3V8QA

Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-5'-deoxyadenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
263
structure length
257
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYGEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDELSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 68
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8qA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8qA01
3S40A 2QV7A 5EJFA 1Y3IA 3V7WA 5EJGA 3AFOA 1U0TA 2BONA 5DHPA 2AN1A 1SUWA 5DHUA 2I1WA 3VZCA 1U0RA 2Q5FA 5EJIA 4L02A 4WERA 3V8RA 3VZBA 3T5PA 3V8MA 5DHRA 3VZDA 2I2FA 2JGRA 4V24A 2I2AA 4WRRA 2I29A 5DHQA 2I2BA 1Z0UA 5EJHA 1YT5A 2P1RA 3V8NA 2I2CA 4HAOA 5DHTA 3V7YA 3V80A 5DHSA 3V7UA 3V8QA 2QVLA 3V8PA 1Y3HA 1Z0SA 1Z0ZA 2I2DA 4DY6A 3PFNA
chains in the Genus database with same CATH superfamily
2BGKA 2FWMX 5AICA 3WLHA 4IIJB 4HMPA 2QN9A 2B4AA 3HFGA 2C1EA 2JLQA 5ALVA 3IAM1 2QWXA 4JT8A 5AVUA 4MV1A 4TRRA 2AZXA 1LLDA 4U7PB 5DW3A 4TWBA 2HA4A 5C0OE 4X71A 1NL3A 4FCVA 5CX1B 3WTCA 3AR8A 5AVTA 1OA1A 5I4BA 5AVQA 1WB9A 1B4DA 2IUSA 5B2FA 2Q2OA 5BN4B 4FYJA 1W34A 1ZN2A 3DHNA 5DWDA 2D2EA 3TOCA 1R5BA 3C39A 1GYQA 3H1EA 4JB0A 3PXGA 3TI7A 4EHBA 1E1KA 4ILKA 1A4XA 3BJEA 4NZYA 1DHTA 2EGHA 5DLPA 4LJ5A 1MW9X 5HSGA 4Q7EA 4YXWD 3SYRA 2R25B 1Q19A 1NFRA 3IBGA 2HC9A 5EIBD 1YJ5C 2GCEA 4YP5A 1M73E 3A1NA 5EZYA 2PUBA 3FTDA 4ZRNA 4D4MA 4YAOA 5J3JA 1WTCA 1RVDA 3BERA 3IPXA 5JVDA 3Q0IA 4MYUA 5G1OA 2GJSA 1TMYA 1JS1X 4RIIA 5IAJA 1XD9A 1FTSA 2JKYA 5JHHB 2CHVA 1ADJA 2H1RA 2WD8A 4JB3A 5COQA 2GFHA 3TNYA 4L4UA 5JNWA 1C3VA 2ZGVA 3KWFA 3SWWA 1EGAA 5K7SA 3CLHA 3LA8A 1W0KA 1HEYA 2VZLA 3SU8A 2IPMA 2A5LA 2FMTA 1E3EA 3VR0A 2A0WA 3DFFA 1RXWA 3GFQA 2ZRLA 3HZRA 3G1UA 5J5AA 5IRCD 1UOPA 3A2NA 1P5JA 1ORTA 2OWDA 4N1AA 2G9UA 4NYJQ 3IUQA 1E2PA 4O4LA 3H2HA 4F97A 3JVVA 1C3EA 1VKOA 3PX3A 4Q7MB 2WJ4A 3K2IA 4BE9A 4DKXA 2NT4A 4XOUA 1Z0DA 5IMBA 2ZJ5A 1LNSA 1XU4A 1ZK0A 3KTAB 1Y8AA 3N6VA 4NOJA 1D7OA 1SKBA 1XDDA 2ZJOA 5BSRA 4FZJA 5ALLA 2KQUA 4ZV9A 4ZCIA 1IY0A 4MYSA 1RHJA 1ZP6A 1RC0A 2DCUA 1PJBA 2CBZA 2HYDA 2VHEA 2WOJA 3JCZA 4ODIA 2ES4A 3GQBA 3HADA 1A1VA 3VR5D 1U2DA 1ZM3A 3U7JA 4BQIA 3OCJA 4ND1A 2CXQA 3RAGA 2JJQA 2VDQB 4V0NA 4J6EA 1JUDA 1QHIA 3OZCA 2UYHA 2ZJYA 3C1AA 3OFSA 2ZCUA 2JA2A 4P3NA 1T8SA 4R2WA 5M29A 4PYMA 2Y0CA 4FX2A 1VJ0A 3ZVLA 4R1TA 1LV7A 3LT2A 2VHCA 3NAGA 3RVNA 4LDAA 3MJTA 2PZBA 1RI2A 4WLFA 4JLSA 1GLNA 1OZGA 2DBVO 2OCKA 2OGWA 5AVWA 1MP0A 1NW4A 4MKRA 2ICAA 3BFVA 3DKKA 3VUEA 4DZZA 4FBLA 1FCJA 1KY3A 4CM6A 2Q2QA 3AI2A 3NHWA 4B7UA 3QUAA 3EVBA 3AETA 3VSCA 3CBQA 3R3WA 2J3MA 4JITA 2G5GX 3UC5A 1CZOA 3GVHA 4X93A 4ER7A 5BWCA 3AQIA 3OMLA 1NJ8A 4MZDA 4X6XA 1Z0UA 3DMTA 1IVYA 4S2EA 4O2BB 1GUZA 4G5GA 1FYXA 3AHFA 1DLJA 1M8GA 1P0QA 2C29D 4M8NE 4I5EA 4PQRA 5ER6A 4LNUA 3W77A 3FPFA 3ZE9A 1C5KA 2C20A 3A28A 4FFVA 2EIHA 2PT9A 5JCOC 2XZOA 3K5PA 4HFNA 5HZKA 1GG9A 1KAMA 1YJ5A 2NO4A 4WZZA 4I46A 4X3OA 3RARA 1GFSA 1WCIA 5ABPA 3CMCO 2LXNA 2GHRA 2P91A 4GX1A 4TXNA 1J8DA 3ND5A 4MUIA 3W1VA 3IUMA 4MVWA 3H0EA 4HDNA 2QQEA 4ADSG 4AKIA 2CXOA 1Q11A 2VKQA 1LFDB 1P9WA 2BMEA 3PCTA 4HEJA 3A7DA 5IDQA 2P4HX 3SDZA 1XJ0A 1U2RA 3TOXA 4PPQA 1U28C 3PICA 4O4HA 4FCTA 3GGOA 3MWLA 2QJTA 1WQ1R 4BNWA 1M0SA 3R4CA 3G9TA 1UDAA 1TZ2A 2B30A 2CD7A 5IPFA 2HT1A 2BFOA 1M1YA 2QSJA 4DIOA 5ADWA 4DM3A 4M86A 4WT7A 1T35A 3RC1A 3I5AA 3ELSA 3AZQA 1IZ7A 2WKQA 4WLOA 3ZGZA 2JBWA 1P9RA 4ZQBA 3UUGA 1VHQA 1VKJA 4K3VA 1JSLA 4G9BA 3HB1A 2DSNA 2HNBA 2VSXA 4YUVA 4DQ0A 2I03A 1B6RA 2JFNA 3FCOA 3FUUA 3NDPA 4C07A 1UBJS 3ICCA 4EB3A 1L4LA 4QM6A 1C2TA 3BMCA 5A5FA 1T5HX 4M0PA 3MJRA 1TQ6A 2VCYA 4IZIA 2X5XA 4U2GA 3TPCA 4TV9B 3EPJA 1TQDA 4BO8A 2QT1A 1AMOA 2A1UA 2A0TA 1BU8A 4Q7QA 3X1YA 4C22A 5CXQA 4RF2A 1KI6A 5DRYA 1DRJA 1WB6A 3H5IA 3JVIA 5T67A 1TTQB 3C8HA 3GL9A 2PGLA 3E61A 3K0HA 1WL8A 4F60A 1OMOA 3LW7A 3ZU2A 2Z9CA 5FPPA 3PE3A 2Z2XA 2VPQA 3IOCA 5C5DA 3SBOA 2RJOA 2WU0A 2ZTMA 3HXKA 2V7VA 2YWGA 3FMIA 4KACA 4Q3LA 4QREA 3WV5A 4EF6A 4X60A 1XQVA 1X77A 3OZRA 2MSDB 5JPIA 5B2EA 2YX1A 3ZY3A 4HUQA 4KJXA 5BSFA 1DAIA 3VR2D 2HBQA 2J3IA 4GPD1 4O4LB 4X6UA 2VAMA 2YRXA 5DHRA 1FRVA 1Z4QA 1ZJ4A 2P6OA 3UB2A 3AILA 1OH5A 1G0NA 3OQ1A 4HB3A 1TLLA 4WOPA 2DE0X 1YR6A 3O0TA 3H5LA 2QG9A 1QOQB 4RJLA 4DIDA 2IHTA 2NVUA 2IX3A 3GQBB 4R8KA 3L8MA 4Q9HA 3STUA 4LXIA 3DKVA 4UW9A 4V3CA 3OP4A 3UT5B 4DB2A 2G9VA 3NBMA 4FR0A 2FPPB 5KNCH 3H8WA 3HCPA 2COUA 4BEWA 2GAAA 2FGJA 2QPTA 4M1ZA 1D6SA 4EW2A 1HXHA 1P91A 3PQDA 4XGQA 2YYAA 1W4AA 1D7AA 4MQLA 4L22A 4OHCA 1JU4A 1KPHA 1Q0QA 2C4VA 3GCGA 3HE3A 4RKEA 5B57C 2AQKA 3AOEC 1QTQA 1IZ9A 3OIFA 1YVRA 1G3RA 2ECKA 3GELA 4PR3A 1SBCA 2RGEA 1L4FA 2EF1A 3AETB 3C3DA 2AD5A 3WKEA 1G20E 1TF7A 1TJ5A 5IN4A 4MRMB 4UATA 4K0RA 5CK4A 1AH2A 1XV5A 1ZQ9A 1H2BA 1BS2A 5K0JA 4IEEA 1B8NA 1NRIA 5GJWC 3WL8A 1YC2A 3TIXB 2R7MA 2VS1A 2BEVB 4LNUB 3M6LA 4ESEA 4OM7A 2ZM5A 4O29A 3VKGA 3ZE1B 4TVSA 2XVYA 1US8B 1CUZA 1GO2A 1I1QB 2DTEA 3EF0A 3FI0A 3IURA 4AQ7A 2AK2A 1MC8A 5I9SA 3PUHA 4HEQA 4ZYVA 5CBKA 2HRBA 1NBOA 4YTEA 2GTHA 4D8VA 2ZCJA 1WCIB 1D2MA 1U1CA 4MHSA 4QO8A 3VSBA 1H2FA 4BDTA 3O93A 1TT5B 4JMLA 1Q16A 1EXVA 2RBGA 1HORA 4K40A 5KKCA 2WQ6A 4HDNB 2CL6X 2IEAA 5K6AC 4KAAA 1PR1A 4C0BA 3OC6A 3OM8A 4RSHA 5BOVA 5F5NA 2QAIA 1Y3AA 3NFRA 1HM5A 1QE0A 1I5OA 3PR2B 3FX2A 4A1FA 1ICIA 2X9GA 2CK3D 3MCWA 2WIBA 4JOBA 3TPZA 4YV7A 4IMRA 5EIFA 1IXZA 3HM2A 4PANA 3DAPA 2MSNA 3UAZA 5DN6D 4B0PA 5TPWB 2H6EA 2O7SA 1JALA 2JCSA 1G60A 3NT4A 3DZDA 2PMBA 2DFKB 3NGLA 2XD4A 1H6BA 3AUYA 4PR0A 5CHEA 3RJ5A 5EKXA 3ZXXA 1YQUA 4DDWA 4LEIA 3THOA 1P44A 2EJCA 3ML1A 1VPEA 1UANA 4O02B 4UBJA 5SY6A 2VYVA 1SJ9A 2W6IA 1SVOA 4KN9S 5DX1A 5H7XA 3OA0A 2CYAA 1KL7A 2RGXA 3BMCB 3TLJA 2HZ7A 2KFUA 1M33A 5EVJA 3N5CA 3VO8A 4D57A 1BN6A 3N86A 1VFPA 2NM0A 3NHPA 4M98A 5DV9A 5ES3A 4BQSA 3R0JA 4CLHA 1PFVA 4Y6SA 1D0IA 4ZAGA 1AHHA 2OSVA 2WDPA 8OHMA 2P9QA 4FEAA 3DMGA 3IKJA 1B1CA 1HF3A 2G76A 2I2WA 3DYIA 4HQOA 4KQEA 4EVIA 4EH1A 3RS3A 4FHZA 3L6CA 4QTUB 5HK8A 5IX8A 2HJWA 2OVBA 1UADA 3P26A 2AFIA 1UJCA 3KEQA 3LI2A 1FXUA 2YY6A 2WZCA 3L7BA 4W5JA 5CT4A 5AJHA 2YMPA 5EHQA 3DE1X 3U3JA 3W5IA 1AZWA 1X1SA 5BYJA 4C6HA 1CNEA 3RC7A 1IBKB 4HD8A 3AOEA 3E2IA 3GJRA 4AROA 2X40A 1WB5A 3RUCA 4B32A 3FRJA 4MJLA 2VSOA 4PS1A 5TC4A 4DIFA 3V8PA 4DMHA 1D09A 2RCNA 2BF4A 1LI5A 2WMDA 2O2EA 3QVKA 4RSMA 2O0HA 5H80A 4DKJA 4DRXA 1ESCA 1DP4A 1YA8A 1ISRA 2O8BA 2Q1YA 1XZLA 1IDOA 4JMPA 5WRFA 1YUMA 2N75A 4F9EA 1V25A 1UXIA 3AG5A 4C0JA 2OV2A 1UJ6A 1THMA 3U4AA 1KHHA 2XUGA 1FPQA 1TYDE 2BH9A 2D74A 4E46A 2G9ZA 1X7YA 2B94A 3Q7RA 1J06A 3HNOA 4LQLA 2WA2A 5CUQA 3UPTA 3A1CA 2WTBA 4JBIA 5IWCA 1VHTA 4R40A 1B0UA 4Q37A 1PJ8A 2N9UA 2SBTA 1UDCA 1BC5A 1BEEA 2COEA 3WLIA 3TZBA 5K6AA 3I1JA 2FUNB 3FSEA 4UU7A 1MVOA 2PN1A 4MEJA 4B76A 1KWKA 4IINA 1IJFA 4L4YA 3JWJA 3HGTA 1F7VA 2H63A 2XA1A 7ABPA 2JW5A 3A6ZA 3JAWA 4RY8A 4DNQA 5J58A 2DSTA 4FIZA 4CEIA 4NMXB 1JR3A 1U6IA 1GDTA 3IPYA 1Y7PA 1L7NA 4KQHA 4QHSA 1F5SA 3CLTD 4FR2A 5FFNA 3SXJA 2ZJ6A 4D8XA 2M6RA 4B3DA 5LZ7A 4LZNA 4JV5B 4CR6A 2L0XA 2PQ6A 1HZZA 1AKUA 5A9SA 1Z07A 4QT4A 3LE8A 2G0NA 3HCBA 2OV4A 3LQ2A 3ECCA 4ROSA 1MV8A 5I51A 2MR5A 5CJJA 3V8QA 2N3ZA 3HZZA 1MB2A 2ASEA 1YZ3A 1E5DA 4QELA 1W5SA 4GKKB 4DG9A 1SVSA 1MNAA 1ZH4A 4BCBA 3KLPX 3U13A 4J0QA 4EGSA 3O6VA 3FBWA 3L40A 5C1PA 1OTHA 2VXCA 3QLVC 1NVKA 2KMLA 2JG3A 2RGAA 3MT8A 2AFHA 2PCJA 2R1ZA 4MQUA 4QU9A 2Q4DA 4BECA 2FW6A 1W6RA 4NLLA 2A92A 3DLPX 3IRVA 4XKJA 4B9EA 3DVRX 3EPPA 1DBPA 4FHFA 4G4SP 2NUTA 1KR2A 1EFRD 2WYUA 5CLHA 3T5MA 5JJKA 2VBIA 4Y9UA 2RGCA 3HUFA 3HYSA 2HYIC 3FMGA 1TYZA 1W94A 4KVGA 4BGVA 4F8YA 3Q87B 1Z88A 2AYZA 2HK6A 2X6RA 1CJBA 4ZU6X 2H54A 3WV4A 5BSKA 4OHRA 2WM3A 3KOWA 3C3WA 1QXSA 2EX4A 3D6HA 1XWFA 3IV6A 3PT9A 4OHVA 4OATA 5THQA 5I9BA 3RD5A 5CFMA 4UNIA 3U17A 3P20A 1SVKA 4NE9A 3ZH2A 3TZEA 4YLYA 1XPRA 3GLKA 5F64A 4PINA 3ZYZA 3CEPB 3K3PA 1T2VA 4C1BA 4CDRA 3LKVA 1DL5A 3MQ4A 2NSJA 4UHCA 2JJYA 4N6NA 1RMQA 3QW2A 4WFIA 2FUCA 2JDIA 2VJBA 3UIEA 3TAXA 1YFJA 1DAGA 4GUDA 3VUFA 1TUEA 3N58A 3E7DA 4M9QA 2WWYA 3NYIA 1Z0IA 4H60A 3GAMA 1K8RA 4B80A 1P73A 3NTQA 2OT3B 3FZNA 2OBFA 3ITKA 4ZVMA 3LT4A 3PTLA 7MDHA 2G70A 4XB1A 1C9MA 1U9YA 3FDFA 1YO6A 1ZQ1A 3LO8A 1RM3A 3ABIA 5KOJA 1PJ3A 1RIIA 1DU4A 4GT1A 4I8IA 1UXGA 4J7AA 3TW6A 1UUFA 1P60A 3ADBA 2DMRA 1VMKA 2CMKA 4MA4A 1IN1A 3CONA 4BJ3A 4O3MA 1JDNA 2GK3A 4QFCA 4AZSA 4DCPA 3MT0A 1YZNA 3AINA 3GF4A 1EVZA 3M1YA 3USCS 5GZ6A 1ORRA 4E94A 3E48A 1ISMA 1E32A 5KKNB 6ADHA 4EHIA 1WA5A 2Z5GA 1ZNXA 5IAGA 1W4BA 5B7QA 4IGFA 2KPOA 3SYKA 4BCDA 4OF4A 4PO9A 4A16A 3KM0A 4AJJA 1SO8A 3QEMA 3IA7A 4DJEC 3CKKA 2EP5A 1X3SA 1X7YB 5D7BA 5E9AA 4YDQA 4CLRB 5J1SB 3BYZA 1TZKA 1XT6A 3ESAA 4O4IA 2H1CA 3RB8A 3VRHA 4YRGA 4BP8A 1YOVB 2W8ZA 1Z4IA 3I62A 2W90A 1L8AA 3RS8A 4O25A 5GVRA 3OQMA 3A9VA 2C7OA 3QLVA 1Y4SA 3FUCA 4P0PB 2XXAA 1SHJA 4P7BA 1TPZA 4C6RA 2LCIA 3DVSX 3GXOA 3BGSA 5BR1A 1VL5A 3CE6A 4R1NA 1KK2A 4CLOA 3QPDA 1GZ4A 3VGJA 3LPMA 3NPMA 1CK4A 4E2ZA 5JAZA 2P2YA 4COKA 5K0EA 3MK31 4FVTA 2FZGA 4BWGA 3L4KA 1ZNYA 3Q3HA 4X94A 2X1LA 3BE6A 5AKXA 3TQTA 2XI4A 1UAYA 1TQ4A 3PF9A 1XKLA 3Q10A 1XXHA 1ZSVA 4TMYA 2G77B 1SULA 3FTQA 3QNWA 3EIWA 4RD0A 4RD1A 2YWXA 3WWEA 4ENPA 3B1KA 3OPYI 2BP7B 2ZSKA 1VJ5A 4HEHA 3FUTA 1OI3A 5D6OA 3QYPA 4E88A 4EITA 1AZSC 2RC5A 4O6VA 4L85A 3JZMA 3M9LA 1GKLA 4D41A 5BR7A 1GQFA 1QGED 1FFWA 2ACKA 4N5NA 4Y2TA 3PRJA 4BZZA 4OHFA 1FQJA 2YN0A 2ZBPA 4BZWA 4DLKA 1U8AA 1W2HA 1RBYA 3A6DA 4IVRA 5JMOA 4M8LA 4MKZA 3FKJA 1VE9A 2E5FA 1A95A 1MXFA 2GSWA 4IHQA 4C0HA 2FA9A 1F3OA 2NUTB 1N0UA 3OT1A 4L72A 5GM2A 2A5JA 1R10A 2W11A 5BUZA 5I5GA 2PTHA 4OGFA 1QVRA 1C1HA 1UBKS 2I1QA 2EJTA 3OQBA 4OAPA 3L7MA 1Y8RA 4ARIA 2V4ZA 1I01A 1JJIA 1UMCA 2R2AA 3I9NA 1FNCA 2I71A 2DOKA 2QB5A 2I3AA 4Y7CA 1ISHA 3KDSE 3RASA 3SF8B 3IQXA 4CFYA 3FVTA 4ECEA 1UT6A 4I99A 4MW7A 3M81A 3UB3A 4F3YA 2ISQA 1TQHA 3DONA 3UXYA 4AUKA 2CF6A 2HWYA 4LKOA 3SFVA 5ERYA 3IDQA 3TEJA 3HR7A 1XGKA 1KOGA 3ELYA 1TAHA 4C6TA 1P2VA 3M5PA 1G4UR 4CE6A 4ZK6A 1Z6PA 4OX9B 2JAXA 4ID9A 4M46A 2QL7A 2CZQA 1RE0A 2WF8A 5B3KA 3ACBA 2AEEA 5E2AA 4LWZA 4R7GA 1EBUA 3QU4A 1IUNA 3G0IA 1WULS 2PT6A 4X3PA 2AZTA 1RQ7A 2VNKA 4FD3A 4P4TA 1NYRA 1RACA 2V6IA 4W6ZA 2IEIA 4JYAB 3U4GA 3F5QA 1V3TA 1ECBA 2J6IA 1GEEA 1QSGA 4BQPA 4E32A 3QKSA 2UU9B 2FWAA 4C21A 3WGKA 4S1OA 1T6NA 1ISJA 1XQYA 3E9NA 2YV4A 2JCXA 3HYNA 4RDXA 1N5LA 1DRKA 1LWNA 2XZDA 1QJCA 4FGWA 2XMZA 4FOTA 1PR9A 2J4FA 3SP1A 3TZCA 4H35A 4QULA 4IOJA 2EDAA 2EYQA 3G59A 4LGMA 4MI6A 2IZ5A 4EQZA 3T0GA 4BLPA 5KIAA 1U0OC 2XTZA 3KT0A 4O4JB 2H4HA 2J87A 3L1KA 2VFAA 4U2DA 5IBRA 5BQPA 4DT1A 6Q21A 5DSZA 1TGYA 3PUYA 1BEUB 2QAGC 5DYGA 2Q5EA 4IJUA 3DZHA 3ZDDA 2XF8A 1PFWA 4R1SA 4WKOA 4QOEA 5J63A 4B17A 1GN9A 1OI7A 4Y67A 2Z2KA 1VLMA 3RKSA 2XCQA 3VR6D 4GL2A 3QE9Y 3FVQA 4O4IB 4D79A 2RJ3A 5FYQA 1OKKA 1YQDA 1EVQA 1H2YA 1EX1A 5K8TA 5JSHA 4YJ3F 3RGWS 3AHEA 4WLUA 4J7XA 4V0KA 3RU2A 3E7FA 2VSYA 2NACA 4N7JA 3G6KA 3EXFB 3Q7SA 1WP9A 4M1QA 5JLAA 1H8ED 2WFMA 3UT0A 4RIFA 1BGVA 2JGEA 3SICE 3W04A 1ZOQA 3NYRA 2YFQA 3VAZA 3WE7A 4FK8A 1EBFA 1DO2A 5ICSA 2OTCA 3BK7A 3DCJA 1VIYA 2DHRA 1F60A 2E6KA 2BZ1A 3IT1A 3G0DA 1JHPA 3DL7A 3DYVA 4RORA 5H1YA 4DLYA 2ZYUX 5BN5A 5BWMA 5C18A 4QVIA 1XXHB 3SR0A 4RL4A 2XVXA 4EYGA 2PUVA 3R20A 4MR8A 3SFTA 4PNEA 3PKZA 3N6XA 2F3SA 1E5TA 4DCUA 2F9LA 1NVGA 3RYIA 3QELA 1SRRA 4JUIA 3ZLJA 2ATXA 1DV1A 5IJXA 3UAOA 4ZZ0A 4UTVA 2LUOA 2Q4OA 3EGXA 4AUEA 3LS2A 4MI1A 1IQPA 5FJJA 2OUIA 4IIGA 5DOZA 2XNSA 3UHAA 4M89A 2LWIA 4DCVA 2B61A 2PTGA 1DKMA 1P77A 2WUWE 4UQLA 5IYZA 5E4JA 1S3IA 5IDXA 3CU5A 1VGRA 3AWIA 4P4NA 3SYTA 1ZH6A 1OXKB 1T5LA 3G8YA 5E1OA 5EJ4A 5H5JA 4NJOA 4X1KB 4Y2VA 4Z8YA 5EVCA 1C9EA 3UMMA 3ANXA 4HGZA 1B6SA 3F3SA 1RYYA 2JCVA 4TGLA 2HRQA 5E8JA 2IV3A 1E4YA 2A67A 4LCBA 4O59O 5DH9A 3ZK9A 1KDVA 1Z5ZA 1LDEA 4EJMA 1ZNWA 1FL9A 4KXWA 4NMWA 2HGSA 2BOVA 2F7SA 2X5NA 3O8OA 4BRUA 3EASA 5CT5A 2X0DA 4XWKA 1UMCB 2R6DA 3OP1A 2C9CA 2HSEA 2OXRA 4KDFA 4Y6QA 1UBGA 2RK4A 5CXSA 4LJ6A 5TS3A 1WCYA 3UATA 3OPVA 3SIXA 5IHPA 1OQAA 2FQQA 5HUQA 4EI2A 4A0HA 1N6LA 5CD1A 1IBSA 2WUGA 1C1YA 4XIIA 4C6TB 3E4DA 3EZYA 4D8TA 3L9WA 3O4FA 4V1CA 1QIHA 1WDMA 4BWFB 1BXRB 3A27A 4HEA6 2QNRA 1HE4A 3ZE6A 3RRXA 3BN3A 3MCZA 3NZEA 4TLDA 5I7EA 3ZWDA 2IS1A 4HNVA 4JFRA 5CB4B 1JKMA 1U7VA 3OLXA 4RXTA 2LC1A 1L5LA 2FHPA 3JAMA 3EPKA 1EJ2A 3HUTA 3MJSA 4NESA 4ZAVA 2BC9A 3OTGA 1R6UA 5A6SA 3NC0C 3F7TA 3R1IA 1GG2A 3LRPA 4YECA 5B1DA 3THRA 5KVVA 5G3ZA 3K70C 1ZW6A 3QEJA 1PBNA 1JQAA 2HXGA 5DX8A 4YQEA 3IC5A 3T35A 4G1UC 3QX3A 1H65A 1RC1A 2BFFB 3E3NA 2YWJA 2EWMA 3OJOA 1H9BA 4HNSA 4RK5A 4XCQA 4F4CA 3MT9A 4CL0A 5IKPA 1RI1A 2DGDA 5T3YA 1PD0A 5C81A 4E07A 3KC2A 3L84A 2OAP1 2J0UB 2ZWMA 4ISBA 4S1NA 4X44A 5H70A 2FE4A 1LJUA 2GEKA 3Q8LA 4REMA 1Q0ZA 3EBPA 4OMCA 1JZQA 1EQUA 1WDLA 4IKEA 3ROKA 2XWPA 2ZZKA 2YVUA 5BMVF 1TCVA 3GQSA 1QX3A 3WYDA 1JHOA 2F64A 3RABA 4UBKA 1XUOA 1J8YF 4GICA 3WGLA 1ULZA 1JAZA 1GGKA 1SHUX 1RRMA 1WXHA 2QROA 2W2LA 3DE3X 2QEQA 3HDHA 4WEOA 5DEIA 5H81A 2E18A 4XFJA 4DTCA 2MDTA 1QBKC 2GARA 1NWHA 3CZCA 3RADC 1BHSA 2JQLA 2C00A 4AJIA 3LBNA 3GJXC 2W3OA 1NE2A 5G1PA 3PFFA 1SVMA 1O58A 2NZWA 3NGXA 2PMCA 4Q4HA 1VMAA 4QLBA 3WLAA 2D6FA 2OBLA 4YAEA 4DF3A 3IEPA 4RMNA 1ZL2A 1U99A 1H22A 3JY6A 4FHEA 5I45A 3FFTA 5D3MB 3EF1A 4F4DA 5TIIA 1NAHA 2Y1XA 5EHNA 3FKSA 5BN5B 4DVJA 3BE8A 4WGGA 2DKOA 1UBCA 1UL1X 1YRAA 3QGMA 5IDVA 4RH1A 1I4TD 5DXFA 3L4EA 2HB6A 1RFGE 4BLVA 5J43A 3GT0A 1E3WB 1M34E 3AEKA 4B2LA 5DYNA 3HYRA 2QQGA 3WGQA 3QELB 3NHLA 5LD2B 5CB8A 1Z38A 2X9LA 1N8SA 1NR1A 5CXXA 2QTFA 4IKPA 4DADA 2ERYA 3EGXB 5IVIA 4ER5A 2EH0A 1YDGA 3BD7A 1NN3A 4RVHA 5DTJA 1XRLA 1CR6A 2JIOA 3DH0A 4FINA 3ZW8A 1J0EA 3QP9A 3CR8A 3STTA 1EZZA 2JFUA 4BJ1A 4E5MA 1HI9A 1A4RA 4RSGA 3HV2A 4M4SA 1ECPA 1L4MA 3WJ7A 1E3DA 4AO7A 3IEUA 1YKFA 5JANA 3H9JA 3LP8A 2Q0QA 3P5BA 1JG4A 5K03A 2F3RA 2D2IA 4CTNA 4EFDA 3L43A 3I9JA 5AM4A 3AVPA 1RLUA 3DHWC 1AURA 4RL6A 4NV3A 4EW1A 3OBIA 1LPMA 3THYA 4BRZA 2ADMA 4ETIA 1G8MA 2B1JA 2YVLA 4GSKA 3WLOA 1VJ1A 1J7JA 2X3FA 2BMAA 4GBED 4PAOA 4TXLA 2EWWA 3CM0A 5ERGB 1K98A 3S2UA 4JN6B 1NUHA 2N1BA 2I7DA 2Z30A 3CUWA 1S8AA 3A9CA 3S4YA 2DUWA 3SKYA 3JVUA 3PEVA 1S96A 1OFUX 3MRSA 2QAGB 3CH4B 1YASA 3KJZA 3O1LA 2AEFA 3WLRA 3LY9A 3NOQA 4CLEA 2P1ZA 4JENA 1YRLA 2H5JA 1NG9A 1GVHA 2GHTA 3JXEA 1U6KA 3R5XA 4R9RA 4I19A 1U7VB 2HA7A 1JHAA 2XR1A 3BQMB 2OXCA 4OJYA 1LGPA 3HP4A 3Q9UA 4IZ6A 3CH7A 5ELMA 2J3DA 3TJRA 3GLGE 1JDVA 2O7NA 4YIHA 1JHQA 4JODA 2XJ9A 4LMAA 1DG3A 4E1BA 3I45A 1N2HA 1ZKDA 3A6KA 1M83A 5BUCA 4X65B 3USZA 2O8CB 2C31A 3ADPA 1CRWG 3P27A 3VNBA 3AP3A 3N8NA 4N01A 1TTHA 4V0QA 1JHVA 5EP1A 3A3PA 3GUCA 3L04A 2V65A 2Q1SA 4MK4A 4B45A 2WV9A 3IOYA 4JT4A 2Z56A 3C45A 1XJWA 2F1KA 5BT9A 3ZHBA 4EECA 3TG8A 4Q1VA 3WLQA 3SVZA 1JXQA 3ZI4A 5LB2A 5TQJA 3SHTA 3ZHYA 4JUBA 1I2BA 2AX4A 1Q0TA 1G9XA 2Z83A 5FKJA 2XCSB 1MA3A 3AB7A 4MV0A 1ZS9A 3KU1A 3F47A 1SURA 3CF0A 5BW8A 2G1AA 2LDBA 2X5JO 5FNZA 2YASA 1BDIA 5JG7A 1QIKA 4PFJA 4CODB 1ZWLA 3RLIA 4MJ3A 2AOVA 1BGWA 4H17A 4CUJA 4MUJA 3RVQA 5TJ9A 4MS3B 2IHNA 2NU8A 3VDNB 1DMRA 2W43A 4F2HA 1JW9B 1PJRA 3AF4A 5GWXA 5H68A 1GA1A 3ZW9A 2GUGA 4LDRA 1QJ4A 3CO0S 1TO2E 4E0BA 4FD2A 4A4YA 1M76A 4DIKA 3O21A 4RSRA 1AQUA 3AUSA 1QRRA 3VDRA 3UUFA 4RLQA 1ISIA 5IW8A 4XFKA 3IPRA 1AGRA 4L8WB 1FTYA 3S81A 2I2XB 2I6GA 1WXXA 1CZNA 3C3EA 2H0AA 1A82A 5SZKB 4UBLA 4PQYA 4Q05A 1U0BB 4F8JA 4GE0A 4B79A 4BMPB 1NAIA 4CNBA 2QD4A 4F2WA 1V47A 4BPBA 4GRAA 3NHRA 1BQ4A 3SLGA 4MDFA 2WF5A 2RAFA 1NUSA 4WA8A 2QL5A 3Q6NA 3FPAA 4M60A 4OQNA 3MOGA 1E5XA 1Y1PA 2C0CA 3OIGA 2ZJ4A 1V8BA 2YXDA 4AFNA 4G67A 4D44A 5BOSA 3HI4A 5K8UA 4YCCA 1P4RA 4V3BA 2PUWA 1U1GA 2JANA 1PQWA 3PQEA 1S9DA 2R96A 4KR0A 5BUQA 5LLTA 1FUIA 3DOEA 8ATCA 1Q91A 2VF5X 3IR5A 2DUJA 4UU0A 3CRQA 3STVA 5KS2A 1V37A 2GOYA 2HU7A 2NU7B 3GJ8A 4NYJR 2B21A 3NALA 1X0XA 5FTWA 2CXRA 3QU9A 2WM9B 4OQFA 3BGVA 3NBZC 3H3FA 4I9UA 5CEEA 1S9HA 3HCWA 4DA7A 3R9KA 1M6YA 3NAMA 1PKEA 1M6HA 1V39A 2H59A 3V1YA 2ZI3A 2C4HA 3B9PA 4H7FA 4QYXA 5KYUA 1T1EA 3Q8WA 3HUEA 1ISPA 2RJNA 4KE7A 1RD4A 4LV8B 4OI4A 4DPKA 3THYB 1CRPA 1XPUA 1II8B 5L4SA 3VKHA 1H05A 1NSFA 2OXFA 2ZR9A 1KC3A 2J3QA 1QK3A 2O2JA 3MGBA 2HKIA 4XIFA 5C8YF 2FTKE 2WG2A 1UBOS 4TS9A 4GPEA 4HVTA 3CNHA 3W5SA 2ORIA 4D25A 1GD1O 1HG0A 2Q6IA 3EDYA 3H6GA 3JQAA 3U44A 1H6AA 5EZ5A 3ZE8A 1K3QA 3DO5A 3UWMA 2GZ1A 2VJMA 5ALJA 2Y0EA 4W1QA 3REQA 1ZI6A 4LKRA 1OX4A 3EIXA 5BV7A 2MSEB 2RH5A 5HYVA 4KJZA 2YY5A 4UPVA 3W6PA 5CLIA 2AWNA 1SN7A 3W2FA 2FWPA 4MEAA 5JS2A 1T3HA 4MRRA 1W4LA 3LWNA 1KJWA 1OWMA 1Z7YA 1S1CA 3ONVA 4FFDA 3DHVA 4OSPA 3PXDA 4I50B 3TWOA 3KSUA 2G5CA 4R16A 3ZJ5A 3RAPR 1JN0A 1BQ3A 4XYMA 3MUNA 3Q12A 1N77A 1VG1A 3VV3A 1SKMA 1X8XA 5A4IS 2O3TA 2ZTSA 1X1QA 3DF9A 5JRDS 1HRDA 2C4WA 4QO7A 1WZUA 4IRXA 1GFWA 1KBOA 2ZWPA 3QLUA 4NMLA 4R83A 1RLIA 4BLRA 2PSEA 1LC3A 4X1OA 2H4JA 2PH7A 4CQMD 5IJ9A 4Q4AA 3HXMA 3ABRB 3GWZA 4QAQA 2J67A 1FMCA 2WPDD 4F5ZA 1ZGGA 3TLAA 2W2PA 1U2GC 2AD1A 5CDGA 5L3SB 3SJ7A 2HV9A 3WYGA 4UCQA 3S1LA 1YDFA 1GLVA 2HF9A 2WF7A 4DMGA 4EI8A 5K45A 3OUUA 5AD1A 1BCRB 5F1YA 2WJWA 3M8KA 4HDAA 2RH4A 3R7WA 1D5WA 4EP1A 1QX4A 1EVKA 2XVAA 4LHVA 1P8AA 5AI5A 3FNIA 1UF9A 1G8KA 4QQNA 2JA1A 4OKIA 5BSVA 1ZRHA 2PD4A 4EEKA 1I1HA 3CCCA 2PYZA 1T9GR 4MRVA 5C1BA 1NPYA 1K7XB 5AHKA 3RSOA 5LNK6 3HA2A 4HTAA 4ZI7F 4IVPA 5DULA 2GEDA 3NU1A 2PZLA 3GDWA 3HHEA 5JRZA 1NWCA 3TSCA 3OFVA 4Q00A 4R9UC 1QU5A 4R8VA 3UJBA 1ZLXA 4BNNA 1DJQA 4PTYA 1E4EA 1SBNE 4QG3A 5BWNA 1A9OA 3A05A 3PDHA 5SYAA 4EZIA 1QANA 1TA9A 1C30A 5H82A 4PSVA 1HT2E 2QV0A 1COWA 4ZXFA 4HQRA 2W6JD 3ZLUA 2X14A 3DBVO 3TDKA 2PKQP 2XY4A 3UJPA 4KE9A 4OJQA 2B9VA 3P9RA 2FMKA 4GMHA 5CH5A 3ICEA 4E5UA 3TD9A 1YU9A 2E55A 1AK2A 3MJFA 4XWYA 1K68A 4NYMQ 1JA1A 5KYGA 5KBYA 3KXKA 1N33B 4MDYA 5IF9A 3EGEA 2E37A 4S24A 2H2GA 4DHWA 2VYND 4HO1X 4KFTA 3HV0A 2XYRA 1AUOA 4BO5A 2XBUA 4LY9A 3OKPA 1N5DA 2G5PA 3BXPA 3F7NA 3H4TA 1I10A 1EHIA 2A7QA 5IXYA 4U6SA 1YD7A 1MJNA 3NAQA 3P9IA 2ZS8A 4HGRA 2DT8A 3KAKA 3OCYA 5BQXA 1O9GA 1W8IA 2J6BA 4EG4A 3X1XA 5DGXA 1K7CA 4RU1A 3SAJA 3PUVA 3QXHA 3RF7A 4M0KA 4YAFA 5DK4A 2PH3A 3L7DA 2CLMB 4O2AA 1RI4A 1SC1A 4IDPA 5D5PA 3A58B 1GDHA 4Z5XA 5BY2A 2IYFA 4QRDA 4YDRA 4L5BA 1SU8A 2FKNA 4UXJA 1WR8A 1LFAA 2DQZA 2WP8J 1XP5A 4AP5A 4FFWA 2NNLD 5H59A 3PT5A 2ZKLA 2M32A 4PG4A 5KJCA 5KNDA 4MUXA 4XTCS 1WLNA 3KYDA 2VWHA 2ZROA 4GM4A 4I5IA 4V39A 4XJSA 5HIIA 1QBGA 1T3ZA 4JXJA 4D9GA 2ZZMA 3SJCA 1RQGA 1ZIYA 3G68A 1DIAA 1HYQA 2F3PA 3MWDA 4RZHA 1D4FA 4CL3A 2GPTA 1I7NA 2OLEA 4LS3A 2H00A 1GYRA 2FPGA 3IQWA 4R01A 3LQFA 4XGNA 4D4LA 4QSHA 1RT9A 3AKDA 3I09A 3FB1A 3MGGA 4WN3A 1MC4A 1QPZA 3A4NA 3D81A 3EXEA 1SOAA 3NOVA 5DJ5A 2IX9A 4QBIA 2GASA 3DQZA 4AUMA 1YS2X 3BFXA 2P78A 3OLWA 4UUPA 1CULC 3SYNA 1OBCA 3GYGA 3OE4A 4RM3A 3TMYA 1GR0A 1ZOOA 3RAJA 1ORHA 3FLBA 3OJWA 2AJDA 4URHA 2YZMA 3JPWA 5KYTA 4IJQA 5ALYA 2UZ3A 4FNGA 1XVLA 2UYYA 2KI5A 1W30A 1AD2A 1SKYB 2B6NA 4GR9A 1P81A 4DY6A 3EA5A 5FPSA 3WA6A 1KIAA 5P21A 1KEPA 1QGUA 4M87A 3R7LA 3SD7A 5JARA 1YUBA 4ZFNA 2JEYA 2EZTA 4JJEA 3WLKX 2AMYA 4AZWA 1AOXA 1XOIA 2IZOA 2C8LA 1OYYA 2A9PA 3F5SA 3R2JA 4EHAA 1VMEA 2ECFA 2V7WA 3EFOB 2LE0A 3IKTA 5CEFA 1ZONA 1VRVA 1XN4A 1U8TA 2HL6A 2IUYA 2AG5A 3DFKA 3CF4G 3KKMA 2AJLI 3KTDA 3L6RA 1S7GA 4UUQA 5D3ZA 4A5SA 5FLYA 2G1LA 1F2DA 1P72A 5LU9A 1T5IA 2ZS7A 3VU9B 2PDAA 3AOGA 1ND6A 4RF4A 1T9HA 4MIEA 2FSVC 2RHHA 3GUUA 1F38A 2D5AA 3M4YA 4Z9XA 4BBZA 4TYNA 2OV1A 1T8YA 4GLLA 3EVTA 4NCNA 4A7PA 1WZIA 1MOZA 2NAPA 5CA0A 1B26A 1UQRA 3MTQA 5BVGB 2B7LA 3IQFA 2I67A 2HH9A 1NNUA 2FMIA 4MYRA 1EUYA 4AI6A 4AYWA 5EWJB 1GTMA 3FRIA 4M0UA 4MGEA 4BKRA 5FAXA 1OPRA 1IRXA 2IXFA 4YBRA 1W52X 1OROA 2IY8A 1EK6A 1GQRA 2Y92A 1CIJA 1HYHA 5M04A 3O38A 1XD8A 5FNVA 3IBYA 1PZMA 1P29A 3ZTYA 2O7VA 4KITB 3IQDB 2WWHA 1WKBA 2XOEA 4KXFB 2IYEA 4FWTA 1OX5A 1Y37A 2COKA 3ACDA 3ZHRA 1NF2A 3T7JA 3G88A 3Q1LA 3UHOA 5EE3A 4LF5B 1KZYC 1VBNA 2P65A 2XUIA 4G5RA 1DUVG 4OBWA 1VYVA 3CKLA 4HS4A 1SD1A 1RJWA 1WVIA 4J1TC 5AKHA 4F56A 5C7OO 4JKIA 5IJWA 2IKQA 2GXQA 1MO2A 4X97A 2C7PA 1G18A 4HLCA 5DBFA 1R8QA 3FIJA 5E8RA 3V4FA 2JIZA 5JQGF 4OP2A 4MV8A 4MA5A 2RH9B 3EMBA 3IUNA 3MCAA 3T5AA 7REQA 4RKFA 3FPKA 2V03A 1VYTA 2XE4A 2Z6VA 4YJ2F 5BWLA 4XDZA 2Z1DA 2Z57A 3ZVNA 3OEHA 1JAIA 4C5AA 2KB4A 1NFQA 2GA8A 1X86B 2O07A 3CRZA 3CURA 3EVNA 4NFLA 4ZVQA 4Q12A 3ZV7A 4L8GA 2VP0A 1N9ZA 1JV2B 1KXZA 1B41A 1PQYA 1RPTA 3S7ZA 4B3XA 3HEBA 3NOOA 2X1HA 4CF4A 5DNCA 6YASA 3MWDB 1YZHA 3HJAA 2J41A 4DLLA 3UCEA 4CIAA 2FCRA 1RKQA 3QWFA 4UUAA 2R8BA 3ZN2A 3H83A 4QJIA 5A4MS 4IG9A 2SKCA 3C97A 3MBIA 1BDMA 1NONA 1V11B 3IDAA 1NYQA 4FKZA 4M21A 3X2FA 3ZCSA 4OFZA 3O26A 3GMIA 1T0IA 1L1RA 3OLYA 1QONA 1R1DA 2IXEA 1AUQA 4MVJF 5AJVB 2JLWA 3TKAA 1LQ2A 1TFUA 4FR5A 1CUYA 2KS6A 2BTQA 4Q1BA 3TOVA 5AW6A 3QFSA 2RGGA 1EE9A 4JVSB 1RPNA 3L8ZA 3MBKA 4OQLA 2W6MA 3N9IA 1XROA 3VMFA 3U0BA 4KLRA 4NCJA 3NATA 5D84A 4FILA 2YXNA 3CG4A 1FBTA 4AF7A 1SAYA 2G4CA 2BR3A 1ITZA 2NGRA 3GD5A 2YWRA 1GU1A 2W00A 3RFXA 4LE1A 3U60B 1I3LA 3THWA 1F6DA 4QBFA 5REQB 3ES9A 2Q62A 3SZ3A 1Y34E 1EHCA 1HLDA 3IPLA 1EX9A 3CUVA 1KPIA 5A3JA 2B2XA 2I4MA 1LK0A 2RGWA 1ESZA 1A9SA 3S2GA 2YMQA 4A8JC 5JOQA 2FP4A 3MS4A 3QUBA 1XVTA 3BULA 1NQAO 2BL4A 1HFEL 3BSFA 2O0JA 5KQRA 3QUCA 3SF0A 1W85A 3L05A 5HE9A 3W8FA 5JZ9A 2PX4A 3QRWA 2BKLA 2PX8A 4JLUA 4BVHA 1EK5A 5EINA 4X20A 1C4WA 2OG2A 4HAVA 5DBOA 4A26A 2HIHA 1F20A 2RIPA 2C5EA 4JIVD 1FJ2A 5FBKA 2D5BA 3NAZA 1NMQA 1JP7A 1K5DA 1N4DA 1W47A 2MTBA 1P45A 2PJUA 4J1TA 3SYMA 1P7VA 4AXBA 4F38A 5AVXA 1IK4A 2WHRA 3HM9A 2R8EA 4OQYA 2QXUA 2QD2A 2FUG6 5CURA 4A4DA 1DARA 3P2IA 4IV5A 4UOEA 4D8WA 4YY3B 1CY4A 1LPAB 2WHYA 5JCJA 4KEAA 2GDZA 1NI4B 1B23P 1SCUB 4J4BA 1M7BA 4B6SA 4RLHA 1XCGB 1BO6A 2HY7A 2WFAA 3IAFA 1EFUA 2GAIA 1VLVA 1VLLA 5CDYA 4JJZA 4GMGA 4PSAA 2F3UA 5FNVB 4YONB 5AW8A 3T12A 3TBHA 2UYGA 4UMDA 3CRVA 4K26A 5FR1A 1NGSA 1EUCA 1NW8A 2XZTA 4NU6A 5K0CA 1PK8A 4CHGA 2VTBA 1KS9A 3P9XA 4R84A 1C2YA 1ISGA 3R0ZA 4G1VA 4Y2JA 1FU4A 2W2MA 3NTOA 3V2GA 4HQ0A 4KFRA 4B9AA 2VZ0A 5LP6B 4WXEA 2YJ4A 3PJDA 2ODTX 1M2OA 1L5RA 1E60A 1YQXA 2ACWA 4YMHA 1A9QA 1BCSA 4F93B 3DULA 4KX5A 4KO2S 4X84A 2IOFA 2J5QA 2HMSA 4O8ZA 2V3WA 2DCMA 1Q0SA 2C88A 1L7VC 5DGCA 4KIFA 5DLDA 5FLXA 2IBTA 4OHBA 1D9ZA 1C0EA 1P1KA 3DEIA 1SVIA 4RTLA 3RIYA 3A2MA 3WBBA 2J5KA 2XA2A 3PFGA 3IV9A 1FNMA 2GF9A 4JXKA 7REQB 3KT9A 2E9SA 3LHIA 2B2NA 2IGTA 4AWXA 4COOA 3ZEAA 2NVWA 3LOUA 1OF1A 4U7WA 1RKUA 2PIAA 4EF5A 2FLWA 3IP5A 5K0NA 4B43A 1QHNA 2ZUUA 3FCSB 2VDOB 5E7QA 4X6LA 4E30A 2VP2A 1KEZA 4QDZA 2LCQA 3TKLA 2CLKB 4CJXA 2PBFA 2PV0A 2YFHA 3F6YA 1QV9A 2QENA 1UM8A 4IIHA 1M7HA 3NP9A 2R84A 1KQPA 5ADUS 3IEVA 4PAQA 3KAQA 1QAQA 2QQ5A 2AKAB 3GPCA 2P4QA 1FOEB 2AJCA 4AICA 3TW8A 4A8JA 4KH1A 2EG5A 3Q0EA 5CTAA 1JQDA 1NVEA 2W9XA 4HAYA 2PQ2A 3SYLA 1O77A 3Q3IA 4HV4A 1FFCA 2WWGA 1Z8DA 2Q6LA 2P11A 3CN7A 3EWSA 2LP4Y 3MWEA 5ILOA 1R8SA 2J8ZA 2PKYX 1G7CA 4ZVRA 1XELA 1E64A 1NOJA 3A1SA 2BTQB 5AKJA 3SPXA 4CFSA 1J4AA 1JF8A 2Z4SA 1YE8A 3BGWA 2BJWA 2VJKA 2TMDA 5F3RA 2BZSA 2GEUA 3JATA 4L0QA 3M89A 4GI5A 1IN6A 4TUYB 5DLQC 3IMCA 3G8AA 4FYPA 5HOEA 1YJMA 1V35A 2WSSA 5G0TA 4ABTA 1KJYA 2ZANA 1ACMA 3H5WA 1S2NA 5E2BA 3GEIA 4V1CI 4CW7A 3UPUA 2BF7A 2UVPA 1J25A 2YWHA 1JEOA 2CMHA 4EUHA 4L1KA 1N0WA 4JOCA 4CMEC 3WYNA 3GXBA 2RSLA 2VJOA 3ZIDA 2C82A 3RBZA 4DV1B 4L8YA 3LQ1A 4XDGA 4RD6A 4LRUA 1NP3A 4QFDA 2ZLBA 1KQOA 4OPMA 1T1JA 1QP7A 4FS3A 2FP4B 1DUIA 3ABSB 2AV6A 3LY5A 4QGGA 4YFVA 4EHDA 1EA7A 2W6ID 1QDUA 3FNHA 3LUGA 4G5XA 4P84A 5CNJA 1PG0A 4YRCA 3ET5A 3B38A 5JZSA 1RLOA 1TM4E 2A5YB 2H1HA 2IK8A 3KJNA 2XWBF 2VEDA 1UK9A 4GX2A 2ANBA 4TROA 6REQB 3LBAA 3UENA 1X13A 3UH0A 5FI5A 2Y1KA 4YPVA 1SRQA 4UEOA 3WAKA 5FA6A 1WV0A 2B35A 2JGDB 3ORRA 1E7RA 2BBSA 2ORVA 5CT8A 4MS4A 3SSMA 4I8DA 5C46F 4HEA1 3B9QA 1AMNA 1JFSA 1Z5PA 3IQIX 3SQMA 1SHKA 3RWBA 4G0MA 1QZTA 1L7OA 1NNI1 3Q7TA 4K87A 4BVAA 1VKHA 1PZGA 5D01A 5DI9A 4AN1A 4BFUA 2QLMA 2WU1A 1IWBB 1CEYA 2IBMA 5CIWA 4J7UA 4OB8A 1CUWA 1O3YA 5JWHA 3J81k 2AW3A 2BRUA 2RKWA 3KXPA 3N8GA 3UGJA 2R6JA 1RWNA 1ZK2A 3NDIA 3QXJA 1N5MA 3LBFA 4ZOBA 5JH7A 2BBTA 1GNQA 1K6EA 3ZBTA 1Q21A 2VTBB 3TO5A 3SIRA 4H1WA 2JLYA 1MORA 2VI5A 2R11A 5EG5A 3SC2A 1U1IA 4GM0A 4DL9A 3EK2A 4CQLB 3V00A 1P4HA 3DD5A 3IGFA 4OK5A 1NI5A 2R7NA 1BCSB 3RJMA 1Z7WA 1KSFX 1O94C 3IP9A 3IDFA 3MTBA 3OJCA 1WKVA 5M7EA 1A88A 3DOHA 4RLFA 4NJEB 2XMQA 3D2LA 4OLBA 2Q5LA 2WUVA 3K9BA 3LBHA 1KE2A 3NCHA 3SCZA 4ASUA 1LLCA 2FSUA 3OLZA 4UM9B 4MKHA 1H2XA 4FW8A 4XX0A 4O2RA 4QD3A 4I9FA 2HCRA 1G7RA 2HU8A 3CW2A 3N2YA 5D85A 5IJAA 1KVRA 1AUPA 1Z26A 1EGQA 1KHUA 1XWIA 3BEOA 5KNCA 1Q14A 5CVEA 3EXIB 4EY4A 3EXAA 3JZDA 1E9DA 2J46A 1YRQA 1JR3D 5F3DA 2PLWA 2VCEA 5CA1B 5JPDA 5LXTA 4CMEA 1UM9A 2A9RA 1ZHHA 1UKYA 1AS0A 3AW8A 1OFUA 1CJSA 2RHGB 2ZTHA 2O2CA 4QXRA 2PH1A 1YHYA 1ONOA 1TIPA 3MWGA 1SZDA 4A8JB 1F2UA 1W2GA 4BMNA 1JQBA 4HGOA 3NM5A 3BEDA 2ZJ3A 3DVAB 2C8VA 4DDMA 3GP3A 5TGDA 4ETWA 4MRNA 4F7WA 3JZAA 3NUGA 4QGHA 1Y3DE 2OCBA 3DFIA 3TTYA 1DQZA 4RVDA 4CV3A 3MYYA 4N7RA 4K0KB 1K6MA 3GUVA 3OHSX 4X7MA 4X63A 3BT7A 1NASA 1VJGA 1ACLA 2YWEA 1EX6A 3V6MA 3AR7A 2GVNA 2PMFA 3ZX4A 1AY0A 1QB7A 3OJFA 1BKYA 2DPMA 3F4BA 3LBYA 2XW6A 4Q6WA 2Q21A 2V54A 3DLIA 3IXMA 4RIEA 5C52B 4GWKA 4MQ4A 3T7SA 2X1MA 2G17A 4BNKA 3DDCA 1KKUA 1PSWA 2Z04A 4RX1A 4QXPA 5ECDA 4BMCA 2XRFA 4B82A 3W06A 4ZVVA 1EXDA 1C4OA 2N0SA 5EQJB 4FFBA 8MHTA 1ZD4A 3GC6A 2YXLA 4LBVA 4M8IA 3W3AH 3LDAA 2FRDC 2LR0A 1S8FA 2XUOA 4L4XA 4NP6A 1G64A 2DWPA 5IARA 3ZZMA 4C03A 3AZPA 1IB0A 2ZIEA 3RUAA 5K6RA 5CFRA 4QCJA 3KWLA 2QTZA 3KQYA 3NQ41 3HCAA 4ZMSA 1PN3A 3T1TA 1PR4A 1P2TA 1U9JA 3FETA 4XYGA 3OFJA 2H4ZA 3QI7A 5CP8A 4K9SA 1TLFA 4XVUA 4MR9B 4F84A 4XVQA 3FVVA 2JDID 5JY6A 4EAQA 5GY7A 1NW7A 3S6JA 3DBRB 1SELA 5CMLA 1GOTA 1O94A 4MS4B 3IUSA 4UZEA 4YVFA 5BSEA 2ZUSA 1F2TA 2NIPA 4IOKA 1PAUA 3OZSA 3H2ZA 4J0DA 1ZRSA 3ESXA 4IIJF 4DJAA 1HTWA 1QVAA 4G0ZA 4ARSA 3CR3C 4JVLA 1N0VC 4U63A 4Y2UA 4DLPA 3ZDAA 3RS9A 5TF0A 4E2FA 1EIZA 2E1RA 2ZPUA 1PZFA 5FTJA 2ZDGA 4B3JA 3CFYA 2XT6A 5ER9A 1N2CE 1QCYA 1ZJJA 3H5AA 4MVXA 4D42A 1BU5A 5CRIA 2JRCA 3T3PB 4I55A 4IQ0A 1OH7A 4BEJA 3RUPA 1WZ2A 3NO4A 1LF5A 2H2AA 3QU7A 4D0RA 1D1SA 4ED9A 4D9CA 2P5SA 4AJ2A 3CPJB 3SC2B 2PO7A 2A35A 2XITA 2QZJA 2YV1A 4LF8B 1T4CB 2I1LA 4IWNA 5FO1A 1LD3A 1EZ1A 1WX1A 1NKTA 1YFZA 1E1CB 5JPCA 2DBQA 1F0YA 1RYZA 2LD4A 4JQZA 2FXVA 1M5UA 1KFJB 2WAOA 2IXAA 4IIUA 4XPIB 3PBKA 4G0YA 1T2NA 2WIKA 4KTTE 3IUJA 2WINI 4RKYA 3T38A 5BN3A 5KWIA 1XTTA 2UZ1A 3DC7A 1ZAKA 4R2XA 3PNQA 1RPJA 2JJ8A 2QMHA 2QJFA 4P3YA 5HS4A 2OBYA 4RK7A 1WD5A 2JBHA 4TZTA 4XX0B 5L51A 4RTPA 1T36A 1Z5GA 3K9GA 4A36A 4O5OA 1S3FA 3HL4A 2O8DA 2AFRA 3ENKA 1OFVA 3GH3A 3RVRA 2IHYA 4AJKA 1Q12A 2VG8A 1LDGA 4MQFA 2AW5A 5BNZA 1YQWA 3W2HA 4DQXA 5TQ2A 1L5YA 3CQ9A 1PEAA 3D5QA 5LDGA 1SXJE 5EZQA 5G4KB 1DKQA 3UTCA 3CSUA 4CR8A 4IOMA 2C4UA 2DP4E 3AI1A 1TAQA 2HNKA 4YV2A 2FRDA 3IH5A 1Y4AE 3FFBA 4NQRA 3KR1A 4B34A 2E0IA 4TMVA 2OCXA 5FPKA 4HYTA 1UBUS 3IAHA 4G1EB 2J07A 3INGA 2QI9C 4GNKA 3AM1A 2Y76A 3H87A 1MIOA 4PSUA 3COJA 1BIFA 3TTUA 4YJGB 3HN7A 4ZKEA 4M6WA 2ZAGA 3H1FA 4WHMA 1PYGA 1GP2A 1GY8A 2I3DA 3Q9NA 4V38A 3VMMA 3RVMA 4DCJA 1OA0A 1C8VB 5COAA 2C9OA 1Z12A 1QZUA 1C8KA 2HRRA 2W6CX 3CPSA 5TE9A 4DW8A 2F48A 5G2OA 2IXGA 3PCXA 3Q5GA 1FHQA 3ZDEA 4E13A 3ILVA 4J07A 5ENDA 2AH5A 2QE6A 3OWHA 5KAMA 4BZPA 4BO2A 4A6PA 1E7YA 4EGFA 2E5WA 3W6OA 4A6EA 2PS3A 1X1TA 2B8WA 2VYCA 3O31A 2Y2UA 4G65A 1OFGA 2H0QA 2P69A 1LBQA 4KSYA 5FWYB 2H8KA 3BE4A 3FHCB 3NXKA 2HJGA 4RTSA 4MR7B 3ED5A 4UTZA 1ZINA 4JLJA 4B3GA 3KJFA 2XQJA 2AOTA 3UW3A 4LYDA 4IO0A 2XGGA 4YCMA 5UKDA 1N2IA 4O2BF 3PYMA 4FN4A 5FUWA 1GTJ1 2CDCA 2VPXA 3KHSA 2HMVA 5FTNA 2FPRA 4ZYLA 2IGBA 3DOFA 4G1CA 2QW8A 4L27A 3W1WA 3RUEA 4B7AA 4XDHA 3GJ6A 4PLFA 1W5BA 1JU3A 4MVYA 1XRRA 1SG9A 2EFGA 4EY5A 1EE1A 2B98A 3BD8A 1P74A 1F2TB 3LECA 3OQVA 4DA9A 1AA6A 1D2AA 1PZXA 2PBRA 1EWVA 4XEHA 3VC7A 2A3RA 2PWPA 2BW0A 4HDRA 3SMQA 4C14A 2VXBA 2NZYA 3MSCA 1RXCA 1SUPA 3C2QA 4QOFA 5HS6A 5T4FA 4D92A 3Q7IA 2FB9A 3KZKA 1VE3A 3W90A 2H3EA 2YXEA 2J09A 1R6AA 2C5SA 3KUKA 3L7JA 2MMGA 3IT3A 5EIWA 3ZNNA 4C9BA 2PLFA 4DNPA 1E3LA 4Z4QA 4P4UA 1X7DA 3H4VA 4FZ3A 1IY8A 3FJ1A 2OFWA 3ZZNA 4I55B 2CJPA 4JT9A 1XCLA 4FEGA 2C4TA 4JLDA 4BE4A 1KY2A 2QRUA 4M1WA 1KYWA 1T29A 4NCKA 3P7MA 4P22A 1DC6A 1A9PA 2IHBA 4RWEA 1I7PA 1WXFA 3P96A 1R0LA 4ZJYA 1KH3A 2BV3A 4EY3A 1TYAE 1RXEA 4WOKA 3WYFA 5AOVA 4QL3A 3URMA 3FWHA 3Q85A 4DCTA 3R9XA 3NFYA 3DLTA 4I3GA 1IUKA 3D59A 4MB2A 3H2IA 3G0BA 2WUFA 1MJGM 2NZXA 2OZPA 3LCVB 5ECYA 5IBCA 4TV9F 5BORA 4FYKA 2UZ1B 3I1IA 1OKKD 3ZDQA 1IOVA 3TNJA 4QEDA 1V5WA 2PV7A 2HAEA 1K9VF 3CF4A 3T1VA 1OB5A 1H2AS 2OHXA 4RKQA 3X1KA 1T36B 3R6WA 1H0KA 4KSCA 5K99A 2O8DB 4N8DA 1YRBA 2IU4A 1OIVA 1ZY2A 3KV1A 1EE2A 5EUMA 1EEHA 3TQQA 4B5KA 3AHHA 1NZDA 4LA4A 4DXDA 4WZBA 1ZITA 2OHVA 4GM1A 4WK2B 3QFRA 1ZR4A 3NDBB 1YF3A 1EMDA 1RLTA 1DC7A 3I73A 2WUDA 4QVGA 4KAXA 2DWCA 4CCYB 4O4LF 3HQ4O 4KQJA 2BGWA 1J6UA 2JAUA 3CVWA 2I29A 3HCOA 5BT8A 3HGQA 1O5TA 1YR9A 2HGZA 4LZLA 1EP3B 5IJ0B 4CG1A 5JI2E 1ZRNA 2DFPA 5MN6A 1EDBA 2HV8A 5DYYA 3NX4A 4AZ0A 2F4NA 1PT8A 3KZNA 1LV8A 2IPNA 1KZ1A 2ATVA 2JJ2A 2QRLA 2DC1A 2J33A 3ED1A 1EFLA 4KGXA 1PKXA 2C9YA 2ZKIA 4P7JA 1YXMA 3TSWA 3PQ2A 3H4IA 4RVSA 4D02A 3CT4A 2WG1A 4M6WB 2ZRPA 4BO7A 3PNYA 2J3EA 3WSVA 1V2GA 3AR4A 5JZVA 1AGNA 3B6KA 1IY1A 3UMCA 3MFYA 3VX3A 3O4JA 1K97A 4D9IA 4LY3A 2G7ZA 3KLBA 2A8YA 1QCCA 2AXPA 3WRXC 1WAMA 2BMWA 4GP6A 4EHNA 1YTLA 3KSRA 4KBFA 4Q93A 3S1AA 4BASA 2MR6A 4BB9A 3QXCA 2JIRA 2O1XA 4YR7A 1Z68A 4BFSA 2JFFA 4HZIA 1G21A 1B15A 1OASA 2B0JA 4C3UA 3GARA 1R37A 3VNRA 4RFSA 5KZMB 3PLNA 4O33A 4IHAA 1XD2A 5J5VA 2RGYA 2VN8A 3L7YA 3WLFA 1OU0A 1Q0LA 3DVLA 2JRLA 1O95C 2AOTB 2Z5VA 1XKQA 5FB3A 2ORED 3F71A 1G2QA 1KK1A 2VDJA 5JC8A 2DPHA 2LDXA 2R79A 1J2JA 1EEXB 1N5OX 1NZFA 2NTEA 3ZLBA 4BO6A 3GLFB 2NTJA 1L1QA 3TQIA 2I6XA 2ZAIA 3WZ2A 2A30A 1KMHA 1M6WA 3VZBA 3HU5A 3ILYA 1GTVA 1H1LA 3PPYA 4A1OA 5ITZA 1R0KA 4N54A 2UYOA 9LDBA 1XDUA 2GKGA 1LLUA 1X9GA 1E6MA 3OQJA 2BVNA 4FQ5A 1BN7A 3A25A 3UM9A 3NS7A 1T9GS 3P19A 5DYIA 5KYVA 1Z4OA 4EZEA 5FV7A 3EZFA 2QVCA 2IWRA 1NFFA 2DUNA 1KFEB 1MRZA 5DNDA 2NAFA 1K7SN 1T2FA 3WKDA 1HQYE 1W44A 4M9UA 4PN3A 2HJVA 3K4PA 6GPBA 2GBIA 5LDDC 1UBLS 3PDUA 4LPKA 1RFLA 2IY9A 4CMIB 1B43A 1OV6A 2UKDA 2PU5A 1QYIA 3LFUA 1PE0A 3H6HA 3MERA 4LDJA 2PM8A 5ADHA 2EZ9A 1LVUA 1WNFA 3QWBA 1YONA 3RU9A 3I64A 3EBOA 4D1YA 1YIDA 1RP1A 1USWA 3GMSA 4LHEA 4PC3A 4E33A 2FOIA 3MXTA 3ZV4A 4FN5A 4RZSA 2X9VA 4JLPA 3VYRB 3WK5A 2MCFA 1DAMA 3NTXA 3PUWA 3D8TA 5KTSA 4W4TA 5E4TA 1CUXA 2OENG 2VSQA 3IAAA 4TSFA 3GQVA 3D1VA 1SG6A 3HCFA 4IRMA 4E5VA 2IYWA 4BO0A 1PS0A 3TAHA 4PGAA 1M2NA 2XOKA 2F1RA 2W2LD 2OZEA 4EUKA 1IBMB 4RQAA 5K9ZA 2GCPA 3GGJA 2ST1A 3OIWA 3WIOA 5JXHA 3THXB 1QIIA 2R4UA 2GPSA 3OH8A 4PBRA 1I8TA 4GIBA 3CZRA 5EIOA 1W59A 1FQWA 5K2OA 4PLGA 3N39C 4R2KA 3U4MA 2H31A 2C4NA 3HJGA 5JNSA 5PNTA 4QTTB 3WRXA 5LN1A 2BSQA 4MV6A 3HGMA 3RTCA 2QKYA 3NHUA 1NY6A 2O06A 5BRAA 1IH8A 1PCXA 3FTPA 4RVNA 3TSAA 3D4IA 4MVJE 2XUAA 4HTFA 4KNYA 2F00A 3OPQA 2DPYA 2R00C 3N1UA 1TW3A 1OXUA 3ZDCA 2PKXA 3FKSD 4GS5A 4NBKA 1NXTA 4ZMRA 4HXEB 4V2UA 5JSQA 1DPGA 5AUOB 1SXQA 2D00A 3A8TA 3H65A 2PZGA 4LQCA 4AZ0B 3DLAA 3IEIA 4DLXA 3ETNA 1A8HA 4PLZA 3WGNA 3QVWA 1JIQA 2IHUA 4U9IS 5K4AA 3F9CA 3UMFA 1MD9A 4CM7A 2A78A 3KP1A 4IEFB 4AZ3B 3AF5A 2C5AA 3GVCA 3KOYA 3PR1A 4RQUA 1SBQA 5B1HA 5KHAA 2C5GA 4DMMA 1RLMA 2XCIA 2RGNA 5BVIA 3EVCA 4AY3A 3ANMA 4CKZA 3AB8A 2ZJ1A 1YNSA 3TD6A 4D9FA 4GMDA 4FYVA 2I0FA 2NTNA 2X8JB 2ZRMA 4WUTA 4AWAA 2I6FA 3OOWA 2QW1A 4HRXA 2Z5FA 2X4DA 5CDFA 1G21B 1UXOA 4A6XA 4NYMR 5FQOA 3A04A 4EGAA 4LPSA 3VSDA 3HJBA 4RFSB 5KDDA 3L6EA 3QF7A 3O8LA 3DDWA 4Z51A 1FP4A 3FGOA 4PCAA 4DGQA 3WNQA 2H4FA 3SS7X 4NJMB 4R1OA 1X8JA 1BX3A 1UT8A 3T0FA 2PZEA 1Q22A 2CE2X 3FWPA 1C8BA 2VDRB 3O7WA 4D4HA 4FFSA 2PCLA 3NHKA 3RUIA 3WFJA 4ZOLA 2KBFA 2IIBA 4PX3A 1DIOB 1N8TA 2B1IA 4FU0A 3FHJA 3FDZA 3G2HA 4C0LA 3PI7A 3R74A 3ZQ4A 1YULA 2JKVA 2QLTA 3V4LA 1O4WA 2O5EA 2OCDA 3AIMA 3ONFA 3H97A 3ANSA 4P1ZA 1WF3A 2GJ8A 4PZ0A 3AL3A 2OO7A 4G81A 4MARA 3A1UA 3QFCA 3RIXA 4AG6A 2BAGA 1YVPA 3ZXIA 3DNMA 1UZMA 2O59A 1V4BA 3FE2A 3SHFA 4HCJA 3WMFA 2NV0A 4L0CA 4LXUA 3ZKAA 3A6PC 5JELA 1KI3A 3CZ5A 1ZXLA 1W5EA 4MKFA 1Z9BA 4CKEB 5BVHA 3WO1A 2C58A 3N2ZB 4DLVA 1KERA 3DP9A 5TDHA 2H1FA 1IN8A 4JC4A 4PYNA 4WX2B 5BRJA 3ZK7A 2PZMA 5FWAA 1AGYA 1XNJA 2QM3A 2ZB2A 3GRKA 5ETJA 3VR4A 4D9MA 4Q24A 3HN6A 5TPZD 2Y1WA 4MXDA 5LYJB 3H1AA 2R00A 2FGKA 3L8DA 1USGA 4PGFA 4B33A 4UAVA 5JZBA 2QN8A 3DHYA 1RAHA 2YIVX 5DHFA 1PJQA 2GD2A 4RADA 1F8GA 5AK0A 1F4VA 5K8IA 1DKPA 2UUPA 2GCOA 1IPFA 1QTRA 1GPBA 4PVCA 1HT3A 5JAQA 1ADGA 1STOA 2EQ5A 2I4OA 1Z6XA 3BDVA 9ATCA 3WGOA 4HDSB 1JIXA 2I33A 1JIJA 1VIAA 4HRAA 2KB0A 1BX1A 1SEPA 3FOBA 1IHUA 4TV8A 2ZJ0A 2BFPA 3KKZA 4Q48A 2EW8A 1ZUNB 3LQQA 4BVEA 2FXIA 2ZRKA 1G6Q1 3OWXA 3F6BX 3DDHA 3HSKA 3O3CA 2Q6TA 2BGUA 3R5TA 3PUZA 4K05A 4PRKA 1VE1A 1WXDA 4X1YB 3BGOS 4R2HA 4TQGA 1VJTA 1KZ4A 2L69A 3S5UA 4YEDA 3F9IA 2BEWA 3MB5A 4JT2A 1SCDA 4FJ0A 4GBJA 4WXMA 4F5YA 3R23A 5AOAA 3CWCA 1SUCA 3PVZA 4B35A 4LOIA 2VPPA 2FUG1 1KY4A 2Z3VA 1NJ5A 4HWPA 4LWOA 4QYSA 2NSYA 2YJ3A 3WJ1A 4OQXA 1CR1A 3E9DA 5KKAA 2OORC 2WZBA 4AK9A 1BMDA 4HAZA 5C4MA 1QO0A 2FMHA 3E5MA 4IDOA 1C8LA 1NR5A 1JKJA 2JCBA 1HTBA 4K28A 4DS3A 5AW4A 1WEKA 1WUJS 3U9TA 1LK7A 1TCAA 2OHFA 3K8OE 1XSEA 3EJWA 2GR9A 2PMKA 3FTNA 2VZ9A 4MB0A 1K6IA 1PSZA 4RTRA 1KJZA 3OSUA 5AMXA 4K3UA 5IEJA 3VA4A 2BFMA 4RVFA 3TL2A 1MB9A 1U7TA 4FYIA 3TLCA 1YKSA 3WNZA 2F8LA 3WLSA 2EQBA 4MKIA 2KJQA 4L7QA 5L4LA 4ZVNA 5KAPA 2MYTA 3OZXA 4I14A 4ZIRB 5KUTA 1CFZA 1IHDA 1BE1A 1TZJA 2HQ1A 5HCIA 5PGMA 2RAVA 4AG3A 2YIJA 4LQ4A 4E7PA 5JD6A 1P2SA 4KXUA 3ZTTA 4MLZA 1RM5A 1FP4B 3UGKA 2XB2A 3CRRA 3M1LA 1NBAA 1E2QA 3NYWA 4K6CA 3WLEA 3DL0A 4PYRA 3WMGA 4QNMA 4U9HS 3B3GA 4HLUC 2YVAA 3DEAA 3SM9A 2CVZA 3VOBA 2XUZA 4G1MB 3PLRA 1RJDA 3C4QA 2FQYA 2JGAA 3JQAD 1QMGA 1JWAB 2PIDA 1Z83A 3LFHA 3UMJA 3WMXA 1XLTC 1VHLA 2EKPA 2E4XA 4RVOA 4I3HA 3ZQUA 3UK2A 4F91B 1YI8A 2A4MA 4FM9A 4JUAA 5A5DA 3KELA 1SKAA 1X9IA 2J0VA 1ZD2P 2YHUA 3LX4A 4MA0A 3U4QA 1N2GA 2WHQA 1KYXA 4XIGS 1GPLA 2JFYA 4EOGA 3RVSA 1DDOA 1NJSA 4ZU3A 1XCPA 3BXFA 5GINE 1Y9DA 2QTTA 1V9CA 2ZCVA 1CUEA 3GA0A 5KHOC 4PQEA 1LCIA 3H1BA 3OM9A 3S8YA 2Q3HA 1GQQA 5L6MB 5ESDA 1II0A 1JVSA 3B1XA 4K9PA 3NI2A 4QOJA 1EFKA 3R5KA 3H84A 1JJBA 3OJEA 3W5VA 5BPHA 2Z9DA 5DIFA 4KDRA 1EFVA 2HX1A 4FSXA 2B4RO 3Q9LA 4RWZA 4WLVA 2AQIA 1LUAA 1PYOA 2XNDA 3NHZA 4GUAA 1BSVA 2IPXA 5C7YA 3TZHA 1X70A 4IQ8A 3PDIB 2BI8A 3PTAA 3GLHE 4YRNA 3FOWA 1CJUC 3W9SA 3AQ4A 1GV1A 1W5FA 1V43A 1RKXA 2Q45A 3LIPA 2GCOB 1JSXA 5HPYB 4NV0A 3CHYA 2DHQA 1QFZA 1FFHA 4EGXA 1VOTA 4TYQA 3K05A 3VHXB 1X14A 4HWSA 4RZ2A 4YCLA 2OORA 3OX2A 3QM1A 2C3OA 1JHYA 5EZSA 2C1XA 1A96A 1E9SA 2DWUA 3WY9A 3QMPA 4DEYA 2XIQA 3GFRA 2WWXA 4TV8B 2DT5A 3X1JA 3ROFA 3F1LA 3VU0A 3ROEA 1NP6A 1JTVA 1OSNA 2Y6VA 5JATA 4I1RA 4AJ9A 1GRCA 3U3KA 5TB5A 1LBTA 5FEUA 3Q3GE 4LJ9A 1F3LA 2YIDA 1HDRA 4EGQA 1ZW1A 4L3WA 1DZIA 2FEZA 2GK4A 1GTZA 2OD2A 1DQYA 3I0MA 2IPLA 1IPEA 3CX3A 4OLHA 3IAXA 1G63A 1U7ZA 1COWD 5EE5B 3N2NA 3EPHA 4YMVA 1H5NA 5AVJA 3LUJA 2JEZA 1Y4UA 2AVDA 2NSLA 1O5IA 2XE8A 4LJLA 4O4JF 3EPLA 2CZCA 2VATA 4DLBA 3ID6C 3C7CB 1NBMA 1GAQA 1PJLA 3Q5DA 4PG8A 5A0TA 1GUAA 1PZEA 1V9SA 3CS3A 3A77A 3I9MA 1RI5A 4QBHA 1SWWA 3IO3A 1Q0UA 2VLIA 4TL9A 5BNTA 1QH1A 1Z2NX 4RY2A 1KI9A 1LZKA 3O4RA 4BWVA 2JK0A 1CB7A 2QMEA 2F43B 3EX7C 3U6BA 4XJTA 4P83A 2FY8A 1MEEA 4O4IF 4AUNA 1P6XA 4EDFA 5I4CA 5GONA 1G291 1T5BA 2O2ZA 3HEMA 4YP1A 5L7WA 2CV2A 2R8ZA 1E79A 3E22B 2PL5A 4PLWA 3FCYA 2IIQA 5CFPA 2Z2JA 1VA5A 3PQ7A 4J3NA 1RE1A 2AXNA 3BWMA 3RRMA 1UMDA 2D13A 1YDHA 4MWCA 3FOZA 5K0GA 4AF8A 3R77A 3BHJA 5GOZA 3WP1B 1HDIA 2CSUA 2QS9A 1WUYA 2YRWA 3G2PA 3IE0A 3LUBA 3OBBA 4JKYA 5U4QA 2W42A 2V96A 4XTRA 5A4KA 4HAWA 4WJKB 1GL6A 2I3BA 2OHHA 3DZIA 3PHGA 4GOMD 4N3GA 4PTZA 1XDGA 1Z4MA 3A9RA 4PWZA 4C3VA 1RRCA 5ILQA 2OCAA 3ZWNA 2B1QA 1MABA 3CLRC 3X2SA 3NVMB 4E5DA 3VZRA 2NP6A 2HMTA 1SCBA 4ITUA 4CKWA 2OESA 3H8VA 2V5VA 4QYIA 1N7IA 2GK7A 4Z4EA 3TSZA 2Z43A 3A70A 3LLSA 1XEWY 3PFHA 4JGGA 5LA6A 1U5AA 3W8NA 4ERNA 4UZSA 2J7KA 5BUSA 1PS9A 1R9JA 4KQ1A 3ZCTA 1DV2A 5LBTA 3FPGA 3GZNB 1J8QA 3E27A 5I9IA 3DO8A 5GAJA 5A5GA 3ELDA 4NK4A 4XIYA 1W1UA 1NNSA 3VR5A 4LYYA 4NHOA 1IWOA 4F6RA 3LUPA 2W2OA 5BR8B 4YV1A 4JYBA 4U3JA 4HL6A 3L8YA 2IHZA 5EMNA 3DMFA 1UC5B 3R75A 1GVNB 5DNVA 5DTQA 3W5JA 4PIVA 1Z0FA 2YW9A 4OQEA 2Y2VA 2OECA 3TD2A 3BTUA 5AW7A 3M9XA 1I1NA 4HDKB 4HVLA 3EW7A 4OX9Y 1NW6A 3ZU4A 3UOTA 3T1QA 1JEYA 5THKA 3W8EA 1CJKC 1QCZA 2NSDA 2Q29A 3PGMA 4QXAA 4EABA 2ENUA 1CJMA 2I8LA 4YAKA 4NMHA 2GN8A 3R3HA 3QYJA 1TK3A 4Y2HA 4DBZA 4UULA 3U19A 4I1OA 3M9WA 3BH6A 1J49A 4JLNA 4TKMA 2FPSA 2JI9A 2GJKA 3U4CA 5BP7A 1Z2AA 2H07A 2E4UA 3BRSA 3GFPA 1MT3A 2IRWA 3PQ5A 1LJ8A 5EIEA 5FUMA 5HM6A 1TEXA 3K32A 4W5OA 1OLSA 3ZBQA 4ZVSA 3C3MA 1L8OA 5CB4F 5J47A 2VTVA 2GN1A 3AESA 4W7SA 2FDCA 1R6BX 1KO1A 1LZLA 5KU1A 2NX2A 2PT7A 4HYYA 1HY3A 1V5GA 4F04A 4DABA 3LHSA 1QB8A 1E8DA 4OHKA 3HO1A 1QO7A 3QKRA 4B83A 1LH0A 3I6WA 1V8FA 1NUQA 2YYSA 2J45A 3GDHA 4PCVA 5H3LA 4BUZA 2G40A 4HNQA 4DCOA 4I1VA 5JAPA 3LCJA 4BL5A 2E4YA 1QYWA 1QRTA 3H9UA 4M76B 3IVRA 1YS4A 4RPIA 3RK4A 3UAVA 4EFMA 1T4GA 3CH6A 3ICVA 1FP2A 1S2GA 5JR3A 4KXNA 2EJBA 1KRXA 3F74A 2VF8A 2HCFA 3KETA 3GH1A 4MS1A 4EYQA 3B1ZA 2BCJQ 4NC9A 5EXPA 5JADA 5JD5A 2FF5A 1U90A 2WC1A 3MINB 1VL8A 3OAAA 3PDWA 4JD5A 3LWZA 4R1MA 5AYVA 2Z1MA 1ZISA 2VQSA 2XLCA 4YT2A 2HRZA 4NSNA 2VNSA 4C7BA 1LU9A 3F98A 3QHQA 5E0KB 1VG9B 1N5KA 3N5KA 2Q0XA 5FA5A 5HQ3A 4XWAA 4ZQCB 2OM6A 2XBMA 1JSCA 2WR8A 3FH0A 2XNJA 1UXKA 5D2CA 5KYWB 2J9FA 1J8MF 2QU7A 1YFLA 2P9JA 2GFQA 5JNLA 3C6XA 1RJ9B 5KWSA 2FCAA 3UMRA 1UDWA 3ECAA 4U8GA 1U1FA 5FDFA 3RBXA 2WD7A 3MS2A 1EVEA 3BD6A 4K6KA 3ITDA 4MIOA 2AMJA 3QF4A 2Z8YA 4QUDA 3ZI0A 5FV4A 5K0BA 2I4NA 2BEKA 2WFZA 3DV0A 5KMGB 4PXAA 4Z53A 4Z9AA 4EBFA 3SXUA 3D6MA 1U8FO 2XKBA 5EFZA 3SIPA 1W88A 2VCHA 1UEIA 2ZI4A 3MA0A 4ZQHA 3ROQA 4FUQA 3W7VA 3RVLA 4CKWB 4QYIB 3QKTA 4RHTA 3DAGA 4LDZA 5C9ZA 2QG6A 2O3JA 5JWRA 3ETGA 3GG9A 1CJVC 2OYSA 3A3YA 4R7ZA 1AIPA 1FRFS 5TVKA 4ZC8A 3TXXA 2Q5OA 1ACJA 3QIAA 3SZUA 1P7CA 2P8SA 1P4JA 3ZHSA 4G85A 4FW9A 4RF5A 3SXPA 3KQHA 3SZGA 2P2DA 1C1XA 1FYWA 2DETA 2YOGA 2IHJA 5FWDA 3KKQA 3U7EB 1I5RA 2DFDA 1Q2UA 5DNAA 1SU6A 3WLPA 3REGA 1D6NA 2H5EA 3DV2A 4I36A 4M0FA 2OLJA 1ZOSA 3N2KA 4ZV7A 3G5MA 4IIEA 3M34A 4PF1A 1YS7A 3TNFA 2B5WA 4NXMB 2JIQA 2BUAA 4MMZB 5DISB 5ALKA 1WD7A 3L1JA 2IUEA 4MZXA 3SLRA 2WILA 3LC7O 4B4DA 5IFKA 1SQSA 3QKIA 1AN0A 1P0CA 3OCZA 4FZ5A 3DT9A 1JYFA 3PPIA 3A36A 2PXAA 3DWGA 3UY4A 4NENA 4MUHA 2CYCA 1G6KA 3K9NA 4FNOA 5FL7A 5KJ1A 3HB7A 3F8WA 5FF9A 3RYTC 3VPBA 2CXXA 3AI3A 2DR3A 2IELA 4EWLA 1CZRA 4MW5A 2ACVA 2HDNB 3E9RA 3ZWPA 3LVFO 5B53A 3UOAB 2CY0A 5D5QA 2IZ7A 2GBGA 1SCJA 2CFRA 3KOUA 3V55A 5LPNA 1AO0A 3U9SA 4GSYA 3SR3A 1AHNA 1DIGA 2CCJA 2QTWB 3L0BA 4N7BA 5EIAA 4UUBA 3VOTA 5JCXA 1XVVA 1I6KA 4YCJA 1QQBA 1I0IA 4G4GA 5EKSA 1RXUA 4KH0A 1RI3A 3F0TA 4DSNA 3UTDA 3SHOA 5AK4A 1MX3A 1WMFA 1N6PA 3T7KA 1OLSB 4CTOA 1L5HA 1EU1A 1Y6ZA 3H5NA 3RODA 1YB2A 3KQSA 2YTZA 5C7LO 4I2VA 4KI7A 4EMUA 4IJVA 5HUHA 1U8YA 4IDQA 5DCUA 3UPDA 4BMZA 1POXA 3AR6A 1OFHA 2AX3A 3SOPA 4R31A 5BN1A 2Y8EA 1GPNA 2JJ1A 3CXUA 3C1UA 4Q66C 3DMHA 3PJRA 2ILTA 3P0HA 5A3VA 5TGZA 1R16A 3N74A 4IBOA 2WWTA 5JEKA 4G5QA 2FPIA 2Q07A 5TMEA 3EWAA 5DM70 2GYUA 3TLMA 1ZIXA 3QX7A 1J33A 1K1EA 5TEWA 2WTMA 1SD5A 3FY4A 3C5CA 5KTKA 3PNVA 3CLTC 1LI7A 3OSZA 1SIBE 4FFLA 4J49A 2D5IA 4RF3A 2AOUA 3LXMA 1WBJB 6PFKA 3QV2A 4JJIA 2TMYA 1HYEA 3QY0A 1FEZA 1E59A 2GPWA 2ODPA 3L41A 4W82A 3MJEA 2V3VA 4XD7D 2FWIA 5BXQC 4B71A 2PFGA 2QRPA 4ZEOA 1T6YA 4FGUA 4JROA 1JLHA 2JCYA 5JERA 1H42A 2FMUA 2PS1A 3QBJA 4UM8B 1R0YA 5K8CA 1JECA 1KP9A 3EVFA 1D04A 2C3UA 2NWQA 2XUDA 3LOQA 5FUVA 1KDRA 4E6EA 1SC3A 3LZ6A 4IFBA 3O8QA 1IZ8A 4DR1B 3DKIA 4P5DA 3C3CA 3V1LA 5G3YA 1XMOB 3WQBA 4EJSA 3EA4A 1G20A 1L7QA 4F4HA 5CU7A 2HDHA 4I4TA 2FHSA 2O4UX 4I4CA 1DKLA 3DV0B 4LFAB 1N1MA 1CQIB 1UBMS 3AYXB 3CV3A 4GR4A 3WBFA 3TECE 3EZGA 4YRDA 1KGDA 1W88B 4W8HA 3X43A 3VOSA 2WLTA 3QVXA 5DTEA 1PEKE 4OXNA 3JQDA 1XMSA 5AXBA 4F21A 3KUCA 4NBRA 2P9TA 4Q3EA 1XA3A 3WQRA 2PD3A 1NXSA 1XCJA 3I9LA 5LL6P 1GEGA 2IKSA 2KWIA 2V7TA 2ZT5A 1X80A 5DVZA 2FK8A 5JXJA 4RCYA 1GPYA 2VA8A 4TMZA 1KJNA 1LBSA 4BBPA 4C7MA 4F8EA 3R24A 4Q4JA 5AVOA 3I5UA 3TX6A 2BCEA 4CG3A 4I4IA 3WLNA 2IIVA 2WG0A 4D8YA 1OILA 1CCWA 2H5IA 2ZR8A 3LUFA 1KGSA 5I9NA 2FJUA 4M1OA 1EX7A 3Q2IA 5NULA 2CC2A 4D46A 3HDGA 1MHPA 2Q3JA 3KRTA 3U3RA 3GT3A 3DE5X 2ZTLA 4XLZA 3WA7A 2G63A 3FLEA 1T8UA 1ZN8A 3FYUA 1DIHA 4UZFA 2F3QA 1KPGA 4JBGA 4NENB 2J7PA 2WSSD 2FN4A 3QVGA 4BNTA 4G5HA 4ES6A 3AKZA 3JD4A 1HE2A 2VK4A 3AY0A 4OK3A 5DTRA 3E1GA 2VJQA 4KBGA 3UK0A 3T3HA 1W29A 1Q0RA 2JFGA 3ODGA 3PQFA 2DJIA 2WNSA 1OUMA 2ZETA 2OPHA 1G7SA 3AVQA 3K0FA 1MF7A 4XH9B 1T24A 5B3AA 1QFYA 3HDVA 1WJGA 1QVWA 2H8GA 2ONKA 2Z8ZA 4PC7A 4BMOB 3D6JA 5KTNA 2CF5A 4JDUA 3TMKA 2YFKA 4L9WA 3HY4A 5BQOA 2ANCA 1MQ9A 3IDZA 4PZUA 2RGRA 2QD5A 2CMDA 1GL3A 4UNPA 1VG0B 1BROA 1USKA 4FB4A 1DPFA 3GGSA 2ZBUA 3STWA 2NTVA 2V7GA 4MYDA 4KI0A 2QP4A 4O2LA 1TK9A 3FYTA 1A2BA 3GUZA 1JDTA 4I50F 3T7IA 3EDCA 1DBRA 2YBDA 2GAOA 3GO4A 4AG5A 1C3OB 2HTEA 1TAGA