3V7UA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with mta
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
261
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 75
structure length 261
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v7uA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v7uA01
2QV7A 3V80A 5DHRA 3V8QA 5EJHA 2BONA 3VZBA 1U0RA 3V8NA 1Z0ZA 1Z0SA 3PFNA 5EJFA 4WERA 5EJIA 4DY6A 4V24A 3VZCA 3VZDA 1YT5A 1U0TA 3V8MA 5DHPA 2JGRA 2I2AA 3V7YA 2I29A 5DHUA 3T5PA 2P1RA 2I1WA 3S40A 2I2DA 4L02A 3AFOA 4HAOA 2I2CA 1Z0UA 4WRRA 2I2FA 1Y3HA 5DHSA 1Y3IA 2AN1A 3V7UA 2QVLA 2Q5FA 3V7WA 2I2BA 1SUWA 3V8RA 5DHTA 5EJGA 3V8PA 5DHQA
chains in the Genus database with same CATH superfamily
4YHBA 4REOA 3KHUA 1LXCA 4P4UA 3FNRA 5CLFA 3HP4A 1OH5A 1C50A 1LTQA 1PFYA 4DR2B 2PMDA 1K7CA 4KQHA 5ERYA 4RHCA 3MGKA 4OQ4A 2WUVA 1AHNA 1B6SA 1V9LA 3COVA 3M6VA 5CT9A 3DJFA 2ZBUA 3R8XA 2NGRA 3C3KA 4DV3B 4HGYA 2J4FA 5I4IA 5B1YA 1KS2A 2XMCA 3JARA 4FJ2A 1UWKA 2L0XA 1P9OA 3DEJA 4NTZA 4O4LA 1TM4E 5BV2P 4XWKA 3C3AA 5BNFA 1FUKA 1AQJA 1OH6A 4B6EA 3PGMA 5FQNA 2X3UA 1E99A 4LJ6A 5TRTA 1BVHA 1JPUA 2GK7A 4JQSA 1QIGA 4YMIA 5ALTA 5C7IO 4G2SA 1PQYA 2H5EA 2WIJA 1HQDA 3NJ4A 4LYDA 4JI1B 4R7GA 1K75A 2G9RA 4TLBA 3M3PA 1DO0A 1FIUA 1DZIA 1THGA 5KDDA 4D3DA 3SN6A 4OOEA 4R1MA 3MGCA 5EZYB 2C7QA 2Y0EA 3Q15C 4W7HA 1JXQA 3IVXA 4PXAA 1VHTA 4RNCA 4JI8B 4NEGA 1UM9A 3TE6A 1UDAA 1YBHA 2OG2A 1TMOA 1USKA 2YFHA 4AU1A 5IJ9B 3WB1A 1P4SA 3L41A 5EXPA 1ML3A 1F2UB 2WB4A 1J4OA 5J2TA 2J5XA 1WE2A 2Y6VA 4N1AA 4QLOA 1BDBA 3TLXA 5I7RA 4N0DA 4HMQA 2FR8C 1CDDA 5EESA 1SBIA 1DCTA 5E9QA 4OPMA 1QZZA 1E64A 3LO8A 4Q47A 5HKKD 2DTDA 5I4KA 2J30A 3DEYX 4FFPA 4MQBA 1ONPA 2XKAA 4HLQB 4QGAA 4YGYA 1PJQA 2I4RA 4ASUA 3QU7A 1WZEA 4DTIA 4WINA 1M66A 3UK0A 1YZGA 3TJZA 1YDMA 2QVBA 3DGFC 4HPWA 5CXXA 5AJWA 5DFAA 4ZAGA 5K0ZA 2B0CA 3EGXA 1PLKA 1ZZEA 2HM7A 4JUAA 5AD1A 3JWEA 4G26A 1CB7A 5A7FA 2W48A 3RSLA 3VVCA 4J0CA 1F14A 2X6RA 3EE6A 3I05A 2PX0A 2XXBA 4DLRA 2AWOA 1J7JA 1W52X 2WE7A 1GTZA 1X7WA 1EI9A 2J1LA 4K7JA 4TMWA 3RAJA 3T7CA 4EOGA 2ET6A 2A5FA 4FOTA 3TDNA 1FDRA 1KPGA 1O6ZA 1Z33A 4UVEA 1UEIA 2JL1A 2PGAA 3FNGA 3N7UA 4KLNA 4LJ7A 3AL2A 1DRWA 4LYAA 3JARB 3VZBA 4DC1A 2DPGA 1T36A 2BJHA 3CF4A 1Q84A 4G8BA 4PCLA 5LQSA 2NT3A 3GEPA 4WZAE 2XCRB 1Z5ZA 3H5LA 2C8JA 2XUZA 2JCXA 4DR4B 1SVKA 5ICFA 4A73A 1GWNA 4HYTA 5EMJA 3Q9SA 1F4LA 2IP4A 1JG7A 3HLKA 5AHXA 5HKAA 2WDPA 1HO3A 3MGAA 2ZSFA 4LZOA 5L9AA 5KWVA 3SZRA 3ICEA 1R0RE 2W6MA 2QN1A 5BSKA 3TNLA 5B2ZA 1YRLA 3K0CC 1MFPA 2R4UA 2AR7A 4G0NA 4FFRA 3I8OA 2VYCA 1TUGA 3EVZA 4PNPA 5DOVA 2JLVA 2IA5A 1ICIA 3R7DA 2ZFUA 4LXIA 4MS1A 3GFSA 2I7XA 4OF4A 3URKA 2YKGA 5HKBA 4XDHA 1H65A 1SO8A 5J2TB 4OK6A 2ZG6A 3BK7A 2OKGA 1QVWA 3KQTA 3PTZA 4ZREA 5F21A 2ZATA 3QF4B 3FVVA 4DM7A 1UMDA 4HSGA 3CF4G 2HCFA 3QUBA 1YVUA 3E5NA 3VJLA 2FWNA 2OZLB 4ZTUB 2PIEA 3OZEA 4GE0A 3IKJA 4CG1A 2D8MA 4CPDA 5K6AA 2ZR7A 5E9AA 1GAJA 1KI3A 1LTHR 3GEHA 4LXTA 1EFLA 4DAOA 2E48A 1XWIA 3DVQX 4Z4QA 3KQYA 4F1WA 4TSKA 2E4XA 4QFBA 2V8BA 4IIXA 1GNQA 1SG0A 2CXNA 2IYZA 4Q9KA 2O2CA 4MO9A 2PK3A 4KO1S 1XCJA 1KVTA 1LS1A 1DKOA 1PT7A 4O59O 5IANA 2ZUSA 3ZY6A 1G0NA 2R2GA 3WMGA 3U56A 3CYFA 1QP7A 1SCQA 4KZKA 1Z82A 4G0XA 5K51A 1YR6A 3EVFA 4UAGA 5FTMA 5HFJA 4D5EA 1P9WA 5JEMA 3CQ9A 2QRJA 1S2NA 3HB0A 4DKJA 4MRMA 4PU0A 5JI2E 4GZMA 4AY5A 4C4PA 2QDKA 1QVZA 4R5HA 1IXRC 4RORA 2J41A 3I8XA 4H3KB 4Q9JA 2CDBA 2CZCA 1N3BA 3RS2A 4E4YA 1JVNA 5KX5A 1T5SA 1NXOA 1YE8A 2B61A 3PL5A 1NKTA 1CJKC 5EP2A 5F3RA 3UV7A 5FLEX 3TIVA 3BJMA 2B5VA 3BB4A 5HMMA 3V2GA 2FK8A 4PWZA 4PXSA 3HBMA 3HJHA 1VG1A 1VSBA 1I13A 1XWWA 3GMDA 1K7FB 5KEIA 2XB8A 1DIAA 5FO1A 1H2AS 5KSWB 1CR1A 1N2HA 1Y5MA 5I9LA 4ZHSA 2CJYA 2IXBA 2JIZD 3HN6A 5ITWA 3SC6A 4QWWA 2RHWA 3FE2A 3B48A 3SF8B 3GDFA 3MWLA 1YA8A 2WI8A 3BTSA 2O8DA 3AEQA 5AVYA 3UC5A 1R3DA 3AY3A 3A10A 3OICA 4KXUA 4MS1B 3DKIA 4D8WA 4ILKA 4J4HA 1JU9A 2Y1CA 1PBNA 3NHAA 1JX6A 3N6RA 3KUCA 4YQEA 1G8PA 2R87A 2FPRA 3R5FA 4U2FA 4RX1A 2HDOA 3DLAA 3TDMA 1YJQA 1NVTA 3L2OB 4ZVKA 5TPZA 4E1BA 5G0SA 3IXQA 4ZICA 4EITA 2VQDA 1SD2A 3ES9A 3MUFA 4LZWA 2IW1A 5AKJA 1I80A 1SMKA 3LUAA 5DLEA 4F4IA 2OGZA 3BQMB 1OVMA 2EFGA 1JSLA 2IODA 1TW2A 2J5RA 3C3PA 4N9QA 2VK2A 2VQSA 3SFZA 1L4EA 5GP1A 2Y1EA 3FNBA 2XQFA 4XB2A 4KMOA 4HN9A 5FHRA 2GBGA 2PTHA 1CUDA 2WYVA 3LCUA 4CXMA 5CT5A 3WK7A 2DEUA 3H5WA 1HT0A 5IC6A 4FFMA 5AI6A 2FMFA 3DZFA 1PTJC 3CLHA 1C1YA 1LI7A 2RHCA 3FKQA 4W7IA 4YCJA 3C0KA 2RG1A 3V6MA 1UP4A 2YINC 1DIGA 4TWIA 1U9YA 1U02A 4QU0A 5AIAA 1E2HA 4LF5B 2D0IA 2ZXEA 3BICA 4E5PA 4YI5A 4WCVA 1KR5A 1WZUA 2OV1A 5AWFC 1YGSA 2WAXA 3TS1A 4EVQA 4O4HF 5A4DA 2F9FA 2K2WA 3ENZA 5DM2A 5FJJA 5HIMA 1T3HA 4X9XA 3NH6A 4RV4A 5KX5B 1I94B 1L4GA 1M7BA 1ZXLA 1QVVA 5JCJA 1VPWA 3VKVA 1MR3F 4NMMA 4P22A 3TN7A 1EFUA 2X58A 4G0OA 1YQQA 3PCXA 3VA7A 4E14A 1RZRA 2H52A 3WWEA 1LU9A 5KQMA 2JRLA 1RWPA 2EQAA 5AQ1A 2OV4A 3G9XA 3GQBB 1ZC4A 2ZT5A 1Z35A 2QUHA 3IV6A 4JYCA 4XOIA 4XA8A 4YV2A 5KCZA 1SIOA 1L7RA 2VR1A 4UMFA 3K8YA 4FCTA 4ZCSA 5A71A 3WMFA 4V2UA 3SOZA 5CD9A 2VP6A 1C14A 1BCRB 1LDGA 5ALJA 3UMJA 2VYVA 4ASUD 2V3CC 4FU0A 1TMYA 2A0UA 3LYLA 1AJEA 4YR9A 1TGVA 3GYGA 5IUNC 2H4WA 5EWLB 1TVMA 3F3KA 3D4PA 1L5FA 2BLLA 3UENA 1E4EB 4TRMA 2C4NA 3LCMA 4Z1OA 5A3QA 4O08A 4F71A 4A4DA 1NG1A 1I24A 3AY6A 4BQPA 4YCSA 5TIIA 3PP8A 3KLMX 2D2VA 4G63A 1IY0A 5T41A 4JN6B 3NT4A 3M70A 4KNVA 4WXEA 5ALZA 1H2FA 1MNQA 3DFKA 1YZYA 1MTOA 2J6IA 2OUIA 1MVNA 3K09C 4ZRDA 1I14A 1ST2A 1ULHA 1W5SA 3JZFA 4LAFA 4LG1A 3DF7A 1SXGA 4O5OA 3LXRA 5A4MS 3TB4A 1YCFA 1UZUA 3NX4A 3AR4A 1ML4A 1KI9A 2EP8A 2H31A 2QZ4A 4LBZA 4DMLA 4YRMA 4TUYF 4R98A 3RRMA 1Y63A 1O87A 2QRZA 2AEEA 1UFRA 3E2IA 3FFBA 4LVNA 3BFKA 3ADPA 3L1VA 1UUFA 4HUQB 5CM9C 5JCZA 2WR8A 3TG2A 1F3LA 4HDRB 5F1KA 1GV1A 2MSCB 3QE2A 3FUCA 3DTNA 1TYEB 4PXYA 2C3UA 2EFYA 2WJ4A 4KXXA 1U1CA 2HREA 5J9FA 1GU1A 1WKBA 4TZ0A 1GG5A 2GJ8A 2CHUA 3TQRA 4DSAA 4ZARA 4KAJA 1L5QA 5FTJA 1JJFA 3C7CB 3RK1A 3TR6A 4EVSA 4MVWA 5HEKA 5K0GA 4W8OA 5IRCD 1JEDA 1LV8A 5AI5A 1QG4A 2C94A 3KR0A 2ODPA 2QPTA 4R6XA 5JJ5A 3JWHA 3GZNA 4PBSA 4RV9A 4XYGA 3WSTA 1K98A 3QFRA 1AQIA 1YHYA 3I62A 2PBFA 4WNIA 5T5QA 1GKYA 2Z43A 3PCRB 3W7BA 4ER5A 1PV2A 3GJQA 3A6HA 2IBSA 1JU3A 1OXMA 1XTKA 3WJAA 4WZAB 3BSWA 1PR9A 4YMVA 1GUZA 4UHDA 3EMVA 1IB0A 3OT1A 2HHCA 2MMGA 4FONA 4FQ7A 1Z9BA 4GKBA 5C2JB 1FL9A 4K86A 2FMKA 5AW9A 5K9ZA 2P2GA 4KDFA 5IM4A 2OBBA 5KSPA 2VC2B 5JQGB 4ZIRA 2HXGA 4J03A 2R47A 2XI4A 2ZAYA 1RPZA 1XMXA 3DBRB 1LQUA 4I4NA 5ALUA 4YAKA 1JLSA 1DTWA 2HD4A 1M2OB 1YTLA 1D3AA 2X5KO 3ITDA 3VSDA 1SVMA 2HBQA 3AQ4A 4D97A 3NO4A 4OX9Y 3CRVA 3EB9A 3TH5A 4EFDA 2DF8A 5CW1A 2I3BA 3L7DA 4XUGB 5YASA 3QWBA 1XZNA 3HC7A 1QV6A 3K9NA 3EUWA 1NAIA 3BKXA 4KZPA 3TPZA 2BGGA 4I19A 1AKRA 1RAAA 4HS4A 4PAWA 2MYUA 1BAPA 2F9MA 1O97D 3PQ2A 4M60A 4QPCA 5DK4A 3W1WA 3GLGA 3QIVA 3W5BA 1GZ6A 2HRZA 2Y0DA 1OT3A 4KK3A 1S7GA 3E4DA 1BKDR 4E1VA 3AR7A 1HFWA 2HNBA 4J6EA 4IIJF 3FNEA 2MT9A 3CNHA 2EBUA 2OP1A 4RPLA 5CYOA 3U4CA 1JZQA 3HMQA 3NV7A 5DHTA 5ESRA 5I51A 1WJGA 3LZ6A 5AHRA 5K3CA 5JMWA 3WK8A 3AUJB 4GX2A 4RDIA 1Z4LA 2WAOA 5KYXA 4DADA 2CXSA 4Q82A 4WGGA 1J70A 4XIFA 5FF9A 5K0EA 4H7JA 1DJPA 4YUYA 2BKXA 2ONYA 1XVLA 3ZNPA 5CB8A 1T9GR 2BI8A 1WPRA 2HQBA 2W4IA 1D04A 1Y6RA 3GZNB 4S1PA 4N0PA 4YTEA 1DJMA 1XAIA 5TPZD 1S8FA 4C7KA 3FG9A 4KQJA 3PLRA 3DPIA 5G4KB 3G5AA 4ZC8A 5DHFA 2IV2X 1UDBA 4CKCA 3M4ZA 1I6MA 1W1UA 1H1TA 1GKKA 4UTPA 3RQSA 2VCHA 4R01A 3NTLA 4Y9RA 1DMRA 3WLIA 1CULC 3Q40A 4NH0A 4TXNA 1HX7A 1FU7A 4ES6A 3ZE1B 2PZMA 3HJUA 1TJ3A 2Z6UA 2CSXA 1XN4A 1E1YA 5C7LO 4WXPA 1R2QA 2AW5A 4QU5A 4QLBA 4Z54A 2HSZA 2YZMA 2NPFA 4PF1A 4KUEA 4V0NA 4QJ5A 1JFLA 2ZJ5A 3ZV7A 1LPAB 1U0RA 1M7HA 1JEOA 2YHIA 3K5PA 1T1JA 2UKDA 1CR2A 4MV4A 4QFDA 1NHGA 4UXJA 3VPAA 1RWQA 3BD8A 1DTWB 2AZTA 3ST7A 2J3QA 2OKCA 2VRBA 5C1BA 4MHTA 3E1SA 3QQPA 4QE3A 1DBQA 2R7MA 1DI0A 1I1OA 2ZKLA 2DHDA 3C39A 2A58A 4IF4A 4UE3S 4B0PA 5EMKA 1GFZA 1PDVA 1TA0A 2O1EA 2J0UB 3FCAA 4QGFA 1UOQA 4M76B 3C24A 2FEWB 4BB9A 4U7PB 1EEHA 5HGJA 3OFVA 5DN6A 1QUEA 4OMDA 3DXFA 2X2PA 1NXSA 4PIVA 2PR7A 1J8YF 2XUHA 4XW2A 3K70B 4YP6A 5IKOA 1RC0A 2G63A 3POAA 7REQA 1OZHA 3UB3A 5HRUA 4BP9A 3V1LA 3QH4A 3QX7A 3WRXC 5HHTA 2EVWX 3EVBA 4R81A 4Z4CA 3ZTYA 1RZRD 3QU9A 3QWHA 2WSIA 4J8PA 1CCWA 2PBRA 2HEGA 1KBZA 2Q1TA 2HFKA 4KE7A 3NOQA 2VXCA 1U2EA 2I65A 1MAHA 4K40A 3BH6A 4PNZA 5EHGA 4PX9A 2VHVA 1EVLA 2C9DA 3NAQA 3W9SA 2VJOA 4KSBA 2COEA 4OP2A 3PHLA 1H8HD 3QVXA 5KTRA 4CDNA 1D2RA 2HTFA 1WVMA 1C41A 1KVUA 1PN3A 2FA9A 2ZRDA 3A3NA 1IUPA 2AEMA 4H7HA 3ECAA 5F64A 5EWJA 4WUTA 5KJ1A 1LSSA 4C7OA 4HMOA 3TOCA 1ZRMA 3M6UA 4Y1EA 3OSUA 1B16A 4JJEA 5A4AA 1ODKA 4X1IB 1XP8A 1PZGA 2QTGA 4ZRMA 1P17A 1SUPA 2BEJA 2O2ZA 4L7VA 5EZ5A 4AZTA 1ECBA 3H1FA 2R1VB 5BOSA 2HSJA 5COQA 5DXFA 1VGQA 2G09A 1EFTA 5ABPA 4NE7A 3JPYA 3KD2A 1CLEA 1S2IA 2VDOB 4JBWA 4TTPA 5F7JA 3ZU2A 3PEYA 1B1CA 2AJDA 1CR6A 3KV3O 2O3JA 2XOEA 2RJ3A 1Z2EA 1P77A 1KJ9A 2VQ6A 2XRYA 4IJWA 3SWWA 4LFAB 2ADMA 4YJHA 2MHCA 3NC1C 3EDQA 2XB4A 1QO9A 3B3QA 2OR3A 4D42A 2GX6A 4KIFA 1IJFA 3RRZA 4DDHA 4BNTA 1ZD4A 2XZDA 3BD9A 3UHPA 3GCXA 5IF3A 4TMXA 1U7PA 2AOVA 4C0SA 221PA 3RRFA 5TT1A 2YYSA 3OKAA 4FOPA 2WVHA 2OB1A 2CMGA 3M8KA 3PC2A 3R2JA 4F12A 4B3GA 2OECA 3EWAA 4JLWA 2H9YA 3B9RA 4GNRA 1KS9A 4XQGA 2EARA 2XNDD 3PXXA 3OCVA 2BYTA 1V45E 3AF1A 4TMFA 3PT9A 4L57A 2WICA 3DAGA 3FPLA 3RFXA 1XR3A 2GXAA 1C0KA 5H1YA 4DB2A 3TNYA 4LC1A 3WLPA 2F8TA 1RR6A 1VA5A 1VE7A 4R84A 4KAFA 3KVVA 1Q2UA 2AZ4A 3GRPA 2ZREA 4EEZA 3DUFA 1LPMA 4R9UC 3KAKA 3SK0A 4DBLE 2IS6A 3COYA 4NXMB 1IXSB 3RVJA 1S2GA 2GN6A 4Z9BA 3RSHA 1J8FA 3P2JA 3H3JA 3WL8A 5K8UA 4MVJF 1YZHA 4LKRA 5SV2A 3CIOA 2YQ5A 2ZCVA 1HDGO 1MNAA 2E4YA 1DCMA 2QV0A 4P5EA 5A1JA 4HAUA 4D8XA 5BURA 3K6KA 1VGRA 4AZWA 3D54D 4C7OB 1ZNYA 1KJIA 1PSWA 3SZOA 4XGKA 4J16C 3T4XA 3RRYA 2FRDA 4Q34A 4HKTA 4Q9AA 3WR5A 1DQNA 3K2EA 4Q1CA 4GR9A 1DSSG 5ARCA 1U2TA 3MPOA 1GKIA 3VPSA 3ETNA 4WJLA 2ACVA 3PDUA 2WWFA 4MI9A 5C35A 3C5WP 1GNTA 3TD9A 2YCLA 2G40A 3KSZO 4LHEA 1AB6A 4PG7A 4B3XA 3DKPA 2IL1A 4MDEA 1E9BA 3INTA 1MJ5A 2CCJA 1OAAA 3CT6A 1BSVA 2KW5A 3DTTA 4RGQA 1YS9A 5JH7B 1UAAA 5JYBA 1PP4A 3K70D 2CVFA 3AR8A 4INAA 1FLDA 4QU9A 4YJHB 4E5SA 3FTEA 4I6GA 4MCIA 3TINA 2G7ZA 3VAZA 5JD6A 1EUCA 4UFNA 2I4IA 3H6GA 4BMCA 2ZM5A 3WGKA 4MVYA 2HJ9A 3KQQA 1RLOA 2VAWA 4ZI7F 3LPNA 5IT4A 5E6UB 1J0AA 3C6XA 2YV4A 4PLZA 3UC9A 5H9WA 2XWJI 5DHUA 1MT0A 2ICAA 4IKOA 2Q5IA 2AUMA 1GGFA 4K6GA 9LDTA 2IKSA 4CU2A 4S1VA 5T4HA 3T5GA 2PH7A 3BM5A 1DHRA 1JIXA 3BGSA 4FJ0A 1E66A 5JVDF 3BMNA 2GCGA 4Y1GA 2IS2A 1ZHOA 2OO3A 3K92A 2C4KA 4CQLA 2O8FA 5BMOA 2PGOA 5C8YA 1YBVA 2GPJA 3WMEA 4W5HA 1MG5A 3G0OA 1SIBE 2QLBA 3P1JA 3VBEA 1VZ3A 4H3SA 4F21A 4HN4B 3KX2A 3JR3A 1FYFA 2VHEA 2VL7A 4KN6A 4OJQA 4PYQA 5DT9A 4BKRA 4EG3A 2R1TB 4FW8A 1YRBA 2RG7A 3CR3C 2BFDA 3GCWA 4UCXA 5EJ4A 4GYJA 3UAYA 2QBYA 4XQCA 5BSWA 4UHKA 2ZAIA 4WIAA 3G49A 3KXDA 1JMYA 1A7UA 2FDRA 721PA 4YQFA 3DAYA 1V5EA 3L0IB 1I3LA 5GZ3A 3ZVNA 5FQOA 2DKNA 2VZ9A 5HOQA 3ENQA 1UMBA 3PLAE 3IMCA 3WGNA 4IMPA 2V0GA 5JNTA 4RJTA 5LBUA 4KL8S 1GLGA 1VPTA 4ARAA 4UC0A 4M7RA 3RAEC 4N3CA 3V7NA 1S8OA 1T5LA 5FORA 3HTXA 4NI5A 3T7KA 2X5OA 3FDFA 3HU3A 3LF1A 1NVGA 5HF6A 3WXMA 4DIDA 2W0MA 4HGOA 1ZH4A 5L3ZA 2WP8J 1PD1A 2ZCUA 1G19A 1ESMA 4ZAWA 3NNNA 1D9XA 5PNTA 4D3SA 5DYNA 2YQZA 3AIKA 3ROFA 1BA3A 4HDKB 2ZTMA 5I9BA 5CDFA 5DN6D 1Y8RB 3AR3A 4A7PA 4NESA 1RMTA 3WIBA 1SC6A 3HY4A 4JNCA 5AUQA 5JRJA 3MJDA 2UYCA 1R0SA 4FM9A 2FG6C 1EJ6A 2I22A 2JFUA 1W0JA 1WCYA 3LQFA 5HF8A 1X3LA 3TD2A 2F43A 4LDJA 5JEKA 2YHUA 5LLDA 3ZVKA 1ATIA 2H5IA 2ZQ5A 4LC9A 1V7QA 2OYSA 4N01A 1DEVA 4NY1A 2DJ5A 3HPQA 3LFUA 2QUJA 2QTFA 2WIBA 5H83A 4RENA 1U99A 3N39C 3NBXX 5FI0B 4Z0PA 1NQAO 3UJHA 3JWJA 1QPZA 1DPGA 4QJ4A 2HXSA 4TM7A 3CA8A 2O5VA 3I2JA 4QULA 3PWTA 4RZQA 1U4NA 3LFHA 1K2MA 3KTAA 3AFHA 3RYIA 1O08A 2FRVA 4H27A 4RQTA 5AICA 4I2NA 3UOGA 2A9OA 1WDTA 2FOIA 4C4TA 5MGBA 3LHDA 1T3ZA 1WCXA 3ND9A 1E1CA 3KYBA 5IULC 2JA1A 3ET5A 3K5HA 4MW0A 1NJ2A 2XCLA 3QVGA 4Q3AA 3RS0A 3COJA 2VFAA 5E4FA 4GLLA 2BF7A 1BE0A 3AP3A 3ZCUA 1R7RA 2W2KA 1U5AA 1D1PA 2PD3A 3BVPA 3IYLW 3DUWA 4EB6A 4F4UA 3DGEC 3IP7A 4C04A 1NBHA 2XBUA 1EM8A 5KJEA 5KCMA 3CZCA 4IJVA 4AQDA 3UAWA 7AT1A 3NT2A 1B73A 3GFBA 1UMBB 1YQEA 1QK4A 1YZ3A 3IPRA 4TXJA 5IAEA 3N3AC 3RIHA 2PX2A 2B1RA 3K9HA 3W2TA 1O5IA 4TLDA 1JKJB 3JQ8A 3JVVA 5C8VA 5B6IA 4BXOB 1V4VA 4X6YA 3KHKA 3AETA 3G68A 1F8YA 1NLYA 3HK2A 2XUGA 1ONOA 3QEAZ 4ZANA 2NQ8A 4ZRNA 1R4NB 1ORRA 2OSVA 1ZIDA 1ZLYA 3A14A 3B8EA 4KRFA 4QOSA 3SZUA 3R3SA 3F78A 1Z0DA 3JAKB 3CKMA 4OQMA 2XKBA 1RJEA 1JP7A 2FPSA 2VJMB 1E1LA 1QZTA 1M2KA 2QS9A 3D6NB 3PT5A 5D6OA 3V1YA 3GLQA 3B20A 4ETWA 2J5BA 4GGMX 4HD8A 3V8QA 1DPFA 4LY3A 4FGSA 5I7OA 3UYKA 1P0FA 2VZ8A 2ZJ0A 5DTMA 2F43B 4HLCA 3EZXA 2W70A 2FEXA 3TW6A 4G5SA 4EG4A 5MDHA 3FCUB 2VQFB 2M32A 2R0QC 3T12A 2AFHE 3AW9A 3HCNA 1RABA 4FYMA 3QEJA 1QIFA 2OCBA 1P3JA 1QMGA 4NF2A 3GXOA 3GPLA 2OEPA 4I4TA 4UVGA 3ONVA 2OM2A 4MPDA 2VWQA 4JSRA 2UV8A 5CX1B 2BEVB 3UQZA 3RYIB 2ONZA 4HWPA 2X4IA 4R9VA 1U7DA 2YOGA 3EAFA 3S2SA 4OI4A 4HNAA 3TTUA 1KC3A 3SZMA 4BO7A 5HZMA 5IWAB 1K2WA 4GEGA 3F46A 3K1AA 3QVGB 3CVXA 5JCPA 4GBGA 1Q22A 3H5TA 4P9NA 1P33A 3S44A 1VDZA 4BDTA 2OUKA 4IVQA 4LRSB 4L5IA 2IYEA 3ZHVA 1NXPA 1MAAA 1L7VC 5LXTF 3UWKA 4ACBA 1Z3CA 3IKTA 3K9CA 1WOMA 1POXA 3KG2A 2P2NA 5EG5A 2NSLA 4M36A 3WA6A 1J49A 1I5EA 2JIBA 3G59A 4IHJB 1V1JA 2C9ZA 1OKKA 3FZEA 5AXCA 3ILSA 3EPLA 3QLVA 1QX3A 1WXQA 1M1YA 2GESA 2QLFA 2QG4A 1ZN2A 1SOAA 2RGXA 3GT0A 1P18A 2ZWMA 3IQIX 4B7AA 1O0BA 4JR2A 2AZXA 1AKWA 3HZOA 4WLNA 4ZD6A 1Q7TA 2ECPA 1SUIA 3QG5A 3B3AA 3N6XA 3UA3A 1PO7A 4IICA 4QZVA 1NLFA 5FD8A 5ALYA 3TTYA 5TF4A 5J5CA 2HMSA 1Q16A 4JSTA 4IH4A 4UPEA 4JQZA 2CHFA 2YJZA 3R6DA 2XEDA 2VAVA 2JD2A 4MPTA 4OHPA 1N6OA 4F38A 4YUXA 1M5TA 4Z2AA 2VDUE 4UAJA 4P4SA 3WYEA 4K9NA 3TMAA 2A33A 4KRXA 4IGAA 1GUBA 5JFTA 2W6IA 4E22A 2X2FA 2JAUA 4WNAB 3ZHUA 2BFCB 1QHHB 4IV0A 4PFSA 1EBUA 3C8MA 3IDFA 4WN3A 3VV3A 5IHPA 2QD2A 2IUUA 2A4MA 5ED4A 2WY2D 3O8NA 4IDFA 3GHHA 3T9AA 1F2DA 4Z0TA 3IIEA 4QYMA 3WSVA 3ETDA 2AC4A 4BGEA 1TKCA 2OMEA 2XHEA 1G88A 1T9DA 4G5OA 1RCUA 4YRZA 2JHGA 4IDOA 4M87A 4ZQBA 4TKVA 1PWXA 2OLKA 3IKLA 4JI3B 1U7OA 2HRBA 3ABZA 4TMZA 3SHWA 1JSXA 3K53A 2FPIA 3GC6A 3QBEA 1QCDA 2JLQA 2X1VA 3N7AA 1DRJA 4GI3A 1IJEA 1X77A 2BGLA 2FJPA 4TLAA 4U7TB 3QI7A 4XR4A 1CERA 4ZPXA 4Y2YA 1XHFA 2BH9A 4B43A 2HUNA 2PL1A 3Q3EA 3QYFA 4JLOA 1QIKA 4GWGA 4IQFA 4AUEA 4JA2A 1JHOA 2BGUA 2VT6A 2Y9MB 4R7ZA 2GHIA 4HXFB 2YY7A 2NMVA 1EWTA 2ZP1A 3GCZA 3FGZA 5AM1A 2IBTA 1IHPA 1KU0A 2AXEA 3FOCA 3O2NA 2WM3A 1S4QA 1Y0BA 3G79A 3OG9A 4MVJP 4PX2A 9MHTA 2D2FA 1I0LA 2IHUA 1NF8A 2QZZA 4AJJA 4BBPA 3QVTA 2WRZA 3G02A 3I6MA 4X93A 3HABA 5JIBA 4AB1A 3Q9UA 1YF3A 1U1GA 2LE0A 2J3HA 3NS7A 3QFSA 2OBLA 1CRWG 3ZEIA 1VBNA 4FT4A 3SDZA 4JFRA 4NZPA 5IMSA 4ITVA 2ZRHA 4DXAA 2HSGA 4M1WA 1L5RA 4E2ZA 3TBKA 1M2FA 4ESVA 1A4IA 2OQRA 4RK0A 1TDJA 1C0EA 3OZBA 1Q0QA 4UUOA 1QHIA 2DR2A 2O57A 1E2KA 1ZHFA 4P4SB 3FHCB 1T13A 1OF1A 1RQGA 2AZDA 2GYUA 3SFVA 4B46A 3H7AA 3RYHA 1REQA 2G08A 3PFWO 1SZPA 1PJ4A 3CX7A 3BJIC 3N2KB 3DVAB 5CU7A 1A9XA 5HM6A 1FEZA 1DMSA 1Q7BA 1T15A 2PBZA 2I1LA 2P6MA 1TQ2A 2WEKA 2YIDA 1UDXA 3CLUC 4OAPA 3QY9A 1XWFA 3EW9A 1P2TA 1M8KA 3FRIA 1XUOA 1U2PA 1U98A 2QJTA 3PFCA 1T4MA 1CK4A 3VU1A 1N2ZA 4E70A 3DTVB 4TKVB 5KSYA 2G6TA 5E50A 1ZITA 2GASA 1VP9A 2XGMA 2GZDA 3EOBI 1POWA 5JS8A 1IY8A 4KWIA 5KVSA 3DOEA 2B21A 4C5BA 2J0SA 2B4KA 2XECA 1CUAA 3P9NA 4C4AA 4UJ3A 3RHSA 5JDIA 3GNSA 4B45A 1X7ZA 1D1QA 1SVSA 4HNUA 1QO0D 3D9QX 4GLBA 4A4YA 1ODIA 3C6ZA 3SNKA 2Y05A 1PUXA 3ZE2B 2C0QA 5IP5A 4TSFA 4LJRA 4TMKA 4DEVA 2FSVA 4YI3A 1DAOA 4N54A 4B2YA 2HW8A 4OQNA 1ZK0A 2ZI3A 1JZTA 4QTYA 4DCOA 1ULBA 1XEXA 3CNOA 4HZGA 1R64A 4PM4A 3RIEA 1XVIA 1D2HA 3FYUC 2HIGA 4WN9B 4YCDA 3WNQA 3RT1A 1G41A 3VSEA 1UL1X 3ESAA 3N76A 2XR1A 5ICGA 4Q16A 3FVRA 4WMLA 4QT4A 1RQXA 2HJVA 1WB6A 4UASA 4EEXA 1H0SA 5H7XA 2XZPA 3B1VA 3DEAA 5L3RA 1EDDA 1Q50A 3AF5A 3F1LA 1B8PA 3FYDA 5KOHA 1WHSA 4O2AA 1LJUA 1IN1A 4BVHA 4CLXA 2SKEA 1B0UA 4Y0VA 3QVLA 5J40A 2A5GA 4IO0A 2WWTA 1YZQA 3PSAA 6LDHA 1AV7A 1XLTA 1JBEA 3DD1A 1PSZA 4OA5A 4LZNA 5EZ6B 9GPBA 4F92B 1CXZA 4R71A 4XAQA 3CFYA 2GEKA 4EG6A 1REQB 1T10A 2Z2JA 2DFVA 3FZYA 3OE1A 3VX3A 4XLLA 4EH1A 5JXWA 4DV4B 3PU6A 3ZHXA 3ECCA 2GFIA 2ZUVA 3E22A 3JYLA 4D44A 4BVGA 4D5GA 3V48A 4B73A 4IRMA 1NQWA 3HVKA 5CA0A 1OWPA 3NRJA 2C77A 4R7TA 1R0ZA 4FT2A 5H3LA 1HTWA 4JJ4A 2QT0A 3U3DA 121PA 3HA2A 3U7JA 2FB9A 3BIXA 3CNNA 1EAMA 1UFVA 3L84A 1I4LD 2C88A 1E3QA 2AFHB 1E2MA 1U8ZA 1OKKD 2W83A 5T57A 3R9IA 4BAUA 2BSXA 2P6NA 5A6SA 1HL3A 3BSSA 4HB4A 3A4TA 2Q6OA 4H60A 4JT2A 1X7ZB 5JBQA 3N05A 3B3FA 2VRWA 4AUKA 2ZU6A 1ISGA 2W3OA 4IO1A 4M22A 1QPGA 4CLRB 1L7EA 2C83A 2HU8A 2OD2A 2VDMB 3W6PA 3BF8A 1TM2A 4ISCA 2GD2A 3LVQE 3A4MA 1S3FA 2ZOSA 4RA6A 2OGUA 1TA9A 4A0QA 1HMYA 1JDUA 2BR4A 3N8HA 1MGOA 3R75A 1Y9JA 3RG2A 4IDEA 4B6FA 5DBEX 2QUZA 2QGZA 3JVEA 3UMCA 1JIUA 3BE8A 3PUKA 4UNNA 4F3RA 1Y6GA 4OQDA 3QY0A 4Q4JB 4BATA 4UQLA 1V25A 2AR9A 3JYQA 1FVHA 2EFCB 6GPBA 1PYDA 2W6ID 2CKMA 3C5VA 5CT4A 2FDCA 1WQ3A 1WWKA 5B4UA 1QP0A 2P67A 2DFLA 4NZNA 1QIMA 1XDZA 2J48A 4NNJA 2J9ZB 2QTWB 1YACA 2WK1A 4MARA 4YRTA 5DYGA 3WYBA 4EMUA 3NIGB 4MRVA 3DBOB 3ICOA 4QEKA 4WY8A 2YC2C 1N1GA 3EVCA 3BD6A 4PQYA 2YIJA 2XV1A 4UARA 2C96A 5CPFA 5CFPA 4QODA 5TJHA 3DB1A 4TV8A 4ZEWA 3KOWA 3H87A 1GNSA 5A0TA 2B3DA 2WYIA 5ALDA 1RHRA 2Z98A 1JHVA 1T6XA 4UUBA 5K3DA 4UBJA 5IAAA 5IDQA 4IZOA 4ARBA 4YPOA 4J29A 3CGWA 1MENA 2OCYC 4OJMX 1Q57A 4KH1A 4AO8A 3IOYA 5I8PA 3IR7A 3A7DA 3CWZA 3WBKA 3D0OA 1ZVMA 4AN1A 1GARA 1TO2E 3L0ZA 1PZNA 3E22B 2A5JA 2APJA 2B2XA 2ZJAA 4GSKA 1E4VA 4MQMA 3O31A 4N0QA 5IJ0B 5KNCA 5B3KA 1MHTA 5CA0B 3KIPA 1GGNA 3AIOA 2I29A 1P72A 5AI0A 3REQA 3BTOA 3PWSA 2X23A 1NRXA 1MX3A 2YHBA 4MKIA 4BBZA 4FWBA 3TDKA 2KB3A 1D6NA 4WBNF 1ODCA 3KTFA 3JQBC 2BVNA 4PZ9A 1FFWA 2DULA 1MB2A 4XXHA 4JUFA 3TRIA 2EZTA 2I54A 5I3ZA 5ICSA 5JJLA 1PS0A 4KFRA 3UXHA 3NTVA 4AZ0A 4HR7A 5KNDA 2R68A 3I9KA 1WW3A 2GHRA 1SN7A 3CF0A 5TMDA 3FAKA 4TXHA 2AJTA 4PZLA 4QDUA 4Q3KA 4Q4AB 1I1HA 3AFIA 3TLBA 1JEAA 2ZE7A 4LXGA 1B1AA 1SUBA 2AH5A 4QXRA 3R3YA 1XC7A 2GN2A 2IXEA 3OQHA 3KJZA 2EDCA 4CN9A 1QJCA 2C92A 5LQKA 4UBOA 1YS1X 1ZBDA 1G8FA 4FHEA 4MCJA 5IS2A 2PANA 3GEDA 3DM9B 5FAKA 3D2BA 1P2BA 3EK2A 3DXXA 4M89A 4XWOA 5JRZA 1M2GA 5FPKA 1DOZA 3RV4A 1YONA 1W46A 3Q6MA 3QEOA 3O8QA 1EJ0A 2O6HA 5EVJA 5KUTA 4LI0A 1IXYA 1UFQA 5SZKB 3IPAA 5JAPA 2XXAA 3L7KA 3ROKA 1RXWA 4LX8A 2ODEA 4FX5A 3WGGA 1PQUA 4FDTA 2FAXA 1O96B 2FYTA 2B4YA 4J7AA 1GN9A 4NENA 4TV8B 3ZHSA 5LFAA 1DXYA 4XJTA 3SS7X 1JEYA 3H13A 1ZISA 1HNZB 2JBWA 4K9KA 3U4GA 5DCYA 5FBWB 4A8PA 5JT1A 2CSWA 4PLVA 3OQMA 2H08A 4HTFB 4PLHA 1RHQA 2GCIA 4CV3A 2MSLA 2EFEB 1L4BA 1FA9A 2ZQZA 3R3JA 2CL5A 1DNPA 2FUG1 4BNLA 3BEDA 3ZI4A 4A0FA 2ZB7A 2NVWA 1BVYF 1YRQA 2I2WA 5I7SA 5E3JA 1TVKB 1NU6A 3FYSA 3RE1A 1JSCA 2WVJA 5KYWA 7MHTA 4Y7CA 3II6X 3VGJA 2B1GA 2GSWA 3R44A 4A26A 1EUZA 1YVRA 1WV3A 3FCXA 1NWHA 2CJWA 2IZ1A 2QZSA 1I30A 3IJ5A 1BJRE 2YOFA 4ATNA 1A7KA 4D4KA 1BX1A 4WBXC 2BBWA 5IWCA 3I6IA 4E7PA 3BAZA 1V5GA 1LPBB 1W4CA 3RS9A 4CKEA 1XKTA 2P77A 1T25A 3LOUA 1RI1A 1N8TA 1YL7A 1S01A 2P4SA 5CCBA 2GN0A 1QGUA 2EOAA 3I09A 1A9SA 3MAAC 4FYXA 4N5HX 2HZBA 3TK1A 2XMPA 1B23P 1DAHA 5LMZA 2FUG6 1RI4A 2J7PD 3CW8X 1M6VA 4DMKA 1JTVA 1QYVA 3CZ5A 1YQWA 1NDHA 3KU1A 1RAFA 2FLWA 2FN8A 3D64A 1YIOA 4J94A 4OU4A 4X94A 1PU2A 1QM5A 3U0BA 4BP3A 2C7BA 2PZLA 4GHWA 2RK4A 3DVLA 4EPVA 1QPBA 2GVDC 5H4GA 1BQ4A 2BI7A 3DBLB 2PZJA 1ZJ4A 5EXTA 2UUOA 4LA4A 3THOA 4IYJA 3ENVA 4MKXA 2OOKA 2D1FA 3DZBA 3FROA 4XASA 1YT5A 3HDJA 1EK1A 1FB5A 3BAFA 3F1KA 3KJNA 4L74A 5JTTA 5LP6B 4ZYVA 2JLXA 4N82A 1FUEA 3RIYA 5ALXA 1BN6A 5FTKA 5J5AA 2J3JA 3IPXA 1DBVO 4EIWA 2JFOA 2ZBFA 4QOFA 5HK8A 4X3PA 5IT0A 5U4QA 3EPKA 2HIAA 4HI0E 4R2JA 1CPYA 1TEZA 2PS3A 2C0CA 4BWGA 5AOVA 2HWUA 4WZZA 2R8YA 3O6VA 4OFZA 1GV0A 1OA0A 4EQ6A 1RKVA 5JEEA 4DLYA 3DJYA 3D6TB 2NSYA 5L4NA 5LIPA 1IVSA 3G89A 3RK4A 4YXFA 4CODB 1PJZA 2H6EA 3VC7A 4WERA 1YK0A 4JYZA 2QE7A 3DSRA 3G82C 1XELA 1KI7A 1OWNA 1HI9A 3EH2A 3OX3A 4JVSB 4RNDB 1AHHA 3LUPA 1T0BA 1F4PA 3MRVA 1RJ9A 1NC1A 4I1PA 4EFKA 5TPWA 1E8NA 1THMA 1C3OB 3ABQB 1TZBA 1PNOA 2VYNA 2H1LA 2CDAA 3DE0X 3KLNA 4C0XA 3VDRA 2CNDA 2QQEA 2W8ZA 4RGBA 5FT9A 4ZV7A 1Q1AA 1N5RA 5EKUA 4B7CA 4DDKA 1VCNA 3MRXA 2O50A 1MDBA 2NO4A 3QVKA 2DHEA 5JS6A 5FDFA 3ELYA 4QQNA 4K5QA 3C3CA 4OXRA 2Y1XA 3UOTA 1GZUA 4YT8A 4Q00A 3SGLA 1CKEA 5I6DA 1XVUA 4C1NA 2EQ5A 3TZBA 1R37A 3AL0C 3AVYA 3GV0A 1ISRA 1CC1S 2Q1YA 1BN7A 2C5AA 5H16A 2R5WA 1RYNA 3WLFA 2HWXA 3C5EA 4RU1A 3FKJA 1CUVA 1DQSA 1QDLB 1FJHA 3M81A 5HCIA 1W36B 1W8IA 3N58A 4BX3A 1OROA 4BGUA 1NPDA 4J1QA 2GILA 4I9HA 3TPFA 2ZJOA 2ETVA 3CURA 3ZI7A 3T3MB 1KAHA 4DR5B 4AKEA 4BFUA 2VDNB 2ZB4A 1RKQA 4G5QA 2C7RA 2RK6A 3V8VA 1R3UA 1X0XA 2AMLA 4YNBA 3ANYB 5I7UA 1O4WA 1P1JA 3ZLVA 3MJRA 4DJEC 5KNCD 4YYEA 1GUAA 3IQWA 1AQNA 1CVIA 5TS2A 3PNMA 4Q24A 5B1EA 1QG2A 4D9GA 3DV0A 3PC8A 2EKPA 3IEKA 1SIWA 1FUUA 2O7VA 1PL6A 3PA8A 4FEAA 4K88A 5JNLA 3W90A 4JNKA 4EHHA 1UKVY 3PXAA 3PVCA 4S24A 1W96A 4TT8A 3F9IA 2ZT8A 1YH3A 2Q4EA 4JP2A 2H2HA 2E4UA 1GN8A 2XJ9A 5DW3A 2JJ1D 3ZV6A 1XA3A 4M38A 4D4HA 1GDDA 4RABA 1V26A 2J0VA 2JASA 2JKZA 3ANXA 3RTEA 5C0OE 3EA4A 4BLWA 3SVTA 3T94A 5KYKA 1T2DA 2XA2A 5FPQA 2NU9A 3UY4A 1GPWB 4P0PB 2ZTUA 1XZIA 1M5UA 3GLFE 2I34A 3IQDB 2P69A 5DGIA 3JALB 5LVAA 3GJZA 5T6MA 3FUXA 4WLUA 3BJEA 3ZU5A 3MINA 1SA0A 4GX0A 4LX0A 4M99A 3HA3A 3W34A 1DKQA 2X9GA 4LCEA 4LN1A 5GIOE 1JFFB 4N5DA 1UCFA 1KDVA 1ZJJA 4X95A 3O73A 4FSHA 1BDMA 1RYYA 1UFKA 1ZXBA 5BOVA 1BMFA 2DPMA 5K4AA 4EHLA 1WB4A 4L0DA 4ZYXA 2PT5A 5CFOA 1R6UA 5IDXA 5HBRA 1RJDA 2SECE 4D9IA 1W1IA 1DE0A 2AYYA 4MKRA 1RKXA 2JI4A 1A7JA 3SDBA 4D1YA 4G81A 1A5BB 2LP4Y 3PWZA 3LQ1A 1I2DA 4ZU1X 3BQ9A 2XF2A 2YW2A 2A59A 3GJ3A 1L4NA 2XNJA 1BEZA 1ULUA 4WESA 1D2EA 2PPLA 3SBDA 3UG6A 4YA6A 4C0JA 3NHUA 5LUBA 4C7MA 2Z1MA 5AW2A 1E69A 1BX0A 3EEYA 1OIVA 3ETEA 4IDCA 1UXGA 2DWPA 2JK1A 3M83A 1N6IA 4N49A 1I0IA 4H4EA 4Y6RA 1V8PA 2RMKA 1EDEA 4F3YA 1T8SA 2X9NA 2VZEA 1LBQA 3GAMA 4AP6A 2HWYA 3EZ6A 2G4VA 4K6FA 1QIIA 4BRZA 3VHQA 2AG5A 4HZUA 1RJWA 1NUTA 1XCLA 2CW5A 3IHWA 2BF4A 4LRYA 4DS3A 1D2AA 1UZLA 1V41E 3R5KA 3K1YA 2VTEA 3GGPA 4AC9A 4MWSA 2FSPA 4XEHA 4YMTA 2YMPA 4EGXA 1LJLA 3IEUA 1WXIA 2JH8A 3EDYA 3RJ5A 2FQWA 2SKCA 3SC4A 3M33A 1X9IA 4FXOA 4M0PA 4BTLA 1U0JA 2NUPA 4FOSA 5DGHA 1T4BA 3W2IA 2BFFB 3LHFA 3ZTTA 3ACDA 1C0LA 2ZIXA 3UMVA 5GTDA 3QMWA 1P7VA 3UXMA 4RVUA 2I91A 3FBWA 4IHAA 5EMHA 3L18A 2I66A 1T8WA 1X7YA 4PTZA 5LZ7A 4JI5B 5BVGA 1KQFA 3HXOA 3SYMA 4MIKA 5C1IA 3KDAA 3QLTA 3HJGA 5AVXA 4IDBA 2BFEA 1NN0A 3EBLA 3D6AA 4ZZ3A 5K3FB 5CEFA 1WCIB 3R7BA 3AM1A 1MOZA 3QE3A 3D8UA 4M88A 4QJ3A 2P6RA 2SHKA 3CWCA 2WUGA 3D6VA 4ZTZB 3E9MA 2HB6A 1W36D 1GZSA 2FZKA 2Z4SA 4Q4HA 3A3YA 5LQNA 3EZ7A 2XLCA 1R5NA 5LMNB 1UJCA 3H11A 1SK9A 4JGIA 3DLBA 1KMQA 4NPAA 5G3ZA 2PSEA 3CUVA 3OURA 5LJLA 3E2PA 1XQ1A 3K1TA 3B7WA 2XW6A 1JWLA 4H4DA 4P7FA 3PHJA 2FF7A 5LDDC 5BN3B 1CWUA 1XRPA 3WRWA 1L5NA 3F5DA 3ZUGA 4OM8A 4L9RA 3HB4X 3TNFA 4ZQEA 5JUWA 1LZKA 1W2HA 3NHKA 5EIBC 1PLJA 1QYDA 1UJBA 5B3JC 4G1BA 2R00C 4ZOLA 3J7AC 4BGVA 3HG7A 1WXEA 4TYMA 4ZQHA 3JYPA 4DANA 4YUAA 3LJKA 2OXCA 3QVOA 4DMRA 3ZJ4A 2AFFA 2JLUA 3M1LA 3N2LA 3V4RA 1XK7A 2JLCA 4UTVA 2A1UA 4TYQA 5HSGA 5DBIA 4ZVUA 3EUEA 3OPQA 3VR6H 3MILA 2VBGA 1UBRS 4BV3A 5AOCA 1T9KA 1WBBA 4F60A 1XXHA 2VYND 2XD4A 2F8SA 1RSZA 4L95C 4CMBA 4RKEA 3B1ZA 1XNQB 3LDHA 2G17A 3V4FA 1YZFA 1WOYA 4O4HA 1FTWA 1X94A 1WDMA 1QE0A 2H85A 3GUHA 3GP5A 2A1IA 2FCRA 5C1PA 1F0PA 1DRUA 1OX4B 2P7HA 4IIEA 5E0KB 4CTJA 2O1XA 3IALA 4G1EB 4YMHA 5F3DA 4KQ9A 3FLAA 4JKIA 5ECWA 3THYA 3BXPA 3WK5A 2J3MA 1BD3A 3OT4A 4M1QA 2OHVA 4PZAA 3S7TA 3T7IA 5AW8A 4I6EA 2VKTA 3ACCA 5DE3A 3L6UA 3V80A 3GUYA 3AHEA 1CUZA 3QUCA 4YIHA 4HH3C 3L8MA 4C3UA 4PG5A 1FZQA 2ZJ8A 2F48A 4UQPA 4DIUA 4C5AA 5GWXA 2H1HA 4RJJA 1FXUA 3K9FC 4AG5A 4LJSA 4M1KA 3B6MA 2IU0A 1WB5A 3R3HA 2NUBA 3LIPA 5A3VA 4B3TB 4IBOA 2ZJBA 3ZBPA 5E7IA 2ZR0A 3GRCA 1F6WA 1UMCA 2O2JA 4X1KB 3QV1A 4ND8A 5HE8A 4N0EA 1NUSA 4F8EA 4F2PA 1X8LA 3PXUA 2XIQA 521PA 4ZQIA 1UANA 1SQ0A 3O91A 4DBZA 4RCVA 4NE2A 4MVCA 1HY3A 1S9HA 5M3BA 1V3TA 2VP4A 5CBPA 2IEAA 5B5SA 1GDHA 3FNHA 5JADA 5BSGA 2AT1A 5IVIA 3RBVA 5FL3A 5KWEA 1NPYA 4TUYA 3DAHA 1UC4B 3PB3A 3U7RA 2X8WA 3B6KA 2YV2A 1U2ZA 2FZVA 4IH9A 4V0OA 3VDQA 4CT5A 1OXVA 3PHGA 1KZ9A 1UBSB 1WPXA 4XWYA 2VPQA 3MJEA 3IESA 3HFRA 1CUFA 1SKBA 1UC5B 1QKIA 3PQ5A 4YAWA 3UWDA 5CFMA 5KU1A 1LGYA 1T2NA 1N5JA 3I0MA 4N03A 4OXYA 2D5LA 3QM1A 2PUDA 1U6IA 1WXXA 3ND5A 5KC8A 5BORA 4ALKA 3H9JA 4Z9XA 1G1MA 1GTVA 4RTJA 4TRJA 4I7EA 4NABA 4QUDA 5GZ6A 3OAAD 2BCJQ 2VATA 3ESYA 1Y98A 2J9YB 3GH3A 4W1RA 1SHJA 3JASA 1TPYA 3UAXA 4A8TA 3UAZA 2DQ4A 1GEGA 1Y7PA 1QFMA 3T3HA 4OHOA 1BXRA 1ZR4A 5LR6A 4AO7A 1K88A 4WJZA 3RSCA 2LPMA 4L5JA 2BFBA 3DYVA 3O84A 3U13A 5CDGA 2XTZA 3PNKA 1H0HA 5HTOA 1D5CA 3F74A 2PHZA 4TQUS 3IBFA 3GLFB 3TUIC 3SF0A 1IPHA 3S1AA 1VHLA 2ZWIA 4MJ3A 3NOVA 3KJXA 4Z99A 3HVHA 3SEQA 4B6QA 1TO6A 4F97A 5L45A 2XQKA 2WM8A 1SJ9A 1XTTA 4QPZA 1I4TD 3MBIA 2GB4A 3W78A 2ZYAA 1G6Q1 3QFTA 3EA0A 4TLEA 1XD8A 4GXTA 5A9SB 4B32A 2XMBA 2JLRA 4E07A 2IDJA 1CZUA 5F12A 4IQ4A 2XCUA 1O95D 4WFKA 3K6SA 3CR8A 2PSFA 5K3AA 2FEPA 5CBPB 3BXFA 5A4FS 1EPUA 2WKSA 4LF7B 3MWEB 2A30A 4M6WB 1MX5A 1OYWA 1RZVA 3A4YA 3W6UA 4EW6A 5KWIA 5G0TA 4RHYA 5ADUS 4K0KB 1DKRA 1E18A 2NVUA 1IFXA 3U3RA 1NF9A 3N8DA 5FPPA 1GVNB 3EFHA 2CC2A 4R1SA 1IATA 2OENG 3X1JA 1XA0A 1XO1A 1FNNA 1N7IA 3JS5A 2EH0A 5DJOA 4FCCA 3CB4A 1E2GA 1GPJA 3GPDG 4FMCB 4GVPA 4AS3A 5JROA 3RABA 1UJMA 5EJAA 2VNIA 3NASA 5FOXA 5TGTA 1GTMA 5FRDA 4B6SA 3P27A 4IIJA 3W79A 2V1UA 1Q1EA 4RLHA 1BMQA 1VYHA 2AR0A 1XU4A 2WU0A 4A9AA 3BGOS 5KYYB 2XVXA 3QFFA 4E51A 5T8KC 3KAQA 5FUQA 3HDQA 3WIOA 5B1DA 2XMZA 4Z7OB 5IF9A 5AW6A 3JASB 2VUSA 4Q1AA 1JKMA 4TV9F 2PT7A 1MJHA 2IE8A 1RPJA 2QTVB 4O8CA 1RRVA 1U8FO 1VJDA 1PLLA 2OBFA 4OI2A 4ZFNA 1DT3A 1IDOA 1QQ5A 1V3UA 1AA9A 2QM3A 2X3FA 3RVKA 3IHKA 2Z8ZA 4ZHQA 5C52B 4WK6A 1NNI1 2Z1DA 1WUJS 1W9HA 4KE6A 1WM1A 4MUGA 2VCYA 3UFXB 2QRGA 4EPWA 3WL5A 1P61B 5ANRB 1GRCA 5CHEA 3ONNA 4FDVA 1G3MA 1FMFA 4D57A 5K3SA 4NMLA 2HJSA 3U4IA 1F8GA 3NBKA 4GAEA 3H7IA 1TCVA 2QM8A 1ZI9A 1SHLA 1XZPA 2BMDA 3PFIA 4ITRC 1Z6PA 4O2BB 3NWJA 2QYHA 4I66A 5EUQB 3VJKA 4UXIA 5AUOB 1NBAA 1Q0UA 2HLPA 4EKDA 1F48A 4B8ZA 2BMAA 4MUAA 2FMTA 2F1KA 4K05A 3K6SB 4BAZA 4POOA 2EW2A 1DAMA 1A72A 1Q6YA 1YHNA 2JAXA 1JDVA 3LZCA 1ISIA 4FUQA 3IFSA 1XLVA 2LDBA 5L6LB 2I8AA 4AZVA 5AM3A 1HLDA 2KQUA 1BQEA 2BTQB 3V1MA 1IHDA 1C9MA 4EUSA 2DZDA 3GIDA 3OY7A 5KQPA 2O1SA 2VUIB 5BUSA 1TFUA 4WTOA 1YJBA 2CY0A 1VFPA 1KHXA 3T0GA 4Z0HO 1GO2A 3MT9A 1D5WA 4ZVVA 3QHQA 2Y6UA 1O9GA 1LS6A 4EM6A 3T0FA 1JR6A 1W6RA 3KL2A 2HKIA 3OPMA 3ZIDA 1LCIA 5FNVB 4CV2A 1A98A 4OUKX 5FYDA 3WWDA 1RAGA 2B2NA 2WUEA 2ZYWX 1RWXA 1UKBA 4CT0A 3QTLA 4L0CA 5GJVC 5LB2A 5EFOA 4ZJZA 1EVIA 2JFXA 2RBGA 3PF9A 2JJQA 3DW3X 2B4RO 1CJCA 3N74A 3UUGA 3PUZA 1N2CE 2FGKA 2ODQA 5GGXA 1UADA 2HQOA 2IOFA 2A9KA 5ICEA 5GY7A 4LRQA 4MRAA 5BYJA 2C31A 1I2BA 1KO4A 3FWYA 1ABBA 3EF0A 2HMTA 3T4UA 3IELA 1JAYA 1UF9A 3FUUA 3A6JA 4K9RA 3BCRA 5HWSA 1ZGGA 1JG4A 1Z74A 2B94A 2NQTA 1G8KA 4K28A 3EC1A 5EJ8A 2WYOA 3WGTA 3F67A 5AVJA 1M2VA 1X9GA 2VP3A 4WLVA 4CW7A 3Q0TA 5CDSA 3UAOA 2XUJA 1ZAYA 4Y9DA 2FWBA 2XUPA 2EL9A 5DLDA 1S89A 5JW6A 2K4MA 4DSNA 1S3GA 2AI1A 3NAZA 2IIQA 2QMEA 4J7UA 3MGBA 2DYKA 2QE6A 4GOLD 3OX2A 1PNQA 3IJEB 1TMKA 3NBQA 3OLVA 3OY2A 4JU9A 3P20A 4QA9A 2JLWA 1A69A 1IWBB 4F6CA 2EU8A 1DQPA 1D0SA 1KP2A 1YJCA 1ZRHA 4O3FA 1SVUA 1WG8A 4D9VA 1Q0ZA 3QWAA 5A04A 3PUWA 2QX7A 2B83A 2D3TA 2WC1A 2JARA 2QROA 3QYPA 3JX9A 4WY2A 4ZT2A 2CJXA 1J07A 3CLSC 4IR7A 5LP1A 3RVRA 1KL7A 3PIDA 2ZUEA 1AVTA 1QP8A 1F8UA 1VHWA 2CFCA 1NWCA 2PVPA 2XQGA 2ZI4A 2JCVA 2WBLC 3CEMA 1K27A 4CLEA 1X7HA 1T9HA 3AT1A 1N78A 1SB8A 2KB0A 2XIJA 1UT6A 3CS3A 4R1OA 2GXSA 4UEQA 4Y2HA 2HA6A 3FNQA 4XTRA 5DLPA 4C4RA 4DJJA 5EJHA 4KPFC 4DMGA 3A8TA 1YJ5C 1A5TA 1KR2A 2BKEA 3J7TA 3SKYA 1DIBA 3WA7A 3O1JC 3SIRA 1CE8B 2JZNA 4DY6A 1E0SA 1E3TA 2XYRA 1EWKA 1Q3KA 2P9TA 3PYMA 4MB6A 4MVJA 1UKEA 1JRLA 4CNQA 1CRQA 1EHIA 3NRCA 1VPVA 4MSUA 4OQYA 3U37A 3E7WA 2B98A 1FHRA 1OT5A 3BREA 5AI9A 4Q7MB 1KMHB 3IR6A 1NQOA 1YO6A 5DOZA 5EKDA 3HRIA 2QUKA 1V0JA 3DCIA 1BXGA 3TQIA 1Z2AA 1DVRA 1H2WA 1NI3A 2AFVA 3EASA 1SXPA 4L07A 5HIJA 2QMOA 3KT3A 1RYDA 5ICMA 1AM4D 1DIOB 3DHVA 3EIWA 4J0QA 4UHCA 2GPTA 1NXTA 1ISHA 2R6AA 1KEKA 2PUVA 3FAZA 3E70C 1DC7A 3PRHA 1Z47A 2RH5A 3ICWA 1CUBA 2BHRA 2YH2A 1X1SA 3FETA 4IJKA 1M2VB 2M98A 3LX8A 4FR5A 4OU5A 2V9ZA 1R0WA 1TUBA 2XMGA 3PL1A 2GA8A 4ZHQF 4P53A 5CA1B 2Y0PA 4XFJA 3BZBA 2UZ1A 1U7FA 2X5NA 4NV1A 5ALNA 5HF9A 4MVJG 3KJQA 2W2LA 1UQTA 2OC9A 3LXMA 1C30A 2QOEA 3H5IA 2AD5A 4QOIA 2FZEA 3R9XB 1C7RA 5D5HA 2RK3A 1B8UA 1HRDA 3ELSA 2Q5FA 2WD7B 2WUWE 3HR4A 1K5PA 3JRXA 4N9WA 1GYQA 4W8HA 1SUWA 3ZDRA 4CIYA 3LC1O 3UB2A 5LOVA 1DRVA 1L7QA 2PT9A 5JVDA 3Q8LA 3LDGA 4A23A 1ZD8A 1ZQ9A 3WDSA 4OHVA 2PA3A 5EE0A 3SU8A 3PHCA 5K4HA 2WTUA 5CEJA 2A14A 4XGQA 4MICA 4P4NA 3ITNA 1JPNA 3OQ6A 4JEUA 1T3SA 2A9QA 4JI0B 1ORDA 1XQ9A 4CCWA 2BRFA 3TGPA 3EZFA 3KOXA 5F73A 4NG4A 1NURA 3I39X 2VBCA 2C4HA 1S9DA 4GI1A 1SXHA 3R09A 2Y77A 2OHOA 4GVXA 4KSYA 2JGDA 3CNBA 2NVOA 2B5OA 2QAIA 3IB3A 3L1UA 2D7DA 2DRIA 1M54A 3QPDA 4AY6A 1PTKA 1E0KA 5DNYB 3AUKA 5K0TA 1SFRA 1IY2A 4C4OA 3H5RA 4WKCA 2YUTA 1GLVA 3NALA 1H4QA 1W85A 3I2IA 1HNNA 4ND4A 3DE4X 1TU0A 1U8XX 2BAGA 3K0EA 1M34E 3BIOA 4KP7A 3ZWCA 1T91A 3Q10A 3L0BA 3RVSA 2OM6A 3MHTA 3PE6A 4QRDA 5E6RB 3R7WB 1R5BA 4YECA 3TZLA 1D07A 3ONFA 1R21A 3DEHA 5DB4A 4UTOA 4IIFA 2H0AA 1N2CA 3NWPA 4OOFA 3RTCA 3Q41A 2C78A 1N3LA 2VHXA 3HBFA 4G01B 3LD9A 4AS1A 5IXYA 1KY3A 1SY7A 4PIPA 1LDMA 2UZ1B 3AI1A 3C4QA 4ECEA 1LBIA 3EPHA 4N8EA 1LK7A 3ZNOA 3W5IA 1UDWA 3DAOA 3N0XA 4EJMA 5JANA 1WXHA 2Z08A 5AKZA 1E2BA 1A9ZA 4ENQA 5A4KA 3EXEB 4LV8B 1SBNE 1K06A 2ZYRA 4IVPA 4PYNA 5COBA 1G8HA 2I4LA 5T4BA 4BVLA 1K3NA 4HXGA 4BIMA 2I6QA 1UBCA 4DLWA 4FWIB 2FQYA 1Z34A 4CM5A 4EARA 2JGRA 4UCFA 2NOAA 2Q27A 1ZM7A 3ISJA 3UT0A 2E5LB 3D4BA 3PWKA 4WDRA 1X8KA 3V1KA 1ADBA 5A5GA 2WZDA 4PYIA 5GGYA 2O4UX 2W58A 4FC7A 4P58A 5BN5B 4UD2A 2FHSA 3PVZA 4EJSC 1MXHA 3WHLA 2C42A 4BVJA 4XVQA 5LLTA 4AY2A 2F00A 1SBCA 4RPCA 3A6LA 4JXZA 3WMWA 5KB3A 1ZMTA 1RWWA 3CZ4A 1FP4A 4FKBA 2MSDB 4J2TA 4PZUA 4X20A 3AVQA 4BNDA 1XMVA 4NONA 3QX3A 2G0AA 5HA5A 3NNSA 4S2EA 4C0QC 4F4FA 2WZQA 3HR7A 4EJ2A 5L7WA 3WMXA 2BE9A 3I6QA 3LAWA 4NNOA 4LZZA 2WG1A 3H65A 2D59A 1FYXA 5IBCA 3T34A 1O6CA 2ZTLA 2DKOA 4QRIA 2K7ZA 3GZJA 4S0XA 5F1PA 3WKAA 4UUMA 3QLEA 1IUOA 1G5RA 1JQLB 2RE8A 4DUGD 3LUBA 3NU1A 5HZGA 4EA7A 1Z0UA 4NECA 4OUDA 3VPYA 1D1TA 1PWHA 2A7XA 2VNHA 2GPWA 1OTHA 4TVKA 4KIJA 4OL9A 4BMVA 3KUUA 5K4GA 4GI5A 3RYCB 4ZK6A 3I64A 3E5MA 4YJGA 3O1HB 2VDPB 3WLJA 1ID1A 2BHNA 2ODBA 3HJNA 1MZVA 4HMPA 3SJUA 5IT5A 1DC4A 2KB4A 1N2CB 1T9BA 2YVQA 1KHTA 3NM6B 2B78A 1L4YA 4B17A 3WL7A 4KGXA 1MW8X 3V8NA 2C3MA 1RDFA 5H3HA 5BQOA 2PYIA 4ZVLA 4B79A 1F3OA 3GA0A 1N5KA 1NJ1A 2GNOA 1ZD1A 4L51A 2RKOA 4QGHA 3SQNA 3UJ3X 1UIMA 1Q44A 1SHZA 4RMHA 4DG8A 1HOXA 1YBAA 4TKUB 2V7QA 2ZEJA 4EZIA 3DOHA 5FOSA 5IJWA 4KHPB 4H31A 4UBIA 3NDJA 3C5CA 2FWRA 4KN9S 1E79A 2B6NA 1XZHA 3W1EA 2UDPA 2WMNB 3KR9A 3RC8A 2JANA 1DBPA 1JAIA 1JQBA 2V03A 1C7IA 4IIBA 4BQFA 5LU8A 4KO2S 2E55A 5BN4B 4C08A 1I6WA 3W5AA 4Q15A 2Y2UA 5DSXA 1RQNA 1QO7A 3CE6A 1A04A 3C97A 3ESXA 3M7IA 2C1ZA 4NJMB 4Q18A 1Y9AA 2G3YA 4KAAA 3UH1A 1W30A 2OSBA 2KSQA 1TTPB 3DHYA 2CXOA 2Q4DA 2M9MA 2VSNA 1Z0SA 3KT9A 1ESZA 1H42A 4KXFB 2QLNA 3DMHA 1KK0A 1WPQA 5B7NA 2GR9A 4PCAA 3ZI0A 3DDUA 3O4GA 2ZZNA 1FP4B 4X20B 2FN9A 2J08A 4TVOA 5I3CA 3RVNA 2VH2A 5FAXA 1V2GA 3T95A 3IRUA 1OI3A 4H3HB 5DHSA 2R44A 4GS5A 4B47A 2NU6A 3K0AA 4OHWA 3ILXA 4RD2A 2G9VA 5DNWA 3VPDA 4MRRA 1R0XA 4ALJA 1TD9A 3M4JA 1Q77A 2IHYA 3AF0A 2Y2VA 3OU2A 4JB3A 1Z56C 4RHUA 3QKRA 4RCZA 5LXTA 2PUFA 1GQFA 1AQYA 1XD2B 3TZEA 2KYRA 4WOBA 1IUNA 2YCBA 2F6RA 2YMQA 1RKUA 2VJYA 2R751 2W2LD 3FPGA 4PC3A 4LDPA 4IQGA 3AF2A 4E5UA 4UHBA 2NM0A 3VU9A 1GA1A 2AJLI 2GEBA 2H07A 1LV7A 1T4CA 2QWXA 1M1UA 3FKSD 3L79A 3PZBA 3UA4A 4CKWB 2NZVG 1AF7A 3OOYA 4J0JA 3PJEA 4K3VA 4QYIB 5FTNA 2D5AA 5C4IA 3HI4A 1J25A 1G9SA 3L7MA 1GGEA 4MITA 3R3ZA 4R4JA 3RTAA 4M9ZA 4CDGA 5F7XA 1DWPA 5JSHA 1XVVA 2QLLA 3SQWA 2G36A 2O8NA 1N36B 5J23A 3HUEA 4L16A 2LTAA 5DXAA 4G0WA 2P4EA 1U9IC 3GPBA 2V5AA 3RDPA 3TFQA 1PR4A 1H66A 1NIJA 1GSHA 4OKSA 1GXCA 3DMDA 4MA0A 5IAGA 3T5DA 4ESEA 4P34A 2ORYA 5BV1A 4NYIR 5C46F 3U4QA 3SX2A 1VL5A 1K6JA 1W73A 3X44A 4DPMA 2REQB 4GW3A 4N8SA 5CFQA 5CAEA 3C8ZA 3GF4A 3EXHB 4J0GA 3ZYCA 5K8LA 4H6XA 1CQXA 3WKCA 2VLIA 3JAWA 2EZ4A 3OJOA 3M89A 2RDMA 1A4XA 1M75A 1XRSB 3MLEA 4H77A 4PW0A 3AILA 1Y4DE 1L8QA 2TSYB 2XUIA 2JC3A 4RQUA 2X0KA 4DSTA 1KE2A 1QTQA 3PC3A 3ED5A 5JERA 1Y80A 1FBTA 3QYJA 5JALA 1FQJA 2V6BA 5B36A 1YDEA 4YPVA 1Y6JA 1R6XA 2J6BA 4US1R 1DEHA 1DJQA 4INOA 4HQFA 3UK6A 4NPHA 1VIMA 2CV1A 3GQSA 4NE9A 3H1EA 4GM4A 1AKTA 3QWFA 3P94A 3FBTA 1N6PA 1ZMOA 1GCUA 1QHYA 1VG0B 2YZNA 3B2NA 5D01A 5K2OA 4G2NA 2CSUA 3U49A 2NU6B 1XRJA 3C14C 4D3YA 4ZXPA 4W63A 5H70A 1IN6A 2ZIUB 4MUIA 4QOEA 3WG9A 3WLMA 7ABPA 1Q7RA 4ZKEA 4AK9A 2GZ1A 1LC3A 3WLAA 1KHUA 2DH5A 4XFKA 1HEUA 1B74A 4EUFA 3NNDA 1FX0A 1RACA 1YB1A 1YE3A 2WVAA 1C1DA 2EJVA 2R5FA 5H82A 2C4TA 1NNUA 4KH0A 3VISA 1ISJA 4NK5A 1CY1A 3RKSA 4DB4A 3AMVA 3Q2OA 5IFLA 4P82A 4ECAA 2IRWA 5JHGB 4EYOA 4QG3A 3SR3A 5GM1A 1XNJA 3BK1A 3MXOA 2IEIA 2E87A 4JOCA 4HQLA 5AVRA 3RRBA 4RJIA 2WAAA 2QX9A 1NVKA 3LG2A 1M34B 1K9SA 1YFKA 2FEMA 3B6ZA 2XYQA 3R7AA 4EHKA 2O20A 1E4OA 2FMHA 2F3SA 2IYSA 1QRSA 4O3MA 3A6KA 2QVGA 3HVRA 5BUCA 2IHJA 3OPNA 3FOZA 3AHDA 4G4GA 1O9HA 3V1TC 4I2VA 2JFHA 4GBMA 3W04A 2B9VA 5EPOA 3F49S 2PE5A 2IC5A 2Q9AA 4RMIA 5DP2A 4GBED 3DWGA 3FYCA 1F0KA 3M6IA 4I08A 4JVLA 4X44A 2W7TA 3V1UA 4B2IA 4OQPA 2DUMA 3Q4GA 4URZR 2IOFK 3LL7A 4EUKA 3W4IA 5ELLA 5BWNA 2CBXA 2I80A 1DXHA 1MK2A 2C2HA 2DY1A 2QKYA 4EFLA 3AY0A 4BLOA 3UMYA 5KTOA 3LA8A 4YONB 2VLBA 4F8JA 3H8JA 2X5XA 2OA0A 5KPDA 1KPIA 1Z7YA 2HWWA 5CHYA 3TLYA 1OI2A 1R8XA 4CL8A 3D0RA 3QOWA 5JATA 1TFRA 4ENVA 4JI2B 3RTDA 3TJMA 3A9RA 2FP4A 4PAGA 1ZVVA 2GERA 4KU4A 4TN5A 1D03A 1OTYA 4FXPA 4D2IA 5TT0A 4R6WA 4RKWA 3TNJA 4MR9B 5DCUA 2NU8B 4S05A 2OAGA 3BWEA 3OO1A 3CH7A 1GQRA 2ZU0C 2ZWOA 3MQ2A 5AJTA 3CVYA 4O5AA 3HJAA 4FJ1A 5H68A 2VSFA 1AGXA 2PZEA 3H9UA 3HHEA 4EX6A 4BEVA 1L8AA 4A5OA 5LQJA 1PNVA 1YKGA 3QPBA 4DVJA 3S2IA 4Z3KA 5IKXA 3AOEC 2HRCA 3AB8A 5I9SA 3BIJA 3PQ3A 4LHSA 2ZR8A 5DNAA 2PS0A 1EWVA 1RVV1 4FKMA 4E15A 2X5JO 4OQFA 1NFFA 3ZWPA 3SQXA 5AI4A 1E1RA 2E3JA 4X41A 1LY1A 1HGXA 3G2IA 4MX8A 4Y2GA 4EZEA 3P9YA 4MQ6A 2O8EB 1DWUA 4UAUA 3SJZA 1JDBC 2C2WA 4J4BA 3PPIA 4L73A 1YC5A 3GROA 2F1JA 2NXCA 4RUKA 3LWBA 1MABB 1TNDA 2V7XA 3O83A 3OCWA 4RKFA 1Z4JA 2XQIA 1NX9A 4JB8A 2ZSBA 4IGFA 1E7QA 5KSOA 3ER8A 2F8MA 1CV2A 3B12A 5ALEA 3BCHA 1EKXA 3WHIA 1NVWQ 3D7RA 3T5AA 3E3LA 3QBDA 3L7YA 1C8LA 3PQCA 4QFCA 5DGXA 4BJ3A 4M8LA 5K6AC 1MJFA 1S3SA 2QG9A 3VQTA 3WQBA 2QRNA 1QGZA 4PX3A 3RBXA 3MYRA 2J32A 3OECA 3MT7A 2AOUB 4GQIA 2B1QA 2FETA 1DUIA 3OCJA 3EAGA 4R2MA 4HQ0A 4F5ZA 5CFNA 3B2QA 1FPQA 4X0EA 4F6RB 3AM3A 4X7PA 5CP8A 4KMMA 2JVKA 3ZNNA 3MWDB 2I33A 3EIUA 2QRUA 4QECA 5IARA 4RADA 1KMCA 4M4SA 1SCIA 4G23A 3CUYA 3PYXA 1AKYA 2YRFA 3LT2A 5IJXA 3U7QA 3WFIA 4OL0A 4AT1A 3AEXA 4AN4A 3PPYA 5FWXB 3QMPA 4BECA 1U3FA 2FOXA 1KJNA 3PFKA 2P6OA 3HY6A 1TUEA 1WY7A 4QTUB 1KO5A 4OTZA 1GTL1 4HXEB 4FFLA 4PC7A 3DZGA 2JZCA 1ILWA 2EFJA 4LK2A 3RB8A 3WLHA 1Z6AA 5F7OA 1MRZA 2BBOA 2G8LA 3BA6A 4OGKA 3SS8A 6YASA 4LHVA 3LPLA 2VTVA 3L1HA 4HAZA 1LLCA 2MSNA 5FWNA 1RFLA 2PEZA 1DAEA 1OWOA 2GJKA 3M34A 5BYBA 4IXTA 3EHDA 4MVJI 5JC1A 2DERA 5C5IA 1G3IA 4OSPA 2O5EA 4GYKA 1QH8B 3KHTA 5ALSA 2WAMA 3TIFA 3OWXA 1T2EA 3A26A 3UOAB 1SQSA 2J9XB 3K0SA 3ZX4A 3O90A 4CM8A 3ZJVA 1VMDA 2PX4A 2RI6A 4KI7A 1QZ3A 1E2NA 5DPMA 1G2OA 5C4MA 3HA7A 2P8SA 1BVUA 3HJBA 4DC9A 2SCUB 2C2YA 2MJLA 4U6NA 4A0GA 4B5LA 1HRKA 2JZOA 2Q6KA 3KYJB 4ZJPA 3X1MA 2UZ4A 5DZSA 1FYEA 3DMGA 1AD2A 4DLBA 4QC2A 5EGNA 2VDQB 2Z3ZA 2X0FA 4R1TA 4AD8A 4TKLA 3VYTB 2QB5A 3Q7RA 3OE5A 4FD2A 1OV4A 2JIMA 4ETIA 1VCMA 2B25A 1KK3A 3LPMA 4L5BA 4P32A 3UMSA 4EI8A 2Q2QA 1NXWA 4GLFA 3ITEA 1NNLA 1FTYA 1M74A 3BWCA 2RAUA 5CB6A 4R1QA 1C3XA 1CJVC 4PQFA 4XD7D 5BSTA 4BTEA 2FZGA 2QVLA 3LBAA 4DPLA 1E63A 3Q1KA 3ZGYA 3ESBA 4PSAA 3ZC3A 1XPUA 1JG2A 5BSFA 4J49A 1IL0A 3FMVA 1XJQA 4I3HA 1JF8A 2IEGA 2QL6A 1U65A 3U7QB 4WBNA 1OLXB 3MJCA 4XYMA 2QGFA 1U5BA 3AR2A 3CR7A 4HWOA 1JMVA 2ZI5A 3EZYA 1IH8A 1N9ZA 3MIIA 4XPIA 2N42A 3GGJA 4ID9A 5D3KA 5HDBB 2WJAA 2AC2A 1QVAA 4DQDA 3CHYA 3IGFA 3U62A 1WY5A 5JXHA 5DGTA 4UOEA 5EY5B 3CVWA 4EW3A 2WU1A 3IHLA 4E3ZA 4ZO4A 5BWBA 2C9BA 1XD9A 1K6XA 1VLVA 1Z62A 2C7VA 5CH3A 3EEFA 3L0PA 2QF7A 3EPJA 2GNPA 5F4BA 3G0IA 1XMOB 1ENZA 1FU8A 2WD9A 4BN4A 1ZW1A 2C3PA 3DWFA 4LGMA 2I4TA 5HIKA 5CLIA 5CR9A 4XD2A 1Q17A 4V3BA 3RADC 2F2TA 4C2TA 3OZXA 2EP7A 3ER9A 3ONEA 2H7VA 2XVMA 3EDCA 3FHOA 4HH0A 4PQEA 4CM8B 3A6ZA 4YYZA 2BHLA 1AG9A 4M1TA 3ZUPA 3GLUA 1UBGA 2EW8A 3DR3A 3DQQA 3EIFA 5AMXA 3K16A 3OZVA 5HUJA 3QBVA 2W42A 2O14A 2R4QA 5D84A 5MFPA 5K6TA 1PF7E 2PCLA 3EJWA 4RHXA 3AB3A 1P7WA 5JLAA 5FO0A 4RO0A 5BVHB 1OFUX 2VF8A 3KE8A 1BD4A 2R84A 2XF8A 3TQQA 1KFEB 1KSFX 4DT1A 1HKHA 3BL8A 3EFBA 1CUCA 2X76A 3IMFA 4N6OA 3AEKA 2OVFA 4RK1A 1E58A 4AX4A 3R6WA 4XDZA 4F06A 3TUZC 2DECA 2J3DA 4JBIA 1P1HA 5DWDA 2CZGA 1KAQA 4P7GA 3U1TA 2G04A 3ABOB 4QKQA 2NO5A 3K0FA 3MQ4A 4CCYA 2REXB 1DG3A 3MUOA 2O05A 3MDBA 2V9PA 4M3NA 5FIUA 4GZ6A 4ARCA 3EOZA 1NYTA 3ZCPA 1F7VA 4JASB 3I52A 3SE0A 3TAXA 3SXUB 5LLSA 3T3DA 4BASA 2Y99A 2WTMA 4KK4A 1OB2A 3R3VA 1IN8A 1GUYA 1HLGA 3FPEA 3NIWA 2XYHA 4WDQA 3RR2A 3ZYZA 3GVXA 3MUNA 2WJIA 1JE0A 1E1RD 3WGQA 3CH5A 4NYJR 1E2PA 5CVJA 4L7QA 4U2CA 1KFKB 4BQNA 3Q0IA 2AIRA 1MDFA 2JFVA 4YT4A 4DNPA 4RPKA 3VHXA 4I1IA 3C45A 4AG3A 4BEWA 4E2FA 3M2TA 3TRHA 1T5TA 4X7BA 1H9AA 5IC5A 2ZSUA 3FCSB 1RJGA 4P7JA 3QUAA 3DAFA 1X7XB 3CEHA 4MPJA 1KOJA 1V8DA 3MGGA 3T3GA 3HL0A 3TUJC 5T3YA 2Q50A 4HFRA 3EWNA 1N77A 3AHHA 2G1PA 4LSZA 4DV5B 3I72A 1NG9A 1GPKA 5B58C 5FEMA 5I47A 5A05A 3ROTA 4F2HA 1I2CA 2M6SA 1QK3A 4ZT4A 2WMYA 5AM4A 2PRYA 3D4LA 1JPJA 2VPWA 4H7FA 1SUFA 2FI1A 3DAPA 1YTUA 1EBBA 2XUFA 3DL7A 3B5JA 3L0CA 4FN4A 4AMVA 2DUWA 4ODIA 2F1RA 3BDVA 3PNQA 3KNZA 4KX5A 3GLHA 1IC6A 4M49A 3ZE9A 2WDZA 1P2UA 2B1IA 1SVIA 4IGEA 4DT1B 5THQA 2W6JD 2XWBF 3ZE6A 2G1KA 2PV0A 1FNBA 2Q0SA 3LCVB 3N70A 1XZDA 4QXAA 3RANA 3W6ZA 1NRIA 4I5GA 1OLSB 2G67A 3DWEX 4C1BA 4ZU6X 1E2EA 3PV0A 3I76A 5COAA 4D9JA 5JQGF 3NIDB 4D41A 5F77A 3W2EA 3K94A 1UIRA 2D7JA 4JXKA 2VOEA 3OJCA 4KIUA 4XM0A 4CEHA 3OIWA 3KVNA 1ORTA 3KWJA 4G0MA 5JBIA 1ELOA 5CJJA 1U7XA 5BSUA 1GRRA 5F35A 2LV8A 3W77A 1NUPA 2FG7C 3OLXA 4DDMA 2YTZA 4FGWA 2W6QA 4GPZA 4TS9A 3MEQA 4RL4A 3DDZX 3F47A 1HNXB 3L49A 1V9SA 3WZMA 2LW7A 1C1HA 2QIPA 4A8JA 1PWYE 1USIA 10MHA 1R74A 3RF6A 1OU0A 1NHWA 3KTOA 1IN7A 4KBFA 3SHVA 4CWAA 5FBVB 3H86A 1YWGO 2TS1A 5BR1A 1OV6A 1JUDA 3AU9A 4HQNA 2AWNA 2BKUA 1OFGA 3B9PA 3LA6A 3WK4A 1AKVA 3D7KA 3O1LA 4RM3A 1KE1A 3SM9A 3CF6R 5K45A 5KTTA 1J39A 1VJ1A 4GE3A 3ZHQA 2PEYA 4ZCPA 3NC4A 4Y6GB 2D62A 1NN1A 3CWQA 2O8CB 2X3YA 2QZJA 4FFVA 1SUSA 2GAAA 4Z7QB 4IOJA 1N7JA 2EF0A 2IHKA 4QICA 4G9EA 4UULA 2W0SA 1A7AA 3HKEA 3F8WA 3I83A 1K5GA 1R4ZA 5FEUA 3E84A 4EHBA 3LBIA 1H1LB 2UVPA 2FSFA 1YS7A 1ST3A 1XRQA 3B70A 3JATB 4Q3DA 1KDYA 4HT3B 3UK7A 2Y1DA 2X8AA 2VF5X 4HN2A 1TYDE 4RMNA 1H05A 2A9VA 3KUDA 1P75A 2JBAA 2V7PA 3Q7SA 5EP4A 5FFMA 1M6YA 3VR4H 4ZV4A 1EA7A 3E0XA 3QLUC 4HDNA 4CMCA 1HZZA 1P0QA 1XCPA 1XRMA 4HWKA 3WIEA 1APBA 3NCHA 1NLUA 1U7ZA 1SVLA 3H9CA 5FFFA 4CM3A 1FVXA 3QEMA 4JC4A 3GPIA 3OZDA 2XEXA 4CLOA 3S8MA 1JJIA 1PHRA 1L1RA 2QN8A 3LW7A 1RXSA 1V37A 3I92A 1INLA 5FP0A 3GDOA 2WWXA 4JJ6A 3AM5A 2VHQA 2Q4OA 1GPBA 1YXMA 3OEHD 3EXFA 4AJ2A 4AP5A 3HYNA 1KETA 3PC6A 4L1KA 5GMOA 1II8A 1U63A 1NRJB 5L4LA 1DAKA 1A5ZA 4JUDX 5E0OA 2ZM6B 3QFCA 3O8OB 4UREA 2ADOA 1A9QA 3GJ4A 3PJGA 1YB5A 4KPUA 1NMXA 1UMKA 3Q7IA 1BXZA 1TK9A 3D59A 4A8JB 1ZOPA 1HEIA 1O7JA 1CIVA 4X54A 1Z36A 4Z9AA 5FUMA 3D1VA 3JQRA 3L02A 4RH3A 2ODNA 4QXOA 5CFZA 3FFAA 5JS1A 3ANNA 1U0SY 2E4ZA 3MERA 3DS8A 1HOTA 1N9GA 3X1YA 4ZDIA 2V54A 3K72B 3RVLA 3F73A 1EP3B 4YJDA 4BX0A 1LF0A 5E7MA 2WYWA 3Q2IA 5J63A 3KL4A 1ZK4A 4UNQA 3DL4A 6NULA 2JFPA 2GCOA 3JQEA 1OMOA 4C20A 3LUFA 4I99A 5IJZA 5AHWA 4EBBA 2V4ZA 1AKUA 3GWZA 1M2WA 2NPIA 4Y2QA 4XUEA 3A28A 3WLNA 2CFTA 3A6EA 4F96A 2I2XB 2I2DA 4IEFB 4QG7A 2HEIA 2A4KA 3REOA 1N1DA 3UHOA 2YWJA 3W2GA 2W2PA 1YJ8A 2A6PA 1ZWLA 1Z4MA 4YRNA 4IZIA 4KI0A 1I7PA 3AF6A 2ZRKA 1SHTX 1NV8A 3ZZUA 3NKVA 4LMBA 2GYWA 5H9VA 2O2YA 2DWQA 1SCNE 4DQKA 5J58A 1WDKA 1CJSA 2ZPTX 2HR1A 4EAQA 5T4FA 4ZA2A 2J3EA 1KZ6A 4CCAA 2AXPA 3QEMB 4Z4HA 1T29A 1THZA 2MR6A 3KAPA 4CQMB 4CLOB 3A6DA 3LQQA 4DJFC 4H16A 2I4NA 1LK0A 4MUHA 5HR5A 4QOGA 2QAGB 1OWMA 4OXKA 1KRWA 4Q39A 5HP4A 1G2PA 3HKBB 2FPWA 4HG2A 1TLLA 3OLQA 4BO1A 4P3XA 3LDAA 3EXFB 4GP9A 3X1XA 1TUIA 1Y6FA 1HQCA 1GTSA 3GBPA 4QOHA 4EG5A 4JKYA 1EH5A 2MSWA 1TF7A 4QNNA 1ULSA 4R41A 3TOVA 3GNTA 4OLAA 4UBKA