GA 1N2IA 1DKNA 1Q3TA 4BNZA 2NUPA 1Z5UA 2X3UA 3K4QA 3TTUA 1I9CA 2J3DA 1RQ2A 2BBOA 2WJ4A 3PTAA 3ZLVA 1T5IA 2D0DA 2R86A 1NUTA 3MJVA 2NZXA 2BEWB 1R0ZA 4J16A 1U31A 2O1WA 4J0CA 2IPOA 4QXMA 2YOFA 3KVRA 3VGJA 2ATVA 3E15A 5DIZA 5EE5B 3BHIA 2HMUA 1LS1A 1L4UA 4Q4AA 1CY1A 1PR3A 1SCNE 1K4MA 3L02A 4B6GA 3OJCA 4EPYA 3LM8A 3WB1A 4KFSA 3NHPA 1OH5A 4J0QA 5AVKA 2DFVA 1XHLA 5EXDA 5KTSA 1KEZA 5B3JC 4FOOA 1QV9A 1X9HA 4UXHA 1XVUA 1F2VA 5JSKA 3RSZA 1E3SA 4EHIA 6Q21A 3A7DA 1U7PA 1AA9A 3IXLA 4CVNA 5CLFA 4J1NA 2V7WA 5K8CA 2OXRA 2ORIA 4IMPA 4JBGA 4GPTA 2XAUA 3VZBA 4HSEA 3CN9A 1K7EB 1BMDA 1VL8A 1PZEA 2G6BA 2IZ6A 3HABA 5D6NA 4IF6A 1SUFA 1BVHA 1KS9A 3UICA 1L4LA 2OZVA 3CF4G 5I7AA 3GZJA 4AY2A 1EK2A 3QOXA 2H4WA 2IHJA 3WICA 5AQEA 1RRPA 3R0ZA 1L7NA 4FEEA 5J40A 3FSGD 2G9UA 3AHJA 5TGTA 4JBYA 3TK1A 3NH6A 2C5HA 3NPAA 2C83A 1X87A 1HQYE 2AFHB 2OBXA 3D6UA 5LYYA 2YKGA 4LY0A 3WJ7A 3BIJA 4DIOA 2NAFA 4DG9A 1VLHA 3R7DA 5G4LA 5JFOA 3I61A 1R0SA 3P9CA 5BNZA 3CLTC 4QUJA 3LDFA 5JSQA 2F3TA 2TMGA 3ZE7A 4DWOA 3TXXA 3H1GA 1UBUS 4JNKA 1O0SA 2O3TA 4Y6LA 5CMLA 4ACAA 1ZEMA 4UHFA 3W6ZA 2RD2A 3L01A 4HAVA 5K0LA 3V4ZA 2IYSA 1W0JA 2JGDA 3MCVA 1LVGA 4IVRA 3A4VA 5SICE 4BDTA 4M0FA 3H3XA 5D8DA 3CISA 4V1CA 2HLDD 1GL7A 3CYFA 1M3SA 3VJLA 4JS0A 2I66A 3L7LA 5FPKA 5HFAA 3G2MA 3CSSA 2MDTA 4IUCS 3D2CA 2N3ZA 4TMTA 2JD0A 3CR3C 3DYVA 3GPBA 4FGWA 4LRWA 4LRQA 4W7IA 1H1LB 3OLQA 3BGWA 2XQVA 1F9AA 5DN6A 5HIJA 3P2IA 4JQYA 5IWCA 1R74A 4O4LF 1F6BA 3HC7A 2YY7A 4K3VA 3G2LA 1I1QB 5CW2A 4IX9A 5EMLA 4ZALA 1K8YB 4PHHA 3TW4A 3UHAA 3GZ4A 3ZIAA 3EYAA 1ZIOA 4IRUB 1YB7A 2XTMA 4MGEA 2UYOA 3TQFA 4GFDA 1Y7IA 4GR9A 1G20A 1XGKA 2GK3A 1ADJA 1L1RA 2WMYA 3B6EA 1PEKE 1PZNA 3H6GA 4FYVA 5ALPA 1PT8A 1Y5MA 2V3WA 3PUJA 1N78A 1N75A 5KVAA 2X14A 1XZAA 1MXFA 4X6UA 4COOA 1RP1A 2F90A 2VDQB 4JUFA 2DX7A 2GILA 2FMIA 4UTOA 1L0BA 2IIQA 3PUYA 4G2TA 4ZQGA 5THKA 1T5SA 3SJ7A 5K9ZA 2DR2A 2CDNA 1ACJA 1DEHA 3CNHA 2PUAA 3BZUA 4LISA 4JT9A 4LQCA 4WASA 4UU7A 5B3AA 4HV4A 2YWBA 5B1SA 1BMTA 3UAXA 3JQ9A 1ZK3A 3QOFA 1JLLA 2FSUA 3LCUA 3NDRA 1QU3A 3AUYA 2G07A 1ZIYA 5H81A 4EI7A 2GB4A 3EXAA 4P3KA 4AZ3B 2ZRGA 5BPFA 5AK5A 5IDXA 1PZFA 3R20A 2GLTA 2YZ7A 3MRTA 2AQKA 2ZI5A 3O1LA 1LBEA 1YB6A 3QEKA 5E1DA 1KKMA 5LXTB 1RI4A 3LXUX 1FE8A 4PHTA 1SZDA 3L8FA 1QTRA 1W2WB 5AUNB 4GYYA 3FWPA 2OYRA 4AWXA 1NRJB 4HF7A 1P9RA 3MELA 5ALHA 2RHHA 2IKSA 1GJRA 3ZDXB 2FWPA 4RAQA 3R6LA 4DMGA 5LD2C 2O8DA 1WMEA 1P74A 1EVIA 4NFHA 5EP4A 1D0VA 3WDMA 4F6CA 4FYHA 3JVIA 2Z83A 3DAPA 4NARA 1KAOA 2ZJ7A 3EWAA 5CDTA 2QD1A 1NNSA 4K6OA 4TWBA 3DDZX 6REQA 3QUSA 3W7BA 2ZOSA 3THOA 2JLRA 5FOQA 1Y6ZA 1AX9A 3DCIA 4IOJA 1M72A 1A9YA 4RHYA 3OSUA 1T3LA 3ZGYA 1NI4B 3GRFA 1JG1A 1XQYA 4FM9A 4MW6A 4G4GA 2HHLA 2EZ8A 2DWPA 3A9UA 1GA6A 2IXGA 3I8SA 2DMRA 5FXMA 3ONVA 5CNKA 1HY3A 1SQ0A 3T7TA 1BTOA 3ILSA 3AF1A 2CV1A 1M6WA 3C7AA 2H9IA 1B6RA 4OP1A 3UAGA 3O75A 3PYXA 1LI7A 1W94A 4DS3A 3B13B 1FX0B 4TGLA 1L8QA 2I6FA 3CG0A 3I5UA 3KLPX 2ZQZA 1ZL0A 4OB8A 4OD0A 5GINE 3KSZO 4C7VA 4EW6A 1TM4E 3G9TA 3HCRA 1ZNYA 2WKSA 5ARDA 2OGZA 3DBIA 4I3HA 5DNUA 1JEYB 1M2FA 3O90A 4A0SA 3AERB 2VO1A 3IVCA 1OVGA 2V4UA 2COUA 3KE8A 4BZXA 4D5EA 4BMOB 4XWTA 1P1HA 3SHWA 5AOAA 4OM8A 1KVQA 3M1IA 3ZH2A 2H5LA 4TVBA 3WIDA 5CCDA 1OJ7A 3CJQA 1YZQA 4US2R 4WOJA 1IVYA 2AZ4A 4E88A 3VJMA 4UZEA 4B7ZA 4J7UA 3TX2A 1CF9A 2ZBEA 2PE5A 2DBRA 1KZ6A 3IPYA 3SZ3A 3GV0A 4AD8A 4KDEA 4FFPA 4RHTA 1ZMOA 1P4HA 2WHXA 3AEQB 2WUGA 1USGA 1HMPA 2PZGA 2PZAA 3B7PA 1QAQA 4MRMA 1MB9A 3DL4A 4P58A 4NBUA 5KJ1A 1UJXA 1N0IA 1XMIA 3ACBA 4K9RA 1GL6A 3T9FA 4UEQA 4B3SB 1LLCA 2YHUA 4O2BB 2WK1A 1GYRA 3EC1A 4PG7A 4BNVA 2V6GA 2W58A 3F9RA 2WV7A 1MC5A 2V9PA 4FOPA 1W76A 1KBOA 3A11A 1Z6ZA 2WAMA 5HRUA 4K8OA 4CFSA 1A1SA 4HNRA 5A3SA 1H8HA 2NO9A 1M0WA 3QZUA 2P2SA 1AK2A 3ZJ4A 5D2CA 4C9BA 4CCSA 1P62B 3OFJA 5B2FA 4BUCA 2HYDA 4W5WA 2LIPA 1M5UA 4D6YA 1Y8CA 1V5EA 1AKNA 4H1VA 1I4TD 1OI3A 2ORED 4YUVA 2PSFA 3STHA 5JDIC 1Q19A 1HETA 2QTVB 1Z3CA 2XYQA 3PQ4A 4FQ7A 3GEEA 4IJWA 3U19A 3Q5GA 4UTRA 4PX9A 4BX2A 3V8NA 4MWTA 1Y5NA 1SZCA 4RDHA 2PKWA 1TTPB 2C7GA 1GG9A 2WJPA 4RA9A 1AM4D 4RZUA 4F84A 3CY6A 4GXQA 3PF8A 3IB3A 3LOUA 4NE9A 5CNMA 1E2HA 1F0NA 4F5ZA 1VSUA 4RV4A 2H1WA 1I3CA 2JA2A 2OCPA 4LX8A 4HZUB 3UBMA 3T34A 4JGIA 1UFOA 3UG7A 3HM2A 5FPPA 3WYDA 4UASA 3SK0A 2PXAA 4XGIA 5BSHA 4GZ6A 2BE9A 3INTA 5KNBD 4UMDA 3FFXA 5BR1A 3ZE8A 1XHEA 2EGGA 2ZU6A 4L6IA 2Q9AA 3PXDA 3SC4A 3SAJA 4JCCA 2RI6A 1K3FA 4MW5A 1SGWA 3G02A 1L1QA 4UHEA 4ZCPA 3VDXA 4ZGWA 3AEUB 3FFWA 2ZR0A 4IG4A 1PNQA 2PV0A 3SXJA 1S1MA 2I7VA 1GV1A 4YAKA 1HDIA 3HBAA 2H8GA 1TF7A 1IPFA 2H29A 3H97A 4MRMB 3QPWA 1GQRA 3QF7A 3CLSC 1FRNA 3OOYA 4R1TA 2Z5LA 5KC8A 5LOVB 1LK7A 1WUTA 2DP4E 4OHFA 2QXYA 3FG9A 4OHVA 4UATA 4WFQA 1TXGA 1NXVA 2C20A 2IYOA 2XH8A 3AI2A 2IHYA 2C7VA 2JEYA 4HNVA 4OJNA 4TSFD 1G5TA 5TPWB 4FR0A 1AV6A 1CK4A 3PYLA 3UW3A 3IESA 1ZI6A 4Q48A 3ES9A 3VU1A 2DQKA 4BVEA 3QUCA 4K5QA 4Q16A 1MPXA 1WV0A 4OX9B 3M7IA 3Q7QA 3ND5A 4IMIB 4RY9A 4EG5A 1GKKA 1Z4KA 4TKMA 4BWGA 4LBVA 3KUUA 2YW9A 1BCRB 2G72A 3WLAA 5IJ9B 1HLFA 2YTZA 2X5JO 3PQFA 2RI0A 3PK0A 3DG9A 2C96A 4OHRA 5CBKA 1XLUA 3E5RA 1XCJA 1N1DA 4L9RA 4WADA 3AKYA 2J07A 5F2EA 3N05A 4HNGA 4KUHA 1S3IA 2JC3A 2RH4A 3HJNA 4FN5A 1E1CB 3JWEA 4BN4A 1H42A 3ADKA 5U4XA 1JQ3A 5K3SA 3SX2A 3TLGB 1PWHA 5BN3A 2OO7A 4H60A 1U0JA 2ZRNA 4HD8A 3PQ7A 2W6QA 2IYAA 1CSEE 2X19A 4JUAA 2GNPA 3OFND 2QSZA 2B5WA 1DEKA 1XAJA 2EERA 3VV3A 3H2GA 2JIOA 3KJHA 4ZOCA 1VG0B 2WNHA 1RM0A 3OM8A 1E6WA 1WKBA 4URFA 3SVZA 2HJSA 5JANA 1WBBA 4HNAB 4K0KB 1J0XO 3EQ7A 4N9WA 2AMFA 4B82A 2ZVDA 4QWMA 3Q40A 3RAEC 2PUHA 4FIDA 1N6IA 2VCHA 2IYLD 5FHQA 4CRWB 4DRXA 5INTA 1TTHA 1MEJA 2Y0PA 3P4UA 3PRKE 2VT7A 3FBWA 4WEQA 3T5MA 5ECDA 3TTWA 1XMXA 2EAUA 3PNMA 1NBME 4H15A 1M34E 1PFUA 1YK1A 1QLHA 4XWYA 4CLHA 3D0KA 2ASVA 3OSZA 1KZGB 3KTDA 3WB9A 3I0MA 2ZJ6A 5C31A 3NHJA 2RGRA 1ZD9A 4LGCA 3WLEA 1QO7A 2PJZA 4OG2A 3FIUA 4JCOA 3PJGA 3N2IA 2ZIXA 1QWOA 2YASA 4PZ0A 2D0PB 1R10A 2KJQA 2ZGVA 4NPCA 5EZYA 3N3BC 5ALVA 3ZW9A 4PAGA 1FUUA 2GN1A 5IFLA 5DLQC 3V4FA 1KHHA 4RZXA 5FUWA 2QG9A 3M6FA 5DFAA 3OQOA 3K9NA 4IGEA 3TQHA 1W34A 4IJ6A 4U2BA 2QAGB 3SOZA 1EDZA 3KQNA 5K05A 3TTYA 2WWFA 1QYCA 3BRCA 5KVQA 3MRSA 2P35A 4E5YA 5T8KC 1GFIA 4AX4A 5JS2A 3UNMA 1H66A 2GF9A 2HWWA 3AEYA 3DD5A 4MSUA 4Y2HA 3F98A 1MX1A 4UREA 4EYQA 3DLBA 4YQEA 4GZLA 1OFUA 1LDGA 4LJYA 3LSYA 5K0SA 2ZBVA 1YSCA 3DBOB 4BNLA 5CG2A 2MOKA 2AJBA 4CLRB 1HTTA 1EXMA 1NURA 1TEZA 1J2YA 1XKLA 4V24A 4Q3CA 2ZI3A 3FNBA 1IL0A 1QP4A 4A4DA 3C3BA 3EODA 3VSEA 4KQKA 3D2BA 4DNQA 1BCRA 4P86A 3E6AA 4RTKA 721PA 1VIDA 1Z26A 1R18A 3JRWA 2RAPA 1YU6A 5BYAA 5JYDA 4MJ7A 2F8TA 1KHXA 1QF9A 3D59A 1GPAA 1RQPA 2HPZA 4TX1A 5DBGA 3TI7A 5A02A 3UKDA 3HRHA 4NBWA 4V2UA 3ZU6A 2ADMA 3NOVA 2EWMA 3LV8A 3Q4GA 2QP4A 1DD1A 4MIOA 4XUGB 2BZ1A 3JQ8B 2RGUA 2ZWMA 4L15A 5LQAA 4OVKA 3N2GA 3K6JA 3EX7C 2FUKA 3NM4A 1YI0A 4KOAA 2CJWA 4FMBB 2ILVA 4G4IA 2GFHA 1TCAA 3PHLA 3MS2A 4ZD6A 5U4QA 5AUOB 4YIHA 1JV2B 1LNQA 2OV1A 3CT4A 3OLZA 1J0EA 1M7HA 3ME5A 4HC4A 5DB4A 1N3LA 1EUDB 2JHPA 3EEYA 4G84A 4OXNA 4Q4JA 4XGRA 1NUPA 2NUAA 5FUXA 3TINA 1WP4A 5AVQA 5IVPA 3SBDA 4B0PA 1JT9A 1RJ9B 2ZJZA 3N2EA 3O4FA 3U4IA 3QMMA 4R98A 3CZ4A 1J5XA 2ANCA 4BXOA 1TZBA 2VWGA 4TWRA 3V4VB 5EJGA 1L5HA 1YQEA 4D9VA 3FDJA 3B5IA 4GRDA 4MLDA 4OM7A 4L4RA 4XAQA 4KAXA 2YIVX 3ZKAA 1ZU5A 1J23A 2FNAA 2J4FA 2W2KA 2G06A 3DUWA 5L7WA 5ALDA 4XCQA 2ZRKA 3WWOA 4OA8A 5HQ3B 1RD4A 3CRNA 1C3VA 3DE5X 4IYRA 4OX9Y 3CVVA 1FJGB 1JI3A 1E1KA 2GCPA 2RGBA 4U5XA 2KB3A 1Q1NA 2RI1A 4BQRA 5BW4A 4H3HB 4EELA 3QY9A 4KITB 2NXWA 3ZQ6A 4JJZA 3BTSA 3B3AA 1RM3A 4W7HA 4S1NA 4TUYF 3ETNA 4J0IA 3OECA 3AL3A 3CTPA 2YY6A 3G7SA 5LBTA 2Z5FA 1T9ZA 3WG9A 1IN1A 4S05A 1ADFA 2VHJA 3LIIA 3R9WA 3FOZA 1D4ZA 4EA9A 4AP5A 3LX6A 1GG5A 2Q50A 4FXPA 5AJTA 1F9EA 3D6VA 4H7EA 1DFHA 1CUIA 4X6LA 2P77A 2DXIA 1DTWA 1VQ1A 3MF4A 3RAJA 4TSRA 3C39A 2OMKA 3HN2A 3HCEA 3O94A 5CTJA 3THWB 2Q7DA 2GXAA 3UMVA 1QX3A 2YX1A 3ZGNA 4OI0A 3G9XA 1TJ4A 4KODA 5T4HA 1T2DA 3G0HA 5BWCA 2PTGA 2HT1A 2H4XA 3DFKA 3NTUA 4XLZA 2IIPA 2QTRA 4QXRA 1SBHA 3D7KA 1KYWA 3L6DA 2DC1A 4IWNA 4MXDA 4R81A 4YB8A 1DOZA 2J46A 1S89A 1XPRA 2AMLA 4RH0A 4D82A 1CD5A 1EG2A 1QGUA 2E2WA 2HDOA 4BLPA 1AQNA 1D2HA 2CXNA 4CV3A 3I0NA 2WSSD 2JI9A 1ZCFA 1CNEA 2DPLA 2NVWA 4JYCA 1Z7BA 1SOUA 4LS3A 4LJSA 1N2ZA 5EI5A 2XB6A 5EHNA 1HOTA 1BDJA 1MJFA 3Q3JB 4F92B 3QELA 2HI0A 4DNOA 1RABA 1BDBA 2E6UX 1UODA 2Y67A 3FZYA 5LUBA 1E2JA 3LFHA 3H5OA 4R1MA 3BK1A 1GRCA 3DO6A 1NMYA 1GGVA 3F3KA 3LK6A 4GM0A 4Z1MD 1V7QA 3G17A 4O4HB 4CCWA 2ZUTA 1VG8A 3A58B 2VBFA 1JA9A 4J4TA 4JITA 3KOZA 4O1HA 4MCAA 1ENOA 2OXTA 4ZHQA 3RYIB 4J43A 4GX5A 3WNZA 3N2GB 5F12A 1GD1O 4QGGA 2HXSA 1WMSA 4KQHA 1Z2PX 4TN1A 1Y37A 2FZ5A 4YRQA 4AYWA 4BKOA 2FP4B 4UEKA 1OOEA 1MEOA 3B52X 3R4CA 5DTQA 5FI0B 1XZLA 3U0VA 1WIWA 2GPAA 4ZI7F 4D44A 4EIWA 1EM8A 1GSHA 4RCZA 1RXVA 1DS6A 1FU4A 5CAEB 2P5YA 2R8BA 3DTTA 4UFPA 4AJ1A 3TPZA 1J22A 1UAGA 2PSSA 5JCXA 4EHDA 4ASUA 1RYHA 3UF0A 4F4FA 1E3EA 3IB6A 3TLKA 2ZROA 1GPKA 1HYBA 2IXAA 1SB9A 2G1UA 1ZBQA 2W43A 3JQBC 5JWHA 4DIKA 2A1IA 1XKQA 5ALFA 5FFMA 3VJKA 3ER9A 2D1TA 1TZMA 3QX8A 1GA4A 1N33B 4K9MA 4UKDA 2JGIA 3EA4A 5EIBD 4CDMA 4C1NA 3MINB 1DDIA 2GBFA 2EKZA 2X8LA 3GPCA 4IQ8A 5LP6F 3BIOA 4YGXB 3H65A 2A9KA 4W8HA 2ZTHA 4M7RA 2XBLA 5HMMA 3TI9A 5KOYA 2EBFX 1KAQA 3HVRA 1PL6A 4YBRA 1DGQA 4G1VA 3VO9A 4S2EA 5BSRA 2Y2UA 2OHJA 3K53A 5BSMA 1EZ4A 1FPMA 3AF3A 5ARBA 3RYCA 4X8OA 3PC7A 2PYDA 1I4LD 2YV1A 3KK0A 4D9NA 4FWBA 2F48A 1OSNA 1WXFA 3D54D 3DXYA 4H35A 4XVUA 1T4MA 4MKXA 1XCBA 1EFHA 2JLBA 3AB8A 3CQ9A 2WPDA 4MAFA 3NHZA 2AG8A 2OORA 4NU6A 3DMDA 1NP6A 3GCGA 2CCGA 3FSGA 5DGXA 2X8JB 1G2OA 2QZPA 3LXRA 3P9IA 4C0WA 1G8HA 2JFNA 2P9TA 1OX5A 1JP7A 3VAAA 1R4NA 2VHWA 4QU0A 5ICMA 1VLQA 3FOEC 4PXSA 2Z6AA 4LXHA 1C7IA 3B53X 3VPFA 2CJPA 3O7MA 3W6NA 4KE6A 3AETB 2OHHA 2PWAA 4JLSA 1J8DA 1X7XA 4KU4A 3DWGA 3DLTA 1XU4A 3QU9A 4EJ2A 1DOHA 3EF1A 2HBZA 3LBIA 3MRXA 4Z2YA 1A5AB 1JILA 1L4NA 1SC4A 4PNZA 4U6QA 3VNQA 3IP5A 1JBEA 4D8YA 2VQSA 3H42B 1U0HC 3KIPA 4GMHA 3RTCA 3QJYA 1U8CB 1EDDA 4MKIA 1NW9B 5KO2A 3O8DA 1QTIA 3LZCA 5ENVA 4N6NA 4QBKA 3STYA 3THYB 1ZJJA 1HDEA 3U5ZB 5GMOA 5FV7A 2ZUUA 4P5PA 3ADOA 2YR0A 3DZHA 3W5UA 4BBZA 1I7DA 2EW2A 1Z6GA 5EEGA 1XQXA 3QELB 4M3NA 1OYYA 5I4KA 2AOTA 5HJEA 3ZY3A 3DVAA 1L6RA 3PHJA 1BS9A 1GQFA 1DIGA 1W4CA 3GJQA 1KIAA 3FIJA 3UHFA 1BH6A 2FMKA 3IELA 3EA0A 5ALYA 1J1ZA 3M6XA 5D7BA 4FUTA 1BFUA 4MQBA 3PHBE 4FI3C 3OZWA 1YS1X 1TQ2A 2BMDA 3ED5A 4GPZA 2IPAB 3GW8A 3PBKA 3BJMA 5J9FA 4ZWNA 3R9IA 4Z0PA 3IAHA 3RIHA 1N9KA 1V95A 4AWAA 4Q3OA 3PX2A 2VRBA 5F98A 1HDGO 1HV8A 1SD1A 1NVVQ 1ZD2P 3BHJA 2C3YA 4YCJA 4K40A 5ALWA 2NXEA 3EFBA 5IC6A 1CVRA 1UEJA 5JVDB 3MS7A 5AW4A 2ODEA 3H1AA 4OHXA 2D1YA 2Y1OA 1EJBA 5CG1A 1YFJA 2YXPX 3R0QA 4JLNA 3GJ3A 2DSTA 3INNA 1E69A 1NP3A 1KZYC 2NQTA 3G5MA 4GPIB 4WN3A 1Y4ZA 4ZAGA 3OX4A 5IS2A 1WY5A 1CUXA 1XRPA 4Q12A 4Q03A 2QGFA 3H9JA 4K9KA 3FZEA 1QPGA 2QJTA 4KYVA 1Y33E 1YZFA 2PYIA 4OKNA 1URPA 3IE2A 1QRSA 1F12A 4B1FA 1RBZA 3TZQA 3KOUA 3GRVA 3KUCA 5AKIA 1GQQA 4DVGA 3E1GA 3MUOA 2JD2A 1Z06A 3B20A 3QU5A 2IS4A 3A2KA 4PN7A 5U1PA 3MCAA 3IBCA 4WBXC 5HA5A 2BIFA 2ZK7A 3ABRB 1IG3A 4IQ0A 2G67A 2Y1LA 4QJIA 5T3UA 1NX9A 1V2GA 3R75A 1NOKA 4MITA 4FZ5A 4YJ2B 4ECEA 4JU8A 4DABA 4X62B 2VF5X 5EJ2A 3Q0TA 1W96A 5KYNA 3E81A 3HN6A 1PU2A 3Q8WA 4H7FA 2F1JA 1O1YA 4L9AA 5P21A 2XA1A 3TNLA 4HHEA 4WK0B 3SHVA 3D0QA 1M2EA 2ZSFA 4ILEA 4L3WA 4AF7A 4KBYA 1E4EB 3V8QA 1RHRA 3NC4A 4NPHA 3WYCA 4RPGA 1XZJA 3SG0A 2ETVA 3P2YA 1CDDA 4FYIA 4CF3A 2W93A 4ARUA 2WAXA 2XDQA 4LEIA 1ARZA 2ZDQA 1ZN9A 3ESAA 1XRLA 2KPOA 2QIPA 3C8MA 3KDPA 5H8WA 1PJAA 2VP2A 4Z7OB 4AMUA 2BC9A 3JD2A 4CM6A 2E37A 3M1YA 1IOWA 1TU4A 3C3JA 3P20A 4E31A 2UUCB 2WT8A 3TQOA 4H1HA 3KQHA 2XSZA 1KTVA 1KMCA 1ZRHA 3C8DA 3L7YA 4B87A 1MIOA 2B4RO 4LNUB 3H5WA 3PFBA 5AIBA 3PEEA 5EQFA 3CO5A 1TZCA 4IFBA 5BV7A 3FF4A 3UB3A 2W2KB 3ESXA 1XTRA 1Y5RA 3LG2A 3CLRD 3IQXA 3DL7A 1HFKA 5F3RA 1VJ1A 2GDZA 1TO6A 3WWDA 4G81A 1UBKS 4PF1A 4ZU3A 4LVCA 4MDEA 1UPUA 5TS2A 2WWXA 2X8AA 5CB4F 1ZLXA 2R4QA 3NUGA 1FFHA 4R4JA 4RC9A 3UB4A 1G59A 2G1PA 1C14A 2G1JA 3D3NA 5BSFA 1CW2B 1X13A 2G0AA 1FUIA 4S12A 4QATA 2ZSKA 2QSUA 2ZS9A 4W8OA 3SP1A 1EDOA 1E79A 5DM1A 1I3OA 2WABA 4IIYA 4EDHA 4NV1A 5D86A 3K73O 3GVXA 2CLSA 4R1PA 4RGBA 3O9ZA 2CLKB 2ORVA 2AVDA 5M5BA 2GWRA 4JOSA 4BBJA 2HRQA 2IDZA 3DMFA 1WOMA 2V6JA 4AS3A 5LNK6 1QQBA 1DHTA 3QG1A 4TQ9A 5B2EA 1ZD1A 4XIGS 2ZI9A 1DJOA 4JELA 5ERYA 1YVPA 1YZHA 3AFNA 5AXCA 1PFKA 1J9ZA 4RLSA 2Z4TA 5A06A 5JEMA 4NVRA 2LTAA 1TM5E 3HJCA 1MB3A 5DNVA 2B7CA 4MA5A 4EBBA 4W5OA 4E30A 2WQ6A 2G88A 3ONFA 3QEMB 1A4UA 4HGQA 2OMEA 4UDXX 1MDBA 1WAMA 1JAXA 2R6AA 1E1CA 4II2A 1KEPA 2BY4A 2X0NA 1GGNA 4BQFA 2FPPB 1XK7A 4KCGA 3D8TA 3U4QB 2NAPA 1EVLA 2VR1A 5HKKA 4PNEA 3JQ8A 4KG7A 5AYVA 5JSUA 5EHGA 1ACLA 2DR3A 5L7YA 1YD7A 1PEAA 1EESA 1WPRA 4MQ5A 2NP7A 3KR9A 2BVNA 2RARA 3BN3A 2V8BA 5B36A 2XRFA 2IDKA 2GHRA 1DJPA 1XPOA 3A31A 5K03A 5DM4A 3K2BA 4FW9A 4PRLA 2H9YA 4H08A 1U02A 1L5LA 4KHZA 4RIHA 5HF9A 5CFOA 4TS9A 3NBZC 1N5DA 4LZPA 3N07A 2J0VA 4H87A 5ELMA 1AKUA 2MSEB 4YXWD 3GMSA 4UNIA 2PX3A 2WWVD 3T7DA 2GPTA 2N75A 4MJ3A 4ZTUB 1K7CA 4TRNA 1WD5A 1BXRB 3D4PA 2QRMA 3AI7A 3DM9B 1N2CA 1VPLA 2AV6A 3BX1A 3P96A 2ECKA 3OY7A 4S1TA 2Q7XA 4GQBA 4W4TA 2BJVA 1Y7PA 2VZ0A 2B69A 1DXOA 4G5XA 4JC8A 1EM8B 5EPEA 1NTRA 4FKBA 3SN6A 4BLTA 2GKSA 1G20B 4EVSA 4UE3S 2AI2A 3JV7A 3BB1A 5FLEX 1RLTA 3TQSA 3RS4A 3TNYA 2XUJA 3HCNA 3KNZA 3FF1A 3H13A 1P75A 1XMOB 1CUFA 1KE2A 1U7ZA 3VC7A 1Q7TA 2FEOA 4J0HA 1BO6A 3BAZA 1YVUA 3NOQA 3OH8A 3BMXA 5TMDA 2A0XA 5ITSA 5DI3B 3W2IA 4G5GA 1H4SA 3AB3A 3F6CA 2IP4A 5HJ2A 3CSUA 3VR6D 1PS0A 1QQ5A 4O0LA 5E95A 2VHYA 3INRA 4RUKA 4Z9AA 4A10A 2Q9BA 1BGXT 3CRMA 4JLVA 3QQ5A 4M36A 4UAGA 4DV0B 3RTBA 4K6FA 3TH5A 3GGDA 1EP1B 3H6HA 4L95C 2ZP1A 4NZMA 1E2NA 4B3BA 3OCXA 4FC6A 3V34A 5IKXA 1R6BX 2C07A 4AO8A 1V3QE 2FW8A 3JQ7A 3OTWA 2AFVA 4IDDA 4RF5A 4W9NC 4FNAA 1A9SA 4OFZA 1O4WA 2C3OA 2YJGA 5A3VA 3EXIB 3WL7A 4L28A 5CM2Z 3A9CA 4ZTZB 4MA0A 3HXTA 3EPRA 1LUAA 2QQEA 1U0FA 2VSYA 4WL0A 4OYLA 2CHUA 3LPLA 4ARAA 1LC3A 1AQYA 2I3ZA 4DQDA 2GEJA 1YOVA 2VJPA 1W5FA 3CX6A 1TF5A 1Q6YA 1TAQA 1VJ5A 1C7RA 2J87A 2P2NA 2P3SA 4RSRA 4WESB 4DBZA 4LN1A 4JR1A 4ZEOA 3UMJA 2Z1DA 2XGSA 4UUMA 1Z2DA 3S1AA 2P4EA 1T26A 3ZCTA 3G9QA 4R7GA 3HDVA 3OJEA 5JMOA 2YFHA 1NGSA 3TPCA 2ZCVA 1DZIA 1OREA 4QTXA 5DLPA 3QXGA 2Q99A 3DW1X 3RAPR 2KMLA 1I3NA 4LDRA 3FOWA 5ILOA 1ZJWA 1ONPA 2JCVA 3D8UA 3IODA 1M8GA 2UYCA 4HEJA 4BAGA 5HM8A 2VTDA 2AGVA 2PMWB 1BWQA 2X5OA 3QKUA 5JECA 4Y8VA 4XWKA 1GTSA 1YZTA 4JI7B 3VTFA 1PFGA 2QPOA 3PRJA 3RUCA 3ZGLA 2PSDA 4BNTA 3HX1A 3TD2A 4CN9A 3U26A 1Q0UA 1OIWA 1WXXA 2X76A 5EP3A 1SVSA 4MMZB 2G04A 1RM5A 3RC9A 2X4LA 4B32A 4FCCA 5LLTA 1YE3A 5E9JA 1QP8A 4B6PA 3I5YA 4LNAA 2I7DA 2ODNA 3H4MA 2ZSDA 4QBGB 3RT1A 1RXSA 2M32A 1OAAA 2FRDC 5MN4A 2VJAA 3HGMA 4B8ZA 4I1YA 2IOFA 5KSZA 1Z33A 1T1IA 5AD1A 1MF7A 2QD4A 5FYDA 4BWYA 2EBUA 3KTAB 2OAGA 1WSBA 4EHAA 3IC5A 1GG8A 3NRJA 2WJ6A 2VHVA 4G4SO 2HNBA 1ZWLA 3OIVA 4KLCA 3DZKA 1BXRA 5KJEA 1MO5A 3NYQA 3IO3A 4XQ9A 2QN1A 5LDGA 5BT9A 3TLEA 2Z2YA 1J33A 2BELA 3P26A 5HBRA 2GUGA 2QZ9A 4CTNA 1Y8QB 5CFRA 5JYEA 4YRAA 4GOLD 3FCUB 4LJRA 4TLEA 1AKMA 2MSNA 2VBCA 1G55A 1R4MB 3E9RA 4G0UA 1WPQA 1WULS 2ERYA 1EWRA 3ROMA 1OFGA 5SY6A 4GEKA 5IMSA 3CG4A 3W06A 3TNFA 4CUKA 4G65A 3WLMA 3KLMX 4B80A 2Z2JA 1JIQA 2ZJBA 1W4ZA 1GCGA 4IIEA 2RHGB 3R5SA 1JQBA 1CEXA 1ZCJA 3DOIA 3LZDA 2X0DA 2NP6A 2VJYA 3P9RA 2Z6UA 2QT9A 4D8VA 5EZQA 2BGMA 1A2OA 1EK1A 3MPUA 2MSKA 4HGRA 2JW5A 1DQZA 2DKNA 2OYSA 1OI7A 4CFZA 4E15A 4CT5A 1NJ2A 3KPJA 4E51A 1R8JA 2AJCA 3TECE 2P90A 1MJ5A 5JI2E 2E21A 3MFQA 3PXAA 5UKDA 1F5SA 3RV3A 3KZNA 4ER3A 4WJZA 1MUUA 3X1YA 2G17A 4YPVA 3ERCA 1SULA 5FUVA 4E2XA 5LU9A 2HBQA 1HE4A 1BRTA 3D31A 2Q5QA 2X0KA 3BGVA 3KOOA 3E9NA 3VI4B 3OTOB 1RJGA 5KSOA 1KH1A 1O96B 1CRQA 3H5LA 3NH9A 3AU9A 2NV6A 3GNTA 4G1EB 4BLUA 4EL0A 2FMXA 1JJAA 3AUAA 5IN5A 4M1EA 2VSNA 3RRXA 2BFBA 5AW0A 4GLJA 4B3RB 2HO5A 2IF2A 3I52A 3OA0A 4YP1A 4A8JA 4J2OA 5LZ9A 1U8TA 2VTKA 1USUA 1MJSA 1QHNA 4QBFA 2JVIA 3KR0A 4CHGA 2P9GA 3V33A 3K70B 3NASA 2EH0A 3LDGA 3AERA 4WSOA 1PFYA 2VHXA 3AVVA 1GAEO 3PEVA 2LR0A 2PX0A 5B12A 5IZCC 1C3XA 1P1KA 2OXFA 2H00A 1VLJA 1DKPA 1E60A 5AOCA 2CDCA 3ADCA 3VVCA 4BMVA 1H9BA 1QGAA 2H92A 2QJWA 4DDVA 1H2WA 3NIGB 2H2GA 2ZE8A 4JI6B 3T52A 5A9SB 2VUTA 2OGWA 2G77B 1VBNA 3OIFA 1BXKA 2WVHA 5JLJA 1DV2A 1GT6A 1ICEA 3N2YA 3PJDA 4ALJA 1WQ4A 3NALA 1UR5A 3PKIA 4CDGA 4MVJA 3RRBA 4D3FA 1DDOA 1G8YA 1PJTA 3C5VA 1WCIA 4CKCA 3DZGA 2FPUA 2VPQA 3ZCSA 1HC7A 3E22B 4AUMA 2KS6A 4HWTA 2MYNA 3HCWA 2HSWA 4YACA 4Q6WA 1P4RA 2ZG6A 1N2XA 1YAHA 4KLRA 2QP3A 1OQAA 2XRYA 2QLLA 3EZNA 4PLTA 1E6KA 1II9A 2OCAA 3ICPA 4MUXA 4ZOEA 3S29A 3ZWWA 4EZIA 5JQWA 2R0QC 1UEIA 3TR6A 3HBLA 1JL3A 1D6SA 1KFJB 1NFFA 2ZRLA 3DXFA 1OTHA 1OH8A 3OZVA 1DV1A 2WG0A 3H5NA 4OL0A 3U7JA 3X0DA 3DTVA 1LV7A 5BQFA 1D7OA 4QARA 5FR1A 2H2IA 3EPLA 1EFLA 1FYWA 3AIIA 4HAOA 4Y6SA 1PGNA 5LDHA 3HEMA 1ZC4A 4ZOLB 4CDRA 1VHTA 3AHFA 4MULA 2W6JD 2ACVA 3P4YA 2X13A 5AW7A 1FP4A 2ATCA 3ZNQA 2BFBB 3K0BA 3DDHA 4ZC1A 1PJCA 3QLTA 3V2GA 4BQSA 3LYLA 2AZXA 4XEUA 1JR3D 4L6AA 4NBNA 4Q4CA 2XLCA 1U9CA 2EV9A 4O8CA 3HLKA 4XD7A 1HDCA 3LP6A 2ODWA 2SKDA 2B4KA 1VYUA 4JLAA 1IUOA 2QZZA 1O95A 4K86A 4XSVA 1Z35A 3V8RA 1IWOA 1L7EA 1R88A 1Z6TA 2PEYA 1NT2A 3KCNA 2TMDA 4PO3X 5FULA 5H82A 3O8CA 4L51A 1XEWY 1EUQA 2HGZA 3AF0A 3MWLA 5IU6A 1SIUA 4MO9A 3ABSB 3BVPA 1Y9ZA 4FFLA 5D5HA 4ZDIA 1T2AA 2WPNA 5FYQA 4JWTA 1KI1A 3U4DA 2ZT7A 5KINB