3V7UA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with mta
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
261
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 75
structure length 261
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v7uA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v7uA01
3VZBA 2I2AA 3V8QA 3V80A 3V8RA 5DHRA 5EJGA 3V8PA 4DY6A 1Y3HA 4WERA 2I2DA 2I2BA 2I2FA 5DHTA 5DHSA 2JGRA 3S40A 2BONA 3V8NA 3T5PA 4L02A 5EJFA 1U0TA 2Q5FA 2P1RA 5DHQA 1YT5A 1Z0SA 3VZCA 1U0RA 2I2CA 1Z0UA 5DHPA 3AFOA 3PFNA 3V7WA 3V8MA 5DHUA 2QV7A 1Z0ZA 3V7UA 2I1WA 4HAOA 3VZDA 2QVLA 5EJHA 1Y3IA 2I29A 4WRRA 1SUWA 2AN1A 3V7YA 4V24A 5EJIA
chains in the Genus database with same CATH superfamily
3HB9A 3RIEA 1PZNA 1RHQA 3CTMA 1HRDA 5EE9A 1DBQA 3G8YA 1QX3A 1V26A 2Y27A 1IN4A 1U9CA 4JKIA 3U2QA 5HYVA 4ZYUA 4KXLA 4NYMR 3IKTA 2NZUG 2Q4OA 4CL2A 1NVFA 3M49A 5TXGA 3VHLB 3F9RA 3KALA 5CNMA 5KB3A 2OCAA 5CLGA 2Z98A 4R51A 1YQTA 4QPJC 3RJ5A 2GM4A 3GCXA 3WI7A 4OLFA 4MRAA 5E6SA 4MR9B 4HUJA 3K8OE 4EB3A 2W11A 5FJIA 1ECGA 5IG2A 8GPBA 4EZEA 1G20B 2IYAA 4Y1GA 2C4TA 1ZFNA 2GHQA 3KXPA 3IBTA 1GYRA 1Y7LA 2H4HA 4FWIB 3V6LA 4B80A 1I7DA 4NYIR 1YFLA 1EHCA 5I7FA 3I8XA 2ZI3A 1YCFA 2OK8A 2SCUB 1G42A 3EQ6A 4B0OA 1DEVA 4LDNA 1H69A 1EGHA 2C2BA 4M8IA 2EV9A 3AHDA 2HADA 5CYGA 3BIWA 1UWVA 1I4EB 1S2OA 2O20A 3M6XA 2AMFA 2HF8A 1U7XA 1XYVA 2V55B 4TTRA 4K05A 3RK1A 4CDNA 1ZR4A 2GEFA 3BWEA 4RJKA 3N76A 3WMGA 3FOZA 4FW8A 3EYWA 1VPTA 3PTLA 5JAPA 3P9RA 1MVLA 4TL8A 3NTQA 4QVKA 3NLLA 5BR4A 5MFPA 5DX1A 3AVVA 4MR7A 1KTVA 3JQ8B 3FYSA 4F2PA 3LFHA 1KMHB 4HZIA 2X22A 3WMWA 1VFPA 5JRDS 2PO7A 1YNOA 2PKQP 3CW8X 1S1CA 1IDN1 5JARA 4JIMA 4OGWA 5F7OA 2CD7A 4U4AA 4PR0A 5LP1A 3I0MA 2RCNA 5EJ6A 3DTYA 4D9VA 2P0AA 4L4ZA 3TRHA 3EPPA 4ND1A 4IMRA 3TBFA 3ZIAA 5EJFA 3EXIB 4LNAA 1UBOS 2DF8A 3GV0A 3L5OA 4GYYA 4EW3A 1B0PA 1C7EA 2OFOA 4WNCA 4BMOB 4F4HA 1IRIA 1RC8A 2OCIA 3UKJA 5I7SA 2Z6QA 2TSYB 2ONJA 3A11A 1JHQA 3N74A 5CDSA 5JASA 3Q0IA 4LCEA 3GJ6A 1UBKS 3NR2A 1VI6A 4RWEA 1JWBB 1RI1A 4PSKA 1RR6A 4RVGA 1J42A 2PBLA 1Q0RA 2YMMA 4FKZA 3S2FA 2VBCA 3UTDA 1W85B 2FSGA 1JG6A 5EP2A 4JI6B 2W4QA 4NENB 4M98A 2XECA 3DYBA 4JJ4A 1I3KA 4ND8B 3V48A 4YO7A 3I62A 2XT0A 4LZZA 2SKDA 4EGFA 4HMQA 1FTWA 3M8KA 3HVHA 4KH0A 2CL0X 5KTYA 2DT8A 5TGZA 5LNK6 3CRQA 2C5EA 3FGOA 3OIDA 3AB3A 3CLRD 3RKSA 2WAYA 3NAMA 2HA2A 2M6KA 3MUEA 2R1TA 3Q7PA 4H4DA 5IN4A 2OP1A 3KV1A 5JALA 3K20A 3EX7C 4FP9A 1S4MA 2HQBA 3V00A 1PQYA 4MX8A 2FRDA 3A9TA 3ADKA 3W4KA 3B3AA 4CKCB 2D5BA 3KFXA 3WICA 2IBMA 4P80A 2VHCA 4HYYA 1Z8HA 4XTCS 3SYMA 4BFUA 3A6GA 1AQJA 5KNDH 1YVDA 3FNEA 3KLOA 1T2VA 3Q2OA 1W1UA 5F78A 2XRZA 2AL7A 3KHSA 3L07A 4YMSA 5DFAA 3CS3A 3OPQA 1VHWA 4GI7A 2HJHA 1VMIA 4ZVOA 3BILA 1D0VA 1FTNA 1UKVY 1M1XB 3WYCA 5CUQA 4MA4A 3H1TA 1NVVQ 3GH1A 4M8LA 5AW6A 3T7EA 4LJ8A 3GQVA 5CFRA 4ZCPA 1NATA 1ZI8A 3V4VB 5FUQA 2JK1A 4LI0A 3P94A 2DBYA 4RNDB 3QMWA 3A1UA 3JZDA 2HA3A 2P8JA 1U9JA 3I53A 1U2TA 1I4DD 3HP7A 3IYLW 3LECA 1V2HE 1U04A 1XDUA 3TRJA 5CG1A 4OX9B 3LT4A 1LH0A 2OAQ1 3MN1A 4KAFA 3CF4A 3I2YX 1A2QA 1F4LA 3FUCA 3UK7A 4XGIA 1B74A 4LNUB 4RY0A 1ZN2A 1JT9A 4KO2S 2Z43A 3EFOB 1N25A 3PZRA 4N5NA 2NPFA 1MF7A 2O5CA 3U6BA 4F21A 3IIMA 1ZIPA 2A0XA 4FLMA 3U3XA 1DI0A 4ARCA 1UBJS 4HJXA 4UHKA 4N47A 3WMXA 3DMHA 1JFFA 2GKSA 3E7XA 4D4IA 4CLHA 2DP4E 2H11A 5JY6A 4CF4A 1A9ZA 3EEIA 3KTDA 3R4CA 4IH9A 5ESDA 3EW9A 4WOKA 1M6YA 4RE5A 2I4OA 2ZVQX 3L04A 2NT3A 4NFSA 1CHNA 1X7WA 4US2R 2B1QA 2V0CA 3UGQA 4BUCA 1TKRA 1HLFA 3EGWA 4XGKA 5BSVA 1Y81A 3PR3A 4JDUA 2IDJA 3KAPA 3DUFA 4EHFA 2ADOA 3IJEB 4DVJA 3K30A 1TPYA 4KUGA 4CF3A 3CUUA 2X8AA 1PFYA 2FFJA 2Q4RA 1QHFA 1CF9A 3MIZA 4QDOA 5MF6A 4D0LB 4NE9A 4TLEA 2P2ZA 3L6OO 3T3GA 3X1KA 3E0QA 3ND7A 2B8NA 2KSQA 3BCRA 1PAUA 1RQNA 3F4LA 4MW7A 4WZAA 3SEZA 2VTDA 3R3HA 4PZ0A 4RADA 3NXKA 1TVKB 4LSMA 1TD1A 2CNNA 5GMOA 2JLWA 2FMXA 5BOVA 2J6BA 4D79A 1Q44A 3ROPA 3LWNA 5FAKA 2MMGA 1XD2B 1G7CA 2G71A 1O96A 2I2WA 2PL5A 2OHFA 3ZHVA 3ZE7A 1CFJA 2JL1A 2CJYA 3MRXA 3P27A 1L1QA 1YJBA 1AMNA 3UW1A 3KXIA 4AY3A 3OSUA 4HMOA 4RPGA 3EFHA 1MOZA 1QQ7A 3WWOA 3VR4A 1JFTA 4JOSA 4FFWA 4Y6OA 4WZAE 1I2AA 3HH8A 3VPHA 4MV6A 1FVHA 5BW8A 2EJVA 1EP3B 1HE8B 2GLXA 3VSEA 3A3NA 1YRQA 3IE0A 2NU9B 4JONA 2ISSD 5J43A 1WW3A 4A16A 5K9ZA 3FPJA 1RQ7A 1HV8A 2XVZA 1U9ZA 3R41A 3QWAA 5E8RA 5FWYB 1GTJ1 4JBIA 1GEGA 1HMPA 3BRQA 1UBRS 3K0AB 4R68A 4UU1A 5HFNA 3NQ41 1ZN8A 3UN0A 3KSDO 3UAVA 4AD8A 4OXYA 4JLSA 3FVVA 4BTEA 1DMRA 5CITA 2JAHA 3UOWA 3GWGA 5FRDA 1MJGA 4ZODA 3C87A 5EAIA 4BQOA 3D8HA 3ZVLA 1NXXA 2PZFA 3WYAA 5E3HA 1XTBA 3NZEA 2VDOB 3E5NA 1RT9A 3GAFA 3QKSB 1VMDA 3S2SA 3STWA 2JPDA 4RJTA 4EPYA 3M6MD 4P5PA 3A9UA 3IOYA 4OXNA 4QO8A 4C6TB 4JLWA 3ZX4A 4WN9B 3KWJA 3PRJA 3TRDA 3WTBA 4NCIA 1J00A 1T5BA 3ZWMA 1XLTA 1OYYA 2CSUA 3RVNA 4CTJA 4DM7A 5INTA 3FKSA 2A7QA 1JMKC 1MN6A 1JHMA 2ZJFA 2ZRFA 2HA0A 1M2EA 5CLIA 3M0EA 3M5CA 4DQDA 4EQ6A 5GGXA 1GPDG 1E63A 1J21A 1UPUA 2P2SA 5TS3A 1JE0A 2RGNA 1R0ZA 1IWOA 1XNHA 3MTAA 3R6LA 2F43A 4DMHA 1I13A 2Q1YA 3BJEA 4UNQA 3RVRA 5EHZA 2BVNA 1WPXA 1CF4A 4E07A 2WM9B 1C7RA 1DEHA 5U4XA 3A3PA 5MN5A 1JLHA 1GFSA 2PFGA 4TM7A 1EWKA 4KSCA 5AK0A 2LPMA 3W5SA 2R8BA 4F3CA 1HTWA 3CX8A 2BUBA 4TTJA 5BV8A 3C6QA 1N2BA 1IM2A 3D4OA 4PGHA 4R9NA 3HB4X 4E1VA 1O8BA 4FQ8A 4G5FA 2JA1A 1H2RS 2YVLA 4PS1A 2RHHA 1DAHA 2GSDA 3BCUA 3CE9A 1T9GR 3S7TA 4GMXA 2AUMA 3DEYX 4AZWA 4RHFA 2AFIB 2IYQA 4RV4A 5A9RA 5BMVB 5HOEA 1LUAA 4RANA 1LJUA 3GQBA 1MTZA 1OROA 3SLKA 1W49A 1EFPB 3NWPA 1Y3BE 3PVZA 4K9SA 3D3EA 4PSVA 2QRLA 1Z17A 1K0UA 1XZKA 1TQDA 2A57A 3IQZA 4O4IA 4RMJA 4IICA 4MEJA 3QVSA 4F7DA 1AGRA 1G8SA 1M72A 1J6UA 2ODEA 4C3OB 2XOKA 5AM5A 3UYLA 2AVDA 3F98A 1P9OA 3N2IA 4NU0A 4UBOA 2B99A 5CLQA 5EPEA 3ZK9A 4EI9A 2PWZA 3S6JA 2EJCA 2QRUA 2W43A 4JNKA 4PWZA 3FX2A 4S1NA 2ZM5A 1RCFA 1X1AA 3IVGA 1IRXA 2IITA 2WC1A 4HADA 4PRLA 1WDWB 2FZLA 4X7PA 3OFVA 4BDSA 4WBNB 3F9CA 3HL0A 3FOEC 3STYA 4W8HA 2J5KA 4AJ9A 2Q4TA 3ZBQA 1R5BA 2W90A 3ND8A 1LK0A 4OXRA 2J33A 4QUGA 5B3KA 5IC4A 1O6CA 1UBHS 3T9EA 2V98A 4Z51A 1L5HA 3Q4GA 1GKIA 3RF7A 3E8XA 3H5IA 1T9BA 2NU7A 3VSCA 1EAYA 2APJA 1E2FA 1T9CA 2ZAGA 3CKKA 4F86A 1G19A 1KO7A 4WL0A 5EJ5A 4LF7B 3G2NA 4URHA 4EUNA 1H2AS 1WS6A 1Z0FA 4HRXA 4IRMA 1TMOA 2CY0A 4YJ3F 1I30A 1OTHA 3H0KA 5T4FA 3LX8A 4MB6A 4NQRA 1JKXA 1Y63A 3DEZA 4AU1A 1NW3A 2PV0A 4CODB 5ITWA 2REBA 3L4SO 4I4IA 1A9TA 3NYRA 4LMBA 4WOJA 4XLZA 1KYQA 2GVNA 2HRCA 3WRXC 2VP3A 1VG8A 1IU9A 1RLOA 3MVEA 2GBFA 1N3YA 4MK4A 5CDFE 1U8AA 3K4HA 4Y1RB 2GPYA 2UDPA 4ZVTA 1XMIA 3UW3A 3O8OA 5ALVA 2C7PA 4CUKA 4KAJA 4RA9A 2YV3A 5KQGA 1E2IA 1DX4A 1XLUA 2E5WA 2Q1XA 3PQ5A 4PIVA 3OPYA 3ZBUA 4OLHA 3L4JA 4MVJI 2Q5IA 1K86A 1YULA 2XUGA 4WN3A 4XM1A 3ZV4A 2GVZC 2LCIA 3GPBA 4ZYLA 4G0UA 2G7ZA 1I10A 3TYXA 3WDLA 2GEJA 2XTMA 4ZEVA 3CW9A 3ICQB 1FYXA 5ILGA 3VVBA 3KSZO 2V54A 3OX4A 2FF4A 3P26A 1KR2A 4J43A 3AEXA 3NT2A 2BDEA 1E7WA 1KDTA 2WHPA 3EPRA 3LTEA 1JTFA 4C06A 4JI5B 2RKOA 5DLDA 4KHPB 1HT0A 3NTLA 1YRYE 4QREA 5DHAA 5B3LA 4CLOA 3A2KA 2II6A 4JLVA 1H3EA 5T8KA 3HTXA 2VJYA 3K0EA 4RZ3A 3B1YA 4ZIRA 1A0OA 3FG9A 4P3KA 4XDHA 4F5WA 5KCZA 1ZH6A 3IHWA 4N7JA 4U7JA 3WA7A 2I1QA 1QCCA 2RGCA 3KQWA 4YASA 1R0KA 1RQLA 2WM2A 4C30A 4YYZA 5EJ8A 1GADO 3RC7A 3IKLA 5TPZA 1FXSA 1M1NA 3FPKA 3GARA 5CW2A 1B7GO 4MVXA 3UG6A 5BV1A 2O8FB 5F52A 4AF8A 4DE5A 3C3BA 3GJRA 1C1HA 1K0FA 1UKEA 3QU9A 4KPFC 3JALA 3DO5A 3E2MA 3AILA 4WOCA 1XALA 1N4AA 4A8JA 3X1DA 1NR1A 2VKTA 2Y1CA 1QOPB 1TEVA 3LHDA 4JYCA 1WW2A 3CBGA 1C81A 3PEWA 3L1IA 1BX1A 2FW1A 2FEPA 1C0LA 3HI4A 5F5NA 5HFAA 1IXYA 2HWUA 4JI3B 4GEKA 1BDHA 4KNVA 1A97A 1KK0A 5FOQA 1Z5ZA 1MABA 5GM2A 5BN5A 5KSWB 1ONOA 3Q8WA 3HDHA 1J4KA 3IAS6 1RHJA 4BUJA 3KDPA 4E30A 3T6KA 5ICSA 2CV2A 3R7LA 2H48A 5AHWA 5JZMA 4FUQA 1XVLA 4YCBA 3NHWA 5FD8A 4BU0A 4JB8A 4UM5A 2VDRB 2NXJA 1W581 3QXXA 4LGCA 5CVCA 9LDTA 3N8KA 1XRQA 1DTEA 2UZ1A 1L7MA 3TQOA 4F5EA 1E9DA 3AO0B 1CIPA 3SR0A 3ITNA 4HWTA 1UINA 2C0CA 4J0EA 2BKUA 2XA9A 2ECPA 3RAPR 4QBHA 2BISA 3V33A 5B2FA 5G40A 2GFIA 3HKEA 1G0NA 1AOXA 3TXAA 4QNRA 4QYMA 1KQGA 3EGCA 5K3CA 1AN0A 3RM3A 4C0JA 1S2IA 4LHXA 3E18A 3VKWA 2OO7A 4I19A 3D3QA 3GCGA 4QFBA 3KCNA 1XTZA 3N8NA 4MDYA 4ND7A 2BJHA 3UK1A 2OZLB 5J47A 3EDRA 2OZPA 3H0EA 3QLVA 4KNWA 4E22A 5IULC 4ZD6A 1VRWA 1Z5OA 4OM8A 5LJIA 4S12A 1G5FA 2RB4A 1JRLA 4GMHA 2PAAA 2YOHA 5EKTA 3EOZA 4NDZA 4AL4A 2PWAA 3Q3GE 4OBEA 1X42A 3NJRA 4KJZA 2IYOA 3EMBA 4XGNA 4D9MA 2FHPA 2ZJYA 5F9HA 5GTDA 1X1EA 2H51A 2NUPB 4FFBB 3FCSB 4KV9A 4HX2A 4DXHA 2QNIA 1Z7GA 4HATA 2Q4DA 3NNNA 4TV8F 3TI7A 1I4WA 2DQZA 1G2QA 2WHQA 1N5DA 4V24A 2IYNA 1N32B 4FS3A 2YY5A 1PR6A 4X94A 1WNTA 4BLSA 3GGOA 2HA7A 1AE1A 1MOQA 3M5PA 5I4BA 4MS1A 1KFBB 1WULS 2Z08A 2ZSKA 4J0KA 3WIDA 4M0UA 1AUVA 3MAJA 4JLBA 4KVAA 4E09A 1L7QA 3A1WA 3M9WA 3T06B 3VPDA 3C4QA 3IURA 4LVOA 1D9ZA 2YHBA 2CMGA 1BFKA 3F96A 2QX7A 4PCUA 4E5UA 3MWDB 1A27A 2E4ZA 1F1JA 2PZJA 5DU2A 3KE9A 4EA8A 4A7PA 1N6OA 3C7DB 3LCUA 2RIPA 4R69A 1CJBA 3F73A 4JMPA 3KVRA 3R3WA 3J80A 4YUVA 1VA5A 3OLYA 3ZY4A 1ZAYA 1ZK3A 1P4AA 2EFCB 1M7BA 1TYCA 2R7AA 5J58A 2PKRA 4O29A 5IBQA 4GBJA 2PWYA 5A3JA 1IZ7A 1DG3A 1QHXA 4RSHA 3W7AA 3VJRA 4Q03A 3M33A 4KUEA 2JEZA 3LWZA 4K9OA 4ZRMA 2VLIA 2XMDA 3RLIA 1P1BA 4KLAA 3JZAA 3KSMA 1MA3A 1SUAA 4HAYA 1NMEA 1O97C 2XZDA 3OEWA 2Y1WA 1OT5A 4ZVPA 5TMDA 3ZIAD 5F73A 3L7IA 1B1CA 3PC8C 4N5LA 1OC4A 1T6YA 3FNQA 1Z37A 5K20A 3WRYC 5B58C 1A76A 2QR3A 1QGYA 1WXGA 2RJ3A 3ME5A 4NMLA 3KOZA 4N5HX 2NO0A 3CR8A 2Z4SA 4OIFA 5JYBA 4YK7A 1C0PA 3PEVA 3EQ7A 2GCNA 2IU6A 5BP7A 4MV7A 2D1FA 3E9EA 1ZICA 2BDUA 4RAQA 1YS6A 3B6EA 3KWMA 4BNHA 1HOTA 4MWZA 3K6RA 1T5OA 1I1OA 3B2EA 5BN1A 1U80A 6LDHA 5HZKA 4G1EB 2ZIXB 1ZDMA 2PKEA 1E58A 2YYZA 4IDNA 4L4XA 1QF6A 4ECAA 1KMMA 3OTIA 5DYNA 3JAWB 5DHQA 1TCVA 5LYJF 3SQWA 4P4SB 2O52A 4LX0A 2O7QA 1NJ1A 3IMGA 4MVJD 6ADHA 2WICA 1E8NA 5AKGA 2Y1FA 4II3A 2LUOA 4KC0A 4RGYA 4KNYA 2W6IA 4XWAA 1U7WA 3MM4A 1YO6A 4M0KA 3EASA 1RRFA 4Z2AA 3SY8A 4JQYA 4BWGA 2QTVA 3FRIA 4PE5B 2I4MA 5HIKA 1Z8NA 3NI2A 1REQA 3PQDA 2VHYA 5H3CA 2X23A 3KQSA 2H92A 4LAFA 3QF7A 4LJYA 4YV7A 4B6RA 5KSYA 4G9EA 3ZK8A 3D0QA 1ND6A 1Z56C 2V6GA 1MX9A 1D1QA 1VXRA 2YQZA 2JGRA 2XCLA 3Q7TA 4N01A 4PLGA 2I65A 4EHJA 3GFQA 8ATCA 1AQ6A 4V0NA 3B7PA 3I37X 4M9SA 4IVNA 1PDWA 3RNLA 5A5VA 3LUGA 3TL2A 3EQ2A 2IXDA 4BO1A 2GZHA 3ZTYA 3E2PA 4DIEA 1ZOIA 1Q2UA 5HIIA 2W5UA 3UG7A 1SURA 1E2UA 3IERA 5B2EA 4YS6A 2QVLA 2BR4A 3G2KA 1UKZA 4IXNA 4LZNA 3JATB 1YE3A 4CM8A 1KI6B 4O2AB 4D4LA 1R4MB 2O7NA 6Q21A 2JLYA 1QB7A 2QL5A 3DDNA 1M83A 1J07A 4XLTA 7ABPA 4OV6B 1FNDA 1WZIA 2OV1A 3GJ7A 1W2WB 2A78A 1X87A 5AHKA 4NJMB 3IBGA 2Q5CA 3D8TA 1VKHA 1PR2A 4H60A 5D87A 1UPBA 1KI1A 3UWSA 2IL1A 3ZU3A 3BMQB 2NXEA 1G18A 3SX0A 2VP6A 1JLLA 1WMBA 4AZSA 2PYIA 1ESEA 4RS4A 4O5OA 1KEKA 5IDYA 1J8QA 2QX9A 2GF9A 2I62A 1VG9B 4FYVA 1I01A 4JEHA 4TTAA 1SK9A 2O7RA 4DFDA 2C4HA 3CLTC 2OBFA 1YB6A 3ZOZA 4PEVA 3LGXA 3TLYA 4MVJA 5AI9A 3AVYA 2QVGA 3THSA 2I2AA 2HJGA 5KYNA 5C8XA 2C9CA 2QD5A 2RIRA 3AM1A 1RDFA 3EW7A 4UDOA 4X41A 4EKNB 2C7GA 2V7UA 2P4SA 1D6JA 4HNUA 1FMFA 4MUBA 3DLAA 4CU2A 1F2VA 1KHUA 2Y0PA 3H8VA 4MVWA 5CCEA 1K5DA 4EA9A 1PTJC 4EM6A 1QHEA 3B9PA 3C6BA 3UWDA 1L8XA 2BGMA 1NBOA 4X65B 2O23A 2PDAA 1VMEA 5AXBA 1PK9A 3ERCA 3BKWA 2ZWIA 1UDBA 1A8PA 3SHOA 5DM1A 1DFIA 1U3DA 2W2PA 1ZBQA 2HI0A 1V8PA 3THRA 1DOHA 1Y48E 1I2DA 2YZ7A 2X3YA 2UXBB 4A82A 5IAGA 2C2OA 3H1BA 2PLRA 3Q98A 3K1YA 4RKFA 4CIXA 4DCOA 1MAUA 2AFHA 1PUJA 4OJQA 1VG1A 2VDNB 5FFMA 1PQWA 2QAJA 2LW7A 3GI1A 1SIWA 5DYTA 3B13B 5B1HA 3NH6A 2BSXA 5HRUA 2IOQA 2WWXA 4WXHA 2AOXA 1MJ5A 4YALA 5LP6C 1JQ3A 3HHPA 3MRVA 1GZHB 2ZYGA 1E79D 3T7TA 1GRQA 3KBOA 4QUKA 3SZMA 1NW4A 3T0FA 4D44A 1FMJA 4PFKA 2Y1GA 2HA4A 4U7HA 1M73E 5E6RA 1J2JA 3A05A 3RVDA 1UZNA 3EEFA 2ID8A 2XITA 4UHJA 2OFWA 2QYTA 1RXSA 2WUDA 1DWOA 5IVIA 2QF7A 3QUTA 3H9JA 1IOLA 1UKCA 4KQWA 5IC5A 3TIFA 2Q3FA 2EARA 5D51S 3PNPA 4ZQBA 3EZXA 4F85A 2YZ2A 4F1JA 1YDWA 1KOLA 3F49S 1IBCA 1N9KA 2J45A 2H07A 4NV1A 1N3LA 2ZBPA 2VP5A 5F77A 2D5LA 2H1VA 1SBZA 4EEXA 2DLCX 3QOFA 3I04A 4EPVA 5A3SA 2YHSA 2R96A 3NYWA 1KNXA 2FG7C 3ONWA 3TCKA 4DT1B 1KDRA 4GKKB 3QE9Y 2LBPA 1H4VB 2W7TA 2WR8A 3CUEF 2I7CA 4MPTA 4YT5A 1Y4ZA 2XZTA 5DSXA 5G0VA 3UB3A 3SX4A 2E48A 4DCPA 1F3OA 3O2NA 4CIVA 1N2IA 2ZYDA 3L7CA 4OHBA 5H3HA 5B3AA 4HXGA 1U7TA 1YR7A 1DXOA 4E1BA 5F2KA 4ARZB 2VWPA 5FBRB 3FYUC 1M34A 1RWPA 2HWKA 2Q1TA 3D54D 3K9WA 3KZVA 1N2EA 2Y9MB 3NASA 4AK9A 4Q4DA 3U62A 1OV4A 3ZZ1A 1PT6A 4X63A 3B8EA 2ZI5A 1MB4A 1AGXA 2CYAA 4ZICA 2G28A 3PQ3A 2EX4A 1EJ6A 1DXYA 3HBAA 5DCWA 2ZIVB 4HL6A 4KTTE 4FGKA 4Y2PA 3JCZA 1X2EA 3Q9NA 4IGIA 5I7AA 1M6NA 2PFKA 2OD7A 1DOAA 1VJGA 1WQ3A 2CV0A 4CVNA 4NATA 4XIJA 3K0FB 5IARA 4F45A 1DQRA 4G0PA 1ZIYA 4AY2A 1OKKA 2GFQA 4BMYA 3WSWA 1XDZA 1UBNA 2GNAA 5K7SA 3U7GA 1A9PA 3C3DA 2HFKA 2IQ5A 1MC4A 4ZN6A 1JWLA 2EVWX 2F6RA 3VZBA 1WNFA 1C50A 1FLDA 2XUQA 1TUGA 4HWOA 2ZZKA 2C4WA 1ORDA 4FJ2A 4LXGA 3RS2A 4DR7B 2ZUEA 3QKUA 1BA2A 1J7KA 2EZTA 5KYUB 2ZB2A 5ENZA 4G89A 4KPUB 1TQ8A 3V4RA 4R9VA 4YXWA 2JIQA 4BVBA 4JS0A 4XYMA 2BCJQ 3H87A 2QZ9A 1LDBA 5CB0A 1PDVA 4ND6A 3FOWA 5EP4A 4MZXA 4UEKA 1GGMA 1VPLA 3HA3A 3VR2A 3WGJA 5L3QA 3AF0A 4LSWA 3W9BA 3X44A 3KLPX 1V1RB 2QP3A 3GHYA 1KZ9A 1T26A 3HDTA 1WQ4A 3LY7A 3ZWQA 3SR4A 3DDUA 1XZNA 5I8ZA 2VYQA 3T7RA 2ETVA 4PC3A 4RELA 2QN1A 3I3OA 5FV7A 1NJFA 2G80A 1Z38A 2ZULA 3F47A 3OF5A 4CDGA 4H1WA 4IQ0A 4L85A 2Q7DA 3TTWA 1C7QA 4CKEB 3Q7QA 4R98A 1Y5LA 2H2GA 5FOSA 5ULLA 2C07A 4BVEA 1H5UA 5AHRA 1Z6TA 3BRWA 3SC6A 4E6EA 3C8HA 4XIGS 3P9ZA 2WNIA 4HQ6A 4XIIA 4EUFA 3TO5A 4YJGB 2ZYAA 5EL0A 3F97A 4HNAB 5E95A 5A0TA 3FCOA 1G8FA 2JZNA 1U2PA 1OYOA 4M3NA 5CYFA 2QPOA 2QSJA 1Q7EA 4MLDA 4HN9A 1E7RA 5F35A 3CMMA 3W05A 1DAGA 2V9ZA 4CQJA 4RZXA 3LQQA 5EXTA 4BV9A 5LMUB 4W7IA 1CS4C 4JOBA 3U48A 4A8PA 5BWNA 1FRQA 1IHYA 5TF4A 3FFXA 3PYXA 1KEEB 4A2PA 2ZT6A 2X9LA 1BDMA 2DWPA 1VZ2A 1SCDA 2QKYA 1KDPA 3HDVA 4IHQA 2DPLA 5LPNA 5ALLA 4B2IA 2FN9A 1CCWA 1R6UA 1U9IA 4YAGA 2PS9A 1OLOA 3EVGA 4KW7A 5JLJA 3OUTA 4WCFC 1P6QA 1OHHA 4YONB 1FCJA 1Z0UA 2VLBA 3IHKA 2VXOA 3UAOA 4E5MA 4HP8A 2RGWA 5E38A 4V1CB 2CFIA 4YP7A 3TW6A 4B4WA 3JYHA 4KLCA 5WRFA 1ZNQO 1ZVJA 2ZROA 2VATA 1JKIA 5FOWA 3BIFA 3I6WA 3NDPA 1NDQA 4Y18A 5CCDA 1SCJA 4F93B 2XNHA 3SJZA 1N78A 4GEGA 3L2OB 4DABA 4YJ2B 1VGVA 5D3ZA 3FPFA 2YY7A 3CRNA 3GLGA 1NBAA 1TZMA 3JASB 3L1JA 3PHJA 3FUVA 3ND9A 4PYRA 4X90A 4YX9A 3EBPA 3QWFA 5DO9A 1VL1A 2RGUA 1C3JA 5JEKA 3HV2A 3HCEA 3KBBA 3GAAA 4OKSA 5AQEA 1EU1A 2C94A 3ZPXA 4NVRA 4GX1A 3RSCA 3S5JA 1GLNA 4CCWA 4E88A 2NMVA 4N0QA 5EERA 2OXFA 4RVDA 1XRNA 3ROGA 2NM0A 3O91A 4GPAA 4ERNA 1N0WA 2YWXA 3UOGA 2V1UA 2JHFA 4GZ5A 4MRMB 1XZIA 1NWHA 1G21E 3DV9A 3KEFA 3O93A 4G2NA 2J3DA 3ZKWA 2JHCA 4ZCQA 4IIHA 4JC5A 4DEYA 1JIVA 5REQA 2OZKA 2J6HA 1VCOA 1NLMA 3L1KA 3NAZA 4QOSA 3LXUX 3TSOA 1IHUA 2VAVA 1U2DA 4BGDA 3PDIA 1E1NA 2F1IA 2GFHA 2BCGY 421PA 3L43A 2Q62A 4PY2A 4Y9RA 3NJ8A 4BO7A 4P38A 3DVAB 4OJKA 3EXEA 3VJMA 3WB0A 4G23A 3AF1A 3BMQA 4UVGA 2G72A 2PGJA 4NCBA 1YB2A 4PYLA 5J2TF 4TRJA 1MAHA 2TRSB 4TN1A 1A2BA 3ONDA 1DL5A 2JFNA 2NZVG 4Q5IA 3UMBA 3KX2A 1AIPA 3UT5A 3EDCA 3PWSA 4N5DA 4QT4A 3LUAA 2SKCA 1V6AA 3K2BA 4HZGA 1CIVA 1EGVB 3DAHA 5P21A 1PJQA 4A8JC 1YZNA 1Z4MA 5C18A 1EDDA 1U4SA 1ZL0A 5DPMA 3C45A 3A6KA 1IN8A 1G21B 3KYIB 5JWRA 3EC7A 3BWDD 2FLKA 2WA1A 1OY1A 1PZHA 1QKKA 4Y67A 2DPYA 3HNPA 2XQVA 2KE5A 4QATA 2OECA 2VVTA 3I64A 4K9MA 4ED9A 1LDYA 1DKOA 2QTBA 3L92A 4I66A 5CB4B 1FRZA 2GRJA 4YCJA 4AECA 4FFRA 3LM8A 1IXRC 2Q2VA 5EPUA 3AYXB 1Z29A 1VLVA 1EMDA 1P8AA 2B34A 1SHJA 4GOLD 3U40A 1UADA 2ISCA 3OLQA 4R2IA 2J9ZB 3DOFA 4UNNA 4EB8A 5DJ5A 3E03A 3FRJA 4QOGA 4WY8A 3W6NA 1U2GA 5AVYA 3D4PA 3NEJA 3UAWA 3H83A 1SXJE 4J1TA 2YVKA 2J4CA 1TQ4A 3D3NA 1ZCBA 3CH6A 1CUWA 1NMQA 3EARA 1N2GA 1SIUA 3HYRA 5CFPA 4ABYA 1NHWA 1U8FO 4GSYA 3RS8A 1I51A 4MV1A 1Z33A 3IB6A 4NSNA 1KI7A 2FX5A 1EBBA 1JPNA 2Y6UA 2CHFA 2CUNA 3WGKA 2MSDB 3H9UA 4XARA 4QXRA 621PA 2LXNA 1VHTA 4LOHA 1THGA 3VX4A 1VPEA 1TZCA 1HQYE 5D7BA 5K0CA 3USZA 1Y1KE 4E2XA 1OFGA 1C4WA 3CNLA 3RBZA 3LXMA 4BCCA 4CR7A 1A8IA 1M2NA 3QE3A 4DR3B 4QAJA 3C74A 5FA8A 3VDQA 1GCOA 2D1QA 2QXTA 3CUYA 3H11A 2OXCA 2MU1A 2WF6A 3ICWA 5DYWA 3S5UA 3TEFA 2PLWA 4PTLA 2FFQA 2FN4A 4Q9IA 3A6DA 3GK3A 3MOGA 3OCJA 1O9GA 2FPGB 3ZI0A 2QR5A 2FJPA 4NCJA 2D06A 1G8HA 3HB5X 3FF4A 3JR3A 3NS7A 4FZVA 4IY1A 1QVWA 1FJXA 4TRMA 3QUSA 2WV7A 3TSWA 1FP7A 2RKBA 1F6BA 3MQFA 5DHUA 1QG0A 2AFHB 4QODA 5P8WA 3QSYA 2AJDA 2JAXA 1R66A 3A27A 4F3NA 3NH9A 2OOSA 4IGKA 4YECA 1J5XA 3A1TA 3NMUF 1CRPA 3ESBA 4WI1A 1ABFA 1N2XA 4G0VA 1KFJB 4G8DA 2Q5HA 4B74A 5JNLA 5ESXA 2OA0A 3IUYA 4IYRA 2C8JA 1IBSA 3ANYB 3GDGA 1RZUA 5BRJA 5AJYA 3F6SA 2YRXA 3AKEA 5HQJA 2O8NA 3KZ1E 4OBBA 2I91A 4D9GA 4D80A 4BBAA 2J9GA 3LX6A 1V8FA 3JYLA 2QE7D 1M8PA 2VPWA 1JVNA 2WMNB 4OHKA 4FZ5A 5I9MA 1FC0A 1U7DA 2R66A 4OKNA 1J4OA 3W04A 4RKYA 2DOKA 1YRLA 1DXHA 1DRUA 2DFLA 1SGWA 2ZBUA 3ESRA 4TLBA 5CLHA 4A6DA 5CIYA 3BT7A 1XWWA 2FZGA 3SK0A 4RVFA 3D1VA 5DTQA 3CWCA 2PKQO 2JFZA 2HV8A 1RMQA 3I2HA 4UREA 1XCBA 5EQFA 2ZT7A 3AJ8A 3MJTA 2IDZA 2WAXA 5KAMA 3EMDA 4Z1MD 1FPQA 4Q12A 3K70B 4CKXA 2VQFB 4BQNA 3WWDA 3MGGA 5EJMA 3TLZA 4J0IA 1JLLB 4MA5A 5YASA 5JAHA 3DB1A 1RP7A 4MB2A 4OHRA 5BR1A 1G8AA 4KXVA 5F23A 1OJLA 3F7TA 3GJ3A 4FYMA 3HZOA 4TMTA 1PHPA 3GLIB 1MAVA 1GSAA 2VWHA 2NNLD 2YJ5A 3ZQKA 5FI3A 1EZ4A 1XKTA 1QZUA 1SOMA 2NQ2C 2WUVA 1E2EA 2HWWA 5CXQA 4UFNA 5FH9A 3DZ8A 5JZSA 1QIMA 1OT3A 3FDZA 1M2GA 3R5TA 1YK0A 3RSQA 4JA0A 3VR4H 4CM8B 4QC2A 1KC1A 2FWMX 2HUPA 3BMOB 3ILYA 2WWVD 2BP7B 3BXXA 2YYSA 1B8OA 3OH8A 1YTLA 2C2KA 2C95A 2OGUA 1JZQA 4DVGA 4ODIA 5LN1A 2VHTA 2F3UA 2V7EA 1C7JA 2XEXA 4TQ9A 3BE5A 3L41A 4PG4A 3SSMA 5F4ZA 3V4FA 4YMUA 1OH8A 4H7HA 2O19A 2ZB8A 4GM0A 4ZT5A 2UZ1B 2Y1XA 4DILA 2HREA 3UT0A 1XRMA 2JDIA 1Y8CA 4H77A 3E27A 3K16A 3H65A 4HI0E 5AKYA 5T8KC 5LD2B 5BN4A 5T64A 1CLEA 1REQB 2P41A 1BFDA 1MP0A 2VPPA 4ETMA 3ST7A 3EA4A 3EEOA 2G0TA 2NTJA 1XFAA 1HEYA 1V25A 1CJMA 2BFDB 1JZTA 2EKQA 4L1KA 4P82A 3SBXA 3DA8A 2C7QA 1HFEL 1MX3A 2PXXA 2YASA 3DOEA 3EZLA 4RGVA 2B6NA 2CCKA 2VXBA 4R1MA 2EF0A 3B6IA 4L9AA 4OVKA 4P4SA 1MTOA 2Q9BA 1JU4A 1T5IA 3C39A 3GLHA 5CFMA 2NVOA 2ZIXA 4FN4A 5E7IA 1T2AA 2AMJA 1E0SA 1E2GA 1MDBA 3KB6A 1T25A 3MT0A 3GJZA 4G26A 5KU1A 2H1FA 1DEOA 3GN1A 3EYAA 4RTPA 4QZVA 3V8MA 3GB9A 2C3PA 3C0KA 4UEQA 4AURA 3Q3JB 4ZVMA 1I5OA 1Q50A 4HHEA 3QEBZ 4F0JA 1N9ZA 2QUZA 2FSHA 1YTUA 1CQXA 1WHTA 2OO5A 4LJLA 3EIUA 5K0LA 4KWHA 1TUBA 2B30A 4YR9A 1XVVA 4ZIRB 1I3NA 1DEAA 1XZFA 3O1IC 3LPCA 5A5GA 1N2OA 1F2DA 4ZEMA 5IXJA 5DI3A 2WJIA 3RBXA 5ICEA 1TKCA 2VNIA 3OQMA 2QRKA 3IL2A 2JASA 2QD4A 3DOJA 4NNOA 2A7XA 3P32A 2AXPA 5ITZA 3OHSX 4LXXA 2ZTVA 4LOJA 5LDDC 1N6LA 3VNVA 2YBEA 1ZNWA 4O0LA 4LS3A 1I6KA 2BCEA 4X62B 4C0QC 1E3MA 2OM6A 4L4SA 1HXHA 1LFAA 3G8CA 1MMFB 2O8CB 4G5SA 2ZK7A 2F1KA 1L7BA 1WLYA 2HLDA 1NI4B 1U99A 4DPKA 2YW2A 3JD4A 3S2IA 3KZNA 3WNQA 5IABA 1K9VF 1W25A 3V4ZA 1U8TA 4NFLA 5IUJC 3ROXA 1UK6A 1CEQA 1GTMA 1GPH1 3M4XA 4I3FA 1YZHA 1KH2A 4IUYA 4YUZA 3V80A 4Q16A 1E2DA 1G9XA 3F74A 3QEJA 4HX5A 5EZ5A 2I2FA 4QQFA 3WGQA 2BR5A 2IOFA 4RVSA 1D2GA 2GZAA 4OFBA 1P9RA 1X14A 2ZUWA 2KWIA 2NPIA 2GZRA 3JD1A 3Q3EA 1VL0A 5CW1A 5FQNA 2KBFA 4C1NA 2FPKA 4V0SA 4GOXA 2LR0A 1NVXQ 2BEVA 4D4JA 3ZI4A 4MRSA 4WGFA 1TRKA 5GONF 4ZI7B 3WBJA 1S3SA 4NWIA 1UMBA 2Q8NA 3MRTA 3NOOA 4Q3LA 4U3JA 3VFDA 3WR5A 3FLEA 1DJNA 2OFXA 2RGBA 2HU7A 2ZG6A 3R5SA 3MTBA 1U0BB 1QIKA 3P2EA 4Q1BA 3LZCA 5EJ4A 2JLUA 2AW3A 3IPCA 2DAPA 4Q1DA 5KNBD 1OWOA 4LFBB 2QN3A 4R5MA 1LPNA 1H8ED 2FPSA 3HEAA 1L5YA 3UVEA 3IAM1 1U3UA 4DC0A 4HH4A 1C9EA 3UMYA 4U39A 1K98A 3RU2A 2AOWA 3WXMA 1KQ3A 2R87A 2F8MA 2DLNA 4QHSA 2PX3A 3X1WA 4U2DA 1E1YA 4FMBB 1OIVA 2RGAA 4ZPJA 5D2CA 5SY9A 5GZ1A 4Y2VA 5MDHA 4LDRA 5LQJA 2PZBA 3OKPA 3RSOA 5HR5A 2FOXA 1SVSA 4QUBA 3S1SA 5JMWA 4IAOA 2BRUA 3W2EA 5JQWA 2UV8A 1SQGA 5E4TA 3MD0A 2B8EA 3D9QX 3QNUA 5JZ9A 1TECE 3F9IA 4PCAA 2CVZA 1M0TA 1DIOB 5JSQA 2GARA 5BO5A 1Z3IX 4L78A 4TSRA 4Y2YA 5FUYA 2HK9A 3D43A 2ZB7A 1ZXBA 3OE5A 1WUIS 4X1KB 1MG5A 3RUEA 4D81A 3GLKA 3H1EA 2HLDD 4OMDA 3CRZA 3TAUA 1I7QB 1C1XA 1CYDA 2J87A 2X5JO 1YJXA 3OIWA 3WNDA 4C01A 4E12A 5CDYA 1G59A 1V3TA 1XP5A 2HCRA 2IYRA 4FBGA 4RF4A 1XT6A 2MYPA 4BRSA 4L3OA 4W63A 4CG2A 3EY4A 1IN7A 1NYLA 2O5VA 1E4EA 3AFIA 3QFTA 1SA0A 1HL3A 1Y1RA 4GH5A 4OY3A 4Y0AA 4O2LA 4BO5A 3PGMA 5A5FA 3BD8A 4LYEA 1XTJA 1O87A 4XB1A 4S2EA 3VUEA 1WCWA 2ODQA 3AW8A 4JMLA 3KQYA 3C6XA 4P7BA 4DGSA 2I99A 4LKOA 1DIHA 1P0IA 1ZD3A 1W1WA 4LEIA 2IYFA 2ONKA 4EVIA 3BICA 2VSNA 2JAPA 2GJKA 4YCSA 1TA0A 2CEAA 3RYHA 1OWLA 3RV3A 1DKUA 1E6LA 4QQKA 3T34A 821PA 2CDCA 3O75A 4IG9A 4PLVA 3R4VA 1T29A 5J4HA 2IV3A 3PA8A 2H6EA 3Q10A 4R01A 3VO9A 1FA9A 1IN6A 1RJEA 4L4RA 4CG1A 4RMHA 3ZNQA 5BNWA 1ONBA 2IXGA 3E7WA 3ID6C 3QVGB 3SR3A 1JR3E 5IJZA 1SZDA 1NQUA 5TGTA 3QV1A 2Z8YA 4HB2A 4G0MA 1X39A 1JHOA 4Q02A 3I2FA 5EG5A 2ZRKA 1MNQA 2DECA 3N6XA 4GD3Q 2L0XA 4HLNA 1C0KA 4URZR 3DKRA 3N07A 4K6GA 4BQQA 3DMTC 5A5DA 1MKYA 1R88A 2ZUCA 3IDAA 1Y5RA 1YL5A 4YP9A 3MSCA 3QW2A 3ABOB 3B6ZA 1O08A 3DD5A 3LUPA 1ZD9A 3MGAA 4KFSA 1EVYA 5FPPA 3OPYB 4BO6A 2IJGX 3A37A 1UDCA 4JWKA 1Z08A 2G06A 3WLFA 3KYDA 3PE4A 4QYTA 3ESXA 1D6NA 1CVLA 3LHKA 1F4PA 3M2TA 3PDCA 4IV0A 3FB1A 3PUIA 4XUDA 1YZFA 2YY6A 3WIEA 1FUEA 2B0CA 3PQ7A 2F8LA 1JF8A 4AWBA 1JDUA 2H00A 1EJBA 1J8YF 1DRKA 4X24A 1Y6RA 1QZ3A 1ECPA 3NHUA 3R7DA 2BMFA 3FBGA 2JLAA 1W0JD 3KOYA 4HH3C 1K3FA 4BB0A 4EVQA 2QTLA 3AV3A 2J9YB 4H6WA 2WINI 2VJQA 3WV5A 2UZ0A 1GGEA 1MB0A 1TVKA 3ZY3A 5KMGA 1CD5A 3ER9A 1XX6A 2J5XA 4BVAA 3R7BA 3PT5A 4WD3A 4KIGA 3TTVA 3EWIA 5K3SA 5EJ2A 4QYSA 3ZGNA 2CDNA 4TS1A 3GJSA 1T3HA 2GB4A 3L1VA 2IP1A 4ETNA 3S1LA 1EYZA 4OATA 1IXKA 1M8FA 4F46A 1GPYA 2HQSA 2WYOA 5LKRA 1G98A 5CLLA 2MSLA 1UP6A 3CIFA 4PTYA 1USUA 2Y0BA 4MUAA 3J7AC 4FK8A 4Q9KA 4N0EA 1Z0JA 5DM60 4D0NA 1K2WA 3L05A 2YC2C 1U9IC 2XD4A 3WLHA 2OCLA 3AESA 4KB5A 4ICIA 3CZAA 2PPLA 5KI6A 1DT3A 1VG0B 1Y7TA 1L1RA 2R65A 2VCHA 5AW5A 4OQQA 1YJ8A 2DE0X 3IT2A 1E4EB 3P96A 2DKOA 3GVIA 3VUFA 3B1WA 5CVUA 4LXTA 5SY6A 1S7GA 3BMCB 5BPFA 1YJMA 3HWSA 3PD7A 4NV0A 4AP9A 4LTNA 4PICA 1G8MA 1A7JA 1G6Q1 1C1XB 4IBOA 1NV9A 2BHTA 1LC3A 4K2HA 5EMMA 3RJMA 3W2TA 4IDAA 2M98A 4FFOA 4B6QA 3GGPA 2CLOB 5E4FA 2IYTA 3HJAA 4RTRA 4LDPA 3TB4A 5A3RA 4MTCA 1H4SA 3MYRA 4ID3A 1KAQA 1PR5A 1M8KA 3ZGLA 3WLEA 3EFOA 2QJFA 2P67A 2IZOA 3U4CA 1W52X 2XVAA 4I3GA 5BUQA 1IN1A 2I71A 1EDEA 3N9IA 3GY0A 1NVAA 2H7CA 2BGWA 1D0SA 3L46A 4QYWA 3A31A 3UWMA 4L9WA 4X8LA 3CCBA 1XVUA 5I4CA 2FPMA 2VAMA 3PFGA 4X6YA 1T5TA 1BD4A 3AI7A 2X77A 4BLWA 5DZSA 2W6QA 1YIAA 1KZYC 2CNDA 4DHWA 1M74A 3CH4B 2YQ5A 4H1TA 3LFUA 3AUUA 5SYMA 3WLKX 2FUNB 3I9V1 4IRXA 1D4OA 4YO8A 3ZWBA 1K92A 4MICA 3W5BA 1KEWA 4K0RA 2LKDA 2O48X 3DCIA 1PQPA 2GETA 4LG1A 1QGOA 5FULA 5AW0A 3LPMA 2NYUA 3G0IA 2N1MA 1N77A 5CBKA 4ZGGA 2AKEA 4AQYB 4FFNA 3G5LA 1UMBB 1QR6A 2VXYA 2ODNA 1X77A 4ZI7A 4GLBA 4WERA 1TD9A 3FMIA 4NBRA 4JYZA 5SZIA 4LV8B 4CKCA 1KI3A 3F3SA 4JROA 1ZKDA 2EYQA 4X91A 2P1RA 5C5CA 1M8JA 1Q15A 3DTNA 1H6AA 2P4UA 3E3NA 3FTCA 4B83A 5IMBA 2L42A 3BIJA 3FYUA 1JBQA 1AUQA 2HLPA 5EE3A 1I9GA 4M8SA 1VB5A 1WLSA 2A1TS 3EIOA 4NK5A 3HO8A 3VR5A 2QRMA 1MFPA 1PG0A 4OPMA 4CIBA 2WVJA 1SD1A 2YXBA 5THKA 2VQSA 4D82A 1PQ4A 4ND8A 4XQEA 3GELA 5C2JB 4D4KA 5K8LA 4FPXA 4ZMBA 1R5NA 1GZSA 5J3JA 3DBVO 3SF8A 4EMSA 2GHIA 1YDGA 2EIXA 4UEOA 5F9MA 4AJLA 3S0JA 3AHJA 1MH9A 4TYWA 4PHGA 1NSYA 1SRQA 1E5VA 5AI8A 5HS6A 5IXYA 4RK4A 5BV2P 4RZQA 3I2KA 3GLGE 1Q95A 2O2SA 2REOA 4P3XA 4DBVO 4U8GA 2ZRHA 4C5CA 1H23A 1RBYA 5CX1B 2JHPA 1USWA 3PA6A 3S2UA 2PD3A 4BNYA 5JG7A 1IM8A 2BHNA 2F3QA 3KDSE 1QWTA 3NXSA 2H5LA 3D8SA 4H6XA 2HNBA 2G40A 3RFVA 2ZR0A 1VPDA 4QICA 1HYGA 2ZR8A 2QUJA 4EFDA 2C5SA 2YX1A 2PLNA 3R7AA 3WWCA 4WZAB 3IEVA 3R1IA 1ODTC 2Q45A 3SFZA 2V0NA 4DDTA 5JSZB 4ZOAA 4WXEA 3SZ3A 1WSAA 3GLHB 4NC9A 3ZHXA 2A0TA 2NO7A 4V0LA 1U8CB 1ZUWA 1FFBA 4F3YA 1GNTA 3AL2A 4AUMA 4D4HA 4UPEA 3A2MA 4C14A 4ZWNA 2VP0A 2YJGA 4TXJA 3UM9A 4L3WA 2AZMA 1X7WB 3CR7A 4WHMA 2V8OA 4V3CA 2RHRA 4JL6A 2GR9A 4JODA 1MJFA 3VA1A 3TGPA 3KVVA 1RWWA 4W5JA 4S1VA 3ZIDA 4RLQA 4DL9A 4OQPA 3Q7EA 1AQNA 4NEGA 4XUGB 5FLEX 5EZYB 1JIQA 3RFUA 3O8LA 2R7MA 3VR5D 1T4BA 2FPRA 2X58A 3GJYA 2Q2QA 2O8DA 3GLSA 3EZ2A 3MAGA 3OP1A 1NNEA 2A67A 3A1NA 1BXKA 1O0SA 1PGJA 3EWNA 4JJEA 3HXLA 5ARBA 2IEAA 1EUCB 5EWMA 4FFMA 1RXEA 4HQKA 5JISA 5BOSB 1NYQA 2OFPA 5ADWA 2BF4A 1U2QA 4H0FA 4EATA 1ZN9A 3KJIA 3M5WA 5AK3A 3FD8A 4YRCA 2B5VA 5BY2A 5AOBA 2GDJA 2XCRB 4KE7A 1QGAA 1JPJA 2A5JA 2ZVJA 1GDHA 1QGUA 1KC3A 1ZU5A 3RANA 1FYDA 3GJQA 3LOQA 1DV1A 4U6SA 2IK8A 2I66A 1XP8A 4UE6A 1MR3F 1W76A 3BXHA 2FQYA 5FI1B 4G41A 5BUZA 4DARA 2CL5A 1HUQA 4NOJA 5F1PA 3I6QA 4R71A 1BN7A 5JCPA 3TQFA 3O92A 3R8CA 3E0XA 2QT1A 3FKSD 4GNKA 1EEHA 3H8WA 4JP3A 1OU0A 5DLEA 5TVKA 3FN4A 3TZLA 4NBWA 1N1MA 1C3LA 3MBOA 1L5FA 2YZGA 3CRW1 1UJNA 3HACA 3LLMA 3OEED 5DGHA 4B35A 4D1YA 3VPBA 3P9IA 3AIIA 2R6FA 2D13A 4WUTA 1UZMA 3PWZA 4W9MC 1UBEA 5UKDA 3SC2A 4DMUB 1XRLA 3NVDA 1ARZA 3FOBA 3ONFA 3CPSA 5AKLA 3ZV5A 1H1TA 3RWBA 1H6CA 1DUIA 2MJLA 2QL7A 3KT3A 4LQLA 1CRWG 3GOQA 4CTMA 2JATA 1SY7A 1VBFA 4AO8A 3G5TA 1XJWA 5JECA 3QENA 1KU6A 2QN2A 4L0MA 3TOXA 3LQYA 4Z9YA 1V5GA 4NJOA 2P6OA 1LLDA 2PK3A 3GP5A 4PSDA 4HGYA 5H02A 4HTFA 3SC3A 1PCXA 5DTJA 2Z1NA 5CLJA 3RGWS 4OQZA 3QWHA 1KYYA 3G0BA 3HUEA 1JEAA 2ZYUX 4Z7NB 4EG3A 1Z2EA 3X1YA 5CB8A 4DCCA 4DV0B 2ZE5A 5TV2A 1FQKA 4WH0A 1HE2A 2EKLA 1CR1A 2PYZA 2W2MA 3V7UA 3A4TA 3EC2A 4IHJB 4OQMA 3N2LA 4RLHA 5CM2Z 1NC1A 2YIDA 2Q2OA 1Z34A 3SYLA 2BFFB 5EXEA 1AX9A 1C3XA 4FYIA 4DG8A 1QH8B 1UBCA 2EAUA 4EENA 2PVSA 5AKIA 2RJOA 3BULA 1J4PA 2B1IA 1KBOA 3I6YA 4WQMA 1K6MA 1WSWA 1BXGB 4LQDA 4CIWA 1ZI9A 4HAIA 2I6FA 5ADVA 2H06A 3HJUA 1NF8A 2PRIA 1IBLB 3C8ZA 3DAOA 3H11B 3HU5A 4J9UE 5I5GA 5T41A 3RVBA 4I7EA 4ZO9A 2O6LA 4MYRA 1G6GA 1J0XO 1E98A 1CK4A 3GLUA 4RD1A 3RABA 5D8DA 3KKOA 4QARA 2G1JA 4P8RA 1ZEJA 5AR1A 3UJNA 2Q6IA 5CURA 4LOIA 3ZE9A 4DMCA 2PJDA 3KUXA 1T4CB 2G88A 3P2KA 3SS9X 2K2QB 5KBYA 2X9QA 4G5OA 3TUZC 2OOKA 4BZWA 4KREA 3JQ8A 2OWEA 2BH9A 2WD7B 4XYGA 3E9QA 3JRWA 1U2RA 1YRWA 1Z0DA 3ZLTA 3P7MA 5JSYA 3EIXA 2V6BA 1GAEO 4M1OA 1W9HA 2A5YB 2W37A 1PO7A 4F6RA 4C78A 3BJIC 4DKJA 2RGXA 4LTMA 1QRUA 3WGTA 5IDQA 1H8HD 5JPDA 4NDNE 4ZOLA 5DP1A 3H75A 2VUSA 2HDWA 3PPXA 3PYMA 4X92A 4D97A 5BNTA 3K0CA 5AVTA 1BVHA 2G0AA 2XKAA 2SCUA 1FUKA 2Z57A 1IB0A 4JU9A 1QORA 2YC4C 3N3BC 2Y1DA 4KXMA 5B7QA 3VTAA 3MD9A 2R44A 3VOTA 1JHPA 1J0CA 4A92A 1XCMA 2FSFA 2CWWA 3HUFA 1LSUA 1NRWA 1W93A 1QZZA 4JAVC 2PSJA 5JEDA 2AUTA 4JVMA 4M54A 2CB9A 3TX2A 1J2UA 3F6YA 4MQLA 3SHFA 5G0SA 3TVDA 5C8YF 2QHXA 3DQQA 4KL8S 5FL7A 5TQ2B 3H5NA 3NWJA 2PX2A 1VA4A 1YZTA 3OQVA 4F91B 2VH1A 4CM9A 2GJSA 3U3JA 4DA0A 4B40A 3A4NA 3R0XA 3V4SA 1WZNA 4M1SA 4CFZA 5A03A 4UEWA 1O57A 3C41J 4JBWA 4UJ5A 1GNRA 3Q2KA 1I3OA 1W75A 4MAAA 1QH0A 4D02A 2NU6A 1GEEA 1PW5A 2WB4A 2NTVA 3EXEB 2A6PA 2V5AA 3IHTA 4OQDA 5CDGA 5JQGB 3DMDA 1WEKA 3MJ4A 1NQOA 4MDHA 4RHTA 4AUEA 1FXUA 4HDCA 4FLEA 3U44B 2FGJA 3WWYA 4POAA 3SHVA 4O8CA 2PZAA 4Q7QA 1XA4A 3U39A 3PDIB 4MO9A 3E6AA 5JYDA 2AEFA 4AQ7A 1V4VA 2QAGB 4LXUA 3PUHA 4BY9E 5IZ4A 3DSHA 2IPLA 3R0ZA 3K6SB 5U9CA 5G3ZA 1R4NB 3GLHE 2IPMA 2PQ6A 1LBQA 4ZK2A 4IFEA 2WMOB 2EP5A 5K0FA 4JI4B 1NQWA 4HKTA 2QXUA 4MRMA 3ZWKA 3BHIA 1KY5A 2HHHB 1EQAA 4WRRA 3OSZA 4DUZB 2JH3A 3EVEA 5CEJA 4MW2A 1BDIA 3A6FA 4B1FA 2XUOA 1ZOLA 1O0BA 1L6IA 2A9VA 2D0OB 3AJ9A 1YA6A 1ESCA 3B36A 2WSYB 3KU1A 4LRQA 3VKGA 4AKGA 1UXHA 1UKAA 2YWRA 2Z2YA 3BH0A 3D6MA 4DSOA 1NN0A 2V5VA 1SG0A 3BHJA 1OZGA 3JWEA 3SOZA 2XODA 1E59A 4A27A 4YJ3A 2I4LA 4MA0A 1IUOA 2OGSA 2PLFA 2QAGC 3O47A 4MV0A 5AHXA 1T6NA 4GP7A 2LCQA 3VU3A 4D9HA 3SE7A 4O6VA 5KKCA 4PINA 2QV7A 1LF0A 4HB4A 5ADUS 1Y3AA 3GA5A 3IT1A 1SVMA 1WOMA 2XMPA 2GX6A 4YRJA 3GNTA 1LBHA 3LD9A 5AKHA 1G5IA 2CL6X 2KW5A 3A9WA 1SBQA 1P19A 2X5XA 4Z9XA 4NU5A 5ETJA 4DR2B 4WY2A 2VP9A 5HF5A 3TE6A 3O4JA 4DJFC 2YXDA 5F7JA 3OTOB 3LYHA 4P22A 2VPQA 2AJTA 2TMYA 3IXLA 4B4VA 4XIYA 3BUSA 2CLSA 2BKEA 4PQYA 5DNVA 2ZI6A 4MWDA 1B4DA 1XTQA 4PHTA 2ZS7A 2EFDB 3T61A 1QU2A 1XWIA 3G2JA 3MT8A 4G97A 1TJ3A 3TZEA 2AKAB 4FGUA 4IIDA 2EGHA 2NUAA 5HUJA 3CH7A 1MENA 4QUIA 3TR0A 1XR3A 2I1LA 3DZFA 3RK4A 1GNPA 4E5DA 1EQ2A 3EZ6A 1PZGA 3IE2A 1CUEA 3AOEC 2K6GA 2YOFA 3LK6A 5GVSA 1M2JA 3CLHA 4ZMRA 1C7FA 4BX2A 2QZPA 2WP8J 3C5CA 3J7TA 2CXHA 4N3GA 2XQGA 1VYVA 5LJLA 2BMVA 3CVJA 3E4CA 4PO1A 4JL5A 3K9CA 2IUEA 1NMXA 2E5LB 1R74A 4L6AA 1EK0A 4KJXA 4PPNA 5FO1A 4IYJA 1DAPA 4B6FA 4EGAA 1ORTA 4OK5A 4U2FA 2VHQA 1MC5A 2IY8A 3JQ7B 5ALSA 1VIVA 3LP5A 2HWXA 1JDTA 5EGNA 1SHLA 2PGOA 3T15A 5AVJA 4OL9A 4WASA 3HMKA 1Z06A 4UUMA 1ONNA 1SH7A 1P74A 3OU2A 1NVKA 1OZAA 1JU9A 2V7BA 3PWKA 4U9HS 5CPFA 4ZEXA 5T57A 2IXEA 4WLFA 2PH3A 4GMGA 1EFAA 1T2NA 5HFJA 4M49A 3I2JA 5D85A 2RH9B 4BCDA 1MAAA 1E64A 2OORC 3E5HA 1JSLA 4PHFA 1UP4A 3VR3A 1U7FA 2H7VA 1UC8A 4AN4A 2HR1A 4XR4A 3GP3A 2CZCA 2GK7A 4JCOA 1O4WA 4G63A 3AMVA 4WLOA 1M9NA 2QL6A 1D4ZA 3VDRA 5BNIA 1KARA 1A1SA 4J0HA 3ICPA 1ZUNB 3K70C 1KSFX 3MFQA 1QV9A 2EG5A 4WLUA 2QNRA 3KOMA 3WIBA 4EI7A 2OVBA 5HZMA 4P0PB 4Y9UA 1AT1A 4MGEA 1AG9A 1IOWA 2ZU6A 3V4OA 3ZDQA 3W8FA 3JX9A 1WOYA 4ACBA 3Q3IA 1ZP6A 1YIDA 3K0SA 3GEHA 5SZJA 4CMBA 3TNFA 2I29A 1D0IA 1T3TA 2R00C 3HYTA 5KOYA 2HSDA 1GGVA 4CL0A 4E32A 1RLMA 1FU8A 4L0DA 5DV9A 3GZJA 4BWFB 1OFUX 1KORA 3TM4A 4BX9A 3CG4A 1U0HC 3L5KA 1Y37A 5JS1A 3EHEA 1TIPA 4NK4A 4I9FA 2W6ID 4E14A 4JK3A 2ISQA 2SICE 3HE3A 1V16B 2AI2A 2GVDC 2I8AA 1GZDA 1PFUA 1ZJJA 3L6RA 1GUBA 4H17A 4QA9A 1JDZA 4AX4A 4II2A 3PTZA 1AHIA 3RTBA 3THXB 5CNJA 2Z6UA 4Q93A 5J2TB 4FMDB 3WOVA 1XV5A 3AUKA 3DWGA 4K88A 4DA9A 1SC6A 4DREA 1AGPA 4JZKA 4UBLA 2Q3BA 5IKMA 4OHUA 5IUNC 2CWDA 4QRIA 4ZARA 2I7VA 4NOKA 3I9NA 2C5GA 4RPHA 2H8KA 2IUFA 1M75A 2BUAA 3PC2A 5CLFA 3FPAA 3G5UA 2R62A 4GSKA 3H5RA 1HM5A 3AFNA 5HCUA 4DLNA 5KDOA 1Z5VA 2IS2A 5K8IA 3DDHA 1BXRB 2JH9A 1LBIA 2ZAOA 4GUAA 4IKOA 3TUIC 3V34A 4A0FA 5KNDD 2CMKA 2NQ8A 3HU1A 3L7NA 1W4BA 1CQZA 2O6HA 1YXMA 2OBYA 2YRFA 3AG6A 2GT1A 3CYFA 2PSSA 1M6VA 3FHCB 3K2IA 2BM8A 3NIFB 4GKBA 4BEJA 4KQIA 4BEWA 1Q5PA 4WWHA 3QQPA 3MHPA 2P5YA 4PVCA 4G8JA 2WZDA 3OD1A 1FPMA 2H4WA 2BC9A 1NYTA 1FQWA 3DW3X 1U7HA 2X19A 1BMFD 1SKUA 2VWGA 3TLXA 4B48A 2HNAA 3V1UA 3DNMA 4AKTA 1Q12A 3QQ5A 1S9DA 3EN0A 6AT1A 1T8YA 1KPHA 2ASEA 3MSXA 4DIMA 3CUTA 1SCBA 3KKEA 4B6EA 2YHIB 3NBAA 4LJKA 1RVDA 3UYKA 5TLSA 1UCFA 4AIIA 1RBZA 1V95A 2PRZA 4KYVA 1Q74A 4JDPA 4P54A 3VYRB 3EPJA 2IE0A 4X6XA 5FI5A 4LHSA 2GZDA 1BMTA 3KZXA 3OOYA 2HMYB 1RYHA 2WTUA 1ZHFA 1WD7A 3M6IA 5EQJB 1MB9A 1WXFA 3KKMA 3NHBA 1KO1A 4MQ5A 3D02A 2NU8A 2IYSA 1FFEA 1T0JB 3H4VA 2WFLA 3PJGA 2JBAB 3AGQA 3UJ7A 4FYYA 3OU6A 1DD1A 2BEJA 1MRNA 2JJ2A 3OIGA 3UMMA 1U7UA 3FNBA 3N87A 3OY2A 4HUQB 4YUXA 2D1RA 3OZGA 3ORSA 2X0EA 1CWUA 4OYYA 1GQYA 1FYVA 3ND6A 1SU8A 2MSCB 5ALNA 3O4GA 5M29A 2VR1A 4P7GA 4Q9JA 3VJLA 1CJUC 3B3QA 3I3SR 3U17A 1FYFA 1ZLYA 1F7VA 1ODCA 1QJ4A 2RK3A 3L0CA 3FSGD 4IZHA 3NRJA 4RWZA 3PGJA 5JCJA 4LYYA 3DEIA 4R2KA 5C8ZA 1WA5A 3EUWA 3TGLA 4UVHA 1V39A 3IELA 4M4SA 1EM8A 1JG7A 5EMLA 5LDGA 1LGQA 2HU5A 3CG0A 1ZMXA 4TUYA 1VLMA 1HZZC 5FR1A 4UASA 5I4KA 2ID9A 4WJZA 4ZEWA 1HSZA 2YV4A 1ETHA 3LCMA 2XZOA 5ALMA 2CLCX 1YI8A 3UA3A 3TBHA 1J9ZA 3C6YA 1BDJA 2VF4X 1DBIA 4C4XA 1MU0A 1RKVA 4JB2A 3THWA 5HIAA 2ZTUA 3LLCA 2JGMA 3JQ9A 4P53A 2A9KA 3DBRA 1XTSA 5DNWA 5K3DA 4C2AA 5KYYA 4RZ2A 4M1YA 5DXAA 1ZKMA 3CU5A 1IOVA 1N3IA 1O3YA 2X1HA 3LWDA 2AMYA 3C6ZA 3GJ8A 3PRHA 1JIXA 4GX2A 4NJMA 3H19A 3ZUPA 16PKA 3VZPA 1NZJA 3EIQA 3N2EA 3W77A 4CHTA 1LJLA 5KVQA 3P8ZA 4IJ5A 1EPUA 4M6WB 2DWOA 1A7KA 1R4MA 4HGQA 4IOLA 2OPBA 3DMGA 3JATA 3S55A 4JR1A 1DAKA 1WCIA 2BBSA 5BURA 2P35A 4MGIR 4KRYA 5IYZB 1ST2A 4F3TA 1DG9A 1F8YA 1BGXT 2GRUA 1JR3A 1DEKA 4MKXA 3N1UA 3HEMA 3VPYA 3E9MA 2YDYA 8AT1A 1J2TA 1R3DA 3DITA 1ZX1A 2G63A 4QGFA 1IWPB 1LDEA 4RXMA 3U0BA 1T6XA 1LQ2A 2ZYHA 1ZY2A 2A59A 1B8PA 3CGGA 3FWZA 3GXOA 1N92A 2WKRA 5A4IS 2TMKA 4LVCA 2HEGA 5CT9A 3SBDA 1H2EA 1OBCA 2HSWA 3S99A 4RD6A 4IV5A 3TLJA 1R0YA 4UE2A 4BV8A 5ARDA 1MLDA 1JFRA 4W9NC 1WDMA 1OGJA 1I0LA 2PUAA 3KHKA 4X00A 3OTQA 4PGMA 1YB5A 2ZEJA 3LP6A 3L8FA 3REQA 2ST1A 4KE9A 3ADBA 2WFLB 3SN6A 5BYAA 3WB9A 4RPIA 1YFKA 1SQSA 5AXAA 2O0KA 2EXXA 1NNI1 2B20A 1CY2A 1J8MF 4TROA 3T4UA 3U7JA 3WZ2A 3ZDYB 3R9XB 1IY9A 2H52A 3VVLA 2WVGA 2DBVO 1E0KA 4OSOA 4UBJA 2O5EA 3T41A 1UP7A 4JLDA 1RD4A 1RZVA 2E21A 2BGTA 2QMQA 3BEOA 3SYKA 1SUEA 3QA9A 2FK8A 3C3MA 4BX3A 4BU1A 3PHHA 1MPXA 2Z30A 3RASA 3TGWA 4HVCA 2J3HA 4J7UA 5DN6D 3AKYA 1I1NA 1ZW6A 4GE3A 1SBNE 4CKBA 3C3CA 2QT9A 2ZBRA 3UJ8A 1CNFA 3OECA 3GMSA 2FSPA 3WHKA 3F6CA 3F5DA 1X7ZA 2Q41A 3ZJVA 5CA1F 4JLMA 3ELSA 3FH0A 1BWSA 4CMEA 3H2GA 4DY6A 3ENWA 4S0XA 5KU7A 3ER6A 3B20A 2ZYWX 3JWJA 2UUOA 4YQZA 1P9WA 3L1HA 4H7PA 1N36B 1KP9A 1ZGBA 2QZ4A 3CUVA 3IA2A 3KAKA 4JELA 3TW0A 5L7WA 4BO0A 3B6JA 3HHEA 1XPRA 1PN3A 4DV3B 5BSGA 3Q85A 1SQ0A 1YHYA 4NL4H 1DJPA 1N2JA 3MCVA 5DNUA 3QXSA 4DMGA 1D2MA 1DINA 3KD2A 2QMHA 1WX1A 4M36A 5CVJA 3V55A 2GEUA 3WBBA 1QYVA 1A9XA 3VU9B 1M1YE 1BE8A 2C98A 3PK0A 4GOMD 5L3SB 1UBGA 3OOJA 1QE0A 4Y6GB 2RMKA 4EH1A 1OZ0A 3O4VA 1EXVA 3E9RA 5LQDA 3U1TA 1MAWA 1TAHA 3O1JC 5HK8A 5K8UA 1FNCA 3IGFA 4C3VA 1E3TA 2A92A 3O8RA 1ZZEA 4QSMA 4EHLA 4PYIA 4RHEA 3R6WA 3MJRA 3GA7A 2ZRPA 3I92A 5HF8A 1N1GA 1K27A 1QRTA 5LSAA 2LIPA 1LVUA 5AVWA 1Y0BA 1GAXA 1Y6QA 3FWHA 4W5QA 1WZUA 1GJRA 1M1YA 4R8LA 2VTBA 3RS0A 2R5FA 4FLFA 4KGVA 5BW4A 1PJ8A 3M89A 1WXXA 2X4GA 3V1NA 3ABRB 3RTEA 1NXSA 2JF0A 1SOUA 1WSDA 3UUGA 5IANA 3LT2A 1XTUA 1X1DA 2QN6A 3GRRA 4IDHA 4LDJA 3LBIA 4WCVA 3EPLA 3MJCA 1QNFA 4GDFA 3QVTA 3W5DA 1UBTS 3IUBA 5HQTA 4NCKA 3T1YB 2O1EA 5FA5A 1KIMA 4NR0A 4NZMA 4EMTA 4XYLA 1P5FA 1RKBA 4I8IA 5H3LA 4LCJA 4UDNA 5EZ6B 3NDJA 4FGJA 1ISSA 2QPTA 3DZKA 1KETA 2VQ3A 3C4JA 4WIAA 4Q82A 4EQZA 2XB2A 1QM5A 1PJSA 2ZRBA 2OENG 1DB3A 3UC9A 1AK9A 2R25B 2EKBA 3GG2A 3FMFA 2G76A 4OFXA 4OI1A 5KQPA 4LOLA 5C0OE 2VF2A 1XEAA 3RIXA 3A4LA 2QSYA 2R2AA 4ZRNA 2J8ZA 3K53A 3TPFA 2Y77A 1U8UA 2GYWA 1H2YA 4LRWA 3FWKA 5EKDA 3C8MA 1KJ9A 3T3PB 1FYWA 4JLPA 4LISA 2ZXEA 3O2JA 1DPFA 4V02A 1SBHA 4ZYXA 1U4OA 2H8GA 2Y1LA 2PT6A 4RX1A 2P2YA 2CKDA 2JLRA 3UHAA 4P36A 4EKDA 1H0HA 4LNHA 4ZI2A 4RESA 2CW5A 1C4KA 3IHLA 5SV2A 1L5OA 3UB4A 4E2YA 2C61A 5JS7A 4LJRA 3IIIA 5DTEA 1CR4A 3AHFA 1ADFA 2A5FA 4FFPA 1ZA1A 2R79A 2C9ZA 3AP1A 2HN9A 3H04A 2WJAA 3H5LA 4R16A 1Z4JA 3M4YA 5MN6A 1RXVA 2AZXA 2HMVA 2W2KA 2P9TA 3PHIA 1I7NA 1XHFA 3U4DA 5HX7A 1X8KA 1QFSA 2R7KA 3I1JA 1UKBA 3TNJA 4ES6A 2JS7A 3U49A 3V3KA 4BVJA 4NRDA 4N9QA 3SJAA 4O63O 3I09A 1UPFA 4XVCA 2E6KA 4BNDB 4A8JB 1A7AA 2KPOA 3RI3A 4GYJA 3BYZA 3VNQA 5JS8A 5JUWA 2F59A 2Z5LA 1QQ5A 3W2HA 4XUCA 3JSAA 4QTTB 3VYSB 1SELA 3NVKI 1M1NB 5FAXA 4WK2B 4EKYA 1TUEA 4EECA 1PZEA 3KT6A 2BFAA 2ZJ3A 3TKLA 3QBEA 4XYBA 1IMJA 5EHNA 2YFKA 2SNIE 5CX4A 4P84A 1UJMA 1RHMA 2HJWA 2Q27A 5FTWA 2OY0A 7ADHA 2WJPA 1XD9A 3JXEA 4XE5A 3GZ4A 4WKGA 1ITZA 4XJXA 4FN5A 3UMSA 4N41A 3N2NA 2ZI7A 4G07A 1PUXA 4U0KA 4GQIA 1U90A 3PFIA 3VNBA 4OP1A 4BAGA 3QEKA 5K51A 2WHPB 4FDAA 4EHBA 5LUBA 5KIAA 1EVZA 1G4HA 4EA7A 5KJCA 4GZMA 1ZHOA 1T0UA 4DSTA 1QIDA 2OG2A 2WIJA 1G66A 1UMCA 1ZI6A 3M81A 4BVKA 2BF7A 1FTYA 2QLLA 2RARA 4YJ3B 5K0SA 3H2SA 4EHNA 3BRSA 2WQZA 4UHFA 1FIUA 2MR5A 3W34A 5EIFA 4KACA 5JZOA 1UHTA 2FJ0A 2AF4C 4JBHA 1Y5MA 2HOQA 3VVMA 4CGZA 1QFXA 2FDXA 1Z0KA 4UU8A 1KEVA 4XFJA 4GLJA 4H3SA 2CD9A 4I1UA 1Q16A 4HBZA 3IQWA 4KX3A 4ZI3A 3INNA 4NHOA 4RA9B 4CU5A 1BQEA 3OTGA 5C7IO 2PGLA 2C7RA 1YZ3A 3LQFA 3PIDA 5DE3A 2NX2A 1RI5A 5J59A 3MGCA 1C29B 1MO2A 2J7PD 4CMIB 4UTRA 4TTSA 5BWBA 5L45A 2G83A 1N2CE 3N0WA 1KKLA 2E18A 3BWBA 1WEHA 4MIOA 1FJGB 2C82A 4HNQA 3HUDA 4PGGA 3VTZA 1CG6A 3BS4A 4CLDA 1L4HA 2P1DA 4RETA 4D9CA 5LWHA 1B93A 1W4RA 3K9LA 5JXWA 5FXMA 4CN9A 1QANA 1DWPA 2MYUA 2V03A 4JD5A 4PC1A 1XRRA 4FTWA 2N46A 3BF8A 3TRKA 3G6KA 2VUTA 4UAGA 2PA0A 3JD0A 3PXXA 4ON9A 1X1SA 3Q1KA 3SX2A 1XPJA 5C4VA 3QVLA 2XUIA 4JT2A 3WFJA 1Q1EA 4F6CA 5AUOB 1SCUB 5DYGA 1GUAA 4AZ3B 4EFNA 2AK3A 2YJ6A 3KEMA 1COWD 3DOHA 3AUTA 4XVUA 4CEIB 2ZSIA 1BW9A 4O3FA 4PO8A 3E22B 4N3CA 2B7CA 3U4MA 4LZLA 3TM5A 5JXGA 3TLKA 1MX5A 1G63A 3A3YA 1ZC3A 3GD7A 1IAVA 1NBWB 3QEMA 3ZEIA 4LK3A 2P79A 1S4QA 3N59A 4KXYA 3KQMA 4AY4A 2A5GA 2EBHX 5HCIA 1Q1ZA 2VAXA 2XBUA 5LZ4A 1E0AA 1BROA 4M0FA 2RGRA 2V9PA 1EM6A 4DM3A 1A4IA 1NXOA 1PJ4A 2PD6A 2JIZA 2V7WA 4H59A 3QMVA 5IF9A 5LBTA 4P81A 2D4AA 2PX8A 2YVAA 4KE8A 4NDAA 3GRYA 5DTIA 2A4MA 3E9ZA 5IVPA 1R21A 5EEGA 1Y4AE 3LUBA 3EQ8A 4NZZA 4I5GA 4O4IB 1QLWA 3VH1A 4P6VF 1Q0UA 4C0WA 5KYWB 3SLGA 3L8YA 3CZ4A 1TZ2A 3O4IA 3JZMA 2XWJI 3JQ6A 2AFIA 2H08A 1IY0A 1J8DA 3IDZA 1W5EA 3HNRA 2JQJA 2JFQA 3FUTA 3RVPA 4Q47A 1SNYA 2M6SA 1OWPA 521PA 4ZOLB 1H9AA 2BI7A 1OZHA 3WV4A 2Q2WA 4LDZA 5D86A 5LL6P 3U26A 1AQIA 2HHJA 4UEJA 4JJ6A 3NDBB 3FDIA 2WQ7A 3MPUA 4RW0A 4EL5A 4KI7A 5EE0A 1XIVA 1QQAA 1G6KA 2F3PA 1FFGA 4A0HA 1DTWA 1T1EA 5TSDA 3Q6MA 4YMGA 3ZJ4A 1TU3A 4YRBA 4RDHA 4MGKR 3BFXA 4ZOQI 4YBRA 1BGWA 4MI9A 1J4LA 2H3HA 3IC5A 5DNCA 4R8RA 3TLGA 2WF5A 1Q1NA 2GZ3A 3N5CA 3F1KA 4LCBA 4CF6A 2C88A 5KCMA 1WB4A 3RUDA 3CQ9A 5LIPA 4X61A 3MC1A 1MGOA 3R8FA 4P5EA 3RRBA 3D6VA 3JARA 3DCNA 4J3NA 4G3XA 4ZV4A 4C7MA 4P3PA 4NAUA 1DU4A 4FDTA 4JT4A 2ZQYA 3AINA 3LT0A 4FHZA 4F56A 1CY4A 2MR6A 2VDQB 5SYAA 3WKDA 2XBMA 1KMCA 1EFLA 4P5DA 5CA0A 4KITB 1P2SA 4XH9B 3UIEA 4FDVA 1BXGA 2EJTA 3I58A 3WK6A 1N7JA 1I3MA 2NYRA 3CLVA 1WF6A 2O3JA 4KE6A 4BTLA 1ADGA 2YN2A 3AY0A 3M4NA 3LLVA 1QRDA 2VBIA 1R8SA 1B15A 1XK6A 4LVNA 1YU6A 4PQFA 2X1VA 2O57A 3IT3A 1GVHA 4QOEA 5JVDB 1E9RA 1EA5A 1H2ZA 3IP5A 1XVIA 3LKVA 3T3MB 3TXYA 3L40A 2XMGA 3QMPA 4MQFA 4P34A 5DOZA 5KREA 2F8SA 1UBMS 2Q3HA 1GSOA 4QLAA 5GWXA 1GCGA 3EZGA 1AUPA 1UPTA 2RK4A 3FCYA 2ZR9A 3I8SA 3MJHA 1WV1A 4M1TA 3TR5A 1CEYA 1SZPA 1NJ5A 4WVLA 5A3VA 1XU9A 1CUXA 2J3QA 4OQFA 1T24A 4WXPA 2MCFA 5K05A 3ITEA 5BQFA 1WJGA 4MPDA 4ZC8A 2MT9A 2H1LA 3EDOA 2BFBA 3HGMA 5F1KA 3JVIA 1TTQB 4BPBA 2HJVA 1DIAA 4V0KA 3JQAB 1G1AA 1LGPA 4HPWA 2C42A 4CEJA 1RU3A 1N7GA 1XCLA 1BHSA 4NYIQ 2J0QA 1RFLA 2P9EA 4GMFA 2P9FA 4AMGA 1IHOA 2LD4A 4B7CA 1C30B 1PR3A 4ZJPA 5C3UA 1XN1A 3KB1A 4GYKA 4W8GA 1OD6A 4AULA 1X7HA 5BWLA 2CCGA 2GYUA 2ATIA 3LQ1A 4Y6QA 4CETA 5HWSA 2RHOA 1DE0A 2QLMA 4R40A 2B1GA 4OEHA 2BEKA 4IIYA 3EG9B 2FMUA 3GPCA 4OHPA 3RREA 3UWOA 3OT1B 1ABEA 2AC2A 4EYOA 2WD9A 5IJXA 2JLCA 3VMFA 1RJ9A 3ZDRA 4WBNF 4IDOA 4X9XA 4NNPA 3LIIA 4DNXA 1USIA 3R6TA 5AW4A 1Z6YA 5AVQA 1NW8A 2BLLA 3ONNA 2MDTA 3TW8B 5LCXA 2D0DA 1OBOA 1QGUB 1PV1A 3QF4B 2F17A 4TQAA 3TNLA 3IVXA 3VZDA 2E0IA 2LDBA 3B9RA 4LXHA 2XI4A 4TSFA 1G55A 2XUPA 3PLRA 3QVJA 2VA9A 5IM5A 3R7SA 3B82A 4BWYA 4C07A 3GUVA 5F76A 4BLOA 1XZEA 1YSCA 1CUSA 2DQKA 1VP3A 3IOEA 2ZREA 4MARA 5GINE 1P6UA 8LDHA 4FIDA 4MH0R 3G2LA 3PF8A 3UAZA 5A4KA 1YE8A 2FW9A 4X8OA 2VYFA 2JANA 4NOLA 2W00A 4RNCA 2PQ2A 3G1WA 2ZYRA 2D8AA 2PU5A 1EVJA 3HB7A 4JP2A 4PLFA 4JYAB 2O8DB 2HQ1A 1AS2A 2VYVA 3KUUA 1O4VA 4A2CA 3ZHQA 1DBWA 4G4IA 3GR6A 3DLCA 4MUHA 2HC9A 2WT8A 3U3MA 4QTXA 4UZEA 1R5OA 2DPXA 3EGOA 3N0RA 1NI5A 3GGCA 3PE6A 4M55A 1CBUA 5ECWA 3L4BA 1TCBA 2XLCA 1UODA 1YVEI 1UDWA 3GLVA 4D5GA 1JKMA 2D5CA 2VNHA 3HDGA 3ZG6A 3KKPA 3U9TA 5D6OA 3BZWA 1GU7A 3ZS9A 3UAXA 4J2TA 5F5XA 1E6UA 1SXIA 3D0OA 4XD2A 4POOA 4WFKA 2QU7A 3ZWYA 5AW1A 1OH6A 1DKNA 1RVV1 3QYFA 2ZSEA 2G5PA 5G1PA 4JQOA 3WWPA 5JJ5A 2B21A 3M82A 3NHRA 2YNMD 4UOQA 1TMYA 3EPHA 2JLXA 2RONA 4I8DA 4JUBA 4QFMA 2KJQA 3KZOA 1HK7A 1UIMA 3F3KA 2P90A 3ABIA 3OI7A 3SXUB 4OGKA 2HIMA 3WK9A 2VNKA 3N2ZB 4B3GA 3REGA 1EFVB 1UXKA 3R09A 4TZ6A 1VHQA 5FI0B 2RGEA 4UM8B 5LFAA 1ZAKA 4L95C 4J3FA 1FNMA 1IFXA 4Q3KA 1E18A 3Q41A 2C5BA 5EXSA 3QX8A 4AMBA 4YV1A 3MCTA 2BFBB 4PLTA 5CVDA 4R7GA 1TRHA 1NLYA 2E4VA 3U5ZB 4BXOB 4RO0A 2PBFA 3QI7A 1EUDB 1G60A 3FVWA 3KTOA 4K46A 3OQIA 3HFSA 3FTNA 4QTYA 3AVOA 1R8XA 5CRIA 3SF8B 2CLLB 4F12A 2C77A 2O05A 3UWPA 5JJCA 2WF9A 1XZGA 2XDQA 1A9OA 3K9NA 4FNOA 3SXJA 3H9CA 3HR7A 1HSOA 4MQFB 3RBAA 3QXHA 5EXPA 1SN7A 5KHOC 4TTVA 1Z7BA 4RTQA 1A5BB 4WBXC 3VNRA 3EULA 4Q4HB 2J46A 3E9CA 4D5EA 1N6RA 3FMVA 2XNKA 2GK4A 3CSDA 2IHYA 3DT8A 3BTOA 4PG6A 5AXDA 1LTHR 4AJOA 1UQTA 3LA8A 4TSKA 3PUYA 4WGGA 1VP9A 4NMXB 2BFEB 3LBFA 3EXIA 4FQ5A 2HCTA 4YRLA 4L02A 3IQIX 3T9CA 3ZHZA 3PXUA 4Q0MA 1DBPA 1LJ8A 2V58A 1GTVA 4WAUA 3B1ZA 4CQMA 5A2QA 2DYKA 5CDTA 1PFGA 5BSMA 2O2GA 5CGQB 5C46F 2XKBA 5ESRA 1AM4D 2GRAA 4R4JA 1KWGA 2B69A 3D8NA 4H7EA 2BTEA 4H7FA 4RHYA 1O77A 2WP0A 3C3YA 5IN5A 1YZKA 1VJ0A 3EFEA 1A9QA 3M1IA 3U9SA 3WGVA 1U9YA 3EZYA 1AK2A 5AYVA 3PQ6A 5KC9A 2M6LA 2V1XA 3ZHSA 2GN6A 3Q12A 1T2FA 1PL7A 4RCYA 3IV9A 3EF1A 4YYEA 3LC0A 4G5HA 2VQ6A 5K8CA 1RCTE 3DLTA 4G56A 4YJKA 3IPAA 5JV5A 2X4IA 2Y05A 1OPRA 2FMFA 1ETUA 2OCPA 2WM8A 4TMZA 1S3IA 1YWGO 1UC5B 1LC0A 1ULSA 2ATEA 1RWKA 1P81A 3LCRA 2BKAA 1HE4A 1X70A 3CWZA 3AZOA 4JJIA 3RJZA 2WG0A 1O5OA 5EHXA 3AR8A 3TIGA 4CI0B 1DKMA 2JJQA 3V1YA 3BD7A 2NO5A 1BG6A 1OX6A 1EXDA 2IXBA 1KAOA 3S8EA 1CYEA 1TJ5A 1RWBA 3OEYA 1CQJB 3BSSA 1CY8A 1L7NA 2BJVA 2W2NA 3S44A 1G8JA 2PWBA 2XCQA 4YTEA 3SFTA 4CYMA 5LQRA 4DJTA 5LR6A 1QQBA 4YWJA 4N48A 3ZWPA 2VYVD 2G6BA 1BD3A 1N5KA 2JRLA 3VO1A 2CB0A 1TAGA 4AMUA 4ZJYA 4TRNA 4ISBA 1IWBB 4TMKA 2NXCA 5SZKB 5A5EA 1H85A 4RYLA 1IQ0A 5I9LA 5IM4F 1NN3A