3V8QA

Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-5'-deoxyadenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
263
structure length
257
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYGEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDELSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 68
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8qA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8qA01
3AFOA 1YT5A 2Q5FA 5DHUA 3V7UA 3VZCA 1Z0SA 5DHPA 5DHRA 5DHQA 5DHSA 2I2BA 3V8PA 2QVLA 4WERA 1Z0UA 5EJFA 1Y3HA 5DHTA 3VZDA 2I2FA 3V7WA 3V8NA 4L02A 1U0TA 5EJHA 4HAOA 2JGRA 4V24A 3V8MA 3V80A 1Y3IA 4DY6A 3V8RA 2P1RA 2BONA 2I2DA 2QV7A 3S40A 3VZBA 1Z0ZA 2I2CA 5EJGA 5EJIA 3V8QA 2I29A 2AN1A 3T5PA 1U0RA 1SUWA 3PFNA 2I1WA 3V7YA 2I2AA 4WRRA
chains in the Genus database with same CATH superfamily
2AQHA 2ZB7A 4FFOA 4GI3A 3A77A 3DCNA 3JZAA 1N5DA 2MTBA 4G0VA 4YLEA 4UBNA 3MSCA 3I2GA 2M9MA 5JVDF 2GEJA 2ANBA 1Q77A 3E3MA 1EVEA 4YP5A 1CQZA 3ED1A 4MUMA 4XDGA 1N1GA 2CNWA 2PPVA 3C5HA 4PX3A 4Z49A 1JEQB 2IHUA 3AIOA 1NM5A 2ZRIA 3IKLA 3NP7A 1OU0A 3DFFA 4ADSG 4LQCA 3K70C 1JKMA 2BR4A 1D04A 2XYPA 1O6CA 4GPTA 4NENB 5AVTA 4FLMA 1CF2O 5DK6A 4J0HA 2GYVA 1E63A 2WYWA 3FDFA 3SP1A 4AKSA 2BMEA 3QTTA 1CUVA 1F8FA 2HXYA 4H6WA 1VL0A 1Z2NX 2Z6AA 1ZISA 2IPMA 4XGNA 4XFJA 3Q3JB 1YIOA 1PK7A 2JHAA 4FCWA 5LLDA 2VVTA 3VFDA 2QVYX 3B38A 2JLYA 1XMOB 4GPIB 3JQEA 4A9AA 2WB4A 1HTTA 2AVDA 3SM3A 2E87A 4Y0NA 1J0CA 4D9VA 3B5JA 1EJ0A 1NNI1 5ER6A 3WSTA 4PICA 1GAJA 4ZZIA 5ABPA 2VHCA 1JDSA 4G1FA 4BNIA 1R4MB 2P2DA 3M1LA 5C34B 1ZMXA 3DNMA 1W36C 3NBQA 3WKBA 4KLRA 2PMBA 3DEJA 4A16A 3F74A 3LO5A 3HYRA 4HAYA 3ZCQA 3HXMA 4REQA 1NJ6A 3EXEA 4IDQA 1Z0JA 4QWWA 5KREA 2E4UA 3AI1A 3OLWA 4LHVA 3UPDA 2HHHB 2HRQA 5L9AA 1KR5A 2I1WA 2LIPA 3I6MA 3K8QA 1AS3A 3HYNA 4JYCA 2REBA 3DVRX 1KYYA 3ETHA 4QOSA 4XKJA 1V4VA 1I2AA 4M88A 3E9DA 1G66A 3GI1A 1KJNA 3LJKA 3KLBA 4YRAA 3VJMA 1KEKA 1UXKA 1FMCA 2GZSA 5CXXA 3BRSA 3EIQA 2UYYA 4RZ3A 3RFCA 4ARSA 2DRIA 4O59O 4QIHA 4LOLA 3FMIA 3T0FA 4R2WA 3N2KA 4CYMA 4H7FA 1IG3A 2A4MA 1PNQA 3DP9A 2IPXA 2BFFA 4Q3OA 1XZCA 4QQKA 4Y1EA 3RU3A 1Z5OA 1Z7GA 2CDAA 3I76A 4AZVA 4RPJA 4XR9A 4U00A 1A77A 3VKGA 3B7PA 3FIJA 4NCHA 5LD2B 4RFVA 3NIBA 3KKEA 1LRKA 1X1SA 3N5CA 2OLEA 5DP1A 1WPRA 4DAOA 1ZD8A 3VDXA 3VH2A 1Y6ZA 3BL8A 4DJEC 4LBVA 5D3MA 4Z0TA 4I6JA 3QBJA 4P4UA 3WRVA 4LF8B 2FW7A 3URKA 2C9YA 1LBQA 2PS1A 4HYYA 4DQ0A 3MRXA 1U7XA 3ZWCA 1QIGA 4XH9B 2Q5EA 2OYCA 4ZP1A 3MGAA 2BLNA 3BCUA 3HGTA 3DYVA 1NU8A 1QNLA 2JGMA 4WKOA 3HHPA 4TV8A 1N6RA 3C2QA 5HCUA 4GLBA 4LJAA 2O5RA 4J94A 2QP3A 5LC1A 4KDRA 4Q4DA 1JNXX 4M60A 2VTEA 1T0HB 3MEQA 4QDKA 3PC8A 1T6ZA 1EQAA 4QJ5A 4MTCA 3UJAA 1MX9A 1BU8A 1CYDA 2HH9A 1TM4E 2XITA 3F1KA 4CG3A 2YNMA 2UVPA 3ULKA 4EBBA 2GCEA 2XMZA 4MUXA 4QFDA 4TWIA 1C80A 4MV5A 2X14A 3UOWA 4DLSA 5GQSA 2J5RA 3KJFA 1YRHA 4I50B 4RXUA 4EY4A 1UDRA 1USWA 4ND5A 4E22A 4WERA 2OXFA 3GEEA 1VZ3A 1LA2A 4Q9HA 2F55A 2Y1GA 4BJ5A 1VMIA 2O0JA 4N82A 3V9PA 2QSZA 4RWEA 1Q2XA 2PXCA 1GIAA 2PJUA 2A67A 4QYIA 2QZJA 1B74A 4JI3B 2ZTVA 2F7SA 4PQEA 3HEBA 4GWLA 1ONSA 1OF1A 3GNTA 4EPVA 3QG1A 3HN7A 4MUNA 4CMJA 1NJGA 4YIHA 2X4IA 2G9RA 2HU2A 1YS1X 1PYGA 4GPZA 1EWYA 6LDHA 4L5AA 2OQRA 2NZ2A 2LRHA 4HF7A 3ABZA 4UVDA 1VHWA 3LXXA 3OJ0A 5JS7A 1FX0B 1ZC4A 2J9FA 2V7GA 3FZGA 1OBFO 1B4DA 1P7CA 4G97A 4IMIB 5G3YA 1XQWA 1JPJA 3DULA 3E7FA 3C6XA 4ZRMA 4GSKA 3UFXB 1MB4A 2C7GA 3RIXA 4LCEA 1VTKA 1JIUA 2JHFA 2YWFA 4MITA 1HDEA 1UPUA 1TZBA 2G9NA 3VR6H 1Q91A 1AKNA 4N8DA 5SICE 4ZN6A 1YZTA 1YZGA 1WG8A 3SHWA 3R3VA 1K3QA 1NLUA 5J2UB 4CMKA 2O7SA 2AJ8A 3B1KA 4CTOA 1K4MA 2FSVC 3R0IA 4MH0R 4WINA 4W63A 1FYDA 2WWGA 4BNGA 1A9PA 4YLYA 3M33A 4TLCA 3KNZA 4WY2A 3Q3EA 3ZXXA 3P5SA 3R0VA 4I2NA 2H9YA 2VHEA 4UXIA 3AUYA 3RTCA 4F84A 4JA2A 3V3KA 3COJA 2G1PA 2DFVA 1CPYA 4RZIA 3ASYA 1CUHA 3TSZA 1GADO 1P33A 1F0YA 5ITZB 1CS0B 1QONA 1HZJA 2NTEA 3TQIA 2NGRA 1O96B 5KVVA 3VR1A 3OEHA 4Z8YA 2BFDB 4FYYA 2UUCB 2YQ5A 4RM2A 3FWNA 2WI8A 2R7NA 1NM5C 5JNRA 1YK1A 3VV2A 3AVTA 4JONA 1XZKA 2M2IA 5B3JA 2A1IA 3SDBA 4LOJA 5CFZA 3QK7A 3NW9A 3RBAA 2DPXA 3EY4A 3EXG2 5EHNA 1JEYB 5K6TA 2WILA 2XUAA 3VPHA 1GGNA 4EEZA 5LQKA 1UODA 1KAEA 2JJMA 4ETIA 4KXFB 5JXHA 1XVUA 1R5BA 3H11A 4JC0A 2HV8A 1MK2A 3ZI7A 1X8XA 5H81A 2A1UB 4PQRA 1PNOA 2QNBA 5BVGB 2BM8A 1U1FA 2Y0EA 3K05A 2YW9A 3A1VA 1I7SB 4F11A 1K8XB 1RKUA 4MVJH 1M2EA 2BTEA 2OWDA 2RAPA 5BNIA 1TIBA 2HHCA 1DTWB 2WRZA 2F43B 3CH7A 3EPPA 5EJGA 3F90A 2NUPA 1U1GA 2ZT6A 3UV7A 4C0SA 3QLVA 2H1SA 5JUWA 4CN8A 3C3KA 2EKZA 2XIJA 1NMXA 1M5UA 2QIOA 4CCYB 1A69A 4LGYA 3WISA 3DLPX 2ZYAA 2BKAA 1ETHA 1JDUA 2B36A 2H8KA 4MP8A 4NS1A 1YF3A 4NFLA 4JDUA 5L7TA 3V2HA 1JI3A 1LW7A 4KQ2A 4MUFA 1QF6A 3TKYA 1Y9ZA 3EMVA 3H4VA 4R01A 1I3LA 2PPLA 5EJ2A 3KC2A 4GI5A 1Z7EA 3CVWA 1DEAA 3SICE 2QRKA 4OH7A 1Z4MA 2X1MA 1TYDE 3B13B 2XTZA 4L1KA 5BWLA 1P2TA 1CDDA 1UKBA 2HK7A 4EG4A 1DLIA 1DBWA 1ZGZA 2HQOA 3L92A 2WT9A 4NDNE 4BO4A 3GLSA 3KOXA 2Q3LA 2OL4A 4R7ZA 5BO5A 2JKVA 3DYBA 2LKCA 4XGRA 1DQYA 1IHDA 3WK6A 2J4CA 3Q10A 1Q95A 3QP9A 2XXAA 4I55F 1S2OA 1IBCA 4RULA 1GTSA 3TL3A 1C8BA 1ZBQA 3S3TA 1ZXLA 1Q6YA 4NZPA 4EW2A 1L4LA 1YH3A 4GR5A 3ABRB 5LZ2A 1WZIA 1XAJA 2HBRA 3BXGA 3DL0A 1KBOA 3FHOA 3NKVA 4AJNA 1SIWA 5HJ5A 4S3MA 4BXOA 1R4AA 1PGPA 4KODA 3QW4B 2BJWA 2GKSA 2XVYA 3L40A 3DE4X 3F5FA 1BC5A 3C4JA 3LKZA 2OLKA 1XTVA 1KAGA 1EFHA 3EH2A 4UULA 4BX8A 4HUTA 4MO9A 5BPHA 1EFVA 3ND7A 5E9JA 1P0IA 1NN0A 3I5MA 5I8ZA 5JMTA 3PFNA 1L8LA 2F62A 5EIWA 2Z6QA 1XPRA 1CRWG 3A6EA 3CNEA 4N3GA 4GKJB 3WA6A 1O9BA 2XQFA 3NVAA 3U7HB 4FDVA 2C58A 1HYGA 1SCUA 4L7VA 4Q3NA 3HY3A 9LDBA 1A82A 2HJHA 4NZYA 1DL5A 1AB5A 2PGJA 2VS1A 5C1PA 2C3UA 3E53A 3H0CA 1FMTA 2XUPA 4LGCA 3HLKA 3S5JA 4PG5A 3MF4A 4K9KA 4MV3A 5ESXA 3GUYA 3FLMA 3PI7A 5TQ0B 5AKLA 2HK9A 1NT2A 2PY6A 2NTYC 3IUYA 1MC5A 1XJWA 4KWIA 1BDJA 3OIVA 4LV8B 1VPDA 1BMDA 1S9DA 1V5WA 4RC9A 1I10A 1Y7TA 4QUHA 2WSMA 2NNLD 3A6KA 1XZGA 5GGYA 1GARA 1DWOA 1GG2A 3NPMA 5PGMA 5BR8B 1MVOA 2CCGA 3AKEA 1EP2B 1E79D 1E6MA 4MKRA 1GHTA 2EHJA 4WFJA 4WVLA 3GJSA 5KYWA 5GOZA 4G81A 1OLOA 2WU8A 2FB9A 5C5EA 3AUTA 1KPHA 4TMYA 4ZOAA 4X8HA 2H1VA 2J9FB 3HKCB 1F6DA 4FK8A 1YZVA 1L8QA 3N05A 2W4QA 4L9SA 4TSFA 4MI3A 4EG0A 4HH4A 1I1OA 2IZ1A 2YWBA 3GFVA 2GBPA 3UC5A 4M46A 1FU4A 5EP3A 3PQEA 1JHPA 1HQKA 1IB6A 1J7JA 2Y2UA 2I67A 5K0JA 1GZ3A 1NN3A 2HCJB 2IDZA 2X4GA 5B53A 3AI2A 3REFA 2JCBA 1BYUA 1OGJA 1QFZA 2O8BA 2OK7A 1X74A 4DDKA 4YREA 1E8NA 4FWTA 4N65A 3UAVA 1P0PA 3AU8A 1BN6A 1L6IA 2PS3A 1Z6PA 3AR9A 5G3ZA 3VMFA 1PR6A 1X19A 1F7VA 3JYPA 5BP7A 3AUFA 4MWGA 3W2GA 1QHIA 3EIWA 1ECCA 1SG0A 4H59A 3UKJA 4C4SA 3T5BA 4D0SA 1Y4AE 1KQGA 1TZCA 1FLVA 1UPFA 2ZXFA 1EDZA 1JLMA 2XCOA 4J16C 2IX3A 2PT5A 4CN9A 4DLZA 4EY3A 4D97A 5BQOA 5TPZA 4BFXA 5BY2A 3MJRA 1BHSA 5IYZB 3B1ZA 3CCBA 2ZSKA 1X14A 1V43A 4PINA 4IG9A 3JQFC 5KOJB 3FGNA 3ZWPA 4CMIB 5L95A 3DVAA 3LGXA 4OXXA 2IV7A 4WT7A 2OP0A 3T3PB 1LQTA 1OFUA 2ERXA 3IL2A 4KITB 5ED4A 5CFLA 1OBOA 5HFJA 1N36B 2DERA 1BEZA 4KO1S 5HF5A 4EVIA 2B3TA 3HFGA 4N0MA 4FFVA 4GU5A 5HKOA 1KOGA 2JHGA 2ZAIA 4AY5A 1TRKA 2VNSA 2XQGA 1XA4A 2XCIA 3O9MA 3GUUA 2VA9A 2FV8A 3W7BA 2QV7A 5DYYA 1C7FA 1GZ4A 2OXEA 4Q7QA 3A8TA 3FWKA 1ZITA 2ZJAA 3NTVA 1R8YA 3UW3A 1AZTA 3DZ8A 3L7KA 1R0LA 1UFKA 1R15A 4M8SA 2IEZA 4C22A 3SN6A 4MJXA 3AKYA 3F9IA 4AU1A 5LVAA 4NWIA 4F85A 3GVPA 2FCAA 4M89A 5MFZA 4K0RA 2JASA 4CMEA 4K28A 2QY9A 3AIMA 3Q98A 1KARA 2GEKA 2LDXA 4MSUA 3WIEA 4ZI5A 1ZZGA 5AKHA 5ILGA 2VZLA 2F1OA 3M81A 4GPAA 2UXCB 4RTSA 3GQBB 4BP1A 4C04A 5HK8A 3NNSA 1HEIA 4U02A 3VOBA 4EAQA 5JPIA 2RGBA 4F6RA 4V0RA 4COKA 1LTQA 1ODIA 3OE1A 1N3LA 1E61A 3PV0A 4CMGA 1FBNA 1ICIA 3GWZA 3INRA 4K46A 3AEXA 4CKWB 1K6XA 2IH5A 1FUUA 1T4BA 4LY6A 4XYEA 4ZAFA 1RCUA 4LG1A 1EZ4A 1IM2A 5BMVA 5DT2A 7YASA 2OCYC 2YIJA 4BNYA 3K15A 4ND3A 4ZJYA 1WCXA 2AVNA 2NO1A 1P29A 4QOJA 5EGNA 3MINB 4BFCA 1ZVVA 1VG0B 2BCJQ 4MARA 5CPBA 2OCIA 1V1RA 3MFYA 4WUTA 5BSVA 5F7JA 2JIDA 3C74A 1K63A 3GARA 3MUNA 2O2EA 3PF9A 4HLUA 4OBWA 4O63O 1YFKA 2Y99A 3AVYA 1HKUA 1ABBA 3AVVA 3FAKA 4KO2S 3OLYA 4DC1A 2CFSA 3WVNA 5CFRA 5CDFE 5TF0A 4FYWA 1TO6A 3SYRA 1HLDA 4P83A 3CRRA 3C3BA 3KQMA 1MORA 3QPWA 1D2CA 1ONPA 5ALFA 2BFCA 4N3AA 1O9GA 3W6NA 3C4QA 421PA 3F49S 3ORRA 2OLJA 2CHGA 2FZGA 3A1DA 4RV5A 2WZCA 3L8HA 4L0MA 2MYTA 1D0IA 4LXQA 4OHMA 1DQPA 4FCCA 2VRCD 3IPRA 3HBAA 3TM5A 3FCYA 4N7MA 4RKRA 4F91B 1QDUA 4XE5A 2MINB 1JQKA 4YRIA 1KA9H 1SO8A 4Z7JA 1O0CA 2V1XA 3QKSA 3T4UA 2EGGA 3O21A 4YRFA 2QRGA 1US8B 3GGSA 4MWOA 3GYBA 3T1QA 4J3FA 1PJ8A 1ZUHA 1E1KA 2Q49A 3GQVA 4C7OA 1B26A 3W3AH 1WBDA 2ZJZA 2LKDA 3PWTA 2G1LA 3BH7A 3EF0A 2C5SA 4YCBA 2D8AA 3L41A 5EZQA 4GQBA 3TPCA 4UNIA 5KYKA 1QE0A 4P6VF 4C1NA 2JLZA 1GQRA 1YASA 3N9IA 4QXOA 4DV0B 1BCRA 4BE7B 4D8UA 1I0IA 2ODNA 1PLJA 2W2XA 4TZ6A 3OLQA 3WNVA 1TKCA 3PR3A 3NTLA 4CODB 1IEVA 1PJZA 1MABB 1TZKA 4P22A 3M4NA 5K3AA 1XJCA 1IY1A 5DCYA 3ET4A 4CKWA 1QUFA 1W49A 2TMGA 2GD0A 2PMWB 4YB8A 2JFUA 1UBKS 3FBTA 2HDWA 4LWPA 5CR9A 2IS2A 4HEQA 5IT9A 3AFHA 3M8KA 1OOEA 3R40A 4RVUA 1EI9A 5TF4A 3T4PA 4CDGA 1M8KA 3ETEA 1ISGA 3JAKA 1CZHA 2JLSA 2QMEA 2EZ9A 1CJCA 1SVNA 4Y2VA 1BTOA 1I1QB 1RBQA 3ICCA 3RNOA 10MHA 2FX2A 1X86B 2MCFA 2D59A 2ZVDA 3GEGA 1Z9BA 2P0AA 5F23A 2I4IA 3RUAA 2O54A 3WLQA 1NMZA 4UHCA 1G8AA 4WY8A 3N2NA 1QFXA 4INPA 3D3EA 3MFQA 3UC9A 1Y82A 2OAQ1 1R6AA 4H4DA 3KKMA 4TTRA 4XARA 3LK6A 3ZGOA 3C3JA 4Z86A 1NXTA 1M8GA 2ZQYA 3ILXA 2BZGA 5LYJA 4EY8A 4OKSA 3QITA 1L4UA 3IERA 4DIUA 3V55A 3QEAZ 4MQMA 1WBJB 1XGKA 1IM8A 3EGOA 3DDOA 2XF2A 4TT8A 1JT9A 4DV3B 4ZU6X 3T5DA 2C2KA 1KAHA 4Q9JA 4ERXA 2D0OB 2UUBB 3VJRA 1WD5A 5C81A 1UJCA 1SN7A 2B99A 3L1JA 1GGJA 2G70A 5IVIA 4B76A 2QIPA 4OPMA 3U7FB 1GLGA 2XIQA 3GRAA 3KJQA 3A58B 3G2KA 3R7LA 2CV2A 3DW3X 1QK5A 3FF4A 5E1OA 3GB9A 5KNCD 5TGZA 2QDXA 3KQVA 2FOXA 2QUAA 1JJBA 3PDIA 5JELA 5A05A 1G2QA 3B89A 4TTAA 4J9UE 4NCKA 5H70A 3LW7A 4KR2A 5DGDA 4C0LA 3CVVA 3PHHA 1DQZA 4J3JA 2Z30A 2E1PA 4WNCA 5LZ9A 1EZZA 3AG5A 3BFXA 4W82A 3ISVA 3KSRA 3EUAA 4YUWA 3FPSA 4CEJA 4DR7B 4ENRA 1I7DA 4ZAYA 4JEHA 5IJ9B 2FHPA 2R6AA 3H3JA 1NUAA 3BH0A 3I05A 4TSKA 4RH3A 5BSHA 1CQXA 4I55B 1L5KA 3CLRD 1QCDA 4LHXA 5DLQC 1TO1E 5FIUA 3TMAA 5ELXA 2XUHA 3DHEA 4XVCA 3AR3A 4D0RA 1GUZA 5ALIA 1OLXA 1T4CB 5TVGA 2RHGB 1XNJA 2AW3A 3EQ7A 1YNSA 4CMEC 2PUCA 2CUNA 1LX7A 3RYHB 3IMCA 4KE8A 3EGVA 4DV5B 4LK3A 4NYIR 3WK4A 2WKSA 2VNJA 1BJKA 2RK4A 5FUWA 2ZPAA 3ABQB 4URHA 4KK3A 1B93A 1PIWA 4RIFA 3P9CA 4QAQA 4U0JA 4V0MA 4MJ3A 2YYAA 3GGCA 3W5AA 2XT9B 2AFIA 4WZAB 4LC1A 2FW8A 3UENA 1MAAA 5BW5A 3KVNA 3PHJA 1LJUA 5G4KA 1JGTA 3THXA 3HWX1 4WEOA 4PVDA 4DLWA 3T5TA 5CFNA 2PBLA 1NKSA 2BSQA 2P0EA 1F1BA 4QLOA 2PM8A 2H4YA 3NJRA 4PYNA 4YJGB 4M76B 4ABTA 3W5VA 1X7XB 3JW8A 4RNDB 4AD8A 4CV2A 2HHLA 4KQIA 2ACVA 3GLIE 1GGHA 3GHHA 5DX1A 1X7YA 1U8UA 4G9GA 4P32A 4EPRA 5AK3A 4KUGA 1N6OA 2XOXA 3IMKA 2H7VA 4ZU1X 3KOWA 2RHRA 2H4JA 4OFZA 4L6IA 1JTFA 1T2CA 3BEDA 4YCLA 3BSFA 5KVCA 3W77A 5A6VA 5SZJA 1MH9A 2ACEA 4C0QC 3CONA 3LA8A 1ITZA 2IPNA 3RANA 2GLTA 1ZVQA 3U81A 3P9XA 2W83A 5CFOA 3OJFA 1GL6A 4MW1A 5HFNA 4V0ME 3H11B 3O9ZA 3UJBA 1C9MA 1W73A 1D2MA 3MRTA 3CEJA 2N46A 3OE7D 4J43A 5ALJA 3W6ZA 4ALNA 6REQA 3PTZA 5IKPA 1JLSA 2P6MA 3PYLA 4QTUB 4N47A 3G1UA 3G0CA 2O07A 4BNNA 1OA1A 1HDIA 5K0CA 1JAYA 3W6UA 3HYCA 3K53A 5KJ1A 1FBTA 1YDFA 2EKPA 2YC2C 1DLJA 3JZIA 4Q9LA 1RPAA 4X9XA 2AN5A 1LBTA 3M6XA 1KH1A 4AKTA 3LY8A 4B31A 1T8PA 2QX4A 3EVAA 4EY5A 4YAGA 5K0ZA 2GJAA 3AYZB 5TRTA 3S2YA 4BNUA 3FOWA 3HRKA 2GEDA 4DA4A 1MQ8B 4KNWA 1BDBA 3FUVA 3KG2A 1DX9A 3IPXA 4BY9E 3VHRA 3O91A 1DBIA 1H0KA 4ONEA 1UEIA 4GRDA 1HGXA 2HMAA 4PHFA 3T61A 4Z9XA 4C08A 3KKNA 1FLNA 2P79A 3VU9B 5LZ7A 1R2QA 3GZTB 3UAXA 5IJ0B 3I8SA 4QDJA 2ATCA 4C5CA 4Z4IA 5F76A 4WY5A 1L4MA 1RXEA 4PZZA 2X1VA 1FFSA 2BT4A 2G5PA 1Z2OX 1DEOA 1T0BA 1B8PA 3OQIA 4IGEA 1XDZA 4O4IB 4ZEOA 3ACCA 1DNPA 1F0NA 1Z29A 2OQ2A 3MTGA 4URVR 3DKRA 1L7EA 3VVMA 4MQUA 4TM7A 2EW2A 1WQ3A 4RLFA 1C2TA 5LYYA 2Z95A 2HZBA 4YP7A 4WCFA 3GCWA 4EJQA 3LP5A 2XXSA 1I6WA 3G0DA 4N12A 1VJGA 3ZG6A 4XYMA 2HIMA 3TGLA 3LUFA 2C2WA 3HEMA 1PSWA 3FXAA 4NZOA 5CW2A 1YCHA 4B34A 4ZK6A 3WSWA 4FE7A 4ZMSA 1HDCA 4LZPA 3F3SA 5AKYA 3LDFA 1ENZA 3NP9A 3VTKA 3CCFA 4ER3A 1M10A 3N8HA 1A04A 2MSCB 5IAKA 5CJPA 5AVYA 4WZBA 1DDOA 5EP2A 3EVEA 5KCZA 1D7OA 3FNQA 4XUEA 3MCWA 3I92A 2QV0A 2XMCA 1OGYA 4UEWA 1WL8A 4HDMB 3UQYS 3ZC3A 1SC6A 4B3BA 4X6LA 3WYBA 1U3FA 4EL5A 3KQHA 1U9IC 3RWBA 3D5TA 4QYIB 3B6ZA 3THSA 3TECE 4DSAA 2YHAA 3SQXA 3B48A 2R79A 3DZIA 4HVAA 1GVHA 2GAFA 2HNBA 5GP1A 3IGFA 1ML3A 1ZL2A 3MJCA 2XMDA 3D3KA 3O1JC 2IYYA 4JJAA 4YJ3B 4I4TB 2Y1CA 3EIHA 5JISA 4I50A 3ZUGA 5DSXA 1N8SA 1GPAA 4G0ZA 4UASA 3TCXB 2YYYA 1UWVA 1YUNA 2ON6A 2I6SA 5AOAA 3TQOA 4EJFA 1AQJA 4MV1A 4FJ2A 2HCFA 4PM4A 4MYCA 3DZFA 1W48A 3NHPA 2R11A 1I3KA 4IFEA 2CLDX 2O59A 1TGYA 1XD8A 4RJTA 3PVSA 1BGXT 2XKKA 2AC4A 2V7EA 1ZY2A 1ISJA 2ZKIA 3FPKA 4EO4A 1GCUA 1O96A 2H2DA 2ZIUB 2C5EA 3UOTA 5CX1A 4Z9AA 5HUJA 3BL6A 1FQKA 1LNQA 2PAAA 3KZXA 1AGRA 3N0TA 1MIHA 4OUDA 4YDHB 2VQFB 4MPPA 1DRJA 1GL3A 4MNTA 2RIRA 3S68A 3X1JA 3JS5A 1FZTA 5EWLB 2F1RA 4YALA 2HQSA 1Q44A 4G8JA 5IC6A 3HJFA 5CDYA 4YECA 5EI5A 4X3PA 3QFFA 4LX8A 3FYUB 3RARA 1ENOA 3GJ0A 1J25A 1P7ZA 3RBVA 1UJ2A 1M1YE 1V9CA 1PT6A 1G8HA 1SG6A 1C3OB 3RIHA 4C4OA 3N1UA 5AW3A 1X1CA 1ZIOA 2CF6A 1NPDA 2Y71A 3EK2A 1G42A 1U7WA 3ID6C 3NBKA 3PDUA 5KX5B 2F1HA 2WNHA 2B82A 3OPYI 3OTQA 1E2GA 4H18A 5HX7A 4EGJA 1M7GA 1OZHA 1VL1A 3G0BA 3L6UA 4JJ8A 3TBFA 5EC8A 2G7ZA 2IYXA 1ZGCA 5E38A 3BMQB 3TEMA 1JE0A 1DOZA 1HFKA 4PLCA 1YA6A 4UC0A 3PD0A 4AYWA 1X7ZA 4KQFA 4MGKR 1GTVA 5FPYA 5K8TA 3HCBA 1G5FA 1JN0A 4NNOA 1N25A 2D1SA 4L07A 3GG2A 1XDDA 2OV1A 3NLLA 1TMOA 3P0RA 2Z5LA 3HO1A 2W8BA 4CM4B 3TF5A 4KIGA 4TGLA 4F6CA 3IIEA 3RE1A 2X6RA 1EA5A 1KYXA 2GAAA 1EWVA 2XWPA 3H5RA 4Y18A 5DLPA 4EI2A 2PE5A 2X41A 3UGJA 4XPIB 3ZHUA 3QV1A 4CIAA 5F12A 1MC4A 4R1NA 3TLCA 2Q4OA 5FA6A 4OXQA 5J5CA 3Q3HA 1XMXA 1K75A 2R48A 1QKKA 2AG0A 4F3YA 2GJ4A 2JKYA 2E4YA 3W3AD 3FNGA 2IV2X 1AKTA 4BEBA 2XAAA 4JOCA 3RVPA 3IE1A 4IEFB 3C15C 1Z07A 4H6VA 1G8JA 4TQAA 5DTIA 5IT5A 3EC2A 2UVPB 1IUNA 1CUBA 4IYJA 1UMBA 4OHOA 3MYYA 4F86A 1XCGB 3F6EX 2P9QA 4LMBA 4KNYA 1QF7A 5B7GA 3ICVA 1E7QA 1TEXA 2BM9A 1MP0A 2G6TA 2WM9B 3Q41A 3THOA 3PE4A 2VJMB 3K1YA 3CUVA 3TCNA 2OGZA 4RY8A 4Z7NB 5DN6A 2GF0A 2IW3A 2OMEA 3LCUA 1QK4A 2Y05A 3K2IA 3GGGA 4ZC8A 3ZLJA 3Q3VA 3I01A 5JD6A 3K3PA 4L4RA 2FMTA 1GG5A 2WJVA 4ENTA 2VO1A 4F3RA 3ZWQA 4IDFA 4P4TA 2W2KB 4H35A 3NBYC 2W6QA 2H63A 3Q5DA 3HBLA 4PV7A 5K8VA 3SG0A 4UUAA 3L46A 3IODA 1U5AA 1E5XA 2FEZA 4UNQA 4WA8A 2RGRA 1Y6JA 3AESA 3SX2A 2JBAA 5F9MA 4DIOA 1HLGA 2LE0A 1A27A 4B6OA 4ZOEA 1IIRA 2JARA 4FYXA 2VZ0A 4B6RA 4OXRA 3G85A 3VHQA 5HEKA 1EVYA 3I0ZA 4GI1A 1MJNA 1UJBA 3DUFB 1IAVA 3LZCA 4OM7A 1C14A 4UM5A 3RVJA 4Q6BA 2HK6A 1V1JA 4X91A 2G17A 2SICE 3TGPA 1KNXA 1U0HC 3NYQA 4O2AF 4Q00A 4WFKA 2XOKD 1LJLA 2CXQA 4G5FA 1J4KA 3EC7A 3X2SA 1NVMB 3NEYA 2PCJA 1KIMA 3GN1A 1NVKA 5DB4A 5TQJA 5CA1F 3ZNNA 3S1LA 1JJFA 3CRVA 5IW8A 5KX5F 5E2AA 5KNBA 1IY2A 2AG6A 3FNRA 1EESA 1FU7A 1MMFB 3VGPA 1GU1A 3BIFA 1UC5B 2M1XA 4RELA 1XL0A 3TIVA 2NPIA 5EWLA 1FX0A 1SEVA 3KT9A 1BX3A 4DSUA 1KI7A 4F4IA 1VM6A 4TMWA 2WF9A 2PVCA 1QAMA 1PKEA 1TU0A 1VSUA 3NH6A 4JXJA 3KT3A 3VDRA 1CIJA 4AX8A 3QLUA 4BVLA 3Q7TA 1Z6TA 5KTMA 1YR2A 1NVDA 2YY7A 2EGHA 1II8A 1STOA 2BP7A 4EP1A 1U28C 5G02A 1ZRMA 1QV6A 4I19A 4NMMA 5HNKA 3LYUA 3BMNB 2BBOA 2XTAA 4HH3C 4DSTA 1NWCA 4MLPA 4FT4A 3UJ9A 2WEKA 1WPXA 3NC0C 4K5QA 3LHKA 1J23A 2X19A 3E84A 4J7CA 3UGQA 2GAOA 3U4AA 3GMTA 2CDNA 1JFTA 5EJ7A 3EQ8A 4WZAE 1VSVA 1MF7A 4KU0D 4JGGA 4I4NA 5CT4A 1T6XA 1YR9A 1UMDB 2N1BA 2ZYVX 4I7EA 4IHJB 1F7UA 5MN6A 4QO7A 1W2GA 1GOTA 1VIMA 1ZKMA 3KZMA 2P0YA 3KE9A 5F33A 3HXOA 2DEUA 5L3ZA 1ABEA 1JQDA 3W5BA 1CZOA 3HCFA 3M6UA 1FP2A 3HDHA 1PS0A 4KAFA 1L5RA 5JWHA 3CF4A 1SFRA 2QJTA 3ZXIA 1NXXA 5GV8A 1P2DA 1N9GA 2FMKA 3P0HA 3S27A 1BE6A 2XBLA 4Y2RA 3W34A 2JVKA 4HDRA 4OHBA 3ANMA 2DJ5A 1K27A 3A6GA 3IYLW 1EGMB 4GC5A 1B42A 4BX0A 1Q7EA 4F3KA 2HBYA 3QEKA 4D26A 3WO1A 4JUDX 4IDOA 4H3HB 3I2IA 5KNCA 1D0SA 1YA8A 1CRLA 2DY0A 4MW4A 3JSAA 2F64A 3K4PA 4YH1A 5D84A 4KHZA 4YJ3F 1QO9A 2HMTA 3WGNA 4M8KA 1Q3HA 4D8YA 2AFVA 5LMCA 2YZMA 3MJTA 2KS6A 4HNVA 4WZAA 4PRZA 4F8YA 1YQWA 3TQCA 1ID1A 4A2WA 1OXBB 5FH9A 4GOXA 1TFRA 2EJCA 3U31A 1YJAA 2I1VB 1TM1E 2ASEA 4H7PA 1TW2A 1Y1QA 1CQIB 3EH1A 4EUHA 5J63A 3I61A 3EUWA 3LUDA 4EHDA 4L85A 5H02A 3CRQA 3ELYA 1Z56C 4EL0A 3RPEA 1EIZA 2KWIA 1AGYA 4J6EA 3WMXA 1SVOA 1QYWA 2DOKA 4ZCMA 4IUDS 1N3BA 2H2GA 2PX8A 1DX6A 4PYIA 2P6RA 3D8SA 3I6ZA 4IRMA 4MQFA 1V37A 3CW8X 1UDBA 4YDRA 5IJ9A 4LWZA 2O1SA 5K6AA 5GONB 1L4FA 1R4ZA 1MU0A 2EWMA 1SOVA 4ZVLA 5JRJA 5LKAA 1KFBB 3L6DA 4BN5A 4KVZA 3CJQA 1E2QA 4TS1A 1JIQA 4R9SA 3FTNA 3TZKA 1JLRA 3EGDB 1GXCA 5I7EA 1BVUA 4I5DA 2VDJA 1FJXA 2OG1A 1LV7A 1XNRB 4KO3S 4TKMA 4OA8A 5C4VA 1B1AA 2WWWA 2XT0A 2A5YB 3AFMA 3AV0B 3OZTA 4XX0B 3RJ5A 1U7OA 3BXHA 1I13A 4N6NA 1E2IA 2QMYA 1CFZA 3DR5A 2PVPA 1HFWA 3SLKA 1WETA 1SQ5A 2YIVX 5KNLA 2RGGA 5MGNA 2QYTA 2F9MA 3RQIA 4YCDA 1T1IA 3L4BC 4RV4A 4B2LA 2AUMA 4A5SA 4RHFA 3UH1A 3D2LA 3JQAD 1CEQA 5BSMA 3D8RA 5B4UA 2PZJA 3K0EA 3G5LA 2P90A 3JQ7A 3Q4GA 4MEAA 4TUYB 3P97A 4YJGA 1M6WA 1DC6A 2X4DA 2O5CA 5COAA 2IOFA 1MO4A 3B8HA 4M83A 1Z7WA 3JZDA 3UOGA 4I1OA 2AJCA 3EDRA 3HKEB 4GKAA 3M3PA 4K9PA 1N4AA 2NV0A 4B8ZA 2C2ZA 3AB3A 3IQWA 5AUQA 3T5MA 3NHMA 4CUJA 1A96A 2UKDA 1OLUA 2ZJ7A 3LIIA 4J0EA 4YMIA 4YDQA 3NBXX 2CXUA 4EOGA 2QS9A 2XUDA 3NQ41 5CHYA 1IUKA 2DHEA 3BJMA 2O57A 4GMDA 2YHIB 4DZZA 4GL2A 2XMPA 1M8PA 4RXTA 3RYHA 5FTNA 3SZUA 3T06B 2VK8A 2OORC 2VH5R 3V2UA 4IBOA 1ZJYA 3D4OA 4QQFA 1E59A 1KI8A 4L4YA 4OCZA 2VG8A 2IDKA 3ESBA 5FO1A 1XDSA 5D8DA 4WKCA 2XZTA 1UQTA 4OX9B 2ECQA 3T7SA 1EJBA 1X3LA 5AK0A 3RF7A 1BZYA 1ZK3A 2J4DA 1ZUD1 3D7NA 4K9SA 4Q12A 4TX1A 3HJBA 4U2CA 4UAGA 5DLYA 4HLDA 2Q5FA 3TRHA 3WB1A 1R8SA 5G0TA 4M1SA 3V4PB 5LQUA 4IIBA 4Q4AB 3DITA 3QPAA 5D2CA 3PLRA 5SYNA 3CRW1 1G291 3F67A 2BI7A 4J4HA 3WTCA 3A36A 2BMFA 3PWSA 2X5NA 2HW8A 1MAHA 3BG5A 1U0TA 4L4UA 1EFPB 3ESYA 1ETUA 4K2AA 1CERA 2ZIFA 5HZGA 3OESA 1KZ9A 1MJ5A 2TS1A 5FWDA 1I3OA 1ZVKA 3C7AA 2ZATA 3CKYA 1H3NA 3PEEA 1IATA 3EQZA 3VKFA 3LY5A 3IO3A 3WK5A 2FK7A 1PWEA 3LI2A 4JZYA 2DFLA 5BSTA 4D3FA 4QYXA 5LIRA 4ZGWA 5MN5A 5IKXA 1O6FA 3FPHA 3H9QA 3FDIA 1V9LA 2YX1A 4OHPA 4A4YA 4JASB 4EYOA 4F8EA 2BI4A 2VWGA 4DQKA 3V1NA 5FTJA 2H1OA 2XLBA 3QJGA 4MHOA 2XYGA 2C4TA 1MAUA 3PX7A 4E03A 3R24A 2YUIA 2IXTA 4JP3A 3LCCA 3JRWA 3EVBA 3Q11A 1FTYA 2C9OA 1V95A 2HJGA 2VSQA 2ZWPA 5IC4A 1A7KA 4AJEA 3L18A 4LX0A 4FJ0A 3M1YA 4P3NA 4TTQA 3T7DA 3IVMA 4W8HA 3EVGA 3FOAA 1N2XA 4YMTA 2AS0A 4PSUA 1J5PA 2OYSA 3JQAB 5J3JA 3FKQA 2E7ZA 2Q8NA 4CCSA 5JZSA 1DAGA 2A86A 2VUSA 2Z2XA 4NSNA 2BTQA 1V1RB 3CPSA 4L4XA 3N6VA 1TAHA 1Y42X 2GXQA 3PNLA 5AXDA 1CVRA 4LSWA 1A9RA 1VRWA 1PGOA 1O4VA 3HH8A 5DOZA 4DEYA 1PV1A 2IPAB 2LXNA 5DYGA 4YAJA 1T9KA 4RDIA 4OK6A 1UM9B 3DCJA 2IBMA 4ZJPA 2YVLA 2I3GA 1VCMA 4C07A 5IJWA 4V2IA 2WVGA 1M2OB 3PPWA 3IXMA 5KQPA 3KQUA 1KYVA 2Q3CA 3WIBA 2F8TA 4K87A 2UZ3A 3AKDA 3MD9A 4TLEA 3IKMB 3V7NA 3ZNOA 2FR8C 2PVSA 1IRXA 1NSTA 4DADA 3QOFA 1ORHA 4LTDA 3AVPA 2WR8A 2HY7A 3H5NA 1RLIA 2NU7B 3NI2A 3QPVA 4H15A 5CDHA 2O50A 2PD4A 2ESRA 3EOZA 3G5AA 3IDZA 3EGWA 1ZOLA 3R7SA 4P4SA 4D1YA 1XD9A 3GK3A 1EFTA 3MXOA 4KIWA 4BVFA 4ZYLA 1EMDA 4BNDA 4EB6A 5ES3A 3HN6A 4EAAA 4MRMA 2Z6UA 4JBIA 1OIWA 4IHKA 1U90A 3GN2A 1US8A 1NIJA 4GOLD 2JIOA 1ILWA 1LDNA 2Q21A 2ZIVB 3OPMA 3BGWA 2ZBUA 3GT4A 4FXPA 5EE9A 3DOOA 5K6AC 1EFAA 4B48A 1E3MA 3ZLTA 1VC2A 3BPSA 1TO2E 2DH6A 1BWPA 2WIAA 2Z1DA 3ITKA 3K2BA 3QE3A 3FWHA 3HBMA 4JJIA 4F7WA 3P9RA 1YDGA 2IF2A 2EFYA 2Q2WA 4V0QA 5F7OA 4ZIRA 1TRHA 5A0TA 4BMDA 3F8SA 3OCVA 1OWPA 4DVGA 5DK4A 4PLZA 1VCOA 1G18A 2XVMA 4YP0A 2PKCA 1EX7A 1QVAA 3P27A 5EZYA 4NIMA 2H0QA 1ZD1A 1FFXA 1KJ8A 1BVRA 1PDWA 1UFVA 3LT4A 4PTLA 4ZC1A 4ZYUA 4UNSA 4LRSB 3HU1A 2O8DB 4H6XA 1ZINA 3EZ6A 4P86A 2F8LA 3DEHA 4Y3UA 2PWAA 3ZCSA 3QLEA 1R9GA 2VIIA 2NACA 4YO8A 5FA8A 5K3CA 5I9IA 1E3IA 1DINA 5IVHA 4Z53A 2QD5A 1X39A 5T6MA 4XIGS 4FGZA 3C41J 3AG6A 2PJRA 1JMYA 4E5UA 5MGBA 5B3LA 7MHTA 2PSSA 5JXWA 1A9XB 1LQUA 2JGJA 3IO5A 1R6XA 4FZJA 4KR0A 2A5JA 3OTOB 1OFUX 3AL3A 4W9MC 4L9RA 5EJ6A 3W4JA 4Q15A 1VP9A 1OZGA 1XVTA 1E9CA 2A1TS 2GN1A 4PPYA 3SHOA 1M6HA 5JNWA 2ZAYA 1QBKC 2C2YA 2XQVA 1JHYA 4CKEB 1GPYA 4H6PA 1E3TA 5E9AA 1WO8A 1I2DA 3WNDA 1E1RD 3OM1A 1RJWA 3AOGA 4KACA 2VHJA 5IHPA 1PU2A 2OCKA 1VIDA 4DJJA 4LI0A 1BE0A 1P9WA 2DSTA 3E58A 1SUIA 2VH2A 3VNUA 1XA3A 3AHFA 3PGXA 2ZRPA 4RFLA 2O3QA 3L7BA 3JQGB 4H1WA 5JFGA 1GQ2A 4ZVMA 1KE2A 2DY1A 2KKLA 5GY7A 4EF5A 2PQMA 3HZHA 3LC0A 4MW0A 4IW3B 4ZU3A 3WS7A 1DKPA 4XVUA 2HCRA 3TL2A 3EW9A 1Z4PX 1NVTA 2HADA 4QGHA 4QXAA 1ULBA 5IDVA 4XD7A 1KO4A 3HL0A 3HB4X 3LH5A 2QRMA 1W85A 2PSEA 4D0LB 1N77A 4UTRA 4HUQB 4F1KA 3P52A 3MILA 4CL3A 2A9JA 3T9FA 5ALRA 2WJAA 5JO9A 3QE4A 4GW3A 1Y3HA 4KXYA 2QY6A 1H6CA 1OYYA 4BLSA 5LXTB 2OILA 5G0UA 2BE7A 4Q93A 2G83A 5AKEA 4XLTA 1V96A 1CUYA 3EG9B 4N3NA 3UHPA 4F7DA 5LBIA 1EEHA 1JR4A 4WEQA 3OQMA 1Q0TA 1DQSA 3PUKA 2AFHE 2W0SA 4DMRA 2FSUA 2LNDA 4UOEA 1U04A 2B20A 5EIEA 1BXZA 1CY4A 1C4WA 4BCDA 4DC0A 1RQXA 1EP3B 1YJBA 2APJA 2QVXX 2IYZA 3OFSA 1T9DA 3ZJVA 3ZHOA 3TTWA 3DBHB 1GV1A 2DX7A 5F51A 1VDZA 1UT5A 1JU9A 2QMOA 4OBBA 4BZQA 3VUEA 3NVKI 5DNYB 4A7PA 4HX2A 1I4WA 4Q7MB 4UTOA 2AOTB 1FTGA 1BH6A 2A9KA 1DQNA 2H11A 1WMSA 2I1LA 1FRNA 3IDFA 4Y2TA 2HDOA 3BFVA 4UPDA 3UB4A 1HEYA 4LY0A 4R98A 1CV2A 1RIFA 2WHXA 4EEXA 1NW3A 3RRJA 3W5IA 4M22A 2Q6LA 1DFHA 1Z45A 4LW8A 1E4EA 4OMFG 3MGKA 5KPJA 1TAGA 3IVGA 1FJHA 2DULA 1AGPA 4KGXA 3ND8A 3PA8A 2R00A 3O4GA 1JG6A 2NU6B 3NOXA 3T99A 2QTGA 2ZSIA 4E7OA 4U2DA 3SKVA 4KVAA 4W5NA 3K0HA 3Q15C 4LF5B 4ZQEA 1Y9DA 1ULSA 2QRPA 2RDMA 3FHLA 3M5CA 3OUZA 4ARAA 4BZXA 4V0LA 1YJMA 4Q1BA 5C32A 4I8IA 2D2FA 1M8JA 1VIAA 4BQSA 4DDVA 4HFRA 4XGIA 3K9BA 3W5SA 1BX1A 4NE7A 3B6EA 4CF5A 3RC1A 2QVLA 3H2GA 1ISFA 2GJ8A 3TAHA 2D54A 1YRBA 5KHLB 2II6A 2EJVA 1HDRA 1NVWQ 2PZGA 3G2IA 3QWFA 2BGGA 4U4AA 3OCXA 1GILA 1U9ZA 2EEZA 2IU6A 3EHDA 3EGXB 4QODA 4A8JA 4B3XA 3VYSB 5HW0A 1ZI9A 2V96A 8AT1A 4UMFA 5LN1A 5DEIA 5ALHA 4W1PA 3I1JA 4U1RA 1U0LA 4GMKA 3A14A 2X5OA 2XZOA 4JLPA 4R1LA 4WN9A 5ERGB 3DD5A 2QRVB 3ZE2B 5GINE 1CJMA 2A94A 4RCYA 1SXJB 2C3OA 2ODEA 4RE6A 1BWSA 4AROA 4BIIA 3DB2A 4TL6A 5BORA 4JEUA 1TJ3A 2IHKA 3KELA 4MVJP 3MIIA 3VU8A 3OEYA 2YOFA 4LY3A 1C2YA 1E4VA 3FZYA 4YVFA 4LNHA 4ED9A 4MS4A 3ZGVA 5GIOE 1T13A 4DUZB 3I8OA 1C1DA 2WA2A 2ORYA 1IXKA 4GZ3A 3UMVA 4L0DA 1XP8A 4ZOLF 2GH1A 1SOUA 2IZZA 4IXNA 2PFGA 3EHEA 4MYHA 2B4AA 3MQFA 3KJZA 5KNBH 3VH3A 3QMMA 3V32A 2OAEA 1U81A 5JJCA 1ISHA 3ZDCA 4I9HA 5EQTA 2JH8A 4FXOA 5L4SA 1OXKB 3A10A 3RSGA 5KTSA 1LDGA 1FRVA 2C7OA 1YTUA 4IR7A 3E4DA 2R60A 1GL9B 2JH3A 4DDTA 4KUEA 4J7AA 4BATA 4P9NA 1EFVB 1XRQA 2O8FA 3LVQE 2Q3JA 3GR6A 4KVGA 2OYRA 4BMNA 4H7IA 4JLSA 3QEBZ 4YRCA 3HV2A 2C94A 5A6SA 4Y67A 3MOGA 2W48A 1E0SA 2W4IA 3LPNA 1X15A 4RLQA 3RWMB 2NG1A 2PRKA 4OG2A 3EULA 2NU9B 4B4DA 5KJFA 2CSXA 2JFBA 2FG7C 3CUKA 2UZ4A 5JVDA 1JVSA 1T3SA 2B5VA 4LYDA 3VR4A 2JAUA 3A32A 1M54A 2CMKA 1GGKA 2C59A 3KSZO 3CHYA 3QF4A 1CY1A 2CN1A 3D1LA 1RRMA 1J4PA 3D4BA 3EZNA 3F3YA 3KCNA 1UP4A 4ZQBA 1J0EA 4RENA 3L77A 4H31A 4RIHA 4R6WA 1Z0SA 1Q92A 4W7IA 4ZK2A 1ZZEA 3I4CA 3OZWA 4ZALA 5KC8A 1EVZA 2Q07A 4BLRA 2HSWA 3KTDA 2R44A 3H6GA 4UATA 3ONVA 5FULA 4BLUA 4FKMA 1MHPA 1E79A 4GOJA 1QAQA 2R66A 2VPTA 4JQZA 1LNSA 1PO7A 1C7ZA 3DXYA 3SK0A 3V4RA 1QJ4A 1KI9A 4B40A 3A3KA 4HXFB 3PNPA 2GLXA 3AM3A 4J76A 2C7PA 4TKUB 1HLPA 1ENYA 1Q6ZA 2V45A 4LBWA 5JW6A 3VISA 4HEJA 1ODCA 2X1LA 4MVJD 4BKMA 4OGKA 4PYRA 3QVJA 4LXGA 1M1YB 1RZRD 3A6JA 4WASA 3KD2A 3L02A 3SJ7A 3NUZA 1S0UA 2BGTA 4HDQB 4OJYA 5AW5A 1RXSA 2BMVA 2MSNA 1HNXB 1GXSB 3I6WA 3I34X 4R8SA 3HO8A 4DCTA 2Z4RA 1QGYA 1Z4NA 2ZSBA 3ICPA 3GA0A 4C4RA 1DC8A 2DKNA 3BBLA 3BCHA 5AI9A 5F7XA 3LHIA 2Q50A 1U3CA 1P2FA 2OO5A 2V5AA 3PTLA 3ZHVA 1AKWA 2DKOA 1GQOA 1OXVA 3U60B 1NI3A 3E1SA 2PV0A 4DLVA 3BC1A 2EZTA 5KNDH 4XSVA 5MF6A 2NU8A 2AMJA 1HQDA 2BBTA 2XX3A 4NCBA 4B5LA 1UFRA 1IVYA 4U3JB 3TINA 5LQNA 1KBQA 1PFYA 1Z2EA 4OREX 3ZOZA 2AXPA 1OZFA 4Z7QB 1ESMA 4MKHA 4CFSA 4XEHA 5K99A 4CEJB 1JDJA 4F1JA 4K81B 3MT7A 1A5BB 4MR9A 4ALMA 2ZAOA 1QRRA 2WF6A 5JCOA 2X3UA 2C84A 4G4GA 5B2ZA 5C31A 4RPIA 2OXTA 3DOEA 4XWWA 3Q6IA 3TW0A 1I51A 3ORYA 3COPA 3WP0A 2GFQA 2GJSA 3AUSA 4FFPA 3OQOA 3DLBA 3AJ9A 2D3WA 1XKQA 3MHPA 4WK6A 1GP2A 1E9SA 2PNFA 1YGSA 4G9EA 5H4GA 3CXUA 3WKDA 3SHVA 4TUYF 2UYQA 3WYGA 4MX8A 2O6HA 2QN8A 1L5ZA 1W4AA 3PENA 5JSQA 3AWDA 2DVMA 1M7BA 4PHHA 3S7TA 1N5IA 1ODFA 3OP1A 1AJEA 2YWRA 4U9IS 2NWQA 3H2JA 1JEAA 1Q0HA 1V7CA 3GC6A 1V8FA 5EXSA 3RC7A 3N7TA 1B6TA 4O5AA 4KLAA 4YXWD 3IBFA 2GDZA 1FRZA 2JGKA 1ZPDA 2V5UA 4QUBA 4A23A 5LQCA 1F6BA 1JQ5A 1TPYA 2DGDA 4TWBA 3WL8A 2FPPB 4CLDA 4OLBA 4WNYA 2Z04A 5EIFA 2BGNA 1QNFA 4KRYA 4OBXA 1PK9A 3B20A 4QRIA 4KAJA 3NG1A 4J6FA 4LOAA 1KAMA 3LUBA 4PYMA 3DZKA 5EINA 2PZEA 2XEXA 2P9HA 5K4HA 1GR0A 3E4CA 4JWKA 3C87A 4CFYA 1E7SA 2W6JA 1PJQA 4BQFA 4ZJZA 1KR2A 5HM8A 5CEJA 4XGQA 4IICA 2P9FA 2C4MA 3U44A 4S0XA 2WTUA 3OFJA 3CY6A 1OVGA 2Z3WA 2CXHA 2VBIA 4BNTA 1OV6A 4DEVA 4PWZA 3GLIB 5ERXA 1E98A 2GETA 2IIVA 2J9ZB 4IXTA 5A3VA 3SKYA 1NATA 4H0NA 1HT3A 2FN9A 4JKYA 3WGKA 2C5LA 2ZKLA 4GVLA 4M7WA 5KJEA 3WJAA 1SCKA 3BWEA 4RY0A 1RFGE 2QE7D 1DAEA 4P7GA 1T24A 1ZMRA 2PTHA 3ZDDA 3DEZA 4XIYA 1P9OA 3BXOA 1RYDA 3BIJA 3ECAA 3K9CA 1LV8A 1ONBA 4Y9TA 5JNLA 1XZPA 3CPHA 4XQEA 2PGXA 1ELOA 3BWBA 4HNAB 4RGQA 4WJLA 4KYVA 2OV3A 2CXNA 3IJ5A 3BAFA 3E1GA 3AJAA 4IH9A 4CV0A 4CEIA 4TQUS 1NVFA 2Q7DA 4ENVA 4J4TA 5BWNA 2B92A 3G5TA 3PGJA 2E89A 2YV3A 3HSYA 3M6MD 5CM2Z 1UXJA 5DYTA 5L3SB 2XA2A 2CLKB 1DKUA 4BVBA 1JMVA 2H51A 2HLHA 4G5YA 4L7QA 3FM8A 1C0IA 2PLRA 5M5BA 1O0SA 2QUZA 4QC2A 3CVJA 3TSCA 4UDOA 4DXDA 2C9DA 1S2DA 4BGDA 4AECA 2GESA 4OHRA 2QPOA 2CBZA 2Z08A 4ZAWA 5J43A 2YXLA 1FDIA 1P1JA 3L1UA 3SQDA 2L18A 1TCUA 1U7ZA 4TROA 4F1WA 3IAFA 4RF5A 1VCHA 2EP8A 5AW1A 3JD0A 1I01A 1QAOA 1QC5B 1V7QA 2JI9A 3HB7A 3K09C 2ZM5A 4YASA 3GLGB 3BHNA 3M2TA 5C53B 2D7DA 3DM5A 2F3RA 3MYRA 4E4RA 4XCQA 4Q7LA 4FOLA 2AR0A 3LLMA 5CURA 5LDHA 3DMRA 2ZCVA 3OZFA 1KK0A 1AQYA 1YOVB 4DGSA 3OZAA 4I1UA 4P34A 4W8GA 3VDMA 2X0NA 2PYZA 1R6TA 4OOEA 4RLSA 3L07A 4RPGA 4CQMB 3AY7A 4HLNA 2R25B 3KXKA 1D4OA 3TJZA 4MI9A 4X90A 4ND4A 1YXMA 3WLNA 2HXGA 1BHO1 1NZDA 3NDBB 3C6QA 4WN3A 2PMEA 5HDBB 4GMGA 4M37A 4UHFA 1JFRA 1A9ZA 2FR8A 2PWZA 4YP1A 5JCXA 1RWVA 4LRYA 3H19A 1EDBA 2IHVA 3PXAA 2VP6A 4FFDA 3LDAA 4KBFA 5EZSA 1QH9A 3T54A 4UJ5A 4MHTA 1JJAA 5FEMA 2FMXA 3E3AA 1XHLA 3LDGA 4GLJA 4YJFA 4B6PA 4RTRA 4W4TA 4ZEMA 5ALYA 1AU9A 1DT3A 2CYCA 1XLVA 3KKZA 3N74A 2DETA 4Z3KA 1TCCA 2FYTA 3LDUA 2PAFA 2PD6A 1E4OA 1IEWA 2H2AA 1IMOA 3N39C 2AH5A 4MVJE 5KDLA 1XLTC 1ZMTA 1SAYA 3T12A 1NASA 2FFJA 2WUEA 3RUEA 1NFRA 2PH7A 2Y1XA 2VSYA 5CT5A 5IBRA 3SC2B 5CT9A 4E6EA 1LI7A 3FLBA 3BBPA 4O5OA 1VCIA 3L7CA 1ZN8A 1IL0A 4NC9A 4DBLC 4JMLA 4K9RA 1WPQA 4UNRA 4GC9A 2NIPA 4PY2A 1LVGA 4C76A 2A3RA 2C5BA 5BWCA 2AXEA 4GGMX 3D6JA 2DU8A 5DI9A 4B81A 2XVAA 3NYRA 1G6OA 1Q84A 3I58A 3BREA 3TSAA 4PZDA 3BFPA 2PRZA 1A8IA 2G0TA 4IYRA 1S2MA 4W8OA 5G1PA 2HEIA 3U62A 4BNLA 4QFMA 1A3CA 3FRIA 4BV3A 5IM4F 5KYNA 1GFWA 1U3TA 3STXA 3T3HA 1V41E 4C21A 1VXRA 2B8WA 3ZDEA 4HAWA 4R81A 4B46A 5LWHA 3TR5A 4X7BA 2H00A 2OV8A 5BWOA 4KE9A 5G1NA 4YR9A 3AF4A 4XM1A 4B44A 4N0QA 3ZGYA 4EWLA 1UJMA 2A0YA 2IYQA 1NQ5A 3IRVA 3C14C 1Y5LA 1QPBA 3IR6A 2DM6A 2YJ3A 3CRNA 5D7NA 3RTAA 3VX3A 3T9BA 1N6PA 3LE8A 4CG0A 3MMPA 2YZ7A 5SZIA 1O89A 5IT4A 2PKXA 3IAM1 4INAA 4Q6WA 1N9GB 2WZBA 1VPVA 1E6KA 4XX1A 2AN4A 4D4KA 4LJRA 1E92A 4MDYA 4Y2UA 1GZUA 3PXEA 4EHHA 1RHUA 2C77A 2G1KA 4LN1A 2OHOA 5CNKA 1WP9A 3Q5EA 1P80A 2GPBA 4UFOA 4D25A 1XELA 1C7IA 2NXWA 3KWLA 1UP7A 3M4JA 1CEYA 4RZHA 1DGQA 2XXJA 3FPJA 1WABA 1HY3A 1H2YA 2HRDA 5C7LO 5KWIA 3U9LA 2BZSA 1HPLA 2A57A 5JS6A 2XNDD 1IEQA 3HMKA 4MK4A 3UJ6A 1MX5A 3JSXA 4FFSA 3NM5A 1U5BA 4MAFA 2YQZA 1W4CA 2VYND 3SDSA 1WE2A 2BF7A 3CU5A 3MM4A 1WMFA 2HO4A 5COQA 1D1QA 2E4WA 4NK4A 2J85A 2NXEA 1AUVA 2ZT8A 3OZEA 4RIGA 3V4FA 3VU1A 4D9JA 1HQYE 5KS2A 3DCYA 4FOOA 5GVRA 4D9NA 1V45E 3VRHA 2QT1A 1HLFA 3W2HA 3HUFA 4ZO9A 1EM8B 3HB0A 3I12A 3RRXA 1XCPA 4MROA 3L8YA 1E5QA 3L8MA 1H2XA 4J1QA 4X1IA 2XTJA 2ZJ0A 4RMHA 3A3PA 3FN4A 1ISRA 3TLEA 3WR5A 2BDTA 3QOYA 2VP2A 5ITVA 5JJ5A 2XOEA 3H3FA 4ZOBA 1NTOA 4OHVA 4ZVOA 1T2VA 2VSFA 3KXIA 1NBEA 4ZVQA 1JHVA 4C2UA 3HJNA 4RZXA 3OZRA 3U7JA 2QROA 5ED0A 3L0YA 2YN4A 2WPNA 1L8XA 3BWYA 4NOLA 3GBPA 1DARA 4BKUA 1EIWA 5DOVA 3T9EA 3DHYA 1ZHFA 2P3QA 5CYFA 3KEFA 3T7IA 1DAKA 1EWTA 4P0TA 4DHWA 3BB4A 3PHGA 2M98A 2FWBA 1VKOA 1N7GA 2XJ4A 2NXNA 3A11A 3PX2A 2AKYA 4NQZA 3T5PA 4Z4FA 4A5OA 2OK8A 3I9MA 1H1DA 4JKIA 5CVEA 5JLAA 2RMKA 3DLCA 5TPZD 3TLMA 5KVAA 2H3HA 1JKJA 3O7WA 3T9AA 4LZNA 3PXCX 1N3YA 2OZVA 4UEJA 1JWLA 2PXXA 3C3XA 1E62A 1GU7A 3ITNA 1I36A 1SUSA 3RI3A 3PQCA 1ZGGA 3RVRA 4DHEA 2AZDA 3VA1A 1YR6A 1WLYA 1BROA 2Q29A 5DJOA 4OKNA 2GZ1A 2CFTA 4YPOA 3VU3A 3UMMA 1RZUA 4IF6A 5K0EA 4RA9B 1CY6A 1NBIA 3BXFA 5EMNA 2PRIA 5PNTA 1UOOA 4I1YA 3OKAA 3O03A 4W1RA 3VUFA 3EF3A 4G0XA 1KY4A 1ZD9A 3NDRA 5EHQA 1E1DA 4MJLA 4BASA 3PS9A 3KHUA 4IF4A 4BVGA 2HV9A 5KYYB 1M75A 1O9HA 2AOTA 3ER9A 1RYEA 2EX0A 1KERA 2ZU0C 4BB6A 4YRBA 1P6XA 3ESCA 5FTWA 1O87A 4IOLA 5E4JA 1ZOIA 1EGHA 2QTCA 4EFLA 3RADC 4U2BA 3GDFA 4HFMA 1E66A 3ZHSA 4O08A 4NBRA 4DG9A 2XMBA 2I22A 1YZQA 5GONA 3RSLA 2OFXA 2H6EA 2OV2A 5AM4A 4ZRDA 4BEWA 1QRAA 2Q7OE 4FC7A 5A2QA 2X0FA 2ORVA 1PQUA 3GUZA 4BWFB 1AHHA 2I4NA 2GI4A 1V8PA 2GNPA 5DGHA 3RKRA 1CR4A 3ILVA 1PG5A 3DZHA 4PIVA 1WZEA 5ELMA 4EITA 1WV3A 4IDHA 3ED5A 6YASA 4LV6A 4IEIA 3ZWBA 1QCYA 1G8PA 2J3EA 2GN2A 3LXUX 4AF7A 4HKTA 5A4MS 4LAFA 1R00A 1KMHB 4X95A 2XUIA 2W8BB 4CM4A 3U49A 1B23P 5LQSA 4HNSA 3GRZA 2WNSA 5A06A 1SBIA 5CDGA 4I5FA 1EFUA 4R31A 4MVJM 2X7JA 4G37A 2NYUA 4B6QA 1RI3A 3GPBA 4RIEA 3COWA 3HCPA 2CXTA 4JLNA 1IQ0A 1IC6A 1SHKA 2JGAA 3JR3A 4HXEB 3WG9A 2ES4A 1TF5A 1YS2X 4KK4A 4NBKA 4ATNA 4E07A 1MVNA 1LPSA 4YROA 3M3HA 3OHMA 1VHDA 3PFGA 2E4ZA 1WLNA 3TM4A 3TTXA 5BYBA 1CZKA 1FY2A 4LWOA 4JKOA 4NYJR 2AV6A 1IJFA 2OO3A 3T1TA 1NHWA 1OWOA 1UIMA 2B37A 3GP5A 3ON5A 4JI5B 5AM5A 5JG7A 5K3EA 1I30A 1ADBA 2ZQ5A 2FPPA 3GDWA 4JLMA 2CLMB 4ND6A 2IS4A 5AHKA 1XYGA 2XB2A 2BMDA 2W98A 4PC2A 1D2HA 1XU4A 4DVJA 2Z8XA 1SG9A 2IE0A 3HQ4O 5TQ2A 3ROKA 4MKXA 4KQHA 4R7GA 1EINA 1T3LA 3FUTA 4YP9A 1Z12A 1J0AA 3A4NA 4QAJA 5L51A 2X8JA 4N0DA 4H77A 2NAFA 2NSJA 2P7HA 1U8FO 3C8UA 3F4BA 4FB4A 4EKEA 1LPPA 1N5LA 2YXBA 2JEYA 2O4UX 2VPZA 3UWDA 4ZMBA 1Z4QA 4OU5A 5BMVF 4NXNB 3T7CA 5AOCA 5JAZA 2A1UA 2EBFX 4AQ7A 4RW0A 1Z37A 5LDDC 1IBRA 3QKTA 4TMZA 1OI7A 2QKYA 3BRWA 3CZAA 1P2VA 3H1BA 1BE1A 1NOKA 2TMYA 2WBLC 4L9AA 4PAGA 5FLKA 4AIIA 4HBZA 3ROGA 4MS1B 3S1AB 4ZZ0A 1CBUA 2ZGVA 3K2QA 3M7IA 1G55A 1WULS 5FI1B 1DJMA 1FXWA 3AGQA 2JCXA 4LSMA 2F2TA 5CB4A 3P4XA 2DLDA 1T6BY 4GE0A 3U13A 1KMMA 4AMYA 4IJ6A 4Y2PA 3CF0A 3LD9A 4TXLA 3ABSB 4IIJB 1XZIA 3Q7PA 1T10A 2XDAA 1YGYA 4GT1A 3U7IA 4IDPA 3I32A 3AFIA 2ZK7A 5D86A 1WJGA 5TIIA 2JFZA 1O58A 2IXGA 3C6ZA 3IUPA 1YSCA 2PLFA 3KUDA 4MVJA 2GTHA 4O2BB 2MR6A 1KMCA 1P7YA 5EZYF 3TLJA 1MV8A 4B8YA 1BS9A 3SQMA 4HNGA 4C30A 16PKA 2VF2A 3TI9A 1T5BA 2CY0A 4ZT6A 5LOVF 3IBGA 3DE5X 4YONB 2L82A 3EIXA 4M0LA 3RVSA 7AT1A 4NZNA 4GG1A 2YCLA 3FZQA 4TYMA 2CUZA 4IIGA 3LWZA 2D13A 2H1WA 1YQGA 5FLXA 3EQ6A 1B43A 1N7IA 4S0ZA 3WWDA 3YASA 3ZBPA 1HE3A 2WIJA 2QYHA 2Q8PA 4E5MA 1FDTA 3G9TA 2XNJA 5U4QA 1G8GA 1TX4B 2BUAA 1TJPB 2FZEA 1JT2A 3FD8A 3M82A 3WL6A 4MUYA 5F9HA 2YJGA 5BSFA 1CUAA 4LE2A 3OX2A 3PIIA 4W99A 2XECA 3PQ4A 2OCLA 1XA0A 1G17A 4Y0VA 4FD3A 4H3KB 4DANA 2Z5GA 2GF9A 1EM8A 4ZODA 3DR3A 4GZMA 3SI7A 5AK5A 3QLTA 4C1BA 2LV8A 4GH5A 2I99A 4ETWA 4C06A 4KXXA 2WTNA 1H94A 4RVSA 4X92A 4Y6LA 2IYTA 5EJ9A 4EA6A 1JQ3A 4A10A 4CLRA 3VNVA 3O31A 4NJMA 1HMPA 1IZYA 1QCZA 1S7CA 4JWTA 5BMOA 2HRRA 1EZ1A 4D92A 4BMCA 1LFDB 2IU4A 3O8OB 2WT4A 3GAFA 1YI1A 1SXJD 1RZVA 3K35A 2Z2JA 3NUGA 4I14A 1R0XA 4CKXA 6AT1A 4BGIA 3G0HA 4L3WA 1J24A 1G5RA 3JVDA 4HD8A 3S40A 4TWZA 5HKKA 4MV8A 1W5SA 4XYGA 4E2XA 2Q3FA 1HO3A 4RJ2A 4MVXA 1TEZA 5DIZA 3P9KA 3E35A 4GP7A 3DOJA 3H1PA 3MWFA 3FHCB 3EIEA 3IE2A 1OC4A 4UVGA 2OZKA 4XQGA 1NJSA 5H0IA 2QT0A 3UHOA 2CT8A 4RHYA 3RVNA 1WXHA 3KYCA 1NQOA 3L05A 1UJXA 1NW9B 1QFJA 1U3WA 2I6FA 2NQ2C 2RGEA 2P11A 3LHFA 4LWQA 3ZLVA 2IT1A 1EG7A 3ADOA 1J09A 3M34A 3EWAA 5HR5A 1H6DA 2WAAA 1KJZA 2CMHA 3EISA 4NVRA 3STVA 3STYA 4LHWA 2A9PA 4ILEA 3E81A 4WACA 2AZ4A 3RC9A 3C6MA 1D2GA 3X2EA 3ZWWA 4MEBA 2H5JA 4FFNA 2G5GX 2HJVA 4FS8A 4Q39A 1GM5A 4FHFA 3ROPA 3KJXA 5FL7D 1I0LA 4OEHA 4YQYA 4KBGA 3C45A 3GZNA 2JATA 1DG1G 2B1JA 4PG4A 5LZ5A 1A72A 3X2FA 3ZIDA 1NBMA 4RVFA 1EVLA 1RWNA 3HB9A 4JITA 1JHRA 4WX2B 1H0SA 2XMQA 1KMHA 1U94A 1R4NA 5AVOA 1SBTA 4D9MA 3QPUA 3CW9A 4ZVVA 4HEA1 1HDGO 2Q3BA 2ZIZA 1E3WB 4ND8A 5B1YA 1TUBB 3LNTA 4HGNA 2HMUA 1JTVA 1RYZA 1U1IA 4OSEA 4K26A 5B1HA 4EFNA 1NA5A 3ASVA 3CC8A 2IPOA 3TAUA 3PUXA 4IOJA 1K4KA 721PA 3AYXB 1C9NA 4OY3A 2ZJOA 1OWMA 1GFZA 3DDZX 5EWJB 3Q0TA 4P2BA 4RJIA 1CEXA 4RF2A 1E99A 1UPAA 1NNUA 2INGX 4KFTA 1TGVA 2QEQA 5DNAA 3FYUA 3OU6A 4IQFA 4JI1B 2OKGA 3R3SA 2VEDA 2WTAA 3FH0A 4NFSA 4Q7KA 3ZEIA 3V6MA 5DRTA 2PZMA 4KMOA 1ZM2A 1FNNA 1XDUA 2F43A 2Y93A 4UUBA 4F2GA 2HF8A 1K86A 1MO6A 3VR6D 1JBKA 1X7WA 5P8WA 3H9EO 2YBDA 4ITUA 4CL2A 2XE4A 3LVFO 2R47A 4ZTUB 1J1UA 2GPJA 1R37A 3K09A 3PQ5A 4QGGA 5LA6A 2EVWX 4ZT5A 2NPFA 4CT5A 1HYBA 1P72A 1TYZA 1ZOSA 1KMIY 3RS0A 3KO8A 3EJ6A 4U39A 1XN1A 4I66A 1SOWA 1YFJA 1OJ7A 4PZLA 2A9RA 3NHAA 1NP3A 4UBJA 2B4QA 2R7AA 4CXMA 4I6GA 1N2CA 2DAPA 1A98A 4LJ7A 3CKKA 5MFPA 1N2JA 1M6EX 1QC5A 1VYTA 1ZC3A 3LRTA 1D7AA 2WIDA 3FJ1A 3QWIA 4KIUA 4D2IA 3A1TA 3GJ5A 3T1HB 2VHXA 3CKMA 3B9BA 3UWPA 4KFCA 3IQEA 4OK5A 3FVWA 4GZ6A 4HG2A 4HWKA 5A02A 5I7UA 1U9IA 1GN9A 2D62A 2OD2A 3BGSA 1QS0A 2P1ZA 1XIVA 4XQ9A 4CTMA 5B55A 3H7IA 1EFRD 2QJWA 1Q0LA 2W58A 3R8CA 1ARZA 1U5CA 1VE7A 1II9A 1KI2A 4OD0A 1JQLB 4DIKA 5CDUA 4CV1A 3SVZA 3RVQA 1I4DD 2EH0A 4FNOA 3PZRA 2VH1A 4RK5A 4GR9A 2FZVA 5MHTA 1E5LA 2JFVA 2P27A 2UVDA 3AY6A 4J2OA 3SR4A 3ZVMA 4J0FA 2GHTA 1DXYA 1D9XA 3SF8B 2PR7A 2A5FA 5J2UA 3ZDQA 3N8IA 5M3BA 3JD2A 4J75A 1I6LA 2VPWA 2P4UA 3F7OA 5EIBC 2V3VA 4JUAA 5CLGA 2FJPA 1A9YA 2RBKA 3B8EA 4UXJA 4CNBA 3F5DA 1CQIA 2PWBA 3FSGA 4L15A 4A0EA 3TZBA 4B74A 3U3KA 4XTCS 4DG8A 3JAWA 1PJ2A 5EJFA 2XNSA 1JPVA 5FBWB 3V3TA 1RXCA 4UM7A 4R9RA 1DE0A 1JAIA 4A8JC 3C85A 4NLLA 4WCFC 4Q19A 2IUFA 5BPFA 5HP4A 1T0JB 2VPPA 3UAYA 2FQ1A 4KR9A 3PUIA 1BMFD 1RACA 2OHXA 4QEKA 2WSYB 1E1CA 4X54A 1R27A 4Z99A 1B3RA 3DP7A 1L5GB 4EF4A 3P2IA 6ADHA 2C9MA 5F9FA 2WG1A 3WV4A 1IZ8A 1TVCA 1NVAA 2RI6A 1NG1A 3AR8A 4C6RA 4MIOA 1KPIA 5GJBA 4K1XA 2NM0A 1BE8A 2RK3A 2VKQA 1AA9A 3FDJA 1ZESA 5JBQA 3OM0A 4DYHA 3IP9A 4C6TB 4EHIA 4F9TA 3ERCA 2D00A 4QJBA 4L57A 3BTUA 1U11A 1L7BA 1O8BA 4FWIB 4OL9A 4GGOA 4C7VA 3A2KA 3RYFA 4M9RA 3WB9A 2Q28A 3NGXA 1J4OA 3IAHA 4IFIA 1NYRA 5HIMA 4YHHB 4DV4B 4OYRA 1QIHA 4KQ1A 1EVIA 1UQUA 3I5UA 3E9ZA 1U7FA 4N48A 3EAGA 1PVDA 2C3PA 2VLIA 3VPDA 1B00A 4B47A 2W6OA 1WMBA 4AF6A 4C14A 4DTCA 1GGFA 3F4KA 2ETXA 3DGEC 5CMLA 1EGQA 1G4HA 3SGLA 1QQAA 3GCDA 3VHLB 2HWUA 3OHSX 3QKSB 5CVVA 5C1OA 4MMZB 7ADHA 4MULA 4EZEA 3QTBA 1MAVA 4ME6A 3BMXA 2XXBA 3NWOA 1N5KA 4GL4A 3ZDZB 1SD5A 2CJWA 5DBFA 1HOXA 2YC4C 3VSAA 4NBLA 1C1YA 1C0KA 1EQ2A 2O1XA 1J7KA 1JQBA 4JJEA 3QXGA 4R05A 3SJZA 3WAKA 1WMAA 1F4PA 3E22A 3KEMA 4G0NA 5G53C 2E9SA 3SIWA 2VDKB 2ZZKA 2ZYUX 3AZPA 2FNAA 3GVHA 3MS2A 1L5VA 4H27A 2FPGB 4KDEA 4X1YB 2SNIE 4PGGA 1K2WA 1XYVA 1LLFA 4IGKA 4MPJA 4S2EA 1VMKA 2YUTA 4IKEA 1KY2A 5CIWA 4P92A 4S04A 1QOZA 2AX4A 2Q1WA 2WU0A 1M33A 1NR7A 2LVBA 2VWHA 2FUG6 4AIRA 1PFGA 1H2BA 5A5EA 1THGA 2BW0A 1RI1A 4LDPA 1CETA 3U3RA 1PFQA 1ZUNA 5J23A 4BUZA 5I6DA 5G0VA 5J40A 2J33A 1A2QA 1ZIXA 4LK2A 4UARA 3SKXA 2GD1O 1T9GS 4CLEA 3MGGA 3KOMA 3ASZA 4ZVRA 3HPQA 3TNFA 4JGBA 4F4JA 2HHAA 1SKBA 4REMA 1E9VA 4LQ4A 5E95A 2R68A 4CM3A 4FOSA 4W5OA 1NUUA 2X15A 2J9YB 4QHTA 4IRUB 4YT5A 1RYYA 2AC2A 3B9RA 3LCVB 4BKPA 1L3CA 2HDHA 2GBIA 1LVUA 2B1IA 1OZAA 3GCXA 2ID4A 4K6HA 1GR1A 4KPGA 3NEPX 3CUSA 1UM9A 1R4NB 4D44A 3VR3D 1Y1SA 2KBEA 4XLLA 1VE1A 3LHDA 3F9CA 1EKXA 4EB3A 1NT4A 1K7YA 3G79A 4AN1A 1QH8A 3GL9A 3QFHA 3RR2A 1Y4ZA 2N0SA 5IP5A 1SUFA 4XWGA 1E1QA 2M1ZA 5FPPA 3W5HA 5JEDA 2G5CA 2WJ6A 5DBIA 5B57C 1ZBDA 1JFVA 4L73A 5K8JB 2FEMA 4E21A 3VHXA 3IQDB 2RGDA 1NDQA 1F2TB 1R64A 1IOVA 2VYCA 1MT3A 3TPZA 3ZNPA 1GSOA 1CQJB 4TQ9A 1CZRA 2IBSA 3NEJA 5ISMA 1XR3A 2QAJA 3DDSA 1KEUA 2FDRA 3PJEA 4GX1A 3WDLA 1P61B 2NV6A 4MVWA 3ZD7A 4DR1B 1KSHA 3IVXA 1G21A 4BBJA 1OT3A 3EDOA 2XCTB 5I7AA 4GYWA 3JQ8A 5K0SA 3B2EA 2CZGA 5M2QA 1J2UA 2QYSA 3HSSA 2AEFA 3L6BA 1BDMA 1T5HX 1P5HA 4ER0A 4BGEA 3WHKA 4R2IA 5AM3A 4R9PA 2Q1UA 3KM0A 4M1ZA 3GT7A 3UW1A 4A0QA 1Q19A 1V8ZA 2WWTA 2ADMA 3FUCA 3WL5A 1UBMS 1Y1LA 3QYPA 3C24A 1L8AA 1Y6QA 3EZ7A 1KFKB 1P8JA 1UPTA 2PUVA 2ZE5A 3GFPA 4KFUA 4QBFA 1MENA 4YI5A 4V2UA 3O8BA 3QUSA 4AZ0A 1K98A 4O2RA 2BDUA 1FTQA 4TMTA 4UMEA 2XRZA 4YJHA 1ORWA 2P5YA 2W2MA 2C9ZA 1SC3A 4H1VA 1RAHA 2WUDA 3PFFA 2J3KA 4IJQA 2QENA 4ZI7A 1SR8A 3MTBA 4MDFA 2PSJA 3T7AA 1FNCA 4NV1A 2RFLA 4MXDA 1NGSA 3DW1X 3V8PA 5IF9A 4N41A 4BP9A 3RYCA 1NIPA 5AD1A 3MZ0A 2REOA 3KTOA 3OBIA 4MDHA 2RCNA 1QM5A 4LA4A 5E7MA 2XCQA 5BQXA 1T0PA 1V47A 3NIGB 4BQRA 1W47A 2ALJA 2PFSA 2QRVA 5DI3A 2BFEA 4TXNA 5E4FA 1G64A 3RF6A 4K6GA 3TOSA 3G8DA 3ZIAA 2QX7A 3HU3A 3WZLA 4PN3A 5AVRA 3IT0A 1OAKA 3A6HA 5ICGA 3QXJA 2XUKA 2Y8EA 3KZVA 1Q0ZA 2BEWA 3PJGA 3DE2X 2DR2A 2ZDGA 4PO3X 4BBAA 2V1UA 2WHQA 1R5OA 2FPIB 4BQEA 2IGBA 4I5EA 3P26A 2HSJA 2ZJ5A 3TDKA 4DM4A 2FCRA 1FYFA 3Q40A 2IOQA 5HZKA 1XQ9A 1TTPB 4XAQA 1OZ0A 3FPBA 4J07A 5CX1B 1E5VA 5CA1A 1WSDA 2AZTA 1GPKA 2XDYA 1NURA 5HILA 4Z1MA 2VBCA 1RKQA 3RYIB 4E94A 4QGSA 4GBGA 3SIPA 1ND6A 3IVCA 4JP5A 4IIJA 1Y63A 3LXRA 2G28A 2MINA 3HC7A 1WS6A 1USUA 3NHYA 1NN5A 5FI0B 1BN7A 1M9NA 1RBZA 1GYPA 2WUGA 3SMQA 5L3QB 3A7DA 1Q1NA 4UE2A 5FR2A 3O1IC 3LO8A 5DV9A 3LUHA 1XX6A 1DEHA 3E7PA 4HK4A 3Q72A 2N75A 3K0KA 5B1SA 3SMVA 3M6AA 1V7ZA 4C4TA 4CTJA 5KTOA 1CIPA 2VJAA 3H9UA 5GJCA 3FCEA 2AK3A 3LQYA 2ZUVA 1O57A 4O1HA 2P35A 3U5ZB 4G5QA 5IAOA 4QDOA 1HRDA 4IXMA 4HUJA 2PL5A 3IUJA 4ZCPA 1KI3A 3WQHA 1BEUB 1YFZA 2X5JO 3JQCA 3KKKA 1OAOC 3O92A 3NC1C 3PNMA 4GRIA 2I2FA 1GTZA 1XZFA 4XUCA 4EI7A 4QHSA 5LFAA 3VSCA 2UYOA 4IIUA 4BO3A 3AVOA 5K5EA 3IV9A 2Z1NA 3ZTTA 4JAVC 5JAMA 2C5GA 3E8MA 2VWQA 5LD2C 2AX3A 5EQFA 5KC9A 1RW4A 4OSOA 3EXIB 1J8QA 1UOQA 3K5IA 1H93A 3STHA 2R1UA 2WKRA 1LKZA 3ZYZA 4BFUA 1PFUA 3ORSA 1TCAA 1S2GA 2IHBA 2Q62A 1Q7CA 1HTWA 3IUSA 4ARCA 2FZCA 3LC1O 1YZ3A 4JJ6A 1CE8A 3MTIA 4N6OA 4NABA 4HWGA 5FL3A 4LNUB 2A0FA 2OPBA 2F3QA 4JR1A 3PFBA 4RQTA 2F67A 2Z58A 3LW8A 2HN9A 1LWOA 3LX6A 3QKWA 4K6KA 4ALKA 1Z5VA 4ES6A 4ND8B 2BGKA 2J5XA 1W85B 4G84A 4FEEA 4MINA 4HEHA 5DXAA 2GUWA 5EJMA 3X44A 3U1BA 2M6RA 4UZSA 1VB3A 1WP4A 2QXYA 3PLAE 3TPFA 4G9BA 3CRZA 1VI5A 3IEPA 3PR2B 2C7QA 1XLTA 3R3UA 3CA8A 3ODGA 3AVWA 2G88A 3FCCA 4AB1A 2H16A 3HR8A 3TW6A 1JFSA 2IE8A 1TJ4A 3MCTA 5FBQB 4B83A 4YV1A 5M04A 3I0NA 2Q45A 4HDNB 2FN4A 4OH1A 2Z57A 1K89A 5AK6A 2FFHA 3SOPA 3K0AB 4KYTA 1H66A 1X1QA 3P45A 3PHLA 2R8PA 4HJRA 3SS7X 4OP1A 1S8NA 3VAAA 4ZCIA 1X1DA 2NZWA 1V11B 2VDOB 1JUDA 2GBCA 4K9OA 1A9TA 1THZA 5JNSA 4FYVA 3N0VA 2A0WA 4QOIA 4C3VA 4PQGA 1FRFS 1S3FA 4MWTA 2RHBA 3LUAA 1UBGA 3W9UA 2QNIA 4ARVA 3OFVA 3K30A 3QBEA 4TM8A 4CKCA 2VBGA 3A6DA 4F3CA 5CLLA 1L2TA 4M8LA 4QDUA 4A26A 4ER6A 1KYQA 3EDYA 5KQGA 3ZI0A 1E96A 3BK1A 3ADDA 1TKAA 1AKYA 2ZRAA 3NHJA 1PYDA 3LC7O 3QVOA 4QBHA 1F5NA 3NNNA 4KWTA 3I3OA 2ZW9A 1GUDA 2PIAA 4MWEA 5CGZA 5T4EA 1FIUA 1GCGA 4XJXA 1AV7A 4OYHA 5J2TB 3TGWA 3ZVLA 2JJ1D 1XP5A 1SCJA 5SYAA 1QTQA 5D3KA 1DZIA 3Q85A 1GZDA 2IYWA 3HVIA 3R23A 4MWSA 4RKWA 3RCBA 5LQMA 5CCXA 5AMXA 2A5DA 3BHJA 4V39A 5EIHA 2Q6KA 4H3SA 1U2QA 1QTRA 1XWWA 4TS4A 4QTYA 5HIKA 3WQSB 2HA7A 2ID9A 4BB9A 5KIAA 2BCGY 1RLUA 6GPBA 3L8CA 1NF2A 1UMKA 2IU3A 1T4MA 2OWEA 4QNNA 2HRBA 2QAGA 2E55A 2QR2A 3ZPXA 4PRLA 5HE9A 1BWQA 2R8RA 2XVXA 1FHRA 3RSQA 3UCXA 1M73E 3GGJA 3IPCA 3RRNA 4BRZA 2R97A 1RPTA 1S1MA 4M54A 4WESA 4HS4A 2XPCA 3IDQA 2I4MA 1QFSA 1CULC 4Y1FA 4ZT3A 4Z0HO 3SC3A 1NQXA 1A2OA 3ZLUA 4DPLA 5E0KB 1TIKA 2ZBQA 2FZ5A 3U61B 4JLBA 4UVIA 1U9CA 1NUHA 4WXMA 4A6EA 1I33A 2LGJA 5LLSA 3LQKA 3H16A 3RHSA 4E12A 3K9NA 2C1ZA 3FDZB 2XE8A 4AS2A 2EXXA 2ZRMA 2J7PA 5DM1A 1NF3A 3DCIA 3PRKE 3F97A 2B8TA 5AI6A 5BSWA 3IP3A 1EVQA 5AKXA 1U7UA 1DQRA 3KHTA 4XDZA 4RXMA 4EMTA 3A4IA 3PUJA 2DPGA 3HDJA 3K0FA 1WU8A 1W4ZA 2QUKA 3DZGA 3MOSA 4FBGA 4Q18A 4LFCB 3REQB 3G9UA 3T52A 3R9XB 1WUKS 1JRLA 4BVAA 1DRWA 2PA0A 1RVDA 3AZOA 1USVA 3VSBA 1ORIA 2VJDA 1NW4A 2FUG1 2J5BA 3N3BC 4EX6A 1CG6A 3D7RA 3ORQA 4FDUA 5GIPE 1YU6A 3O3MB 3SZOA 2IELA 4QVGA 4PBRA 5AUNB 3K94A 4RGBA 3G8AA 4LJ6A 3OPXA 5AJZA 4AZSA 4C9BA 2OSVA 2EWWA 4M55A 5BRAA 1RHQA 1QZ3A 3K5HA 3OCUA 1G98A 3E23A 4MS1A 3PUWA 3V7WA 2AI3A 4AJ1A 4PCLA 5EQDA 4EHKA 3WOVA 3B5IA 1GKUB 1RNLA 2CZCA 4P1ZA 4B85A 5KKNB 2EYUA 1KO1A 1ZK4A 2OPHA 1J90A 3E61A 5ARCA 4A0FA 3ZU2A 1SCUB 1X8LA 2NUTB 3UWSA 1K3TA 2E21A 2CC2A 3ZK9A 5JJKA 2IC5A 4FBMA 4WV3A 3N87A 3TQRA 5JH7F 3U48A 4C4AA 3PO8A 5B6PA 4R1SA 2NVWA 3WHLA 3UMSA 1BXRA 4WBNA 4EW1A 2WAXA 1F3LA 4LXIA 2W6ID 3CG0A 4RQBA<