3V7UA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with mta
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
261
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 75
structure length 261
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v7uA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v7uA01
1Z0UA 4V24A 3AFOA 5DHUA 4WRRA 3VZBA 1U0RA 3V8MA 3VZCA 3V7YA 3V8NA 5EJHA 5DHRA 3V8QA 3V7WA 4HAOA 1Y3HA 5DHTA 2I1WA 3PFNA 5EJIA 2JGRA 2P1RA 3V7UA 4L02A 2Q5FA 1SUWA 2I2CA 2QVLA 3S40A 2QV7A 5DHQA 3V80A 1U0TA 2AN1A 1YT5A 2I2FA 5EJGA 5EJFA 3VZDA 2I2BA 1Y3IA 5DHSA 1Z0SA 4DY6A 3T5PA 2I2AA 2BONA 3V8RA 2I29A 2I2DA 5DHPA 3V8PA 4WERA 1Z0ZA
chains in the Genus database with same CATH superfamily
1NNSA 3A6PC 5FI5A 3GPBA 3GDGA 4YQFA 2NSDA 3Q3HA 2C4TA 3CR3C 1I3MA 4H59A 1NXXA 3KFVA 1ZU5A 3ZDXB 3E7PA 5EERA 5G4KA 3DBRB 2EJTA 2WOJA 1X1QA 3O4HA 4HGYA 4OIFA 2ZUFA 5IU6A 1EI9A 1L5QA 2AMVA 2BJVA 2F48A 2QUBA 2FR1A 5AOBA 5K0GA 4O0LA 1Y6GA 1YB1A 3ZGVA 1MNQA 4LY9A 3I8SA 1ITZA 3KQTA 1PJTA 2BGWA 5FL7D 4GVLA 3ZGLA 4C4AA 2XHEA 4UCFA 1SCDA 2HLHA 4RIEA 4M49A 3W2IA 3A32A 5B3LA 1C8BA 5FWXB 3ZW8A 2A94A 2I7XA 4NNOA 4F21A 4XYGA 4HFJA 3DBVO 1XGKA 3FSEA 3QVUA 4CM3A 3F9IA 2XUJA 4WKPA 1DJLA 1KHTA 3PL1A 3CKYA 3IDFA 4L8GA 4OIMA 5KX5B 3QYPA 4K87A 3GPCA 4RQAA 1XMQB 1LWOA 8ADHA 1C1HA 1FMCA 4X6LA 1ES9A 1THMA 2XX3A 3I6IA 4PYKA 1TVMA 4XWOA 5KYKA 2CVFA 3RUIA 3E81A 4GI7A 4L50A 1PS8A 4RANA 4HXGA 1FP6A 1TD9A 2BEUB 1Q7CA 2YJ5A 1ML3A 1HKUA 2G71A 3E23A 4HDQB 4E2YA 2NOAA 1AHNA 4RLHA 2JFHA 1T5HX 4X45A 3ZX4A 3LUKA 1MB9A 3PC2A 3Q85A 3KT3A 1OKKA 3CNLA 2VNKA 1Z5PA 2P9FA 3GCWA 1Q3KA 2H1OA 1T4CA 4GKKB 2Q1TA 1JPVA 2PDAA 2BR5A 3JQEA 3VYWA 4BFWA 4CKWA 3WIOA 1BG6A 4DKJA 1VKHA 2B99A 2CE7A 2G77B 5K6AC 3UMMA 2ID4A 1KDTA 2CLMB 1CE8A 2AJCA 3AHGA 1LBSA 3HI4A 4NDAA 4Z6KA 4I8DA 1T3GA 3OOYA 2EFCB 3I9MA 1B0ZA 1JPNA 4R1MA 3FNGA 2OVFA 5DOVA 3T3EA 5IK2A 3GRZA 4LC0A 4L74A 2A8YA 4CT4B 4BXOA 1MJGA 5F1PA 1MVOA 2ZSAA 4O2BB 9LDBA 2I7CA 3BMQA 2DVMA 3D0RA 3EXEA 4I99A 4J9VA 1O89A 2Y1EA 2E85A 1N7JA 4UD2A 1EFTA 3JRWA 3P26A 3G68A 4HRXA 4R2JA 4X1KB 2R3SA 4EQ6B 4RTPA 3T1YB 4F3TA 3O8QB 4QSHA 4CMIB 3DW3X 4BFZA 4WLOA 1U8YA 1T8TA 4QICA 5EJ6A 1K3JA 1J2FA 5HTOA 1XCLA 3RB8A 2DFVA 2PUBA 3KKZA 3HU1A 4IKPA 3LPCA 4QNRA 4C06A 1ZGGA 2FEKA 4RVOA 3HN2A 2A86A 4MTLA 4PZEA 2P2ZA 5CLQA 1U6IA 3Q2OA 5DM2A 2GF9A 2ZYWX 5I4KA 1TPZA 4YRDA 3WGLA 4Z2AA 4KUHA 1M7HA 2PFKA 5FPPA 5G0WA 4RPIA 3H2IA 4JENA 4IUYA 1RPZA 2F90A 3O4JA 2DUJA 1J2TA 1EFVA 2VNIA 4EUEA 4ENSA 3ACDA 4BE7B 1H2FA 2POQX 1G2OA 1G21B 4IO0A 3VPSA 4AJHA 1K06A 5KJFA 4RCYA 2CF6A 3ZDCA 4WZBA 1YTUA 4LKOA 4YP5A 4A27A 1JEDA 2JLXA 1J4QA 1EWQA 2W43A 4FZ5A 2FK7A 2R84A 4IUCS 4Q9HA 3GJ0A 2GJ8A 3SHFA 2LDXA 1RE1A 3AXSA 3QA9A 4UPVA 2EZTA 2GNAA 4JVMA 2C7OA 1LTHR 5HRCA 3KP1A 4MV8A 3UYLA 1PV2A 3AVQA 4PG6A 5FOTA 3A1UA 1H93A 4L3WA 3C7CB 4RYLA 1E7YA 2ZYSA 1HMPA 1JEJA 1VLHA 1WCYA 1XEFA 2ODEA 1J8YF 2JPDA 3EEIA 3KV1A 1GN9A 1LDGA 1THTA 1V3UA 1UWCA 1XEWY 1R3DA 4BO1A 3SYKA 5GTDA 2XTJA 4EIWA 2C5EA 1E0DA 1X1TA 3CONA 3OT1A 1YB6A 5DTEA 1BGWA 4TS4A 3DM9B 1A8UA 2VYNA 1JFLA 2Y27A 1Z4NA 4RNDB 4YFYA 5IBQA 2O8CB 4GWLA 1GNLA 3TK1A 4RTRA 2VQ3A 1XNQB 4MXDA 4FD2A 4N7BA 1V48A 3REFA 3K09A 4KQFA 3UJHA 2V1UA 2GN1A 4HB2A 3EAFA 3T7IA 3AIMA 3IIJA 1NVKA 5JMOA 3DLTA 3NHSA 1YFLA 1Y9JA 4GLBA 4BO9A 1T8WA 4PQGA 5AOCA 4HMOA 2FDCA 2ZQZA 3CNBA 1P61B 4MRMB 4I1RA 3GT0A 4TTSA 1CY6A 1ZCAA 4BNMA 4UJ5A 2H7YA 1YQEA 4XAQA 1DBSA 1IHYA 5UKDA 2WWWA 1LBEA 1PNOA 2AEJA 3CSUA 2ZYHA 3KR2A 3M7IA 4QT4A 1B2LA 4TN5A 1U8TA 4RFSA 5DRTA 3TR5A 1OIWA 2VDLB 3K0KA 3TDKA 2GM9A 3B7GA 3F5FA 2XNJA 3WB1A 2XWQA 2FN9A 2ZAOA 1PG0A 2XUOA 3D7MA 3DFKA 3T1QA 4LZWA 4A0SA 4EDFA 1TQ4A 3D3EA 3UJ8A 1JHVA 1ICEA 3DSHA 1QQ7A 1RADA 1NZJA 1YVRA 2WK1A 3CEPB 4G9EA 2EHDA 3VZPA 4EG3A 5L4LA 3BJMA 2XQJA 4YRFA 4WDRA 5DNVA 3RUAA 2ZYDA 1I6KA 2GZ2A 3LWNA 3WYGA 1NFRA 1TDJA 3F47A 1H3NA 3TSAA 1PBNA 3MBIA 5J23A 1J0AA 3QXCA 3TLZA 3K9NA 1Y8RB 1TC2A 5HFNA 3ADBA 2A88A 2G80A 4MA4A 5L7YA 1J4PA 1U2PA 2YNMA 1A98A 4DUYB 1N2HA 4K6MA 5LXTF 5IVPA 4R31A 4G2TA 1LDMA 1TVKB 4M21A 1L5YA 1MZVA 1R00A 3I2JA 3NDIA 4AVYA 3ZCQA 3OSZA 1A2OA 2CMFA 4IGAA 1M1YB 4CIVA 2HA5A 2Z6UA 5BV2P 2BFFB 4BQIA 1DIGA 2W2XA 5K0JA 1ZI6A 3F3YA 3IV6A 2HJ9A 1B1CA 1MQAA 1YKFA 4GKJB 3WQRA 1ENZA 2B9EA 5EMMA 4BFUA 3MWLA 4N3NA 4X24A 1CZKA 4I4NA 1B73A 4ZRNA 5I48A 1MN6A 1ZK0A 2VF5X 1KDPA 1ABEA 4GYJA 4NONA 5JT1A 3UNNA 1Q11A 4ARIA 3BSWA 4NBLA 2C29D 4G0VA 4ZZ3A 1SRQA 3E5MA 3QKWA 2HUNA 3G13A 3JD2A 2KI5A 2R85A 2VP3A 4KYUA 2EARA 5K99A 3PXDA 1EXNA 4L2IB 2FWBA 3E8XA 5EWJA 3FIJA 4QCJA 2H2WA 3C7KA 3UMJA 5C8DA 1VLLA 1GCAA 1VDZA 2F8MA 3BMCA 4ND8B 4ZC1A 3VPXA 3WWDA 2YJNA 4TZKA 2N1BA 3HB4X 1HZJA 3DNFA 1P6XA 4EO9A 5HR5A 2VHEA 4IDHA 3N28A 1U99A 4ZGBA 1C7JA 3BTVA 3CLSC 3U3OA 4FFMA 3UHAA 2IYAA 2C03A 5KQGA 3Q87B 3RYFA 4X1IA 1CEEA 3VX3A 1XLTC 3NR2A 4CR8A 4XYMA 3TCKA 3REQA 3S2FA 1KP3A 2O50A 2TMGA 1V1RB 3Q5GA 5CXQA 2A5DA 2HSGA 1I3LA 3K0AA 1YUBA 3T7SA 3QVOA 4W5NA 4MV5A 5DBFA 2VS1A 2DWQA 3CN7A 4I4TF 4YFVA 1W47A 1HI9A 2HTEA 3A05A 2RGWA 1RKUA 2R1TA 4BQOA 1U6KA 5JERA 2DF8A 3ANXA 2P2CA 4FHEA 4IF6A 3OLQA 1RQRA 4X60A 5EE0A 4AWBA 2PUGA 4YJDA 5KAPA 4K9PA 4D3YA 5L51A 2BAGA 1OXUA 3F7MA 1L6RA 1TYCA 2XCIA 3L7KA 4HAXA 4Q1BA 3IB3A 4YMGA 5LJIA 1G1MA 5E1DA 3UMBA 1E9DA 4CL2A 1QE5A 2J4FA 2MWMA 1S6YA 2EZ8A 2XB4A 1WV1A 1FMFA 2FRDC 5AOVA 4J3FA 2PRKA 3SC2A 4AICA 1V45E 3LP8A 1GSAA 4BGIA 4M8LA 3JVDA 4KXUA 4IICA 5KQLA 3IIIA 1ZGBA 3N2IA 4QECA 3MINA 5GIPE 5E9JA 3O95A 1FBTA 4R8MA 4RIIA 3MTAA 3HY4A 4S24A 4C0HA 3BERA 1XDWA 3N8NA 1X14A 4LYAA 4MYUA 4UBNA 3LV8A 3OJLA 1I7SB 1IPFA 4CTOA 2VCEA 4H7KA 3O47A 4ZC8A 3ZJTA 2PBLA 4X65B 1AZLA 1SVLA 1GT91 5IAJA 2FP4B 1BE8A 2FSVA 4UVGA 2ZUCA 1BTOA 5CD9A 1JHYA 3WJAA 1P80A 5IUJC 1GPUA 2WD9A 2HQSA 4QGFA 1DKUA 3R4CA 3HBNA 1XHLA 1BE6A 3QA3E 3QITA 3I42A 3N5CA 3BZUA 3RVKA 3CISA 1V9LA 1POXA 2NZYA 2QRNA 3E3AA 1F1JA 3EVBA 3OF2A 1RLMA 1UBLS 3QLEA 5TVKA 4BFTA 1YCDA 2ZBFA 3UM9A 3UNXA 4HWGA 2QPAA 2V6IA 3GJZA 4EYKA 1A3CA 1Z3IX 2PXHA 3EQ2A 4N7RA 4YTEA 4REMA 1USUA 5KVAA 1T3TA 1F2UB 3ZBQA 4JXXA 2EX0A 3KD3A 4WZBE 5JHGB 1YC5A 4RTOA 2F1IA 4JP1A 1XVAA 3UJDA 1JQDA 2FCRA 2IVZA 4B33A 2BM0A 1YK0A 2P6NA 4BRSA 4CE6A 5FORA 2FZVA 3A58B 3I01M 3EWNA 1IBKB 1NBOA 1BWSA 1U04A 2QQ0A 2Q9BA 3GNQA 3A6HA 4HNRA 5BR7A 1BEEA 1YBAA 3PB3A 2HIAA 4CKZA 3B8EA 4URHA 2C3YA 2I5PO 3QUTA 4RAQA 1APBA 2HU8A 3M4ZA 1RYMA 3CPHA 2QS9A 4G0PA 3ANNA 3GZNB 2QAGA 5JCPA 5KU7A 2VDJA 3FE2A 1RC8A 4UUQA 1Z7GA 3PEWA 2ZSDA 2QGNA 4KQ1A 1F20A 1WIWA 1X74A 2C4VA 2AI1A 3IAM1 3EXG2 4D8XA 3GFQA 1NQAO 2G6TA 3S3TA 2JFZA 5JDIA 1NYLA 2FFAA 5HF6A 3T38A 1E2DA 1KYWA 1VL6A 3I04M 5E3IA 3WGVA 2W37A 4X61A 5JROA 1XZKA 1RPAA 3D6MA 3L6RA 2CHUA 1WQ4A 4FX5A 2OGSA 1W49A 4I1OA 3UXHA 3NASA 3JRNA 4D6XA 1M0WA 2OCLA 2R86A 4B8ZA 2EIXA 5JH7A 1W94A 4YECA 4JY7A 3M3HA 1XXHB 4MUEA 5ECWA 4G2NA 3K6SB 1GZHB 4ZHQB 1XQYA 2AEFA 2P41A 4JIVD 1OBFO 3HP4A 3B2QA 3NAZA 4D9EA 3NHLA 4FE3A 2YJZA 3IO3A 1AKUA 3QU4A 4MIYA 4RLSA 5DKFA 5DT9A 1WQ3A 3OG9A 2YMLA 3H42B 1Z18A 2AXQA 3KTAA 5CHYA 4B87A 1L4EA 5CLJA 2Z6VA 3LTEA 4NJMA 1RZVA 4M1EA 1WEHA 2A9QA 3E18A 4D9CA 4EY5A 4K9OA 1R9NA 2XHZA 3NHFA 4U9IS 2ABWA 1KZGB 2W7TA 1NONA 3EUAA 3KK0A 5CGZA 3T0IA 4YJHA 4E4RA 3OKAA 3MJDA 3PSHA 3P27A 3UKDA 1GPJA 5TRTA 2CNNA 2KMLA 4BZXA 1RZRA 1BW9A 3HCOA 3OBBA 1YU6A 5DI9A 3DOHA 1WY5A 4ZT4A 1GTG1 5JO0A 5E6SA 1S4QA 3I2YX 5CURA 2H4FA 3IELA 3WRXA 4GL2A 1P5RA 1SD1A 3OX4A 3Q8XB 4M8NE 4BMVA 4KAFA 5BSKA 2O3SA 3JAMA 5EMHA 1IXSB 5JATA 1CVRA 1W25A 2XCLA 1JLKA 4JB0A 2CHGA 1WTAA 3UOTA 3TJZA 1IPEA 3TZHA 5EHZA 2PUFA 1GPNA 3TCXB 5KDOA 1QCZA 2ZBPA 1LBTA 1O94A 2O57A 2PX3A 2ZYVX 3A6EA 3CMMA 3T4UA 5J2TB 2ANCA 3EGIA 1R6TA 1XTSA 2F1OA 2JI4A 2C59A 3AI7A 4AAYA 4A26A 3EULA 5TGTA 4HL6A 4DLRA 2PNFA 3NHWA 4JLMA 2PUJA 3W6PA 4P98A 1R74A 2LIVA 3R8FA 2VHVA 4LVCA 4N3BA 2W6IA 5AJTA 4A4DA 4C4SA 5JUWA 5L3RA 5KNCA 2A59A 5CDFA 1G8YA 3TMAA 1FNBA 3AUJB 2E3JA 2ZUEA 3M49A 1B3RA 3HS3A 1GDTA 3KQYA 2NADA 3QLJA 4H17A 1H8HD 1JSZA 1O97D 4L5JA 1ZVKA 3EYWA 3SS9X 3W4IA 1PAUA 4INOA 5AOAA 3TFWA 4GOMD 4C2AA 3BSFA 1W6RA 3ANMA 1J1ZA 3A6FA 2NT4A 4KIFA 3N8GA 4MQMA 5CJ2A 5H70A 4EMTA 2UUAB 2FSHA 1G64A 1MC5A 2AEEA 1ZI9A 3AU8A 3IUJA 3HN6A 3LVRE 5F23A 3KLBA 3OPMA 3W1EA 4WLFA 4UAGA 2OCBA 3DAGA 5IRCD 4J7UA 3R6WA 3KYJB 4L9SA 1EUYA 2I1LA 1EFDN 1HDCA 4G01B 1MEOA 1HM5A 2IEBA 3PJGA 1GKLA 2P40A 3I76A 4MCIA 5ALHA 3RI3A 2GXAA 2JG3A 4H7HA 4JCCA 2P11A 1QDLB 2BRUA 3RAPR 2WFLB 1PNVA 1P17A 1QONA 2E1PA 1U9JA 4YN3A 2Z98A 2GPSA 4AM8A 1HT2E 4ZJUA 5IMSA 4Q9KA 4FZ3A 4JUCA 1TUBA 1P8JA 3AJ8A 2F1JA 3LAWA 2V0GA 3VZQA 1XZCA 4N39A 3K2EA 4JNKA 3OIDA 5JV5A 1FNNA 2C57A 3FVQA 1MR3F 1WXFA 3K30A 4I4LA 4QYXA 3LWZA 4J29A 4WN3A 3COJA 4DSUA 3I6YA 4BNYA 1LS1A 4FYMA 1R5JA 5CYPA 5ED0A 4UMVA 4UTPA 3RYCB 2NTVA 3WL5A 3NT5A 4MGIR 4PYJA 3MWJA 1O54A 3K9BA 3ANSA 3OM0A 2XRYA 5ALSA 4LOIA 4P22A 1NF9A 2JKZA 3PRHA 2H1HA 2F67A 3Q9LA 5GPBA 4B8YA 5DSXA 3NIBA 1EA7A 3VXKA 3JQ9A 2P2YA 1B43A 3E15A 3SYLA 2O4UX 4I0WB 1MC1A 2NXCA 1JE1A 2R8EA 2RH9B 4HDNA 2HK8A 4F3NA 2K5UA 2DECA 2EBHX 1DIAA 2VPWA 4Y0NA 4MP3A 1QOQB 1SU8A 5IK2D 4Q00A 3K0HA 4FGZA 1QC5B 2JIBA 1MZPA 3BIOA 4E31A 3NGMA 3T52A 3RRFA 1RJDA 2C58A 1C0PA 3HACA 3FCAA 3HUFA 1XZQA 2PRYA 3NZEA 3V4LA 4BLWA 5KMGB 4QAJA 1AN9A 1Q84A 1SVIA 4W9MC 2BONA 1XKLA 5FR2A 3NUQA 1SVKA 4JL8A 4PAOA 1ECBA 2RONA 4BFVA 3IL2A 3BWXA 5CA0A 4Q3EA 3KT0A 1R8JA 1WWKA 4OGLA 1YOVB 5ECDA 3ZEAA 4KO2S 1Z2EA 2GSDA 5A5EA 1N9GA 5DGIA 3LL4A 3IULA 3OJEA 4CV3A 4PBSA 4P33A 2RK4A 2YUTA 1SKQA 2D7CA 1P39A 1N8NA 2UDPA 2WSYB 3MAGA 3MWEB 4HZIA 4OGGA 5D01A 3N9IA 3PL5A 1WSWA 4JJ6A 3TLGB 4F4UA 4NXMB 2QVBA 4Z7OB 1OY1A 2ZS9A 2ZSEA 4I66A 1G5TA 4GE0A 2B4QA 3WLAA 1GYPA 5JWRA 4DV2B 4QDZA 3HUTA 3M33A 3SE0A 1OB5A 3B51X 1PJAA 4DY6A 3BK1A 3N7TA 4MPJA 5BOSB 4EA8A 1YWGO 1NBEA 2WTXA 3OU6A 4KHZA 5LOVA 2YZMA 2RHMA 3FHCB 4MAAA 2A35A 3U6BA 3GDOA 3LBIA 3TSCA 3G5UA 2I9KA 4A6DA 2YXPX 3RJ9A 3BGOS 3E8MA 4LE0A 2VSNA 1M10A 1EFAA 3QF7A 3OKPA 2PBRA 1ZCBA 4WACA 4BEBA 4EK9A 4NS1A 3K2BA 4IEEA 3ZY2A 2P3QA 4Y98A 2CSXA 1JJBA 4B6EA 5JDCC 1FP2A 4AZVA 3A1DA 4PO8A 3ABRB 3T5DA 4EYEA 5A2QA 3KOOA 4EGCB 1NNI1 1XAJA 4OHMA 3A28A 3P4UA 5C7YA 2QN1A 2HFJA 4G8JA 4O1MA 3KZNA 4JEMA 5IEBA 5B7QA 1EXVA 4R7TA 3U0VA 4R2HA 3ROEA 1IZYA 1CS4C 1S0UA 2CSUA 2LC1A 4N0MA 1HEUA 2BEUA 1P2FA 2D74A 3C5WP 1QUFA 3CPJB 5AI6A 5D84A 3BL6A 2GFQA 4GIBA 4BQNA 3U4AA 2JBAB 5EC8A 4BKUA 1ESNA 3DBLA 5AKIA 1WDTA 2B2XA 3JVUA 5H16A 4DDMA 3FAZA 3IMCA 4I3GA 3S4YA 5BQ5A 2DR2A 1U7VA 1BS9A 4BB6A 3D31A 3OLXA 2X23A 2H5EA 3GHHA 3WNZA 4OBWA 5HF5A 1VRVA 2XCOA 3JZIA 4KQHA 4HTFB 3C3DA 3ETNA 1BOOA 1RZUA 2X5XA 4XCQA 3SOZA 1TA4A 5FTMA 5DX1A 2GEBA 4XIJA 4Z3OA 5E6UB 5LQMA 2BI8A 4CM8B 1UM8A 3PNLA 2D5BA 2EFEB 3PIDA 2PX8A 3CLUD 2Q3MA 4JVLA 4TVOA 5EXSA 3R7SA 4BNKA 3VNRA 4DBLE 4YRPA 3EEQA 1LD3A 1LNSA 1Y8AA 2HA0A 3TW4A 1KRWA 2ACEA 1BROA 4WCVA 4DY4A 1TI7A 2YOFA 4IO1A 4TOIA 2RGGA 3RJ5A 3AFHA 4KITB 4X1KA 3EMDA 4LYHA 5B1IA 1T4BA 1O57A 3E9RA 3O8QA 2GHQA 4EQ6A 1VPDA 1LF5A 1L1QA 1GSOA 2O7SA 4M99A 4E94A 2GO7A 1QQBA 2VFAA 5JR3A 1TX4B 2TECE 1Z2PX 2J5KA 2Z5VA 3VSEA 5IT0A 3OLWA 3W77A 1FJXA 3EFOB 2A14A 3MTJA 4IDEA 4KH1A 4WW0A 3ULKA 4W8HA 4B6OA 2YWGA 1IEQA 2E87A 4P7GA 1AQNA 3CWZA 1E9CA 2YNMD 3VU1A 3UMRA 1DSSG 1G98A 3ZWMA 5KYYB 3PYXA 3TXAA 4V03A 4LSZA 5BN5A 4DIDA 4KR6A 3RU7A 1TIBA 3B1VA 3HJNA 2QGFA 1DFGA 4BMXA 1XMSA 1R6DA 3PC3A 2D2XA 2Z43A 1N92A 3GAMA 1G21A 3H5RA 5DK6A 5T64A 4I14A 3Q8MA 1N2OA 4ASUA 1AU9A 2H4ZA 3FPAA 2X3YA 1W8DA 2YZKA 3TRJA 3DULA 1OZ0A 4RK1A 4ALLA 1K75A 3PUXA 4ZI2A 4KX5A 4TMFA 5E8JA 2R751 2A9PA 3O82A 1W581 3P9PA 2ZRQA 3M4NA 1U81A 4WK6A 4ZAWA 3B6MA 5F64A 1LFAA 3DDSA 3E70C 3T9BA 5BV1A 1L1FA 4X5OA 4ZYTA 3Q7IA 5LB2A 1HQDA 1SXJE 1OXTA 2MDTA 5BN4A 4XDYA 4RV9A 2DPMA 2QLTA 4G56A 3NEYA 3VNBA 3ZWOA 1XPUA 1IN8A 3SQWA 3GJ6A 4YJGA 2W98A 1EFUA 2IWHA 3X2SA 3OOEA 4AS2A 5AK4A 2P77A 2OV8A 1OFHA 2R6JA 4QUGA 3L1IA 4RS4A 3QHQA 4HUQB 4B80A 1T0BA 3CVUA 3JWGA 2FZKA 1O1YA 1OT5A 3KTFA 1WD7A 2JIZD 2ZRCA 2HMAA 1U3VA 1USKA 2RJ3A 3EXIB 1NSFA 4QJ4A 5FOSA 1Q1NA 1N25A 2RHRA 2QN7A 4WXMA 1VIVA 1JIQA 1Z4QA 121PA 3D8HA 3ON5A 3VDQA 3KE9A 4PZ0A 1U2SA 1JBEA 4LTMA 3WY9A 1D2NA 1UDXA 2W22A 2WU4A 3EZ7A 3LYUA 4GZ5A 5CLHA 3DJYA 3F67A 2XDYA 4Q4AB 2QM8A 1WKBA 5DCLA 1M2GA 2I4TA 3EUEA 3L1HA 1ZL2A 1EQ2A 4HPJB 4IXNA 5FOXA 3EUWA 4QGBA 1RYFA 2XODA 4ZEOA 4MRMA 2ZREA 1W88B 3VTAA 5KS2A 5LYJB 5CDTA 1YS1X 2HT6A 2W4MA 4YCDA 3PUIA 1HQKA 3FKQA 1J90A 2VSOA 3OZDA 3JVEA 3AQIA 2CC2A 1LPAB 1WO8A 2CB9A 3DP9A 3MRXA 3OCYA 3K1AB 5EHIA 3DEIA 3ZHQA 4JBLA 4C4XA 1GFZA 2NVWA 1RXSA 2OZVA 2WLSA 5KTOA 1UQRA 5I9SA 1SBCA 1P1HA 2COEA 4FWIB 3L8FA 1JTVA 1RYDA 1TMOA 3IUNA 1KWGA 2ZI5A 2FZGA 3QUSA 5CJPA 2Z4SA 2CJXA 4MUAA 4AY3A 4AQDA 4PC7A 4MKXA 4O0MA 1YDWA 4XZ3A 1CR0A 2XY4A 3PC7A 4YT5A 3GH3A 2H1CA 4O4JA 1OWNA 2REXB 1TZKA 1WZCA 5L4NA 2ZJ2A 1KHUA 3PFHA 2IXBA 3TVDA 4XIFA 3V3KA 4AU1A 5FX2A 1ZGAA 3CBGA 1O4VA 3CZCA 2G8NA 2O07A 3R3XA 2GN0A 2Q0XA 4M9CA 2Y67A 1YQQA 1M1YA 4FGJA 4R9SA 2R5WA 2JFXA 3DOEA 5SY4A 1LX6A 4M1TA 3STYA 4DN6A 1N6KA 3FKJA 5CFMA 3S7TA 3ZQUA 2JGNA 4BLOA 5FHQA 3P4YA 2JS7A 5DNWA 2FEZA 2Q5HA 2P69A 4CM9A 1VIAA 2QMHA 1ZOOA 2FPRA 3IBYA 4GAEA 4ARSA 2JH8A 3IT0A 2BFCA 4MI1A 4FT2A 3DT8A 4IINA 4LYFA 2YWDA 4E21A 1J2EA 1UJ5A 2DPXA 1OTYA 3U6KA 4XPIB 3GVCA 1K89A 3M6MD 4FEGA 2QLJA 2V97A 3TZLA 1WXEA 1D4ZA 4RJ2A 2FFJA 1ADJA 1BSVA 1UJXA 4IJQA 3JQ7B 1PS0A 1YE5A 3O5AA 4BEVA 1Z5ZA 3FLMA 2IH4A 5LD2C 1PCXA 1SQ0A 2HHJA 4A8PA 1PX0A 1VXRA 2NV0A 2GPBA 4JA0A 3IPXA 2EQ5A 1CJSA 2I6SA 2XMCA 3ZD8A 5A5FA 3AEYA 4YRNA 1E2KA 2ZOSA 2JQLA 1PZNA 1KI3A 3L07A 1X1DA 1YB5A 3O8LA 2NUAB 3ZS8A 3BJEA 1GAEO 4BY9E 1FZTA 4WBSA 2R8BA 1CQWA 4N6GA 4ZV9A 4D0LB 1QGAA 3I83A 3HJTA 2AHRA 3FDXA 4HOYA 3SSMA 3LX5A 3KDAA 4YV7A 3H5VA 1PI3A 1BD3A 4FZRA 1GTVA 4DCJA 3UMGA 1A9TA 3KZ1E 2FUNB 3NBQA 2ZYGA 2VHUA 1XTJA 3K0EA 4BN0A 2QE7A 1LVUA 2QSJA 3OPYB 4G5QA 4W1QA 4ZEMA 1BMDA 3A4TA 3RRBA 3PFBA 4FXPA 3DVRX 2RGRA 1KAMA 3MCUA 4WECA 3P71T 3UAZA 2NZUG 3OOWA 5KAMA 2BF4A 3UH1A 4D41A 1MLDA 1OILA 3B78A 2FQXA 3GO4A 3JQBC 1UZUA 3KAQA 3KEFA 4JA2A 4PLZA 4LSWA 1PL6A 1RRMA 2Q0HA 3D3QA 2R47A 2AG8A 3FCUB 3BMNB 1LZKA 4CL8A 2JA2A 1QFYA 2VATA 1NZDA 1OH7A 421PA 2KKLA 1E1KA 2GS9A 2XQIA 5GZ3A 4HAYA 2I8AA 4MUMA 1TYDE 1WOYA 3WSTA 1N6IA 2P3SA 2ONJA 5KWEA 1TQ2A 1T1JA 5HILA 3AWIA 1YE3A 3U37A 2ZIFA 3R5HA 4Z4FA 1VMKA 2R6R1 1T5TA 5JALA 3S5UA 1JEYA 4HDRB 4DADA 4P32A 3L02A 4L27A 3BDIA 4E5SA 5JXWA 1ZVVA 3N2YA 3P9XA 3CE9A 2Y9PB 1I3CA 3L06A 5K3FA 4EVQA 1Q21A 1Y34E 1Y9ZA 5HBRA 1QNLA 3O90A 3HFRA 3PVSA 5IH7A 3DC2A 2AS0A 3VR0A 3QNWA 3HB7A 1R6VA 4OA5A 1GOTA 5L45A 5AI4A 3SC4A 3KC2A 3BCUA 4KYIB 5HNKA 1S2IA 2C97A 5JH7F 3DF7A 1UQUA 2W6OA 2ZAYA 5DNCA 1KQ3A 1LJLA 2RGNC 1RZRD 5K3SA 5K3CA 1VSQA 4X63A 4YI3A 1C3OB 1RQGA 2PTGA 3ADKA 4RH3A 4OAQA 3V8EA 2J1LA 1TD1A 1YVDA 5HYVA 4X54A 1E7WA 5EMNA 1IK6A 3CF4G 2WJVA 2BGJA 5BNWA 3H4IA 3ITEA 1RRFA 4Q34A 1NBMA 4DHWA 3BC1A 2WKPA 1G21E 5I47A 4J2HA 1FLVA 1C2YA 1F2UA 4ZOBA 3A2KA 3E0QA 3WG9A 1E5TA 4ABTA 4G1FA 5CU7A 3S2EA 3T1NA 2BFMA 1EEHA 3V48A 3URKA 3PNYA 5AJVB 2E21A 4DILA 1O7JA 5AXBA 4OBBA 3GLHB 4ZREA 2HNBA 1U1GA 2PK3A 1CUSA 2V54A 3CO5A 4JUIA 4R7ZA 4CF5A 4I4CA 2Q99A 2V98A 4LVNA 2W6ID 3ADCA 5GJWC 5DMXA 2IITA 4DR5B 1K8XB 2EWVA 2JHPA 2PRSA 1J97A 3LGSA 4ZARA 3OIUA 1E6CA 2OYSA 3GZNA 2EKLA 4FMPA 4L22A 2JVJA 4PANA 4Q4DA 5JXIA 1XCPA 3AVUA 5A9SB 2NU6B 1SXJD 3OQVA 2R79A 3GFBA 3A4YA 1VL0A 4DUZB 2NN3C 1J00A 1QF7A 4LJ8A 1BNCA 1VZ3A 2OAGA 4TMKA 3EG9B 4DNXA 1KO5A 2Y1FA 1JR3E 5TPWB 5J43A 3UIEA 3M82A 5KDLA 4CT0A 3UGTA 4NDNE 1E2LA 1E3TA 3H18A 3PXXA 4U7GA 4R81A 3TBFA 3UAYA 1SC3A 2VP0A 3C5VA 5AKZA 4E15A 4F9FA 2YJGA 2BGUA 3ONWA 4WSOA 5BNTA 3FM9A 3RS7A 3KHUA 1YB4A 3G8AA 1Y3BE 3ILXA 1BDBA 2B2CA 2MMGA 4I36A 2W70A 1HT0A 2A0UA 1P4JA 3C6BA 3V4FA 4H1VA 5SYNA 3DXXA 3RGGA 3WGQA 1J9ZA 1QRAA 1V25A 2WP8J 4K9LA 3F8WA 1FOEB 4QYWA 4A6XA 5C1DA 1MORA 3M4YA 4ZHQA 3K6SA 2B98A 3GEHA 1EESA 3PR3A 1X38A 1SWWA 5DBEX 3GRAA 4IJ5A 3JU3A 5BSTA 3JWEA 2QLMA 1RT9A 1EB9A 2DPHA 4JJ4A 4K0RA 4PICA 1GYRA 3P0IA 1T9GS 4C21A 1FU7A 3OC6A 2QY6A 4DG8A 1OFIA 3LPAA 4PQFA 3QE4A 4ZVTA 4GVPA 1B6GA 3DDUA 1AS3A 4B3JA 5EE5B 1N5RA 4HB4A 2YBDA 1Y42X 1G18A 3FCEA 1PWXA 1BKSB 1XQ1A 4H7IA 3B52X 4M6WA 4RVSA 1QLJA 3VR3D 1JVSA 4U2DA 3JYOA 2RGUA 1WVIA 2GF0A 2Q49A 1E5LA 3QXSA 5CA1B 3KHSA 2CLOB 3OBIA 1KEZA 3ZPXA 4YBRA 3OF5A 1GG2A 4QYTA 4RVHA 2ODBA 4DQLA 4BUZA 1Z36A 2R44A 4CN8A 1M1YE 4R9NA 4KX3A 4G0MA 1GITA 2ATCA 3FFBA 3HG7A 4P5EA 3G8DA 3AHDA 2NO1A 2F6RA 3TR0A 2FWNA 3MJ4A 4B35A 4EYSA 5K45A 3TTTA 3KLMX 5J2TA 1DJOA 3N3AC 3L05A 1P3Y1 3AR2A 4J2TA 1Z6GA 4FKBA 2YJ6A 3SDSA 1UPBA 2IUFA 3O3NB 5JEDA 5JANA 2ZR0A 2WSBA 1SVOA 3CH7A 4XVHA 1CR2A 1L7QA 1WULS 2JJ2A 3AV0B 3LW7A 4INPA 4Z9XA 1WUYA 2XB9A 5CFPA 3P0JA 4GNRA 4X00A 4Q47A 2XOXA 1CY8A 4KPUA 1G5PA 3RASA 1WU8A 5K0TA 3I9OA 1ESDA 2OUKA 3H1BA 2QWXA 3EISA 1OV6A 1T4MA 3IRVA 1A5SB 2HJSA 2WE7A 2IFTA 3O7MA 2L17A 3C3KA 3IEMA 4H6VA 2XKBA 2X8JB 2ZUDA 2XVYA 5CA0F 4XM0A 4KDEA 5CJJA 2C2XA 3OWHA 4YH1A 3MRVA 3RADC 4OLHA 2NQ8A 4YJ3F 5B2EA 4BRZA 1JSLA 2W2LD 2KB4A 4PSCA 1Q92A 1SGWA 2OCGA 3IE1A 2FZ5A 3KZOA 1P7VA 4GQIA 3R7AA 3S0JA 4YMSA 1UWVA 4B2YA 3L6OO 3SQNA 1LQTA 2WZDA 4O8CA 1UDWA 3PUWA 5TIIA 5ADHA 1E4OA 2ACVA 2FOXA 2FJ0A 1LY1A 1U1EA 3H99A 3O8OB 5EVCA 3C3AA 1M2HA 5DYYA 1Q20A 2VWGA 4MEJA 5DHSA 4OB7A 2R6CA 4NMXB 2PWAA 2J3JA 3MC1A 1PKEA 4D43A 2CXXA 3T8YA 4QKQA 4A7PA 1NW3A 1GXCA 3FVVA 1Z6PA 1YKGA 5JSKA 4GP7A 5E2BA 4ZKDA 2QG9A 4PIPA 1O97C 4ZV4A 4RADA 3VH3A 3RYCA 3F5QA 2X1VA 3BMOA 3PA8A 4FYYA 4G5YA 3G0BA 2G82A 1VP9A 1THGA 2G0AA 2NVUB 4CEJB 2ST1A 1Z0FA 3EVGA 1MRZA 4N48A 2V6BA 5FTJA 2QTZA 4OI2A 2O7NA 4RPHA 4WKCA 1ZJJA 1KI7A 2JANA 1JIVA 3WHPA 1JDJA 5FV4A 5GINE 2IYNA 2W2QA 3CZAA 2ET6A 4AULA 1X87A 3KX2A 5IF3A 5KX5F 5CT8A 3GPLA 1CUZA 1ZRSA 4PSAA 2ES4A 4JD5A 2IBTA 1W1IA 2UYGA 3AK4A 1EQUA 3G8CA 3DMNA 4ND6A 4PHCA 5CX1A 5KKAA 4F84A 5BWNA 4R54A 4P7BA 1W2GA 4AMZA 2DMRA 3DMRA 4OH7A 3CCBA 4AP9A 2AR0A 5JNVA 3C98A 5EG5A 1VSVA 5KUTA 1CU1A 3T5AA 3IHTA 4LF8B 4RCZA 4JIWD 1GUYA 2G1JA 4LRTB 4U7WA 2JB9A 3M6VA 1ZH6A 2FDXA 4J8PA 4YAWA 4IHAA 2AV6A 5KJ1A 4KU0D 3HUEA 1Y80A 4EJSA 3R6DA 1V39A 3QBVA 3OIVA 1B14A 1CF2O 2XQVA 1VMEA 4X71A 5BNFA 3ZDAA 1CY7A 1LPOA 4WNCA 4RJKA 5EWLA 1F0KA 3I5YA 3ZNQA 2PAAA 3FUVA 3MTEA 3BHMA 2C5LA 4ZI7B 1ZGZA 5ADVA 3H9QA 2W48A 6PFKA 1NAHA 3LLVA 5HZKA 3ILHA 2AZXA 3E5HA 2XYRA 5KYUB 5AHKA 3TKYA 4E03A 3BSSA 1GU7A 1NBME 4CV2A 3CVOA 1W36D 1SU7A 3N5KA 4F6RB 4XLLA 1QHXA 4M7RA 3TNLA 4B43A 3OD5A 3O9ZA 4O2BF 3HBFA 4N3CA 3S8EA 4IWXA 4R3UC 2NU9B 1K88A 1ZRHA 4IVPA 3CW8X 3LKZA 1NLFA 2B1JA 4II7A 4JB8A 1NUTA 4HLDA 3T5GA 4ZT6A 4ZU3A 2QN6A 2X5NA 2FNAA 2QY9A 1NGSA 3EF0A 3TW0A 4J03A 2H48A 1KDYA 1FRQA 2Z2IA 4TTAA 2YY6A 4TWBA 5JAQA 3VISA 4FR0A 4BRWA 1T25A 5BQ3A 4D0SA 1LVHA 1Z47A 3PCTA 5BY2A 4EG8A 1T5SA 2FE1A 2WMYA 1VJTA 4JLJA 5KTKA 1YZUA 5AVZA 3UUGA 4C3OB 1JKJA 1OPRA 2W6CX 3L7JA 2NM0A 3S8MA 4C6TB 1C3XA 2OA0A 4DGSA 5HSGA 1I32A 2UAGA 3JZMA 3Q2KA 3U4IA 4KPGA 1FFCA 1XC7A 3HXPA 1QHHB 1P3JA 2ODPA 1XA0A 5T4FA 2LW7A 4IHJB 5T4BA 5K0ZA 4OUKX 2I2WA 4B4KA 3KZMA 4IIXA 1DMZA 2VR1A 3AEXA 3W1VA 2BR3A 3BVPA 4TKUA 3QVWA 2H5JA 4B32A 4L8FA 2IZ0A 3OIFA 1JR3D 2LE0A 4NNPA 5I7OA 5JPDA 2EX1A 3DL4A 2J45A 4GF5A 5JC8A 5DNDA 4BAUA 2CB0A 1Y3IA 5CUQA 3A26A 3EZLA 3ZLUA 4A0HA 2NUTA 1AKRA 4F6LA 3K6RA 2OK8A 4LZOA 1WX1A 2JPEA 3T9FA 4MRPA 4K05A 4ZAXA 4ZYLA 1T91A 4HTFA 4GUDA 3DCJA 3ITKA 5ENDA 3GLFB 5IEJA 2J3QA 5E0OA 3ZZUA 2C95A 4CM8A 4LXQA 4REQB 1KYZA 4IDCA 1IQ0A 2RGXA 3W34A 3ZHXA 4DR6B 4UBOA 3FYSA 1VKZA 3BQ9A 3BB4A 2IP1A 2E37A 5EZSA 1FUIA 4FC6A 4P9NA 4GNKA 4FDTA 4BTEA 1AZTA 5IKPA 2EJVA 2QZJA 5LQUA 4PSKA 4E33A 3E27A 1ZICA 1A2QA 3UMZA 3PIIA 3P9NA 2DETA 3RYIB 3D6TB 3TJMA 1F1BA 1J5PA 3EFOA 2AIRA 5IVHA 2PEZA 3HWX1 3KS9A 1MZKA 1G5QA 1YOBA 4MCHA 1M2VA 5FT9A 2P2GA 3LRXA 3LGXA 1W6UA 1G8PA 3ZQ4A 4BO4A 5LZ2A 1E3WA 2XNDA 4KE8A 4RV5A 3CKKA 5CLGA 3U61B 3PQ3A 3L43A 4ZTUB 4TWZA 2OZLB 1QH0A 1YL5A 3OIYA 1ONSA 1T36B 1QFSA 1UBMS 2XE8A 2PWPA 3C3PA 3D4IA 4MKIA 4NYMR 3CLUC 3EGCA 3G79A 4PR0A 2KPOA 2Y68A 1C7RA 2OUIA 4NOMA 5GAJA 5HIMA 3RE1A 1AMOA 1SXQA 2QG6A 4K9QA 4YT2A 3EPPA 2VZLA 1TXGA 1O08A 1RWNA 2WV9A 3IE0A 3JW8A 2HBZA 3MWFA 4OP3A 5CPFA 2Y8EA 1CTQA 3PNBA 5AHOA 3FOBA 5DLQC 4OQQA 4BBAA 1ZJ5A 4JJEA 2WWIA 2VUTA 4ADSG 1AGRA 2LDBA 2AOUB 2WRZA 4CM9D 1Y5NA 3PE4A 1WXHA 3MOGA 4JR0A 3PTZA 4KQCA 4QXRA 3DO6A 1NUUA 2CL7X 5U9CA 1LBIA 4M54A 1THZA 2JCGA 2FSFA 3AI1A 2LGJA 4OFZA 1Y4UA 3WWOA 3IVRA 4B3RB 1U8ZA 3G17A 1EXWA 4IMIB 3ZDBA 2JI6A 4QTZA 5CCXA 4AWXA 1DCKA 2ATEA 4FBLA 5C7IO 2YNMC 4BNXA 2XTNA 4XRRA 3EC7A 4HV4A 4UULA 4CM7A 4ZRMA 4YA6A 1KE2A 2IGTA 3A6GA 5AW4A 1NVFA 2DUNA 3AQ4A 4KL8S 5AW3A 4DM4A 1A7AA 1XVLA 3EXIA 2Q3LA 5EXXA 5IJ0A 4D56A 3TEMA 3MCVA 1MB0A 4B3HA 1HFEL 3I01A 4Y2JA 4WNYA 4YRIA 3DCNA 5JXJA 2P5TB 1BVRA 3CO0S 4BVBA 1N0IA 3AF5A 3D6AA 4L3OA 3GF4A 4XPZA 5KNDA 4OMFG 1VPLA 4UE2A 2UXCB 4CR6A 3KB8A 3DLHA 4PAWA 4NV0A 4DA7A 2IXAA 1PR0A 1VECA 2HMSA 2XVZA 5AJYA 2Y0CA 1HG0A 1W88A 2QE7D 5E1MA 5LYJA 3WGKA 1FU4A 2QQGA 5BXQC 2IVFA 4LYJA 2IYLD 5D2CA 1XN1A 5FL3A 3STUA 4MVJM 2NMVA 4OJQA 1MOQA 3BZWA 4PLYA 2WQ6A 1X7DA 4XGNA 4PLPA 2AF3C 1U2TA 4K28A 4OAPA 4LXIA 3RLFA 2NLOA 2LIPA 4RGQA 1UDRA 4JYBA 2UUCB 3A1NA 4Z8YA 4NAUA 4QUHA 1ZNWA 3JD4A 1DG3A 2YHAA 3VYUB 4B47A 2ASVA 1ZH8A 2W2NA 3VC7A 2ORYA 1ILEA 4CM1A 4BVJA 4CKCB 2XOEA 5EINA 5FLKA 1CDEA 2XYGA 3KCQA 3H17A 3GXOA 4G07A 2HO5A 3PNOA 2PQ0A 1D4AA 2VEOA 2IU0A 3S2GA 4BAZA 4MQEA 5TR9A 4QNNA 5AMXA 4EMUA 3G1TA 3JSAA 4QEZA 4F85A 1KP2A 4HEJA 1VIDA 2YDYA 2Q0SA 2CNWA 1Z3CA 4D6PA 5C7OO 2IEAA 2V74B 3DXFA 5KJ6A 3H9EO 1M1NB 2C5GA 3SN6A 3K4HA 3UO8B 2W6JA 3Q7RA 5U4QA 2WVHA 3T1OA 2Z3ZA 3UW3A 4O4HA 2TMYA 1UMDA 1K3NA 2BP7B 3QM1A 3T7RA 1DUVG 1PWYE 3ETCA 5BOVA 4HGPA 2UYOA 1IJEA 3LP5A 3Q2IA 4DPKA 4ZZ2A 3U7QA 3DEFA 1N32B 1NC3A 3K31A 1IRIA 3E7FA 1OOEA 4A6EA 2Z95A 3S2UA 2OG2A 1Y1TA 4OMUA 3NWPA 4JI0B 1ZUWA 4AYTA 4EVRA 1GRNA 1RWWA 1Z4OA 4KAJA 1NT2A 4WCFB 3ER9A 1RPJA 1NBMD 4WKBA 1QH8B 3GUZA 1K7CA 4PG7A 4W99A 5FI3A 1QKIA 4OATA 1ESMA 4M1OA 3L92A 3SZGA 3G0OA 1HE5A 3H04A 3EC1A 3HNRA 2PO7A 3T5PA 1NATA 1XNHA 2QVXX 4OHFA 3V8RA 2E6UX 1C9NA 3AETB 3VJKA 1P7CA 2IYQA 2AJTA 3DE3X 2Q07A 3MS4A 3QP9A 4QYMA 3B89A 2H4WA 3EIFA 3IXMA 5DYWA 2FSVC 4MVWA 4H9GA 2GPTA 5AD1A 4EW6A 5CITA 3ES9A 2ZAMA 2UZ4A 4DC1A 2V65A 3JR7A 2WHXA 4NPCA 2VNSA 3GWZA 1IIBA 2FQYA 1K4YA 4QOFA 5DGCA 3CVVA 3TNJA 1R4NB 2R6GA 1C14A 1WV3A 1XQXA 1ZK3A 3ZHOA 2EWMA 1WHSA 3TM4A 4JCOA 3VPDA 2XT0A 3M5DA 2ZB8A 4PLFA 4I8XA 3RYTC 3HZZA 4JQCA 3T7AA 1KNXA 3DKRA 3DW1X 1XD9A 5AI8A 4GBED 4ZOAA 4AKIA 2HF9A 5D3KA 3R6GA 2HIMA 1K6MA 4KGDA 4KBGA 1I6WA 3GDWA 1GNSA 5DP1A 3ORRA 4CF3A 3HJFA 1GEEA 2WM9B 3B8HA 1Y9DA 1NX9A 3B6ZA 1SBYA 2I55A 4HNQA 4RWEA 1KO8A 2Z0MA 2OXIA 1T2AA 1N5KA 3IEXA 5AHWA 3WKEA 4RJLA 3CX7A 3HCBA 4CQNA 1C2TA 4QOHA 4LGYA 3UFXB 2F17A 3CXRA 3G2NA 4EW2A 4C3UA 4FJ1A 4R2WA 4EJMA 3IILA 3LOPA 5ILGA 2EATA 2H7XA 3UK2A 3DOIA 3QPUA 4MLCA 1F2VA 1CJMA 1Z8DA 1S8AA 4I1VA 4LJ7A 2QRJA 3LDGA 2GN6A 1DS6A 4FWBA 3V6MA 1ZUIA 1NL3A 1B76A 1SJ9A 1G8MA 2DQYA 2VL7A 2XSZD 4TYNA 4IMPA 1UMBB 2P3LA 4MP6A 2A0WA 2NU7B 2PIDA 1AK2A 3BFXA 1Z8FA 1YE8A 2YIJA 1XXLA 1NI4A 2CDNA 3CTPA 1CRPA 4L78A 4Z8XA 4NTZA 1ZXLA 4J76A 3B38A 1TM2A 5HKKA 3ROMA 2QTAA 4OQYA 1MRSA 4YACA 3K96A 4MYHA 2QP4A 2CKMA 4R1PA 3DMFA 4PRYA 1EGMB 4MYSA 1Y33E 3MWGA 3GEBA 1M2WA 2NTYC 4YP9A 4ZHQF 4BX2A 4UMDA 3KCNA 3K70D 4ND5A 5JADA 1QF6A 2P79A 1VE9A 3PWZA 3QU5A 3CRRA 1C3OA 1GAWA 2W58A 2PSEA 4NWIA 1AH2A 2QXYA 4NESA 5M5BA 3RC2A 2IOFK 3Q15C 3Q11A 2VQFB 1L4LA 4KZPA 3W3AA 4PC1A 2BJWA 3LQQA 1MJNA 2V9ZA 3QXGA 3K4QA 5FUWA 3ZD6A 1H6DA 1HETA 3CZRA 5KNBD 1X13A 4AKEA 3TKAA 2GNOA 1KEWA 2CMDA 3ZV6A 4Q9LA 4LQCA 5DM0A 3CC8A 1UEXC 3RSSA 2J7PA 3OOJA 1Q7BA 4N41A 5F2OA 4Q01A 3IT3A 3AM4A 3FB4A 3KSRA 1VG1A 1V1MA 3AR7A 1KKMA 2ERYA 3CV3A 3O1JC 4QL3A 3VBEA 1Y4AE 4DBLC 2JJ2D 5ALRA 1WCIB 2FKNA 2QX7A 5A04A 2GHIA 2IHVA 5TF4A 4C08A 1O6BA 4EENA 3L01A 4RESA 1QGYA 4R40A 2BCEA 4TZTA 6Q21A 1WQ1R 1U4NA 3CT6A 4OGKA 3WNBA 2NW6A 1U1FA 1KYTA 1LDNA 2QMEA 2XJ4A 4HS9A 1WE2A 2VDMB 2NU6A 3L8ZA 3MGBA 4K6KA 1D03A 4TTRA 1CEYA 5J2TF 4D9GA 1L7PA 4MS3A 1V7ZA 1X7HA 4RF4A 5I7WA 3LPDA 1Z74A 3FGOA 5H02A 2QV0A 5TPWA 3GJSA 4TGLA 4WFIA 1KSJA 4GRIA 4TLAA 5EIOA 5EKSA 3S1LA 4AJ1A 4C7MA 4AXXA 1EU1A 5AI0A 3E9CA 2BSAA 1XZEA 4NAVA 3U5ZB 2I3DA 3UUFA 2V9CA 3QVTA 1DEXA 2VJNA 3ER6A 3MS2A 1H2RS 4NLLA 1DP4A 4L0DA 1CT9A 3MLBA 1AO3A 1PR6A 2E9SA 4MYCA 3IBTA 4P4UA 5T4HA 1JI0A 3Q9NA 1NWCA 3WYEA 3BF7A 5COQA 3SM3A 4IKOA 3AILA 1OZGA 1N33B 1UXKA 4OK5A 2W2PA 2YV1A 4N54A 4OL9A 1R3UA 4O4LB 3H5LA 3CRNA 3E82A 3NHMA 1H9BA 4W9RA 4Q6BA 1SXJC 2Z6QA 4RLFA 2DT5A 1XMJA 2QB5A 2ZPAA 4L4XA 3RNOA 4Y8VA 4DV4B 2H59A 3U3XA 3B9BA 1KOGA 4ZVQA 3NTRA 1M0EA 3QU9A 4NZPA 4K3UA 1OROA 3K0CA 2WU3A 2V5AA 3EPLA 1KI8A 1ZWLA 3IGFA 1L7MA 3A37A 2RAUA 2NSYA 2YWJA 4XM2A 2CD7A 3RRXA 3BRWA 2DPLA 3PUVA 2ZR7A 3TW8B 3YASA 1E1QD 2NO7A 4NCXA 5KHAA 5A06A 3GHYA 3DR3A 3FAKA 1JFSA 2BRUC 1G1AA 3D1JA 1R4MB 3D5QA 3PQ4A 5CAEA 4OM8A 2ZZNA 4L0CA 3HBMA 1ZNYA 3QWHA 4D5GA 1CC1S 3QSYA 2B82A 2FQWA 2B8WA 3IT1A 4TL6A 5DXJA 4QUJA 4FDMA 2C3PA 4QRHA 4RA9B 4LYGA 2RGBA 4XQ0A 3AR9A 5JD5A 2JD2A 4UCQA 2OD2A 3MT7A 3HVIA 1WB9A 3EW7A 2VZ9A 2AJDA 5DOZA 3VJMA 4OBEA 3TECE 2ZSBA 2CDCA 2WT9A 3NWBA 4A8JB 4AKGA 4TL9A 2YXNA 5CM2Z 2VJQA 4U5XA 3GY0A 4G86A 1EWVA 2FF4A 3GRCA 3A4LA 4LJYA 2UVDA 4UREA 1ENOA 1VIMA 2BMWA 2C8LA 4TYQA 3JQ9C 1OJLA 3VO2A 1QP7A 2GZ3A 4E0BA 1U2DA 4P35A 3EDCA 3VZSA 3HYCA 4ON9A 4E4YA 2GZAA 2RDMA 2Q2NA 4RQUA 5C53B 1RPNA 5KYWB 1A27A 3LQKA 2PVCA 5FD8A 2IA5A 2F9FA 4C0QC 1RKQA 4KE7A 3L7AA 1HYEA 4LHYA 2X8JA 2MYPA 3QLUA 4YVFA 2XT9A 2FN4A 2DBZA 3QWAA 3R75A 1WSAA 1ZINA 3KJXA 4H2DA 2Q45A 1EP3B 4L75A 3QPWA 1UJCA 4IUDS 2O7VA 1B6RA 4GBGA 3W1WA 1R8SA 1KU6A 2CXRA 1VSTA 3L6BA 3L0OA 1Y98A 1N6PA 3O8OA 4PPNA 2Y6UA 1CQPA 1XA4A 4MRAA 1GCIA 4L5CA 5DSTA 3RUHA 5TC4A 2Z9BA 4ZIRA 1FX0B 3RVMA 3VHXB 1JAHA 5LBUA 5BR4A 5D1HA 1YGPA 3H5NA 3F6BX 4CKEB 5HUQA 1HTBA 1EEXB 4AS3A 4Y9SA 2RSLA 1IY9A 4UM7A 3NP9A 5AICA 4ZEVA 1GPAA 5GIOE 3DONA 1OYOA 4GFDA 3WK8A 2R11A 3QLTA 3TIGA 1WJGA 3TUJC 1GFWA 1SUBA 3I1FA 4LXYA 5KYNA 4F93B 2V6JA 4PRLA 2B7CA 1ZWKA 1NY5A 2VH2A 4JT2A 5CDHA 4CEJA 3TL3A 1NM5A 2ZXUA 4BCDA 2VOEA 3WAJA 1C7QA 1PUJA 3CT4A 4KJXA 4Q93A 1PN3A 4PVDA 4CQMB 5B58C 1BFDA 3CLHA 2VDRB 3H2SA 5DULA 2YUIA 1J4AA 4M7OA 4EVSA 3VGPA 1UBKS 2XJ9A 4HX5A 3UPUA 3LBFA 4TT3A 4PG8A 2DOKA 2IHBA 1WLYA 1G3RA 1ID8A 3U3MA 2BJHA 1R27A 1FX1A 1VOTA 3NYQA 1G8FA 5A62A 2YASA 3ABZA 1WCXA 2B34A 2PYDA 3GARA 3LUJA 2H57A 2CGEA 3PZBA 4LCJA 5DU2A 5DYTA 5CB4B 1HQCA 3P7MA 4YP1A 5GY7A 1E5XA 4GSYA 2X0DA 3SXJA 2VJMB 3ZKWB 3GEGA 3FPCA 2C9MA 4Y7CA 1KXZA 5I8PA 5JJKA 1XEXB 2BRFA 4P36A 3WSWA 4I1SA 1MVNA 1M2JA 1CEQA 1XHEA 1PFVA 2Q6TA 2QNBA 4ZVNA 1U3WA 1RVDA 3BWMA 1V6AA 3MA0A 2F3PA 4TXLA 2CXUA 4TWAA 2UXDB 2A1TS 3IYLW 4ZI7A 2ZCVA 5DXFA 3PS9A 3TOCA 2VH5R 3EXHA 1RDFA 4G0YA 3VR6D 4M0CA 1CUEA 4D5EA 5JG7A 2H29A 1L8OA 5A4DA 3AL0C 1J24A 2XNDD 1YCHA 1T3ZA 2C4UA 2WIKA 3G2IA 3NOVA 3OI7A 4GZ6A 4TRRA 4RF3A 3DVAA 1VP3A 1EB8A 2A78A 2O48X 4C5AA 2DT8A 3L8DA 1YFZA 3PRKE 1V1JA 2BC9A 1SHZA 5CGQB 4M0EA 4DQDA 4IJWA 3BPSA 3KVYA 5FFFA 1L5NA 3DWGA 5TF0A 3AJAA 3GLHE 1JQ5A 4EHIA 3PZRA 4DLXA 1OYWA 4LXGA 1Z4MA 1LVGA 2I7VA 2I33A 3GP8A 1L9XA 3EYAA 4R8LA 3VR4H 2AMFA 3E7WA 5JBQA 1NI3A 1SG9A 4CNQA 1GGVA 3F78A 1M2KA 2PUHA 4ENPA 4YV1A 4IX1A 1DU4A 3L0YA 1TJ3A 1FP1D 3ZVRA 1GUZA 2GN2A 5C80A 4JBIA 1NW4A 3N58A 3ZY6A 3CUWA 4C6TA 2Q4BA 2QJOA 4EKYA 1QQAA 2D54A 2XVXA 4NABA 1G20A 4G5XA 2HHAA 3NAQA 4IMRA 4OREX 3ZHCA 3VA4A 2KFUA 4MRVA 1ODTC 3KZKA 5AKGA 2ZT6A 2BHNA 3UMFA 4UATA 3ROQA 3FNHA 4DZTA 1J1IA 1N1GA 5JFTA 3MB8A 2DHQA 4IHJA 4LHXA 1PQ4A 4EB6A 2REQB 1TO1E 1C41A 3DTTA 5BVIA 2GLUA 3H9UA 1FS5A 3EA5A 5FPKA 4YRZA 1NOJA 4H35A 4I4IA 2X5JO 1FY2A 2EEPA 4TUYA 3LQ4A 4JXKA 3GAAA 1GXSA 2DG2A 3M5CA 4E22A 3QOXA 2DEUA 4AXBA 2OZPA 2ORED 1YJCA 1J4LA 1XSEA 3IIEA 4HMQA 3RS3A 3ZCVA 4BO5A 3T3HA 1MMFB 2J08A 5LA6B 3M6UA 5AVJA 1X15A 1WDLA 1C8KA 3FZGA 2MSLA 4FQ8A 4CM4A 3JAKB 3K1YA 5A4AA 1N9ZA 3QX9A 4WK0B 3WAGA 3S68A 2C3MA 1IM8A 5H80A 4TROA 3MJHA 4CJXA 5C1BA 2XDWA 1GAQA 2C77A 3GA7A 4Y2HA 4ZAYA 2H7CA 3PLRA 5GGXA 4REQA 4MAFA 1KL7A 2RG7A 3GL9A 4UHHA 1ZUNA 3FFTA 5FWAA 3CWQA 1DEHA 2ZSJA 4IQGA 3TQRA 4QBFA 1YJBA 4Y2VA 1X80A 1K7FB 4KPFC 4RXTA 2AZ4A 1YR1A 2DLDA 2LVBA 3HO8A 3PQ5A 5A4JA 1PYGA 3WFIA 4DZZA 2D2VA 4EGXA 4IH1A 1J23A 1T0UA 1CS0B 3T4EA 3DMHA 4TL7A 2O2GA 1XRLA 3OTGA 5CNIA 5J4HA 1Z7BA 2WPNA 1F8YA 3DHYA 3RYIA 3ZGZA 1FFSA 1SBNE 5DF1A 4ZA2A 5JFGA 4CR7A 1V8PA 3RAFC 1WUTA 1KYQA 4YCSA 1CIJA 3KOYA 2AH5A 3QVKA 1WNFA 4HEHA 4XSVA 5EESA 3EK2A 4ZYVA 4JU8A 2Z3WA 1GZ6A 3OO1A 2FZ4A 4RZXA 1GUFA 4G41A 5DBGA 2EFYA 3N2ZB 3TVYA 5I7AA 4BC0A 1D2GA 2V8BA 4GGOA 1M6WA 3FTQA 4NC9A 5EJAA 3R76A 5JPCA 1DFHA 2BWJA 2V0CA 2GZMA 5JD6A 5AXCA 5C1OA 1ZA2A 3IDOA 2WTEA 2HY7A 2VF4X 4C4YA 4Z1MD 4LSGA 3CW9A 3SX4A 5EP1A 3GXBA 2W6JD 5E95A 3IMFA 4DQXA 3KQHA 1OREA 4UBMA 2H1WA 2WYOA 2ZKLA 4C76A 2WLTA 2Q3EA 3OP1A 4QVGA 3RODA 1L5LA 1SCQA 3CTMA 4F56A 1FP7A 1QFZA 1Y3FE 4LJKA 1M3SA 2PH1A 3C85A 4LUCA 2P67A 4ND2A 4Q1DA 3WV4A 3ZW7A 5CBPB 3AFMA 5B7PA 4QA9A 1ST3A 4KXWA 3A3NA 2A0FA 2QRMA 4M60A 3RC8A 3OLCX 5DB4A 2X19A 4K6GA 1KJYA 1JTFA 3I92A 3SZ3A 1ZA1A 1E58A 3IDSA 3IHWA 3JYNA 4QGSA 2JEOA 3F96A 1AGNA 1GADO 1VJGA 3G9XA 4MV3A 3MTDA 3QHAA 4RKYA 1U5CA 2HC9A 3SP1A 3UA3A 4X1YB 2VDVE 3DTNA 1SUSA 3C3CA 4P3XA 1H22A 4S1NA 3CRQA 2QTNA 3NV7A 3HM9A 4Q37A 2OR3A 4OQNA 5P21A 4O4HF 3ZV4A 1CDOA 1WB5A 3V46A 2WILA 3CZMA 1U2GA 4M83A 2O2HA 4YHBA 3IR7A 3FCCA 4TM8A 2ZIXB 5J1SB 4ENWA 1PP4A 2DQSA 2OV3A 3F98A 5HIAA 4G5GA 4Z0TA 4QDJA 1U6JA 2VOJA 4PZYA 3T35A 3OPYI 3RUDA 1RHJA 1N6NA 2CL0X 2HJGA 5IJWA 4MTCA 1YQTA 4ALNA 1BOFA 3LSYA 2PQMA 1OZHA 1X9GA 1NVUQ 2DWUA 1M1XB 2VZ8A 4DDHA 5F1OA 2RHBA 4G1VA 1DX9A 3ROGA 1F8FA 2Q3FA 1I36A 1YBMA 3FPLA 4NYJR 1TQ8A 4YXFA 4YCAA 4PAGA 3UJBA 2BH9A 4POOA 5EYPB 3OX2A 1VG8A 1DV2A 1CUCA 4DXAA 2CZCA 5CT5A 1A7KA 3GDFA 3LPMA 3CRW1 3ZD9A 4OSOA 5IAGA 3II6X 1MG0A 1CZHA 1XZIA 4I9NA 4XVRA 5ESWA 5G2OA 3M6LA 4BE4A 1PO7A 2E82A 4X3CA 1FP4A 3N53A 2CNDA 3WIVA 4B5LA 5DISB 3IJ5A 4MW2A 1NVXQ 2HMUA 5FJIA 4DLPA 4EKEA 2ZULA 2GRJA 1EUDA 2PY6A 2V7XA 5HQ3A 3WB2A 1HDRA 4OFXA 2E2WA 4ZO4A 4BQPA 1XQWA 3GGDA 5A0VA 3KDPA 4Q9JA 5KTYA 3NVDA 4FDAA 2GBPA 3W6UA 1QRSA 5LQJA 4DMMA 2R8XA 5J5VA 3TLMA 3D6VA 4CMKA 5GMOA 2Y0PA 4A36A 4LNHA 3HBAA 4R51A 2YXDA 5HEKA 4L4SA 5TEVA 4ALMA 2JFYA 3ZZTA 1I1OA 2IE8A 1VBMA 1A82A 4U39A 2CV2A 1HV8A 1YAHA 2EVWX 3QVLA 5DJ5A 5EZYB 1L5HA 5LMZA 2JJMA 5DCUA 3WQHA 4KRFA 1Z73A 1U9IA 4JI2B 2AUNA 2V96A 5FQOA 4LK3A 3HXTA 3D6HA 4S1VA 2CSWA 3CXUA 1XZ8A 1SBQA 4IOKA 5GONA 2E55A 1XCOA 2V4UA 3AEKB 4XYLA 3L4KA 4FM9A 3RRZA 1FU8A 3EGWA 1YT5A 1ZD5A 2C4HA 4ZAGA 1BH6A 5HDBB 1P1CA 3RUPA 1ZP6A 4KN9S 3ZZNA 4BIIA 1V8OA 2UVPA 5ALKA 5C8YA 1R6XA 2J9GA 2WHRA 4MUNA 4Y9TA 2CKDA 3W3AD 5LPNA 1V43A 4G5FA 1O2DA 2RKOA 2W0MA 2R1VA 1IY2A 1QH8A 2QD1A 2ODNA 1LRJA 1BD4A 3H2YA 4BFXA 3RVRA 5D87A 1R5OA 1O87A 2VHXA 2J7PD 2JCXA 2PKWA 3L0IB 1BJRE 1M2NA 1DZIA 3KEGA 4O4IA 5IBRA 1CJVC 5KSZA 1S3IA 4S04A 2GLXA 1UBUS 2Q8QA 2GFIA 2HGZA 1DVRA 4KFSA 4UC0A 1QRTA 3W0LB 2BCGY 3COYA 2J67A 2HQOA 1DD1A 1QCCA 3MK31 2BHLA 1Z0AA 2ZPUA 3QUCA 1XYGA 1BCRA 4G0XA 4MGYR 1RWMA 3MXTA 4RKWA 1QPZA 4MR7B 4DA4A 1VQ1A 3TD2A 1U90A 3IUEA 3FDZB 3PA6A 4B5KA 4ZOQI 2DR3A 3W5JA 1LGYA 2HSDA 3RTAA 3PE6A 2BMJA 3O4FA 5E9QA 5K9ZA 1DIBA 5SZHB 4A23A 2PMKA 4MLDA 4PQRA 3O8BA 3HK2A 3FXAA 1FJHA 3KFLA 3N1UA 3U09A 2GRUA 1QO0A 5TX7A 1W4RA 4CF6A 2QM0A 5JFOA 4MQLA 2EDCA 4GRAA 1KY5A 4LC1A 4DUGD 2C2YA 4QO8A 3JQDA 5DGTA 1DWPA 1QKJA 3BKWA 4MJ3A 5BMOA 2YQ4A 3E3OA 5HWSA 5DZSA 2FFHA 3MJVA 3N86A 2Y92A 2Z4RA 3H6GA 2IBSA 3UFXA 1C8LA 4IY1A 3DOUA 4LGMA 5D6OA 3OFKA 5EXPA 4L76A 1RKXA 1U28A 1IN6A 2LNDA 3EAGA 1DLIA 1G9SA 1YHYA 5IN5A 4B73A 4YT4A 5KYXB 4MZXA 2PX4A 3KEOA 4YY3B 4YDRA 1R0KA 3NNSA 4KRGA 4J1SA 5HMLA 4MUFA 4XGQA 3V1KA 5HIIA 3LS2A 4JJGA 1NXTA 1DMSA 2B0JA 5AJUA 3AB7A 4IP0A 3GLSA 4F3KA 1OB2A 3PJDA 4NE9A 1FUUA 1N2EA 1QHEA 1UMBA 2GBGA 4O02B 2OBMA 1NF3A 1RRCA 4H31A 3O2NA 1JX6A 4BX3A 3C0KA 1JKIA 1OJ7A 1OA0A 3JQCA 1W85A 3EQ6A 3IDZA 4YP6A 3OEEA 4WOPA 1SIBE 3AT1A 1FMLA 5JW6A 4LX0A 4TMWA 2XYQA 3IEKA 4PONA 4MB0A 1FK8A 2VJCA 2N75A 2JLCA 3BRWD 4FSDA 5KVCA 4K9NA 3BWYA 4MEBA 3R4VA 2X9GA 2H2DA 1US8B 4QPZA 2C84A 3MAJA 3PU6A 4DLLA 4I9HA 4JMPA 4OHXA 4ZV7A 3WADA 3WNQA 4GYYA 2ZJYA 4LYYA 2EIHA 2Z2ZA 2HREA 4RY8A 5EY5B 4ZDIA 2BKLA 3SC6A 1W73A 5IUNC 2C0PA 1J70A 5CYGA 5ES3A 1I51A 1JN0A 1S2MA 2OCDA 4UPEA 2C1XA 1EE9A 3ZH9B 2B30A 5BQPA 3SJ7A 4EHAA 1EM8B 3O8CA 3C6XA 1H0KA 2N46A 3OJOA 3LZ6A 2FEMA 2MSKA 1BHJA 2FX3A 2WUGA 1CFJA 1EIZA 3A2LA 3GW8A 3BB1A 4A3SA 4TSRA 1RCTE 1JQBA 4CKXA 1YS7A 3CF4A 1XPRA 5E2AA 3BRQA 3HU2A 1UP4A 5CA1F 4GMGA 2UYQA 3I32A 2J41A 1URPA 3L8YA 4YBZA 1MENA 2JIRA 3QPDA 4FFBB 1ISMA 2XUPA 3O7WA 4HQRA 5GOZA 5ISMA 3Q7QA 4PINA 4QBGB 3GNTA 1ZD9A 4I5EA 5AUQA 3VAYA 5LFAA 3K70C 3REOA 2FPGB 5JAHA 3THWB 4CLHA 1QKKA 1KSHA 3EGOA 4QYIB 4P3OA 4D25A 2P9ZA 1B0UA 4NOKA 2WMNB 4FONA 1DCFA 2JJQA 4KJZA 1O5IA 3PKZA 3COVA 3ND6A 3HXQA 4YJ2B 3E1KA 4Q3KA 3VO9A 3QK7A 4C0KA 4NU6A 3L0SA 4FHFA 2ZT8A 4GKVA 1T1GA 4UQPA 2VRCA 3M5PA 1ODSA 2ISSD 1I33A 4TTQA 5JAIA 4LMAA 3DPIA 4D9BA 1NUQA 5CXUA 1E8DA 2X13A 1H05A 1FNCA 3EIEA 3EIXA 5A5VA 5AVRA 5HHTA 4NBSA 4AJIA 1N8KA 1WMFA 4DXHA 1Z7YA 1K8ZB 2PX6A 3TSOA 1SHLA 1GKKA 4ISCA 5LZ5A 1QE3A 8ABPA 1T9CA 3OQIA 4HRAA 3PEEA 4CHTA 5A4MS 2PLAA 4HXYA 3NDBB 3DR5A 3QE9Y 4URFA 2WM2A 1JWLA 4JJZA 4UEOA 3RREA 2FDRA 4JT4A 3OPQA 5B55A 3SQXA 1V5GA 3UN1A 2ZRFA 1EUCB 1ZIXA 5F3DA 4EG4A 4XEUA 4KWHA 3HKDA 3VR2D 3HVKA 1JHMA 3BXFA 4DE5A 2C2MA 1U0SY 4HEA6 4MRRA 3U3JA 3QVGB 4TLDA 4K40A 3FMPB 4RTSA 1IUPA 3IP5A 3OFJA 4HYYA 1V26A 1CY4A 4HN9A 2GR9A 4D1YA 3TTXA 1AB5A 1JLLB 2X1HA 1J49A 1JDUA 2OEPA 3AVVA 1CLUA 3I64A 4IRUB 1U7FB 2QRVB 1N3IA 4D8VA 4DLZA 1DC5A 1SQFA 3Q7EA 4H27A 2GUWA 1KVSA 4UARA 4GZLA 4UEKA 3UAGA 1KTVA 1KJJA 1YR9A 5B1YA 1MJ5A 2GEVA 2HFKA 1PBTA 2WHPB 1VRWA 1CDZA 3O4RA 3QXXA 5KREA 1PU2A 2O1WA 3FR8A 4EI8A 1TE2A 2XR1A 3D3JA 3UV0A 1DO2A 3IUQA 1NMYA 1MCZA 3KSZO 4RA9A 3SYRA 4LK2A 4MO2A 4XCVA 4YROA 5ILOA 1W76A 5AIAA 5ESRA 3TQQA 1JEQB 2P4UA 3D3WA 2G4LA 3DKIA 2QHXA 2QXUA 3QENA 1UUFA 3ZTWA 2B5WA 4TWIA 5HP4A 4NYIQ 4B7XA 1N2SA 2J3EA 4JI6B 5LLTA 3LLSA 4CEIB 3INNA 3B3GA 1Z2NX 4AUNA 5L3ZA 2IUSA 2QVYX 1WPXA 4FT4A 3SEZA 5IKXA 3AF3A 3D3NA 4BMDA 2HZ7A 3T3PB 4R68A 2IHTA 1RJWA 4Q4HB 4QPJC 2QA5A 2GCPA 3LF2A 3MGAA 3QI2A 4PGAA 4DR3B 4ZOCA 2M1XA 3NGXA 1ZRMA 5AW8A 1Q0LA 5ICCA 3KJGA 3RUFA 1DDOA 3A27A 3R24A 5BT8A 1SXGA 3N76A 3OE1A 4OB6A 4ME6A 3KDSE 3I0ZA 3AERA 4J43A 1EHYA 4K9SA 1E4EA 1NNLA 1JLMA 3GPIA 3JQ8B 4ZI7F 3K9FC 1AF4A 2WG1A 3A3YA 3AF0A 4MS4A 4N3AA 4N76A 2O2ZA 4WASA 1T1EA 2FMHA 1E1DA 3EZYA 4B6GA 4BQEA 2CDRA 4B7CA 2YX1A 4UFPA 5AUPB 2OBNA 2JGJA 5T57A 3E58A 1MT0A 3JQPA 2LCIA 2GASA 2ZVJA 4FHDA 2CMHA 3ROZA 2AN5A 2WUFA 2PJRA 1O95D 3BFKA 2CLIB 2P8SA 3VHXA 3OO0A 1FQJA 1TW2A 3OY2A 4B3IA 4BWYA 4N5NA 3FYHA 4C29A 2JHFA 4C7BA 4D9MA 5ITZB 2X0EA 2H1SA 3KXKA 1SUEA 5I01A 2ALJA 1I30A 1XJWA 3EGXA 2WHEA 3C7AA 2R6DA 5FEMA 3CF2A 3ESXA 4NFSA 4DCTA 4ENTA 1T13A 3FTNA 4HRVA 1Z0IA 1F5NA 4JLSA 4BB0A 1Z0KA 4OXRA 3L5OA 3WKDA 2EKPA 1W30A 3F5DA 3AOEC 5F3WB 1QQTA 1ZMTA 1PLLA 5EJ2A 3RIHA 1CUXA 1JDZA 1SKMA 2Q1YA 2YHBA 1TU4A 4PBRA 2NU8B 4WI1A 1VGQA 2G5GX 1IWOA 1GP2A 1OASA 1XKXA 5TY0A 2GM5A 3B1ZA 1T5DX 1JG4A 3AV3A 5JEJA 4KQJA 4QOGA 3L8HA 2ZIZA 5H1YA 3DO5A 5ECYA 3SJAA 2ID9A 2BFNA 2VBIA 3DPSA 3TG8A 4EAQA 3GRPA 3AHIA 3EIOA 4BJHB 2C9ZA 4IHJF 4RE6A 1BKYA 1L5RA 3KUKA 2HLDA 1XZDA 2ZJOA 4C07A 2P35A 1VHTA 1EAMA 1FFGA 1PW7A 5CB4A 1Z0ZA 4BGUA 4FNGA 2VJMA 3NU1A 2OAEA 4CLRB 4PC2A 1YONA 5ALVA 1C4KA 1OFTA 2L42A 4WAUA 3BGSA 1DJMA 4A6PA 2AFHB 2QLLA 4WZZA 4FJ2A 1RYEA 5AH0A 4NCHA 5BW6B 4BO3A 2EKQA 1JT9A 1W59A 2H4YA 2VZEA 2QMQA 4HNHA 3IFSA 4HQLA 4MPRA 5TT1A 5SZJA 1VBFA 4L5BA 5E50A 4R9UC 1WUKS 4PXSA 5IDYA 1K3QA 3FR7A 1ZJWA 1Y89A 3LQYA 1M33A 2D59A 2OENG 3E03A 4EKGA 2J07A 1INLA 1X7ZA 2E4ZA 3I52A 3WRWA 3PI7A 3QU7A 4WXYB 2EYUA 1V37A 1UZLA 4EG5A 5H9WA 1GARA 3A2MA 4QQNA 3WWZA 3MXOA 2D6FA 1QU3A 4AZWA 3AP3A 3E8SA 1W2WB 3GJQA 2V5VA 1T9HA 2AMLA 1Q1EA 1OXSC 1QIEA 4QU5A 5CFNA 1NQ5A 3C97A 3M83A 5CNJA 2W8ZA 3GPDG 3N6VA 3UYKA 4AZSA 4JFRA 4F11A 3FOWA 4YRMA 3H8JA 1DTSA 2O8DB 1WMAA 4ZAVA 1L7DA 1GQSA 5I9MA 1FXWA 4AUKA 5DNYB 4XE5A 2JGEA 2R1ZA 4HBGA 4R69A 4Z0HO 2RH8A 3A25A 1XD2A 2D0OB 4JLOA 4MLPA 5LSAA 2A9OA 1YA4A 2C4MA 4LWZA 4NYMQ 3KJIA 3FMVA 3URMA 1ZH0A 1FLAA 1Q7TA 2JLRA 2KW5A 3FHOA 5CX4A 3WRYC 1XRRA 2RI0A 3HCCA 4D3FA 1Q2XA 3LGAA 1H0HA 1TQ6A 4F96A 3S1SA 4OX9Y 2R8ZA 1EK0A 3B9QA 2QMYA 2Y66A 4GX1A 2AL7A 3WS7A 2HR1A 4QTYA 2WV7A 1UDBA 4NOLA 3SFZA 3IQWA 2IEIA 2ETXA 2Q5LA 4X92A 1Y63A 1F8GA 1FRNA 1N5LA 4E6PA 1ZIOA 3MYRA 1E9BA 3QBEA 4OLFA 4Q1CA 1U7WA 4AN4A 1G5FA 1PYOA 2X7HA 2BMDA 3GJ7A 2FSUA 3AB3A 3A9VA 3RWMB 5J47A 2Q3BA 2CBZA 3ZE7A 5C8XA 3LXMA 3HI6A 5CT4A 2WF7A 5CXSA 5C4MA 1FRVA 2NP6A 1E92A 3OCUA 3K15A 4KAAA 3PD0A 1UFQA 3QYJA 5EP3A 5EHQA 1IN4A 1RU3A 2BM9A 2C9DA 3QI7A 1QTIA 3L6EA 1XQVA 1NQWA 1QVZA 1DJNA 1JXQA 3HDJA 2A9VA 2VP5A 3V7NA 4B2IA 3AGQA 4BJ3A 4WPGA 1B2RA 2B1GA 4MDEA 3R0ZA 3SQMA 5DH9A 2H2GA 1NT4A 1T8SA 2PEYA 3LUDA 4G23A 2FKAA 1EPUA 2ZUTA 1BKDR 2IS2A 4UM8B 4ESEA 5DHTA 1G7TA 3A3PA 1A9XA 4LRWA 1JBQA 3WGNA 1T5OA 3CNOA 3NH9A 1T3HA 5F2EA 1WBDA 1V35A 1Q1AA 3ECSA 3UGKA 3FHJA 2OFXA 5LUBA 1YZNA 1CUAA 1HFKA 1RJ9B 5HCIA 1Y37A 2IEGA 2QRQA 4M8KA 2IT1A 1Z4PX 1OAOA 3I09A 5HBGA 1I8TA 2E5LB 4YDQA 4B44A 5ULLA 4DIFA 3DBOB 4Y30A 2GETA 1EJ2A 3CPSA 2JKDA 4P08A 1I7PA 5F7ZA 3ZVLA 2DUUA 2PFSA 2G28A 4FINA 1PWHA 2A30A 3Q9UA 2FQ1A 3BAFA 3BSYA 5FIUA 3BS4A 5T3YA 3TQOA 4Z7QB 4BECA 1MABB 5B2FA 5H83A 4QLBA 1CQJB 1E64A 4EG7A 1RCFA 3BXZA 5AK6A 2I8LA 1AT1A 3IIMA 3NI2A 4TL8A 4AURA 2ADMA 2QW0X 5DHQA 3AR8A 4Z51A 5A02A 1JXAA 1ULZA 4GMFA 2Q9CA 4O5OA 4TS1A 1Y7TA 3QVMA 4Q3LA 1IPHA 2AR9A 2FPKA 1TMYA 2QTHA 2Y4NA 3TMYA 4DLBA 4QLAA 5P8WA 1WCWA 1NZFA 4CU2A 5KCZA 3VVLA 4GXNA 4A0RA 2Q6IA 1JDTA 4QJ5A 2ZWPA 4X1YA 4PSVA 4A82A 3DZCA 3DE6X 1OF1A 2PIEA 3OTQA 4Q5IA 4EGJA 2YWBA 4FYXA 5KYGA 4I1YA 4BEWA 2XZTA 2Q5CA 2IX9A 4QARA 3D2AA 2Z2KA 2BEWB 3L2OB 3L18A 4J91A 3PQEA 5GONF 4YAIA 1JMYA 1JT2A 1ZM4A 2IUYA 2JL1A 3EEFA 4HR7A 4QREA 1IAQA 3BIJA 1HRDA 1OBOA 3BIFA 3H86A 3TEJA 3V33A 5AT1A 5I5EA 3PJRA 1EVEA 3ZEIA 2VNHA 5IDWA 3PGJA 1ZQ1A 3UJPA 1EVZA 2PRIA 4XJTA 5E2IA 4JKOA 3WBFA 4N0DA 2YVKA 3K72B 4XWGA 4YIHA 5JQGA 3JWJA 4A15A 3AVTA 3EJWA 4HYTA 1H1LA 1AZSC 3N05A 4J1TC 2CLEB 4D3DA 5MFPA 2YINC 3BOSA 2IS6A 2XYHA 4Y67A 4F8YA 2RAVA 3DUFB 4G5RA 1DTWA 1HDIA 5CVVA 1POWA 4QFBA 1C7EA 2BEJA 5EYPA 4OU5A 3SX0A 1P7ZA 1QO0D 3WA6A 4EF5A 2W6NA 1WPQA 3VHQA 1E3IA 1YVUA 2OZKA 2W71A 4UDYX 1I2AA 2BFAA 1N8SA 3ICQB 4I81A 4WY2A 2CL6X 3HYRA 5HRAA 1KDZA 2MIIA 3ZHRA 3LX4A 3FOFC 2FWRA 2VP9A 1GR0A 4RHFA 5GV7A 4D8YA 2WM3A 5EWMA 3T5MA 1IEVA 2JNWA 2ZJ0A 3X43A 5C4VA 4M46A 2CFTA 4K8OA 1AKWA 4UZFA 4RY9A 2YMPA 1VPEA 1IHPA 4MICA 4LOAA 2IEYA 1Q1BA 4PYLA 5ALWA 3T4PA 3G2HA 4FYJA 3TTSA 4KNYA 4MI9A 2N0SA 1SOWA 4GI3A 4HRYA 2DX7A 2HHHB 4F60A 3PSAA 1GNQA 2YIVX 5HFAA 3NFYA 2RE8A 2AZTA 5TPZA 3LT0A 3RAEC 1VMIA 5FBQB 2Q2OA 3ZWCA 3VNUA 3EDMA 3V00A 1FFBA 1ISHA 2NZVG 4FVTA 1UCFA 3C39A 5EZYA 3UCFA 1ZOPA 4C4PA 1R5BA 1UK7A 2XECA 3DKPA 3OEED 3WK9A 2LRHA 3SOPA 3LQ1A 3GLRA 4LHSA 5LKRA 2MCFA 3EXG1 3ZU6A 3OESA 2XCSB 2UZ0A 1V16B 3MT8A 5AVWA 2X8AA 3NBFA 5GJBA 4HC4A 5AVQA 4WJZA 3JQAA 5A7HA 3OTOB 1BA2A 1PNQA 3RU9A 5DI3A 2X15A 2JJ8A 4KWIA 4NZYA 3WGIA 4OUDA 3PFNA 5F1KA 4BX0A 1RM4A 2GM4A 1OGIA 3HWWA 3U3ZA 5IPFA 1NU8A 1D9ZA 2EOAA 3VDRA 1SCUB 2ATVA 1XCMA 2YXLA 5G0SA 1BYUA 1P2BA 2FRDA 2YHIB 3S2SA 4Q18A 3STVA 4UOEA 1PT8A 3PC8A 3HBLA 2X5KO 2FSSA 4PTYA 3WHIA 3P96A 4E13A 1Q0TA 4GPBA 4U7FA 3I2GA 5IKEA 3ENKA 2YIDA 3L4SO 3TINA 4AJ2A 5KWVA 3W7VA 5C8VA 2FK8A 3ZJUA 5HW0A 2R66A 2WFAA 1ZW6A 3ICOA 4IDAA 4LNUB 2IC5A 4KRYA 2AG0A 1DRUA 5CIQA 4P80A 4J3NA 2PKQO 1QIHA 3IEIA 1Z0UA 3JWPA 4L9AA 4QOSA 5WRFA 4AQYB 3OCVA 3VZBA 3GEPA 5J40A 2P5SA 2XI4A 4UZSA 1DIRA 3RNLA 1QVRA 1L5FA 4IM7A 1H2AS 4YR9A 4A92A 2WT4A 3EGDB 3U4DA 1KYIA 1OX6A 1WLSA 1GCGA 1OD6A 2JI8A 3IX7A 3LT2A 3QNMA 4KO4S 4XUDA 4DIEA 4EUNA 4ESVA 4PWZA 1X39A 4X7MA 2BR4A 1E2PA 1JG2A 1Y7PA 2PU7A 2WMDA 4C9BA 3DYBA 2XUHA 3ZHBA 1D09A 3ETHA 4DWJA 3TNDA 4ZRDA 5K09A 4WE3A 2J3DA 1GNTA 3EPKA 5EP2A 2HQBA 1QH1B 1U94A 6GPBA 1AX9A 1O9HA 5JYCA 1IZ8A 4I5GA 3K1ZA 4LWOA 2VRCD 4LRXA 4QTTB 1XZBA 4JLWA 4NV3A 4ECAA 3VR1A 1KMHA 1L5SA 1V7QA 2EFDB 3EOAI 1D2RA 2FWJA 1M34A 2VT3A 1PFKA 2JH9A 4MJLA 1NQXA 2G7ZA 3ZDZB 1P73A 2I3AA 3L7OA 4Q0MA 1JAXA 4N3GA 1BJKA 2Z09A 3ZVKA 3NIWA 3R7WA 3FVRA 4X94A 3K20A 2OFFA 4L8WB 4ZXFA 3R74A 1AN0A 4YYEA 4Z9BA 3X1WA 2XCTB 3FPFA 1UKCA 1MB4A 3H1GA 4ZDWA 2Z83A 1KBZA 2VZ0A 2ZFUA 3DPUA 3T99A 4D3SA 5TVGA 4DM7A 1N77A 2XXAB 4TXMA 3ZS9A 3E5NA 3IA7A