3V8QA

Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-5'-deoxyadenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
263
structure length
257
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYGEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDELSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 68
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8qA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8qA01
3S40A 4WERA 3PFNA 4WRRA 3VZBA 2I2CA 4HAOA 3V8QA 1Y3HA 1U0TA 3V80A 2JGRA 3V7UA 3V8NA 5DHRA 2QV7A 2I2AA 5DHTA 5EJHA 2I2DA 2I2BA 2AN1A 3AFOA 4L02A 2I1WA 1YT5A 3V8PA 4V24A 3VZCA 2QVLA 5EJFA 1Z0UA 1Z0ZA 5EJGA 3V8RA 3V7WA 2BONA 2P1RA 2I29A 5DHUA 2Q5FA 5DHPA 5DHQA 1Z0SA 3VZDA 2I2FA 5DHSA 3T5PA 1Y3IA 3V7YA 5EJIA 1U0RA 1SUWA 4DY6A 3V8MA
chains in the Genus database with same CATH superfamily
1B42A 1A9QA 2VNJA 4LOKA 4JLAA 4OAOA 5EP1A 4KXQA 3GCWA 5TIIA 2ZRMA 1E1QD 4HLUC 2FPIB 3KSAC 2AG6A 4ASUA 1DQNA 5LA6B 4GLFA 2BFCA 3N7AA 4B6OA 3R7NA 1IOLA 1YS7A 3FUTA 1SVIA 3SKXA 2H57A 1RTKA 1YVRA 2H2AA 3MJSA 4R8LA 2ZYTX 2Y3IA 1OBFO 2FH5B 4HI0E 4L6CA 1H6DA 3K2QA 3LZDA 1YMUA 4OI1A 1Z12A 4YDQA 1CY6A 3GZNA 4S2UA 2PGOA 5EIBC 1EUZA 2W11A 4MTLA 4JFRA 3MWDB 3TEJA 4CLEA 1PR9A 1NJ6A 5KS2A 2DJ5A 3BWBA 1TUBA 2JLSA 5ICCA 1T8SA 4NFSA 5JLJA 1X1SA 1D4AA 2JKZA 1KQ3A 4YMSA 2Q3DA 1WV3A 1MAWA 3NKFA 4TV9A 4RABA 1L7DA 4M6WB 1P6UA 2JBAA 1DMSA 3BE5A 3L8HA 3SQOA 3WGTA 1MFPA 2EKLA 5GJWC 3W8EA 1OGYA 1BG6A 1NU6A 6NULA 4RKRA 5LWHA 4BDTA 1RBYA 3D2AA 1M2WA 1UJ2A 3QELB 2GTIA 4KH1A 3WZMA 1Y6ZA 1OI3A 1XRRA 4OJNA 5EWJA 5ALVA 1ZI9A 3RJ9A 2ABWA 2XDQB 4RETA 1WETA 1JDNA 2FWMX 4FMDF 4G0QA 3OJCA 5JUWA 2PSFA 3PYMA 6LDHA 1R21A 4PZ9A 2Y1WA 3CCCA 2P6RA 3F5DA 3O9VA 4NY1A 3C41J 3GT4A 4X45A 1RKQA 4OXIA 5G4KA 4BVLA 3QHAA 1JQEA 5HPYB 5IAAA 2O8CA 3DEFA 3P1JA 3U5TA 3FMVA 3TSYA 4KRXA 1XTBA 1K6EA 2ZE5A 1LPMA 4GNKA 3EQ8A 4BKQA 1PU2A 3GJYA 3QVOA 4LCJA 4LJ6A 1MQAA 4GP6A 1Z2CA 2XYPA 4RKFA 3DAOA 5IDWA 1EE2A 1NQWA 2CLCX 3KJZA 4R01A 1Z7GA 1F9AA 4JIVD 1MCZA 3DITA 1R7RA 4GW3A 3AR2A 3WBBA 4OHYA 3AEZA 4NBVA 4Z3DA 1UC5B 2I4TA 3RVOA 1W4AA 2JGKA 4RD2A 1CZKA 4KSYA 1IPHA 1S2IA 4FZJA 3S2FA 3DP9A 2RHDA 2XVAA 3PPWA 4KLNA 4MYTA 2WF9A 3L0SA 4GLJA 4U7HA 3ZE1B 3DEKA 3CZMA 4AS3A 1GFZA 5FB3A 4DIMA 2QVYX 4JBLA 4HS9A 2IWHA 3W3AH 4X62B 4WZAE 2H00A 1DHTA 1Q50A 1SU8A 3FDXA 1P0MA 2DBYA 4CL0A 3QE9Y 2DWPA 4LFCB 1AKVA 4ACAA 4B0PA 1BVRA 1I7SB 1RAFA 2H85A 3L8MA 4WOJA 3W5CA 2BI7A 1CB7A 2PHZA 4TT3A 3WYNA 5EPUA 2DEUA 1QLWA 5LB2A 5JZVA 1Y1RA 1DJQA 1J07A 2EP7A 3ESYA 2EZ4A 4L4YA 2Y1GA 3B9PA 3ZWNA 1BO6A 4QE3A 4P3YA 5C5EA 1SUFA 3L0ZA 2JK0A 2WD7A 3CISA 3QMWA 4P3OA 5G1PA 4A6PA 3IUMA 5AJXA 1Z2PX 4Q00A 4CR7A 1LBEA 1X6VA 3ONNA 4RPLA 4CKEB 1S9HA 1KSJA 3FLAA 3EPKA 4CV0A 3RIEA 2QLTA 3G0HA 4YMVA 2QTWB 2R7MA 2YN2A 3WRYC 4YUXA 5FUYA 2C59A 1V39A 1Q20A 2CT8A 2B8JA 2QZJA 1P61B 5A9TA 3KUCA 1U8FO 1MJHA 1Z0FA 2PG3A 4HO1X 4GX2A 3UG7A 2NQ2C 4POOA 2XZOA 4IQ0A 2HF2A 1PD0A 4RK6A 2IFTA 4DCMA 2QY9A 5EJMA 2NV0A 1TQDA 3FNHA 1E2HA 3K0BA 3O91A 4RO0A 5HQJA 2HXGA 2PZEA 3ZY3A 1LY1A 1UT6A 3FOEC 4GOOD 1WBBA 1RKUA 2JI7A 3ED5A 1QGED 4G4SP 1GDDA 2R3SA 4JGIA 1RE0A 4LRYA 1U3UA 1Z2EA 3MBIA 2XEDA 1SUPA 1P4AA 4E5DA 3IR6A 4BN4A 5DJOA 3TDMA 5EUMA 4KJXA 1PI3A 1OWPA 1NBME 3HLKA 1AUOA 1DAEA 1KOFA 1NMXA 5EHXA 3Q0IA 3DP7A 4UTOA 4WUTA 1T2AA 2O7QA 4UE2A 4E4RA 1E59A 1OZGA 4J3NA 3RAPR 1VHJA 1YHYA 4ZQIA 1OXUA 2X15A 4H35A 2ORVA 3G3EA 1JQ3A 4V39A 4TTTS 2WK1A 4X1IB 5EI5A 5SYAA 3LT2A 5ETJA 3THRA 1ND5A 4YJ3F 4PRYA 3SQLA 3Q11A 1N5OX 4TRNA 4WXYB 3LCRA 1CVLA 2GCEA 3VC2A 1H8HA 1GL7A 4LF8B 2FPUA 4LHZA 1DAIA 2CEKA 3I6QA 3CNBA 1COWD 1VG9B 3C43A 1YF3A 4XJTA 4LF5B 1QP8A 2QMQA 3CRW1 2C2MA 3IP8A 1V41E 1JZQA 1BRMA 1D0SA 1H6CA 1P75A 2LUOA 1KBOA 1EZ4A 2ZBUA 2ZSJA 1TC2A 1FYWA 1D2RA 1M2NA 2FX2A 1E1CA 4P38A 4YMWA 4K9DA 2FDXA 4PPQA 2YCBA 4U63A 3TUJC 4C0QC 1ISPA 3I04M 4MIYA 3U80A 1KI6A 2E9SA 4IDOA 4E31A 4ZEOA 3QOFA 1N2GA 3EOBI 1XVVA 2C9ZA 2AOUB 4WFIA 4YP1A 4C01A 4KQKA 1QFSA 3IA7A 4YFYA 8ADHA 2LBPA 2I7DA 2HQOA 2QVCA 5B1DA 2RJNA 1LRLA 4PANA 1UOQA 4QOIA 1WB9A 1ZGBA 2H4ZA 3MERA 5CH5A 4RWZA 3PIRA 2B6NA 2CKDA 2FQYA 3GJ7A 2O8FB 2DH5A 1WR8A 4LV5B 3N05A 3PDJA 2B98A 3RUIA 3SC3A 1JHQA 2WJJA 4RULA 2CNNA 1JHPA 2Q1TA 1ZD5A 4GH5A 1ZK1A 2N3ZA 3R3YA 5CEEA 2A9PA 3H42B 1FIUA 1GSHA 2ZR7A 3EGDB 4O4IF 4TWBA 2GERA 5T4EA 1WXHA 3RC9A 2GAAA 4DYDA 3LC0A 1MHTA 4C4RA 4L3WA 1AA6A 4BNKA 2IPOA 3BRWA 1DFIA 3C70A 1TJ4A 3CJRA 3N2IA 4UREA 4BVEA 5FWNA 1T6YA 4LYFA 3TAHA 4W1PA 1THTA 2GMWA 2IVFA 2Q6VA 3NALA 1Y1KE 4QL3A 3TTVA 5DTIA 2OFWA 5C37A 4TYNA 3DXFA 2JK1A 4KYUA 3BRWD 1Z0ZA 3CZ4A 4DJJA 1DQZA 1UZUA 3K70D 3VU9B 4JBNA 3M6XA 4QYIA 3A9TA 3VH1A 4I4CA 1XXHA 3KYDA 1I3MA 3G17A 1JHRA 3PA6A 2P4HX 4ZOAA 3NHWA 1DL5A 3A6GA 3GA7A 3L0IB 3TZHA 2FSGA 3EFOB 2ODAA 4MDFA 3JQ8B 1IN6A 1H2EA 3W0LB 1YO6A 2Q99A 3GLHE 3AEQB 3BZBA 3K4PA 3N70A 2ZUVA 2Z9BA 1MH9A 2OO7A 4WKNA 1S1CA 3KO8A 3QKTA 4RA6B 3SKYA 4ERXA 5CFPA 1IHXA 2Q4DA 4IO0A 2XB9A 4XGIA 4Y9TA 4JJFA 1ZN9A 2AN1A 3NBKA 1WP9A 4KN6A 2XRZA 1GEEA 4EZBA 1GZVA 4FN4A 4PBTA 5EZYA 3HXQA 1C3LA 3LE8A 4G5RA 6REQA 2CW5A 2O3RA 4KU0D 4AWXA 4D9FA 2YUIA 1R18A 3CG0A 3EZ7A 3P9XA 4JB0A 2MCFA 4EG8A 1BMTA 3VNUA 4YCMA 2I65A 1HURA 1PTJA 2JCVA 3CGWA 1G9XA 3H1GA 1DCMA 1G5HA 3U1TA 3THXA 2J0QA 1PBNA 1N77A 5AM3A 2FRVA 1VJDA 2H9YA 2YWXA 3LG2A 5DCYA 2Z1NA 3Q3JB 5CB4F 4CKBA 3LZ6A 1MC1A 4ZTUB 1C2TA 3FWKA 4KBFA 3WJ7A 2CN1A 2QRNA 4YP9A 3BJIC 1EVLA 3BL6A 3I4FA 3KAKA 5F33A 1NZJA 3KZNA 3D3WB 4GWKA 4JL5A 5D7BA 3DHVA 2CCJA 4ZRDA 2C7RA 4EVQA 1G3MA 1GT91 4A2CA 2HT1A 3OM9A 3GVPA 3EZXA 3ZCPA 1DOHA 2C78A 2IHVA 2P6PA 3F7MA 1FFSA 4UJ3A 5KAPA 5E3HA 4BYGA 4F97A 1USUA 1XJ0A 1LK7A 5BVIA 1R1DA 1J97A 1T6ZA 2ID8A 4D79A 2ZT7A 1ZISA 2C88A 3VYRB 4JT9A 2OY0A 4ZVKA 1G5IA 1V5FA 2HU8A 5DYWA 5AI5A 3KAPA 3O93A 3MS2A 4KACA 3F0TA 4W99A 2REBA 4BATA 1YZVA 4RMHA 4U0JA 1E2MA 1P3Y1 3UNMA 1DPFA 2K7ZA 3A26A 1GFWA 3IERA 3OWXA 4D0SA 4Y2TA 2BSAA 1TU3A 4DUGA 3DLPX 3QX8A 5CEJA 4PFSA 1NW5A 4PN7A 1DRVA 1O77A 2VXBA 2QDKA 1IBMB 1QO0D 2XF8A 3EC1A 5I4KA 1FX1A 3A3PA 1KHUA 3FUWA 5K8VA 3GLVA 2DZDA 3B89A 1KF0A 4HH3C 3AF2A 3NAGA 4KFUA 4ZDKA 3BF7A 3EN0A 3SZGA 1Z5WA 2QUHA 2JG3A 3ANSA 3VGJA 2H6EA 1LDMA 5TMEA 5DM2A 4PHHA 1NXWA 5E6RA 1J8QA 2A9KA 5EHQA 3OQJA 5B3JA 1YB7A 4Q05A 4CMEC 3DD5A 2BH2A 1Y5MA 3OMXA 2PGIA 1LD3A 3RIHA 1QAMA 3B60A 2XJ4A 1RPTA 3CB4A 1HZZC 3Q7TA 5KYXA 1HKUA 2JJ1A 1JQAA 4TQAA 1OSNA 2MYNA 4Y2YA 5ALOA 2EFYA 4FKMA 1XNQB 3SI7A 4G56A 4YJHA 1NVTA 1Z33A 2ENWA 4JKIA 5F12A 3VHLB 4YRGA 2C96A 2GZ3A 4XYLA 2QLBA 2XMDA 3F6BX 2TS1A 4HSGA 2WR8A 4GKVA 5LP6A 4W8HA 4L5BA 4UU1A 3M5CA 4UM5A 1G4UR 4P84A 3OEHD 1KO7A 2O3UA 1L5ZA 4L7QA 3N0TA 1VKNA 3JQQA 4C0SA 4J7AA 4XW2A 1T29A 4OATA 2O48X 4EGFA 3DMNA 1Q0QA 1WU7A 3OOYA 3T4UA 4NZOA 3UICA 2BR5A 3AR6A 5CAEB 2CK3D 3RE1A 2GNOA 1XI2A 3OJFA 4D9JA 2WYVA 4N18A 2F2TA 3T5DA 2NVOA 3KEMA 1ODIA 3SCZA 1FXSA 4BLOA 1B4DA 2JJMA 2H3HA 4FYXA 1YNSA 2HRZA 2JGDA 3D6HA 4HH1A 2PZAA 4BFWA 4DL9A 2I7TA 5KTMA 2F4NA 3SS7X 4P5DA 3WZ2A 1YGYA 2D5CA 4KLRA 4YMIA 3VAZA 1FBTA 1CIVA 1ORWA 1T9BA 4GUAA 4PO3X 5CA0F 1XYGA 1O89A 1Z17A 1A88A 2P0EA 2NM0A 2ZYIA 1VBFA 4PZZA 2XLCA 3H2SA 2RGNA 1SU6A 2F1KA 3FCOA 3O95A 1CC1S 4L0DA 3VKUA 4BWGA 5IUNC 1OA0A 1SZJG 1ADJA 1AUVA 5HOEA 1UUFA 5CW1A 1FPMA 1VMDA 4X91A 4BNDB 1Y98A 2OYSA 1P17A 3L4JA 3H8VA 4KN9S 3HH8A 3W2EA 4CDRA 3W5UA 4AQYB 1XNRB 1D9XA 3A04A 4UFOA 4ZOCA 1ENZA 3HJRA 3OFKA 3LBYA 4G84A 5LKRA 4D5EA 1O94D 2GAOA 1CZOA 4FMPA 2YDYA 5MF6A 2W2OA 2YIJA 4S1OA 4BKPA 3O8CA 3H0EA 3JVVA 3W8DA 1GGJA 3A9WA 1AV7A 3C4JA 1MEEA 3FX2A 2WPNA 2O2ZA 3SWWA 1QZZA 1M1YA 3MT0A 2D1YA 4FI3F 4IYJA 1BU5A 1IL0A 1C0KA 5L3QA 1SQFA 5LR6A 2JLZA 1AGNA 2ZP1A 1V5WA 1F6WA 4GLBA 4HYYA 1B73A 5LM3A 1PEKE 2P91A 4M99A 3RFTA 4DRYA 4ZN6A 2YRWA 2Q9CA 5DGCA 4R0MA 4LK2A 1QYRA 3IAHA 3NOQA 3B36A 2XQKA 3RRZA 5ENVA 4AZSA 2VJYA 2ZPUA 1MO6A 2C8LA 4I08A 2BW0A 5JVDA 3A4VA 3K0CC 4GXTA 2PWYA 2AUNA 4DQKA 4DLWA 3OCZA 1MJNA 1P9LA 3A77A 3KB8A 3R0ZA 4FJ0A 2FJUA 3CUYA 4PRZA 4GVPA 4HRAA 2GK4A 2H92A 4IAOA 3OTHA 3ZUPA 4DNFA 1E5LA 1OU4A 1SWWA 2L82A 1X0XA 3CW9A 4PYKA 4RBNA 2ZYVX 4JLSA 3H4VA 2IOQA 3H5AA 3F6SA 4MMYB 4R7ZA 1TCCA 2B92A 2HIAA 4GHWA 4G4GA 1VJGA 4FUTA 2C95A 4A16A 1SA0B 1PDWA 1CDZA 1VYVA 3GPDG 1VL8A 3MFYA 5BN4B 1B0ZA 1NPTO 5EVCA 3S29A 4MUIA 1DLJA 2J3HA 3HCWA 1VE1A 2J8ZA 4KQFA 4O63O 1P0QA 1QZTA 1G5PA 1R0XA 5JRDS 2D2VA 4YAGA 2PXHA 4PLFA 2O2GA 4WXRA 2YNMC 5BWOA 5IHXA 3AERA 3HEBA 1Q7RA 4GM1A 1H1DA 3ZU5A 4ZZ3A 5LZ9A 4EARA 4YAOA 1V37A 4I3HA 4OIFA 4Q34A 2I1LA 2JAQA 4LYAA 2POQX 2HWKA 4E09A 4PAOA 3R40A 1QX3A 1KMCA 2GXUA 4L9AA 3GWGA 3ORRA 3GOQA 2XGGA 1FSSA 4S05A 5BW5A 2KS6A 3DYBA 5CM8B 3T9BA 3HBLA 4A82A 3PC8A 2PMBA 4BBJA 4G0XA 3PQ8A 1R27A 3EDYA 2B8NA 3CRVA 3AVPA 5IBPA 1TT5B 1H0RA 2D8MA 2MWMA 3D7RA 1A9ZA 3CCBA 3JWJA 4OHOA 3U3JA 3RKUA 3D4LA 4HTFB 4QJIA 2IQ5A 2Q8PA 3L1VA 3A2NA 3CC8A 3I42A 3QTTA 5F7ZA 5JDCC 4H17A 4QELA 5FR2A 2YN0A 1S01A 2XZTA 3S1AB 3R3ZA 3HLYA 2XMCA 2BDEA 9LDTA 2ZK7A 5LXTB 3MWJA 4LJYA 3TKLA 1EK1A 3B3QA 5CXSA 2ZATA 2GTPA 2C4VA 2DPGA 2ZTHA 5BYAA 2OUKA 3AVVA 4OXKA 4OPMA 3JQBA 2VEDA 3ROMA 3F4LA 1RM4A 1ZHFA 3T0GA 5JANA 1L5FA 1P2FA 5G41A 2A33A 2LIPA 2OGWA 3O1IC 1Y1TA 2KB0A 1Q83A 3FJYA 1HL3A 4X61A 4AN4A 4BBAA 4BB0A 5HJEA 1ATIA 1SXPA 3CH6A 3P2OA 2RDMA 1W5BA 1X9IA 3H1PA 5H4HA 5JYEA 4Q1FA 1KRHA 5IT9A 3R23A 4JLUA 4HWKA 1QXSA 1Z08A 2GK3A 4C7JA 2AKYA 1GY8A 4UNNA 3VHXA 1K4YA 4B5LA 1FQJA 3TQCA 4XDHA 2UZ1B 3F5MA 4R8SA 2AOTA 4F06A 4LJRA 3C0KA 1YRYE 3HKCB 1BMDA 3CUWA 2X77A 3H2YA 4J0GA 4JQCA 1C9MA 5TX7A 4MV0A 3SC2B 2HREA 5KTSA 4I46A 2FFQA 2O8NA 2H5JA 2O57A 5AVQA 4QOJA 1VA5A 3OTOB 1ZUHA 1DRKA 1K8ZB 4M0PA 4WUVA 5KNBA 4AUEA 4P0TA 4OJMX 5F2KA 5JRZA 3L79A 5DX8A 4RNDB 1T1GA 2C4HA 2A0TA 1CFJA 3DHYA 2R751 4MUYA 4M1YA 1KE1A 3ZX5A 3JD1A 4MHOA 1JT9A 5FPQA 2YC2C 3IP6A 4MR8B 1IM8A 1DVRA 2VHUA 4F84A 2VI5A 3DEHA 1FTNA 4HHEA 2IEZA 1TUEA 3H9EO 5FWYB 2I0FA 3VHRA 4MMXB 3OSUA 1UFVA 3B1JA 1W29A 2ZUEA 1AX9A 1MG5A 2PVSA 1GPMA 1R16A 3HCFA 3N5KA 4NMHA 1RXWA 2NZUG 4QD3A 3AB8A 1I4TD 4CHGA 4W4TA 5C1BA 1E9RA 4ER5A 3OT1B 4CG1A 1MB3A 2GEKA 1DB3A 3IEXA 1DDOA 1W96A 4MV7A 3WX0A 1PT9A 4KIUA 5HSGA 3GRAA 1D2AA 1E2EA 3O5AA 4LUCA 1H2WA 1F20A 3IP9A 3OFJA 5SYNA 2PUFA 3R5TA 4MQBA 3WIBA 5A0TA 1VE3A 2HJSA 4N0EA 3AW9A 4RJJA 1THMA 4G97A 1VI5A 3CR7A 4ZHQA 3R3UA 1ISMA 1RWPA 1M6VA 1NDHA 2W2MA 2ZJ5A 1D1SA 4AUKA 1EWTA 4KZPA 3QTBA 3VR2D 4DA9A 4DSOA 1HE3A 3S0JA 2DMRA 5DOVA 1PV2A 5T4HA 2EAUA 5BWCA 2H1IA 1UINA 3O7WA 3OPYI 3QGMA 3M4ZA 3WL8A 5HXAA 5GADl 1M6HA 1ZPDA 2FRDA 1FCJA 5HE9A 4YAFA 4I9NA 4JHXA 2IY9A 1X7ZB 4PQGA 1GTVA 1XD2B 4HDCA 1MR1A 4Z4EA 3VNBA 4IILA 3BS4A 4PFJA 1DIGA 2VP6A 1GUZA 2DWCA 4EY8A 3AQ4A 2VCHA 2ZJ3A 3QBEA 4CPDA 1HDGO 1P5RA 1V5IA 3AF1A 4G1UC 4KO4S 4LE2A 3SQDA 4ALKA 4D4MA 3CINA 5DHRA 1Q15A 4C3OB 5KOIA 1AZTA 1DEAA 2PRYA 3O26A 3D4OA 1HDIA 2UKDA 4I5DA 4RXTA 2SHKA 4JR2A 3KKKA 3D7NA 4HSEA 4K8RB 3GLGA 1A71A 1I33A 3F78A 1K0FA 4KFTA 4O2RA 3LDGA 2B4TO 4KV7A 5A0VA 4MW1A 3ABQB 4NU0A 5FR1A 5A5DA 1CR6A 2Q7DA 3WIEA 2V1UA 1PV1A 2R1TA 3RK1A 3IEKA 4L4RA 2PGXA 3TCKA 2D74A 4ZWNA 2GO1A 4N47A 4TYPA 1E9CA 1DD1A 4MUXA 5K0SA 2ZTSA 5ALTA 4CIAA 5GIPE 4A4YA 4B7CA 2VP2A 3D3KA 4FEAA 4LDNA 4HMQA 3WIUA 3FM8A 3C8ZA 2ONJA 5GVRA 1N1EA 1ODSA 1SHLA 4RZ3A 1R0LA 2IGTA 1KAQA 4Z86A 1G2PA 1GRRA 4MKGA 5DN6A 1U8YA 4DLBA 3QNWA 1TXGA 2FRXA 2GFQA 4MEJA 3R9KA 3P2KA 2BE9A 2XMPA 3KQUA 3A3OA 2DOKA 3NMUF 4N1AA 1P2UA 2VHEA 4CCSA 4FB5A 4BQNA 3JQFA 1R5OA 2J41A 2ZJ6A 4LDPA 3W8NA 5GJVC 4NNPA 4TKVB 3WBFA 2QE7A 2OQVA 3G5AA 3GBPA 3WG9A 4HBGA 2PWPA 4HV4A 4PN3A 1XT6A 4LIPD 3BDVA 1XUOA 3ILYA 3VZSA 1C9DB 3E3AA 4ENTA 5IXSA 4B6QA 1KU6A 2OWEA 3EX7C 3JVIA 4X3CA 1XLWA 2JGIA 1TPYA 2F3SA 2X5XA 4G5QA 2Q3CA 4ZJZA 3MCWA 1YOVA 1NW7A 1V96A 4AO6A 3HFSA 1KAHA 5EPOA 5DHAA 3C3YA 5ABPA 3KC2A 1OIVA 5KJ6A 3TSCA 4C1NA 4M0FA 3RRNA 3WS7A 2O54A 3D64A 5HIMA 3U13A 1UDAA 1G6HA 1T2VA 3VDQA 4ML3A 4X6LA 1NRXA 3AEQA 3M6WA 5B58T 3G49A 3ZOKA 3T41A 2FW6A 2DG2A 4A2QA 1QMGA 5CB0A 5A3VA 5K99A 5LYJF 1RHRA 3N75A 1KC1A 3MJRA 3KLNA 4QBKA 2B8WA 4R83A 5K0EA 3CNQS 3ESXA 1JALA 3RTGA 2R8RA 1PLKA 2FKAA 3I2IA 1E3QA 2FJ0A 1W73A 2AD1A 3AILA 1DE0A 4ZEWA 1MAHA 4DCSA 2M98A 2VWHA 1M6WA 2QAJA 1FXWF 4D4LA 4CFSA 7MDHA 4OGKA 1LI5A 1V5GA 3VSAA 4BZXA 1U9ZA 2WIDA 3P0HA 4RMIA 5D3MB 2FQQA 3EAFA 3MJFA 1GSIA 4TVKA 1WOMA 1M76A 3KUDA 3UJPA 4J7CA 4U7WA 3FLMA 4UZEA 5ES3A 3OCCA 1IDN1 4PX2A 1DQYA 1KH1A 2YQ5A 3M4YA 5EHNA 3PICA 1N3IA 1G9TA 2WD9A 3N5CA 3A1FA 4QTXA 3T8YA 2JEZA 2BBSA 4IUCS 4QWWA 2I66A 1ZCBA 2DUNA 3KWLA 1FX0A 1OXSC 2FUNB 1P19A 2HF9A 1PR1A 4YRQA 2I34A 5B3AA 3ROFA 5A6VA 2ZREA 2OCIA 2QPLA 1TECE 4AJ4A 2C94A 2X5NA 3QMPA 4MVJE 4MA4A 4YJGA 1ZRHA 4WRRA 1E20A 1Z7EA 2OHOA 1UBRS 1Z0DA 4PLYA 4YJFB 2BFNA 3UUEA 2PGAA 2AWOA 3TZBA 3H4TA 5TQ2A 4Y3UA 5LIPA 1MLDA 2Z1MA 1W48A 2OOSA 1SU7A 3AINA 4U1RA 5JH7A 1D8TA 1MQSA 1P2GA 2VDJA 3PYXA 5ALFA 3G0GA 3TZEA 2EIHA 3HN2A 1NQOA 1ZK2A 2IXBA 4EFMA 3LHFA 5K01A 1BS9A 3FJ1A 3IE2A 1PQPA 2WSIA 5ITVA 3INYA 4OHBA 4NMLA 3MD0A 4E15A 4QO8A 3TAXA 1DXQA 1YASA 2ILVA 5EIHA 3DEYX 4ZVQA 4O8CA 3UOWA 4NJMA 5HM6A 2HCJB 5FL7D 4DLXA 3IJRA 3CZRA 3IQXA 4OQEA 4GOKA 3RS5A 1FVFA 4DR4B 3MRTA 1D7OA 4DY6A 2AKAB 2VL7A 3OIUA 1N78A 3II6X 3SLRA 1JA9A 2D0PB 2QROA 5LU9A 3AZQA 3DKRA 2ZROA 4RVOA 4DS3A 4R1UA 3CCFA 2IIVA 1C7JA 1T9GS 2BGTA 2VYQA 3HA5A 2WJVA 1EFLA 4PYNA 1PYGA 3Q72A 4Q9AA 4S2EA 5CJ2A 4G4JA 3EXEA 3PL5A 3D8BA 2MINB 4UUPA 4YALA 4B3JA 3PX7A 3MELA 2LKDA 3RRFA 1MVNA 5AK0A 2P5SA 3E7PA 2KE5A 3JYLA 4GMFA 4OQQA 4GS5A 4RVSA 4CCAA 2PUBA 1EJ6A 1PZGA 3DDHA 2CDAA 1NAIA 3P9CA 5KTOA 1M33A 3A31A 2PL5A 1E79A 3ETLA 4NCBA 5CA0B 4IEEA 4TTQA 3X44A 2JH3A 2VT2A 3G1TA 2I55A 1RCFA 1KY5A 4MV1A 5B1IA 4BO0A 3AIOA 1ENPA 2WP0A 4TLBA 5JS6A 1OMOA 4DBLE 1QF6A 4RDHA 2XY4A 2OBBA 2OQIA 1SK9A 2ZDGA 5DKFA 1ISHA 2DFPA 3D1JA 4QXMA 4DG5A 3LVQE 2I99A 5GOTA 4F86A 4F5ZA 1JDTA 3RU9A 1I9CA 4EUEA 1JR3A 5HDQA 1X1EA 2CLFB 1MO3A 2CB0A 5D86A 5BO5A 1XELA 2WUWE 3HJAA 3SX4A 2BONA 1LLDA 4NXNB 5JWHA 4MWSA 3LPDA 1GR1A 4L4UA 5K3AA 1XHLA 1I4EB 1VFNA 1G88A 3UTDA 5TJ9A 2B3TA 3NQ41 3DE6X 3JD0A 3NHSA 4UPVA 1JAXA 2LWIA 1Z06A 3RU2A 3RVJA 5LDDC 3D81A 4GBGA 4FILA 1ICEA 1RS0A 2VVTA 5D3ZA 4YT4A 2VP3A 4E6EA 3OOHA 4TRJA 4B4UA 1Z4MA 4TLCA 1ZXLA 4TTSA 1F1JA 3CW8X 3IEPA 4GP7A 7YASA 3U6KA 3CLHA 3U4IA 1SUSA 4TPKA 5A1TA 5AI4A 4LRXA 1E9AA 2VBGA 1QLHA 4HPWA 3BRQA 4LX8A 4XLZA 4BNDA 4I55B 4J76A 4KNYA 1J8DA 3OFSA 4P35A 4Y9SA 3LAWA 3LHSA 1NUUA 2HGSA 2P1ZA 3FRJA 4RHUA 4D97A 1EHCA 3TL2A 1W0JA 1YCFA 2J3KA 2QSUA 3AUXA 4NRDA 4C5CA 2GB4A 3DZGA 4QGFA 3GFSA 4BNNA 3QNMA 2JLYA 1NVVR 5F9FA 3ETEA 2D2IA 4QLAA 1SHTX 3CEJA 3K0AB 3PQ2A 4NESA 1FOEB 2YVLA 4OB8A 1IQUA 2JIRA 5EESA 1ZUWA 4D8WA 2V8OA 1YZKA 3EPPA 3Q7SA 5K0NA 2OA0A 4JGBA 1BDMA 3M6IA 3BTVA 3DG9A 4DYHA 1T6BY 4JXJA 4XX0B 4RELA 1N0VC 1Z5GA 2YWJA 2BM0A 3NDBB 1D0IA 1GNTA 1HYGA 2VJAA 4QRIA 1P1RA 2AFHB 2BISA 2YHAA 4B2IA 3GB9A 2YVQA 1W44A 4GF5A 2Q5HA 4KWHA 4HAIA 1GCAA 3OTGA 5EWLB 4PSUA 2FPGA 1US8B 1WZCA 2HCRA 4J3FA 2CMGA 1H1LA 2UZAA 3K70B 1HH4A 1SBHA 2DKFA 2YBEA 4JU9A 4LN1A 2QYTA 3ZE9A 1NW8A 1IEXA 3ZZ1A 4AYTA 2J7PD 1U2PA 2I8LA 1TQ8A 4P4UA 1LU9A 1EVYA 5BN4A 2O6LA 1CJKC 1PJ4A 3C97A 3R6LA 2DTXA 1BD3A 2C4KA 3TSZA 3IV9A 5JJIA 2PCJA 3UXYA 2VQFB 1IIRA 1O4VA 2NUTB 5A4MS 3I5XA 2QJTA 1Q22A 4V0OA 1T4MA 3P9RA 3OZWA 3GEIA 4UHBA 4Z9XA 3IEVA 3WP0A 2XA2A 4A0QA 3P7MA 5IJ0A 1BOFA 2R5WA 2GM5A 1XQ9A 3QXCA 4M7PA 1SUEA 4MS3B 4CEHB 4ZQEA 2WJHA 3R7FA 3T4XA 2XRMA 5DTMA 1YMVA 1K9SA 4LZJA 5DP1A 1MOQA 3TO5A 1RRPA 3OCYA 3PUJA 4QUKA 3S7TA 2GJ9A 4DANA 3ZV5A 1ZM2A 4FHEA 1YA6A 5IP5A 1J0CA 3HR7A 1BHO1 3MBKA 5DNCA 1KVRA 2BMAA 1XEAA 5GQSA 3FYUC 2JAOA 3CKMA 3EGXB 3R8CA 1Q16A 1WIWA 1MVLA 1PFQA 1CJMA 1TT5A 1XD8A 2R6AA 3AEUB 1EVZA 2I71A 1TTQB 1U1EA 3A1WA 3DNPA 1K89A 3I04A 3JYPA 5B7GA 2VJBA 1UKZA 2VJMB 3CY6A 4EB6B 1MNQA 2WIJA 3L93A 4UCXA 1XRJA 1AHIA 5IVHA 4HR7A 4PCUA 1CY1A 4D3YA 4G5FA 1D09A 1F4VA 1TT7A 3DE3X 2RJOA 1E1NA 4UARA 4KUHA 2RC6A 3I05A 5CVEA 5JG7A 2JHFA 1WM1A 4U9IS 1JT2A 3FYDA 1HNXB 2G5PA 5HS4A 3DZCA 1EWKA 4IV0A 3D8UA 5TJHA 3WAJA 1WSDA 2BEVA 2GD2A 3L02A 5A2GA 5HRAA 1IUOA 1F8YA 4TQUS 1O6BA 1ZIDA 4KWTA 1PWZA 3OMWA 3VR6A 1V16A 4BUZA 3OQ1A 4EFNA 2XXAA 4BGIA 3NEAA 4JUCA 4OK6A 4EAAA 2RHJA 3STXA 4PGAA 4BQOA 5KOJB 4YLGA 2EATA 4DG9A 2R4QA 1RQPA 3L43A 4PZAA 4EW3A 1XTUA 3N7UA 4CKCB 5IVPA 4OLFA 3F6YA 1PJ8A 4RF2A 4UTXA 2FEOA 1POXA 2JD2A 3EGEA 4ESVA 3G2IA 2HPHA 4MPTA 1C1DA 5C8DA 1WKCA 4PZEA 4LSWA 3KKEA 4X54A 5BSVA 5AHRA 5FJIA 1JG2A 1YHZA 2AYXA 1QJCA 2PH1A 2CVFA 3HKEB 3PUVA 1UJXA 2PZMA 1FU4A 3BMQB 2O5VA 1CUFA 3O74A 2B6HA 4AKIA 1P31A 2ZBRA 3ESCA 4KYTA 4MMZB 2XODA 4A0EA 3DEIA 1ORTA 1SUIA 3JW8A 3PNSA 4R16A 5KQPA 3VYTB 1KP3A 3EW7A 3CSUA 4KCGA 1M2KA 5ER6A 3PITA 4TS3A 2IC5A 1Z68A 1Q6YA 2UUPA 3AI3A 4F8YA 1SAYA 3ANLA 4UEQA 4M89A 3OUNA 3W1EA 1T5SA 3ZWYA 4AJ2A 3LPLA 2P3LA 3ZE6A 1QH8B 1QU5A 3F3MA 1RHJA 3EZLA 2ZUWA 4FLFA 4A1OA 1UC8A 3J81A 5KUTA 1UFOA 1L1FA 5KX5F 4TTJA 3U62A 2MU1A 3GJZA 1AUPA 1S2OA 4YJ3A 3JYNA 2L17A 5JHHB 3ZHSA 4C7VA 1SR8A 2R62A 4GL4A 2OVBA 3IFSA 4F4CA 4XOUA 4X7MA 3DTNA 3WWDA 1JFTA 2WUGA 3SY8A 1SNYA 1HEYA 2XWSA 3EYAA 1JKFA 2F4VB 3E9YA 3SE7A 3AQIA 4H7HA 1KEEB 4N8DA 1MOZA 5E6UA 4D56A 5KU1A 5CHEA 3VR1A 3EWAA 1Z36A 1XEFA 1MN6A 2WLTA 4OJQA 4EBFA 2QBYB 3H7IA 3T1QA 1A97A 1A9TA 1G21B 1Z8FA 2DAPA 2XKAA 3CPJB 3LPNA 4GPIB 5DH9A 5C1DA 4NHOA 5HF5A 4ZQCB 1CG6A 1EEXB 1Z07A 4FDVA 5TMPA 1Z37A 3SM3A 2AB0A 4EUSA 2NNLD 4J1TA 2XNDD 4HZIA 2DBRA 4IFEA 3AF0A 4NZYA 4ZEMA 3C3CA 4NU8X 1FSZA 5GM1A 4GC9A 1MF7A 4QYXA 1I2BA 4D8UA 2PLNA 5F3WB 1JLKA 4N5NA 1P1HA 1PO7A 2A5GA 2XMSA 1M74A 4AD8A 3J7AC 5KDLA 3ZDXB 3I6UA 2OV4A 1SCAA 4FHCA 1J4LA 1ZK4A 4MAAA 2WI8A 2WPDD 4HB2A 1GTRA 1OKKD 4F5YA 1U1IA 3A6PC 5F7OA 1OV6A 2A5YB 1YULA 1VIYA 4O4IA 4WLFA 2C4TA 1OHHA 3LECA 4JYPA 5NULA 5EJAA 1AIPA 2ODPA 3FCCA 4B3CA 3AVWA 1YR9A 1EMDA 2GUWA 5IM5A 3WB0A 2I91A 1XZDA 1MW9X 3L0CA 2GZ1A 5GZ6A 1QH9A 3K9HA 2FN7A 1JLLB 1OHHD 4X93A 3NR2A 4OG2A 3QZUA 4TUYF 1ADFA 5E1OA 3E1SA 4Q7JB 5AOVA 1KPGA 2R85A 1UQTA 1C30B 3IQFA 5K3BA 3Q98A 3GCDA 4K5QA 5F21A 1NDQA 2WLSA 3GRUA 2PRKA 2FN8A 1SBYA 3E1KA 1QGUA 4P86A 2Q1WA 3EPRA 5CDGA 2HXSA 4M9XA 2MSWA 4DGSA 1YL6A 1G20E 2WHXA 4BWFB 3O4HA 2A59A 2VDOB 3R7LA 4CIBA 4DEYA 1ZVKA 4I1RA 1JMYA 1N8KA 2PWZA 4PSDA 1G7RA 3AKYA 3QSYA 2LCIA 2ZETA 2QAGB 2FG7C 1E0SA 4PINA 1L4LA 2IT1A 3TRHA 3DQPA 4LMAA 3TF5A 3FVWA 4GSLA 4TL7A 5CA1B 3CX6A 3K0FA 1XVIA 2QD1A 2IXGA 2ZM6B 2ZAIA 2FW0A 4PBRA 3O3MB 1RSZA 5DE3A 5CDUA 1RPJA 3NIDB 5KDOA 1ZD3A 2IDZA 2QTBA 4X9XA 2JASA 2PKRA 5HKLA 1T8RA 5DI3B 4Z7NB 4KHPB 2EQAA 1V8FA 2GYYA 3DUWA 4S1WA 1F0YA 1S7GA 4M4SA 1SC4A 2ODTX 4BLWA 3QWAA 3ZTTA 4CQJA 5CK5A 4IKEA 3C2QA 5DYGA 5CB4A 1TLLA 2EW2A 2WJ6A 3BZWA 5AVJA 2GBLA 1S2NA 3BXXA 4ZT3A 4NDAA 3O0TA 5DYTA 3Q8LA 2IS6A 1H2BA 4I1UA 3WA7A 3VMFA 2EYQA 4FBGA 3LUGA 2JFFA 2D3WA 1DBVO 5CDFA 4KBGA 3IVCA 1SO8A 4O3MA 5CJJA 2C5GA 4M36A 4AYXA 1GQFA 2CNKA 2YBDA 1GLNA 4ICIA 4RSMA 3LMKA 4J75A 1IXYA 3L7DA 3HQ4O 2Y92A 2YFHA 2OWDA 1GP2A 3BL8A 3CE6A 2CDCA 2VH2A 4NJOA 5A04A 4LMBA 3P20A 4LZLA 3ZKAA 1Q17A 1FNDA 4IDNA 4D9BA 1W5SA 1AHPA 4OA8A 3O8RA 1KPHA 5FTWA 4ENQA 2ORIA 4YCNA 5HUHA 5GGYA 4W5HA 3TQTA 1T9GR 5JZBA 5AHKA 3HVKA 4DA6A 3TG8A 5J4HA 2I6SA 4QBHA 4Z0NA 1OXTA 1ZIOA 4ZZ1A 2PUHA 3LY9A 4BCBA 5IUJC 2REOA 2W98A 1HQDA 1JX6A 4LC9A 4DZRA 1G3RA 3ZHUA 1CZHA 2QUAA 3FWYA 3LFUA 4IFIA 3N28A 4DSUA 4OP2A 1U2QA 3NP7A 4WK0B 3TIGA 1B8UA 2WBLC 2F48A 2CXOA 4WLUA 1Q57A 4DIBA 3FPBA 1HNWB 2H1FA 4M7RA 5JCXA 4IUBS 4RUKA 3SJBA 4C2TA 2YQZA 1MX9A 2AZ4A 4Y67A 2DFVA 2C07A 4PX3A 2CHEA 1FFXA 4ENPA 4PGMA 2QAGC 2P9HA 4ALNA 4A2WA 4W5JA 3WAGA 1FRNA 3SEAA 4O33A 5KCMA 5CBPA 2P2ZA 4JEIA 1VPTA 1NFQA 1XSEA 2J9RA 3QBVA 4G1MB 4QLBA 1N6NA 3N39C 3MSCA 3OAAA 1W52X 1DCKA 3FOCA 4FCTA 2KKLA 1ADGA 1CY0A 4WZAB 3BA1A 3TVTA 2GN1A 3ZGLA 2Z3WA 3ND7A 1CYEA 4MLPA 5BW4A 1A9PA 1IBRA 1TZCA 1YJCA 4N5MA 4P92A 2BWJA 3OI7A 5CLIA 4M54A 1JA1A 3PVCA 2Y71A 3PE6A 2ZIUB 3ZDRA 4ITRC 4S24A 3Q8XB 4EHLA 4NL4H 2F1IA 3VJLA 1AJEA 1PWHA 4QUIA 4DG8A 4AJ1A 3FZQA 3JY6A 1CK4A 4KXNA 1HDXA 1A7UA 2MYTA 2EARA 3Q87B 2VP0A 3NWBA 4LY3A 2Q4OA 2ZLBA 2L19A 3JARB 4G0ZA 1MNAA 3X2EA 5FEUA 5HUJA 1M2VA 1MQ9A 4HG2A 5DM1A 4ZDWA 5A0FA 3T3GA 4YJ2B 2FPXA 2JAWA 4P2BA 1QC5B 1YZ3A 4HJXA 1J56A 2A6PA 1S4MA 1I2CA 1MO5A 2EX1A 3AESA 3CJTA 4RLHA 5CA0A 3EEYA 5B1YA 4QM7A 2O8FA 5LOVB 4JUAA 3WMEA 1JLHA 3MTJA 1CLEA 4OEHA 3KLOA 4CFZA 4YN3A 3AHIA 1YFLA 3IBCA 4PYIA 2FZGA 2JRCA 1K63A 1T3GA 2Q5CA 2XVYA 1HFKA 3JWPA 3QMVA 5KYTA 2Z6QA 1VXRA 2FFRA 1R8SA 4BE4A 4LV6A 4QATA 3ZJ4A 1ZI6A 4D2IA 4DMGA 3V2IA 2ID9A 3ZJUA 1M8KA 5ALDA 3TFOA 1X74A 3H2IA 4V0SA 1CUEA 4FP9A 2JZOA 4I8XA 1RJ9B 2EF0A 1Z4LA 2P9GA 3I2GA 2C98A 3O4VA 4MI6A 2ZU0C 3B7PA 1JVBA 3QP9A 4Q3OA 5AHOA 2ONCA 3EZGA 2FPSA 2OMEA 4OA5A 4U7FA 1I7QB 1XOIA 1X1TA 3G5TA 2DLDA 2WU4A 2Z9CA 4JOQA 3CNNA 3V8VA 2ECKA 4TWZA 3GT0A 1K8YB 4PFKA 4JI4B 3EWNA 4XQEA 3CE9A 4C88A 4F45A 3OLQA 3V2UA 4MUAA 1RXUA 1KIMA 2Y4NA 5EVJA 1J0EA 1QH1B 5E3IA 4PNZA 5EXPA 3VKWA 3NTVA 4X20B 4GXQA 3WRXC 2YKGA 1I9GA 1OFHA 2FLKA 1CY4A 2DTEA 1JFRA 2HLPA 3F7NA 4P3KA 2W6MA 3OU6A 3TFWA 2B7CA 1CUWA 3FSJX 2Z98A 3F90A 5CT8A 3RRBA 3HDYA 4LS3A 1MTZA 2OCKA 2PX5A 2BC9A 4BIMA 4DN6A 2PX4A 4FFPA 4MQFB 3DMYA 2IITA 2HYIC 1HGXA 1K7YA 3S4YA 5FNVF 3O8QB 4U7DA 4HAVA 3V8PA 5K3FB 1EM6A 1UM9B 2Z08A 3OFVA 1UHTA 3FCUB 3P4UA 5CNKA 2JPEA 5I4IA 1XXLA 2JIZA 4UAGA 4E1AA 2QL5A 2V55B 3GC6A 4MTCA 4ZP1A 1YS4A 1NWHA 3T61A 1DSSG 1W93A 2O2CA 4JYAB 3PD7A 3PNBA 5B1HA 2JLRA 4RESA 3KTOA 4G0WA 5IYZB 3RUEA 1NWCA 1CUXA 4MW0A 4ZCSA 2BTQB 3LGSA 4L72A 3DVAA 3LCJA 1HETA 5MGBA 5IARA 2CD7A 5I47A 1YE3A 5D51S 4BQIA 4BWVA 1JI0A 1TZMA 1ZNWA 2HK7A 4FGUA 4JQYA 4WDRA 2OFXA 2ODBA 2CUKA 3FDZB 4BU1A 3Q5EA 3BGWA 1J2JA 1COZA 2ATVA 2AN5A 3FETA 3W4JA 4FE7A 4GO1A 3TG2A 1V1RA 1VSBA 4OJTA 4DC9A 5CG1A 2FZEA 9GPBA 3KM0A 3N1UA 3RD5A 2CVHA 3RREA 4F71A 1C3JA 2QGZA 3KWMA 5K0CA 3GJ3A 2GEJA 4L8GA 4IDFA 3BFKA 4AF8A 4IPTA 3M1LA 1Z8NA 2CXPA 3DF7A 5C1OA 2VPYA 3TD9A 3UAOA 4JP3A 1W5EA 1VG8A 1XIVA 1IC6A 3OHSX 4CRWB 4KPUB 1CQXA 4QASA 4DPLA 1XKTA 4B6FA 5IT0A 2LD4A 3GLHB 2NUTA 2BZGA 2ODWA 4HGZA 1PT8A 3CR8A 3WDMA 3FTFA 1BCSB 1R12A 4F5WA 4Z9AA 4CL2A 2BFOA 2XA1A 1RMYA 2JH9A 1XAHA 1KMIY 1L5YA 1T8YA 4PPFA 3W77A 4NU6A 2YZ2A 5CNJA 3TCNA 3WHLA 3WKCA 5AK6A 3COJA 1LSUA 2YV5A 3PNLA 2ONZA 3GLFA 3DEJA 1FZQA 2E89A 2AJ8A 4RD4A 4RFLA 5IDQA 2PZLA 1EFPB 3UN0A 3N2LA 3F7TA 3ICWA 1U0GA 3NNSA 4IP0A 5F78A 3BGDA 4II2A 4CMKA 5CLHA 2X2FA 1GVHA 2PRJA 3D2BA 4G24A 3KJIA 4LXXA 5BUQA 4KITB 4I1PA 5JS7A 2ZUBA 1BHSA 3G85A 4NZZA 3EGXA 4WXHA 3OZDA 4W5QA 3V1MA 1A2BA 3I34X 4KVFA 3GEPA 3GFGA 4LBYA 3N87A 3OVMA 2ID7A 4TKUA 2O8EB 4N49A 1D4OA 3GQBB 2I87A 1LJ8A 2AOVA 5L95A 3X43A 2BEWA 4G65A 4C78A 4WDQA 3IVXA 3HV2A 3QVTA 4CF5A 4NBNA 5LL6P 1QPGA 3H1BA 3DDWA 1RQ2A 1ZG3A 3OCWA 4ZOLF 3R8FA 1NXQA 2D0IA 2P9QA 2WKRA 4YRCA 2IXEA 1NYQA 5K05A 4M9CA 3L9XA 4TL6A 4K6GA 5IN4A 2XH8A 3GBVA 3NV9A 3AFIA 2P2YA 4UOEA 1E3WA 3TQSA 1BXRA 4R2MA 1MO2A 3OFNA 2ACEA 3G0CA 3DPUA 4XWKA 2B9EA 2IYSA 3WK8A 3SIPA 4BNTA 2ZAOA 2FSUA 1W5FA 4E11A 2NPOA 2OO5C 4MB0A 2VHVA 4BVAA 4OL9A 4I1SA 1TK9A 1FMJA 4UASA 4ZZ0A 4G09A 4ZU1X 2BJHA 5KQRA 3LDAA 1MC5A 3CUVA 2J9GA 3LQ2A 4EG5A 2QA5A 1Y89A 2VRWA 5F7JA 3SBEA 4KE6A 2AG5A 3PHLA 4M38A 4QYMA 2KSQA 1RNLA 1K9VF 1MKYA 3B8HA 1EZ1A 1WUYA 1RMQA 1BKDR 2DQSA 2QJFA 3KU1A 4JVNA 4M88A 1MABB 5FCDA 5HGXA 1O87A 2NSYA 2PT5A 4KE9A 3ZKWB 5U9CA 3ERCA 1FZTA 3ZEIA 5FTLA 1EQ2A 1XTQA 2J4CA 2PIDA 4JK3A 1M8PA 4YROA 4IIFA 3TXXA 4AMZA 1IDOA 3G7SA 3HZRA 1SVWA 4JNCA 2P6NA 3AR7A 4H27A 5KVCA 2NXCA 4A73A 5LN1A 2FVYA 4BOYA 1RYBA 3P5BA 1AOXA 5EZ5A 2EW1A 3TLYA 1U80A 2FEZA 4NOJA 1M7GA 2NUPB 3WK6A 2YWHA 2OTCA 4CG0A 2QTZA 3UJAA 3UAVA 2FLWA 2H31A 3AO0B 1IB6A 2PD6A 3PHHA 4NV0A 2AN3A 4MW4A 2RK6A 4KH0A 3FTCA 1GUYA 2WA2A 3HDGA 5I7AA 5C3MA 2X1MA 3FGNA 4WLVA 4EFKA 1T6NA 1OREA 1NXOA 3A4IA 3B1KA 2I6FA 3EF1A 5BY2A 5JAPA 2HJ9A 1X7DA 3EIXA 1ZNYA 3OJEA 1LDGA 1RR6A 1X1QA 4OXRA 4X92A 1NLYA 4R69A 2IOHA 2JJ2D 4U3JB 5GONF 3WYAA 3CYFA 1CQZA 5ED0A 2PSSA 3QF7A 4O29A 1YI8A 3L9WA 4WE3A 3R7DA 5KJFA 4UULA 2Q4BA 4O02B 2QL6A 2HGZA 2Z58A 3F47A 5AKHA 1KEEA 2W2KA 1E7WA 2ZUTA 2F3UA 2O2XA 3QUSA 3AV0B 4WGGA 3TJZA 2D0DA 2P78A 3QEOA 4RHTA 4NYMR 5ALSA 2ACKA 4FCWA 5E0KB 3ONFA 5DK6A 3SK0A 1LBSA 3ZZNA 2ADFA 1JWLA 4NZ9A 1R5JA 2ZWAA 3M5DA 3DO5A 5JSZA 4D4IA 3HUUA 1JHOA 1EK2A 1EB9A 3C15C 3AXTA 3KXKA 3Q9NA 2AL7A 2TMKA 2D6FA 2A5LA 1I2MA 1S2LA 1VBMA 1OFGA 2FFBA 2X86A 1H5QA 4Q9DA 1XCBA 5CD9A 4AJPA 3AM5A 4OMCA 1Q11A 3SEFA 4YUVA 3HBMA 3CF6R 4XASA 5JD3A 2NO7A 1QCDA 1BW9A 2YWGA 2UVQA 3RC3A 1EJ2A 3DSRA 4WGFA 1W2WB 4EO9A 2HLDA 1N7JA 2O4UX 4GNRA 3DKIA 4XWAA 4JC4A 2PM8A 4JROA 4FOSA 3I53A 1YBAA 5KAMA 1WB4A 3S55A 1UBHS 1FP2A 2O0MA 3CRQA 3DKVA 3RSCA 3WDLA 1TAHA 2GN4A 5FX2A 3D59A 3CM0A 1QRDA 4PHCA 1KA9H 2XOKA 4DWJA 4YLEA 2ZR9A 4R98A 3Q4GA 4XJSA 1K68A 3AUUA 4Q9HA 3RSZA 1GZSA 2OUIA 1CZNA 1QNFA 3T3IA 4PVDA 3LU1A 1S2DA 5AQ1A 5TPZD 4MNTA 2GCGA 5F98A 2F43B 3EY9A 1K8QA 4YRKA 1XF1A 1C30A 2Q3BA 1L7NA 1YA4A 3L6UA 2EWMA 2LRHA 3QLTA 4L27A 2FUG1 4O4JF 1UXHA 5AJYA 3T7EA 4EGJA 4XIFA 4HLDA 5TE9A 3S8MA 4AJKA 3D8TA 1HY3A 4H1HA 1QDUA 4Y2QA 1W76A 3GU3A 2C7GA 3B8EA 4IQ8A 5I9BA 2WTUA 4N0MA 4KK3A 1IMOA 3W5AA 1M5RA 2A0FA 1E5TA 4BQSA 5EJ7A 1P33A 3NW9A 3PNYA 1KO8A 4Y2RA 4IJMA 4BQPA 4DV2B 2W22A 3EHDA 3PG5A 2HBZA 4MW6A 3AM4A 1Q7CA 3PV0A 5LYJA 4LSGA 1PR6A 2ASEA 3V6MA 4GMKA 1CJUC 3FJOA 4EYEA 4J2OA 1BX0A 1J06A 4BNYA 2FSSA 1J0AA 5DB4A 3SOZA 1W1UA 1XVTA 2C2YA 1TCVA 5B36A 4G01B 3GROA 2PU7A 3S28A 3EAQA 3GD7A 1RAEA 1VP9A 5AYVA 3GDHA 3SC2A 3Q9LA 1FXWA 1WKVA 1W9HA 3BSWA 2PFSA 3GZJA 1XKXA 4MA0A 1B3BA 2DCUA 3UKJA 2A92A 3UFXB 5H70A 2H3EA 2XOEA 1ECPA 4HX5A 1UWKA 2IXFA 3ST7A 3BK7A 2I6GA 3D8HA 4M37A 1T1RA 3AKEA 4FYYA 3W8FA 2PR2A 1UDRA 3GARA 3UH1A 5K0ZA 2XUPA 4EATA 1GAQA 5AJVB 1Z7BA 1BE1A 1UBGA 3HO1A 5CPBA 3G2HA 3HCBA 4H0NA 2P4SA 4BKOA 1JBEA 3IJPA 4RENA 3RG8A 2JJYA 1H4SA 4MGHA 2PQ6A 4N0QA 4JIMA 4IJ6A 3AJ8A 4X7RA 5EJIA 5A06A 7ADHA 1UAAA 5BNTA 3I64A 4WY5A 3LFHA 4YAJA 3UHPA 4B8YA 3JQCA 1WVMA 5EAIA 4EL5A 4OBEA 4RY8A 1WZEA 3LWNA 3QFCA 3L1IA 1G8YA 2HI0A 3JQAB 5CCDA 1NGSA 2W8ZA 4D41A 1ZESA 3L5KA 3CF2A 3F2VA 3NHRA 1ABFA 4QGAA 1Z13A 3WMWA 1F8GA 3CPSA 4HEA1 4D81A 1SXGA 4ZJPA 4OLHA 3OZUA 5TQ0A 2V97A 5B7QA 1H3EA 4B74A 1NMZA 1X94A 5K3CA 1U90A 3RIYA 2X9NA 1MMFB 2I9KA 7MHTA 1FHQA 1VB3A 1VLLA 4P6VF 3PTAA 3IP7A 2CHUA 3G0DA 1QRTA 4EHKA 4QU0A 4U8GA 4M8LA 3MYYA 5FFMA 1XEWY 1QF7A 4LZPA 5KQLA 4CM7A 3PWKA 2OYRA 3C6XA 4MX8A 1U8CB 4CLRA 4DR5B 4EY3A 1PFGA 2PAAA 2XIQA 1JILA 3ZUGA 2YZMA 3WGOA 1ZN7A 2FW8A 1R6AA 1DZIA 3GQVA 1U0TA 2D2FA 2OAQ1 4S0XA 1AMOA 1I5EA 1DC3A 2QIPA 4EG3A 1FLVA 3M6MD 5HX7A 1AH2A 1ZD4A 1ADYA 4D1YA 1L4KA 1PG5A 1R3DA 1MIOB 1ACLA 2Q3FA 4NBWA 4X5OA 2VNKA 3ILSA 5FOWA 4I66A 3ZW7A 4BNFA 1Y81A 3ML1A 1ZVQA 3WJ1A 5D2CA 3MJDA 2WG2A 1VPWA 4XX1A 1B43A 1P60A 4ISBA 4D8TA 3QU9A 3U3DA 2Y4OA 2XCOA 3FPCA 3BE8A 2H2HA 3JQ7B 1P9OA 5BN5B 4YHHB 1D2CA 5I8PA 1T8PA 1R6BX 5C9ZA 2QUKA 1K4KA 2NV6A 5FQOA 2C29D 5A71A 4YQEA 1HLDA 2BMWA 2GZSA 1UCFA 3DAHA 3KB2A 2YIVX 3BAFA 3S68A 3W2HA 1N3LA 2G5GX 3ETDA 3ZU6A 4EVSA 2QRVA 4MQEA 2JI8A 3MGAA 2RGCA 3WGGA 5K3OA 4CMIA 4Q7MB 2JIQA 1UKVY 1KEWA 2VJCA 3FKSA 2G8LA 4J2TA 3DMGA 1S96A 4KODA 3ZWVA 1WMEA 1LCIA 1M0WA 5CJPA 3WK4A 4U6QA 1YH3A 2UAGA 2C8KA 1KZGB 2IE8A 3CZCA 3EE6A 1JA0A 2J6IA 1Z18A 4JI3B 2BFAA 5KTRA 1IN7A 5C2JB 4LSMA 2R00C 1DTSA 1IEQA 1XX6A 1G8MA 3E9ZA 5DZSA 2C3MA 5E4TA 1Q91A 2H51A 4KXWA 3WNQA 2WTEA 4NCXA 1WL8A 2VSFA 2Z2KA 2P65A 3EQ7A 3PQ5A 3RVDA 3WXBA 2FJPA 3ZCXA 1NPYA 3PYLA 3AETA 5KSZA 4PSVA 4GPAA 3B12A 2ERYA 4GKJB 4M0CA 2ALJA 2JNWA 4B5KA 1P7WA 2JW5A 2WWIA 1V3TA 2JVKA 3GDFA 2WOJA 4IX1A 3GP8A 3KR9A 4FCVA 5EA2A 1KE2A 3R5SA 3GJQA 1GARA 1A9XB 2JIPA 2PGLA 3QI2A 4P82A 5AK3A 5F2NA 1NBMD 1ZA1A 2J6BA 3N6RA 1NTRA 2F62A 1PJAA 3C5WP 1DQRA 1NUAA 1IM2A 2JHCA 1LJUA 4XRRA 5E2BA 3QKSA 3K5HA 2ZB2A 4JELA 3AVUA 1TU4A 4D3FA 3NGMA 1QIGA 4REQA 1NUPA 1Q7GA 1BGXT 1J25A 1XVLA 4PLPA 1DOAA 5C8YF 2C9MA 4PYJA 1QZXA 1Z2AA 3F71A 1Q3KA 3L6OO 3B2NA 1ZONA 1EUDB 4CT4B 4DTCA 1HK7A 3OJWA 4NS1A 1MOSA 5FFFA 1OIWA 4G89A 4AZ0A 3BMCB 1NX6A 4F2DA 3T9EA 2PRIA 3A1TA 4PTLA 4DBVO 1JRLA 4V0RA 4RTQA 4G1CA 4M0DA 2G7MC 4Z1MD 3O38A 1W6RA 2W42A 2H1HA 2O5RA 3G59A 3ZK8A 4EA9A 3F74A 5B7PA 1CUSA 2B5OA 2FTKE 3ZYZA 3ROZA 2W58A 3I32A 4DCTA 1Y1QA 4B6EA 1S8NA 2QAIA 1XA3A 4PPNA 4QFMA 4BLUA 2JATA 3EEQA 1QFMA 2BRUA 1RFLA 1E99A 3MDBA 1L7VC 1R4NA 3H5WA 3K30A 3PKIA 4FDTA 4NF2A 4P3XA 2QRKA 1L4FA 1M1NB 1OQAA 4LCBA 3LCMA 1FSFA 1WXXA 3GCXA 3KEFA 1YGSA 4DXAA 1RRCA 2Z4SA 4KQ2A 4L0QA 2R2GA 4GPBA 1F5SA 3RSSA 2RE8A 1DINA 4E1VA 3MJVA 2Q4RA 4MRSA 3ZPXA 4K9SA 3F6PA 3OF2A 4A3SA 1R8QA 3WGUA 3EPJA 4L2IB 4B7XA 3B13B 3SR0A 1W6UA 5H1YA 1TYBE 2QTAA 2DXIA 5D1HA 3IQZA 4QQ8A 5HK8A 4A8JA 1ZN8A 3MOGA 3R75A 4FFBA 5F1KA 3MJEA 4CN8A 4N4AA 5L3SA 3QEMB 2XMBA 1XNJA 2Q27A 1NF3A 1Q14A 3M2TA 1NPDA 4AAYA 3NDPA 5EWMB 1UP6A 4PG4A 4RIEA 1EESA 3TLGB 4F4FA 1FXUA 2PIAA 4B83A 4O5AA 3NNNA 4UZSA 5D00A 2YWEA 1ODKA 5D5PA 3TLXA 3LLMA 5THXA 2QP4A 3ELBA 4MO2A 1QS0B 3Q15C 2HQ1A 1DG3A 1I0LA 1QB8A 2XCLA 3K32A 3QPDA 1Z6XA 4UD6A 5J1TB 1AN9A 4FFMA 1AZLA 1KS2A 2GHTA 1N9GA 3T4EA 2Z56A 1GA6A 2VUUA 3KKZA 4GZ3A 1T0UA 2WILA 3V9PA 1EAMA 3N0XA 5KDDA 5CD1A 4D26A 2FGJA 4UTNA 3OLVA 3A9UA 3DJYA 4ARCA 1L7QA 3O82A 3TPCA 2O1SA 2H0AA 2WUEA 4ZFNA 3N6VA 1N2BA 3IUYA 5G53C 3ESQA 3SXUA 4B80A 3RAEC 1H42A 3L0DA 1CWUA 4KC0A 2R6R1 3AIMA 3KX2A 1Z26A 2NSDA 2V6MA 3N2GA 2Q6IA 3B1YA 5DLYA 5DP2A 1ONNA 1X80A 1E9VA 4FQ5A 4IOLA 1USVA 4MCIA 4Y1GA 2PMKA 4PLWA 3SKVA 4JT4A 16PKA 3CGGA 3L49A 3OECA 2FXVA 5F64A 1NJ2A 1UF9A 2VDWA 1XTJA 1K2MA 3PENA 3F1KA 1GGEA 3B52X 5TGTA 4HB0A 2O7SA 1TM2A 3MN1A 4KRYA 2AGVA 2W8BA 4F9TA 2B1QA 3QW2A 2G82A 3O8OB 2KX7A 3KEOA 1NASA 2HO5A 3C3WA 3QQPA 1IOVA 4F3NA 1FRQA 3BVPA 2Q3MA 3ANTA 3DMTC 4LNHA 4REOA 5C7LO 4BNGA 5GTDA 4M55A 4GKKB 3BTOA 4TZ6A 4BLQA 4IMRA 2EBUA 2PZFA 2KB4A 1NTOA 3KR2A 1J2UA 4HNHA 2N0SA 3O2QB 4JKOA 3C1TA 5TB5A 1R5BA 3PC7A 4BKMA 1N5RA 2HPAA 2G9QA 2VZ8A 5LQSA 3WLLA 4BP1A 5A6SA 3A6DA 4ZXPA 2Z5LA 5EJ9A 2G17A 3CVYA 1VE5A 4DNOA 2QT0A 3RYHA 4DPMA 2YV1A 3H4MA 5HKKA 1B6SA 3AOEC 4ZHSA 3T5AA 4NDNE 5JD5A 3VU0A 1Z5ZA 3VUEA 3IVGA 5I01A 1XMQB 3VOTA 1W30A 1Y6GA 4TMYA 1ZEJA 5JSYA 5KX5A 5AOCA 3DOIA 1G3GA 5JMWA 2D54A 3GZTB 3ZGZA 3X2SA 3O03A 4FHGA 3E9EA 4HDKA 1DC7A 2BKUA 5CLQA 5JEOA 3H65A 5DCLA 4CM5A 3GLIE 1BDJA 3PFHA 5K0LA 4HUQA 5KQGA 3IJEB 2FZWA 3RM3A 1JIVA 5EPEA 2PD3A 4BFXA 3G2LA 3GG9A 2VDRB 4PG5A 4CEJA 4FKZA 3A1UA 3ZH2A 2HF8A 3F5QA 3E8XA 4BMSA 1M67A 2CKMA 2X7HA 1E18A 2W2VA 3KCQA 1A82A 4ND5A 2VDKB 4Z7JA 4FUQA 4UUMA 5B58C 5CEFA 1HLFA 2G09A 2H7XA 4WXEA 1N0HA 2XMRA 3FNRA 3W6UA 1SD5A 4B17A 4MJXA 1FYXA 3FUXA 3ITEA 3LQ1A 3KQSA 1U5AA 2PUWA 2FV8A 3W3AA 1CP2A 1GNSA 4KUGA 1NE7A 3ZI7A 4DKXA 4DV1B 1QGAA 1WCYA 2DY0A 3EG5A 1UPAA 2C61A 5IVDA 3ROTA 2PPVA 1XTTA 3PS9A 3ROPA 2XT9B 2JCXA 3GHYA 5A7GA 5FJJA 4BN5A 4LNAA 2J3EA 5KWSA 1OLUB 2PX3A 2Z09A 1GN9A 1W85A 2DT8A 1UJCA 2VK8A 5C3UA 1TMKA 3ZGNA 3H3XA 4OMUA 4BGEA 1DUVG 1KFBB 2VH5R 3TZ6A 1TFUA 1A77A 2TYSB 4GMDA 4P4SA 4X60A 3W2TA 3PD0A 1EFDN 1L5WA 4RAQA 2I3DA 2R8OA 4JOBA 4L6AA 2I7XA 1C3VA 5KYKA 3F4KA 3HJFA 1GLGA 2QR3A 3ABIA 4KLZA 2NYVA 3K2IA 5DFAA 4HEHA 3V1UA 3VVLA 1O6ZA 4CUJA 1IG0A 1WUTA 3OP4A 4HFNA 4OGFA 1SIUA 4Q1CA 3RBAA 4YMTA 1JEYA 1DT3A 4BXOA 4YCLA 2O5EA 5J43A 1E6UA 2H0RA 3OP1A 1K5DA 4JENA 2NADA 4QNRA 4PLTA 2C1EA 3C7DB 4TUYA 4F6LA 9ATCA 3K6KA 3UQZA 4RFSB 1A4XA 1DFHA 5IC4A 4OI4A 3Q1KA 4NCIA 4DREA 1TVKB 3ZY6A 4UD2A 3JPYA 2ZUUA 3VX4A 5IFKA 2WJGA 3TLJA 3X1JA 5I7EA 1RZRD 3U6BA 3MXTA 1YZLA 1V43A 4DLVA 1GDTA 5EHGA 3AL2A 3I9V1 2Q0HA 3FVQA 4FFWA 1ZL2A 4BCCA 1U81A 1PTKA 1ZIYA 1NAHA 4NVRA 3T3OA 2HMUA 2ZSBA 3JASB 2I4RA 2WUDA 2BGUA 3KRTA 1GGFA 2IOFA 5DIFA 5DHFA 5D87A 3DSHA 3KSMA 4EDHA 4ZAWA 1LC3A 3PVSA 3WHIA 5ALPA 1UH5A 3MG9A 1Z47A 3TQQA 2IP2A 1RQLA 1V0JA 1Q84A 1QX4A 5EE1A 2CV2A 3P2IA 4OX9B 2IXAA 4Y2GA 5JZOA 2WTXA 3D1LA 1R00A 3G2PA 1XXHE 3UK1A 1QG0A 3COYA 1H5UA 2XUKA 4MKXA 2OM2A 4UAUA 2XDWA 4IF4A 1Q95A 4Q4AB 4D9CA 1NV9A 3TSAA 1BWRA 4U5XA 5D5HA 1JHYA 5A4AA 1KMMA 3KT6A 3ROKA 2QW1A 4QULA 3COVA 3V42A 4ZPXA 2AE2A 3D43A 2BFWA 4IF6A 1Y7PA 1C3XA 1HZZA 1OFTA 1Y34E 1BAPA 4Z0HO 3DTYA 4NJEB 3FFBA 1OB5A 4IZHA 2H2IA 5DBOA 2AMVA 4JT8A 4YRNA 3ZCUA 3L8YA 5G0SA 3V3TA 4DBLC 1NBOA 3AV3A 1KYTA 5KKAA 4QIHA 3Q6MA 1CVIA 1CCWA 1DAKA 1CE8A 2GN9A 5A3SA 8GPBA 4FDAA 5K4HA 2QV7A 1IXKA 3EUAA 4UNQA 3SF0A 2OSVA 3HO8A 4MIEA 3E61A 4NYJR 5CM9C 4RF3A 3LUKA 4RFVA 3ZJVA 5BMVF 1GPKA 3E0QA 3KNZA 3FYHA 4QFBA 3BD7A 4V02A 5FV7A 4H2DA 5I3ZA 2J85A 1IUKA 3X2FA 1GGMA 2XZDA 1GO2A 3AEYA 1XTRA 3DR5A 2PH7A 4WAUA 3VU8A 5IM4F 3Q40A 4MIKA 4GQBA 3V8EA 4TTRA 2P0AA 4DB4A 3C3BA 5JXHA 2ZQZA 1UC9A 2FFJA 2ORWA 4B82A 3M9XA 2E6KA 1FNMA 2UVPB 4G8JA 1XPOA 2V5AA 4RLQA 1ZYUA 4OUKX 2JFXA 2JEOA 3R76A 2KBEA 3L8CA 4HDMA 5BSKA 2NPFA 1U9JA 3RAFC 4OUDB 1NM5A 4RSRA 4RDXA 1RT9A 2R8XA 2QN8A 4HD8A 1SCDA 1GJRA 2IZOA 1LWNA 1KI2A 2A7QA 1OX5A 2YIMA 3HYRA 1KI8A 4BLVA 3K1JA 1N2EA 1K5GA 5DXJA 4CF6A 2FHPA 4XWTA 2HV9A 5I4BA 4AB1A 1QBKC 1A95A 1QKIA 1XMSA 3UNNA 4QDZA 5IK2A 3BWDD 3ET5A 4RHCA 4HWTA 1SZPA 4HB4A 2W6IA 1E4YA 3IEIA 1C4XA 3Q5DA 5DEIA 3SDZA 3JQAD 3TEFA 3L84A 4LJ7A 3KQYA 1WB5A 1XGKA 1ZMTA 4KW7A 4EYGA 7AT1A 5BSUA 3OJ0A 1WQ4A 4ZCQA 1IRIA 1RLMA 3LL4A 5G1OA 5L9AA 3HM9A 1DIAA 3R9IA 4UEKA 1IBSA 5IS2A 1C8KA 1QFJA 1LGPA 1KZ6A 1X70A 1Z62A 3JQDA 4ID3A 4O6VA 4YK7A 2H7YA 1U99A 4PC1A 3ZDDA 4K87A 3F8SA 4WBNF 3OURA 1IZ0A 5ALGA 3KKNA 4YR9A 1QCZA 4RGVA 3W8RA 1UANA 4II3A 2GJSA 1MJGM 3ZE8A 4TYWA 1WRBA 5A5EA 2Q0QA 4JT2A 4R9NA 4ZKEA 3WOVA 4A2PA 1ES9A 4AYWA 2NU7A 1JAHA 2Q6OA 2I4IA 4NPAA 3Q0EA 5GAJA 4FHZA 2DUMA 1UBOS 1NSFA 1SCNE 3I9NA 1ZIPA 1BDBA 1YA8A 2JFGA 4IV5A 1X2BA 3PLAE 4I4TF 3RARA 4Y9DA 1XJWA 3CX7A 4G6ZA 2PE5A 3EA0A 1N2IA 2P6OA 3R4VA 2Z8YM 5BPFA 1J4QA 2GEDA 3DV9A 4FNGA 3WWCA 5LLDA 4M1MA 1IPEA 3E3LA 3F98A 3KPYA 5KO2A 3IX7A 1HT1E 4DAOA 3NKLA 3VMMA 1SVMA 5K4AA 3L7IA 1QWTA 1AC5A 1YU9A 2O50A 4U5QA 1B16A 1QP0A 2ACWA 3IUEA 3C24A 4MVJG 4RZQA 3QLUC 4AURA 2UUAB 2HQBA 4J91A 4XLTA 1GUFA 4UXHA 3PEVA 4N6OA 5ALQA 1C8LA 4AS2A 2QR5A 4R4JA 5DGXA 5DPMA 3UJBA 2BI8A 3A05A 4HATA 5I51A 3EIFA 1L6IA 2CMDA 2RI6A 1P0PA 3R7WA 2UUCB 2C31A 4H31A 2VLBA 3TH5A 4IY1A 5CB6A 5LLSA 3P9KA 1VJ5A 2Q5QA 1ZBDA 4EHDA 1JWBB 1E1YA 4YAIA 1ZOQA 1HA3A 2QGNA 1TUGA 2W6PA 1FDWA 2I1VB 2V4ZA 3PFIA 3I6ZA 1NBIA 1T9CA 5AM4A 2IU3A 2J0VA 1O96B 1DAMA 1N8NA 1TW3A 1YBVA 2P0YA 2ZJ1A 2CLHB 3DFUA 3MWLA 2PEYA 1SKYB 2BE7A 1KY4A 4RANA 5TY0A 3VYWA 4JHLA 5JDCA 3MHTA 1B8PA 4GOJA 2X9VA 3FGPA 2L0XA 3KQMA 4R54A 1SBTA 1KJIA 5KSOA 3FAZA 3BM5A 4BP9A 4BEBA 2V3VA 1T36A 1V4VA 2R11A 3AMVA 5FNVA 3CX8A 3DUFA 2HUPA 3HCRA 3Q3EA 5JBNA 1HC7A 1NMSA 1NN0A 1VJTA 2FCAA 1ETUA 1URPA 4LV8B 4QOEA 5EKSA 1CETA 3ZLBA 1LTHR 3JAKB 1U6IA 4DV5B 2XTMA 3MA0A 1DJLA 4R41A 4J6FA 3ZHQA 1Z8HA 4BP3A 3EFBA 1VKJA 3Q5GA 3IIJA 2BFEB 3BCSA 3KPUA 1YI0A 2DWOA 2GZDA 4HDSB 4L74A 5HCIA 1C7RA 1IWBB 3KWFA 4QXPA 1B6RA 3CLUC 1GM5A 2P62A 2DTDA 4KAXA 3VA1A 2YV3A 4RX1A 2OV8A 2ZBGA 3RF6A 4LRTB 2A88A 3D3NA 2VP9A 4NSNA 2ZYRA 1GPJA 1UBMS 3IQHX 1EGMB 2FZVA 2HEIA 2GZ2A 1P8JA 1YQWA 2XYRA 3I6IA 4ZEVA 2NYAA 3V97A 5HE8A 2GN2A 5JAZA 2PSHA 3CUKA 3IT2A 1TD1A 1U9CA 3QLVC 2BLNA 5M29A 3RVLA 4IS2A 2GM9A 1NJFA 3PO8A 1IYZA 3WYFA 2VYND 4AMUA 4G67A 3EVFA 3QVGA 3RPEA 4N03A 1U2DC 5G3ZA 1KFEB 1XZGA 1YQUA 5J5CA 5C80A 5K8CA 1CULC 1YACA 4QNMA 3K3PA 1XZKA 5ALEA 2D1RA 1VLHA 1YBFA 3FR8A 3PZBA 5ALUA 1UMCB 3QEKA 1KYXA 1YMQA 2OHHA 1FFHA 5E0OA 5FEMA 3TD6A 1RHUA 3QYJA 1C4OA 3D6TB 1OY1A 4N0PA 3K6RA 1UEIA 3DCJA 3JAWA 4LVOA 2IYYA 3UHFA 3U4QA 3WLMA 4CT0A 2JL1A 4GMGA 4GR4A 5A8IA 4IJ5A 2JLWA 3KZKA 5A7FA 2PXCA 1ESDA 5AVTA 3ABOB 4ZK6A 3V8NA 5KNDD 4PIMA 4E2WA 1DBIA 3WBJA 4L4SA 1U3FA 3IAS1 4GICA 4MYUA 4WOBA 1EX9A 2DLCX 1K3UB 1PJBA 1P2BA 2QLFA 3LGXA 3ZV6A 2WZBA 4GM4A 4AROA 4QSMA 4JX8A 1LPNA 2NQTA 2XADA 3E1GA 5E4JA 1B6TA 4B6PA 2ACVA 4MA5A 4ZRMA 5C51B 3JWIA 4P0QB 2JLCA 1QYDA 2Z5FA 1TK3A 2P6UA 3P9NA 1KJWA 2WIGA 2GQ0A 3DV2A 3VR5H 2XQJA 1B6GA 4DILA 4HFJA 1DUIA 1PEDA 1RU3A 2OXCA 1WPQA 2PMFA 2YV4A 4F04A 1NVMB 2KLBA 4UDXX 3QE3A 5IBRA 3W5JA 2CSUA 4CQLB 5B2ZA 3B53X 2NTJA 4GM0A 1E6EA 4TWJA 1IJEA 3OX3A 3A2LA 4KDRA 1L8LA 5CURA 3GI1A 3TOZA 1J9GA 1I5OA 1K88A 1G18A 2ZQYA 2ZYHA 3KJQA 5JARA 1XZLA 5CT5A 4ZOLA 2G77B 2H11A 1OWMA 1I7LA 3GEMA 4DF3A 1YONA 3OT5A 4LYDA 4R2WA 2F1RA 2PRZA 2TMGA 4OYRA 4OQPA 4F4UA 3M5WA 3L7LA 1HPLA 2JLBA 5FPTA 3Q85A 2EBFX 1C9NA 2HLHA 3HXKA 1DJMA 3KFLA 3LF2A 4K28A 1X7YB 4PAMA 5EXEA 1K4MA 1X13A 3I9FA 3KYIB 3GLUA 4HLNA 4KO2S 2WG1A 1LDYA 1C50A 3I1IA 1DG1G 4ZO8A 3DLHA 3MTEA 1R6XA 3MJCA 3K71B 3RFFA 1E0AA 3M6FA 4QODA 1O97C 3ORHA 1R0ZA 1T9HA 3SBXA 4D6XA 3IVRA 1CR4A 1HG0A 4OK3A 2XCQA 5IDXA 1WUIS 1Z6GA 1F2DA 6GPBA 1A8QA 2CUNA 5KPDA 4UEWA 4LGCA 2Q45A 3BJZA 2RJ3A 4YAUA 5KTYA 2YINC 3A6ZA 1AS3A 1KS9A 3I01M 4DBZA 4E4TA 4ETIA 4MQLA 3RTCA 2EQBA 1G8HA 3FTEA 4OQYA 4QPDA 1J33A 3U49A 4CTMA 1JJFA 3AGPA 1YZNA 2VG8A 3AR4A 4HLQB 4MVJD 3L1UA 4CETA 1KQNA 4HWOA 4PXSA 1WZUA 4ZGGA 2O8VA 1C80A 2VAMA 4YXWD 5H59A 3R24A 3M1IA 3X0DA 5KOHA 1KJ8A 2ZWVA 3IDAA 4GI1A 4X1YB 4ZT2A 2QT1A 2PNFA 4UU7A 4DMCA 1PHRA 4N5HX 2FMKA 3I1YA 4KGVA 3SJZA 1MQ8B 3P2JA 2FPPA 1PSWA 5JOQA 2OFPA 2WKSA 2V7QA 4KKVA 3GEEA 4QBFA 1G291 3L6EA 4BNLA 2NXEA 4HNSA 1D1PA 3JTEA 1LXCA 1DIHA 2EIXA 2ZRFA 1KDOA 3CNOA 2FA9A 2WSSA 2XW6A 4ER6A 3DOFA 1XRNA 2EZ9A 1IULA 3BDAA 3G7NA 3OBBA 2AUTA 4KOEC 5IU6A 4EHHA 4RPJA 1TLFA 3TOSA 1JL3A 2HLNA 5GONA 3X1DA 4YUWA 4KR6A 5TDHA 5SYMA 1YIDA 4OAPA 1ZI8A 2JIMA 4M53A 1RW4A 2VLIA 1N2XA 1R5NA 4JY7A 5A3JA 13PKA 1CEQA 4RPKA 5IANA 3BMOA 3E3NA 1DG9A 1V11A 2IYXA 4RIFA 4Z4CA 4ZVTA 3A1NA 1YI1A 4YV2A 1PJSA 2HJHA 1H0HA 1G8AA 1QQ7A 2EZTA 1S5PA 2SECE 1RE1A 1RXSA 4NEQA 2D8AA 4QFDA 2FEKA 621PA 3N59A 2EEZA 3Q3CA 5CIYA 3DBLA 1P0FA 4FQ8A 3KG2A 3R0JA 3NC1C 4TV8B 4FINA 1GPAA 5A9SB 3VBCA 2JVIA 1KDZA 2JLXA 3GLGE 3FHCB 5I8ZA 1EXDA 2RBGA 1CJTC 1NBHA 1UPXA 1R8JA 2AFIE 2RI0A 3OIYA 5ICEA 4IXDA 1F3LA 1XPJA 1L8XA 5TT0A 2C92A 4YDHB 4DJEC 3DT6A 1NIPA 2B2NA 2ZITA 3EFHA 2QVGA 4OV6B 5CVTA 2BP7B 4FHFA 4EZIA 3FPJA 4E5SA 3HG7A 3NHFA 1BMQA 2BTOA 4WA7A 4YCDA 5FLXA 1OX4B 2QRGA 1U3TA 1VCNA 1U2EA 3RS2A 3BIXA 1ZCAA 5J58A 4URHA 2R6FA 2Q41A 1QORA 3CSDA 5E6SA 3HXPA 4O4JA 5FPYA 3ZWCA 2RHGB 4ZOBA 4BQRA 2A1UB 4I81A 2XNKA 1T3TA 1H3FA 2ZB8A 4WWHA 3V1TC 1N6OA 2CVQA 1M2HA 1N92A 2C97A 5EUQB 1Q0RA 1EGVB 2X2OA 4IEIA 3HN7A 2P9JA 2Y1OA 3I5MA 521PA 3IA2A 3UY4A 1O6GA 3CLKA 2Z95A 4F21A 1SUAA 3KWJA 4XPIA 4RCZA 1NQAO 1NVVQ 5K8UA 4DWWA 5LBIA 5A1JA 4EG7A 3HABA 4P7FA 4FJ2A 5J63A 3SN6A 2MIIA 1VCOA 3PEYA 3THSA 1CFZA 5TC4A 1YXMA 1RZUA 2V6IA 4LGVA 5I9IA 4BIIA 1D6NA 5LQMA 2C84A 5HF8A 5BMVB 1L5VA 4ARBA 4TM8A 2ZI6A 1GA1A 5LSAA 1PNTA 2VDQB 5IEBA 2I80A 1J8FA 1K7SN 1WPGA 2HL6A 3E3OA 4CKWB 3BKXA 4RD6A 5LMZA 2BGGA 2VS1A 4GYWA 4R1QA 3WGNA 5BWNA 3EVAA 2WWYA 3JSXA 4LSZA 3SZRA 4NPHA 4UHHA 2VPIA 3H97A 1J70A 1PUJA 3NHAA 2DERA 1Z73A 2F00A 4XUDA 2OHIA 3RYFA 1THGA 2RH5A 4G8DA 3FOBA 4UC0A 2GSDA 3H05A 3WRWA 1GPNA 4CKXA 3PPIA 4UNSA 1NSYA 4C20A 2XB8A 1T26A 1VOTA 1N5KA 3AONB 3QIAA 4P54A 4B76A 1S2MA 4Z4HA 5H16A 2KI5A 4KFCA 3LK6A 1A4IA 3C3XA 1LBQA 2VT3A 2AMLA 1U65A 1ODJA 2C4WA 2WYIA 3I9OA 4XR4A 1L4YA 3VR4H 3LVRE 3BEDA 4XDZA 2VCEA 1JFFB 4GOMD 1YQ9A 1KNXA 3KFVA 3IDOA 4J0DA 4TM7A 4X6YA 2P8JA 4JBXA 1IHOA 5C46F 1DC4A 1J24A 2G4VA 4U4AA 2FX5A 3K5PA 1EDEA 2VZEA 5KWEA 3HR4A 4LZOA 4O2BB 3ZDAA 2NN3C 1QTIA 4DDVA 2HA3A 3ZJYA 2NZ2A 3QU4A 1ZW6A 2UVPA 2Y0DA 3GLQA 3TYXA 3D6UA 3KYJB 4MI3A 1EK5A 5EGSA 2C42A 2QY6A 2MSEB 3NYQA 3HU3A 1JDBB 2GPJA 2QRUA 3R6DA 3CXRA 4LISA 4RF4A 3WLQA 1Z4NA 1LGQA 2IA5A 1XMPA 3GMIA 4HEQA 1CEYA 3RHZA 1JVSA 4Y0NA 2CXUA 2JFWA 1QVAA 1U8TA 3I4LA 2R8BA 2WWHA 4HDOB 1U0RA 4N7MA 4BGUA 5B57C 3HY3A 2IUYA 1MU0A 1LLUA 1YBMA 2IPLA 4OQLA 4WBNB 3UK6A 3K20A 4DR7B 2GPTA 2H1SA 1ZUIA 1X8LA 2HWUA 4HRVA 2JGRA 4PYMA 1F5NA 5AHXA 3RIGA 1FUYB 1P44A 3STTA 1DARA 1GUDA 1P39A 2NPIA 2WM9B 3R0VA 4FSHA 4CM9A 1G3QA 3H2KA 4F91B 3KK0A 2QJWA 3AHEA 5T6MA 2MSLA 4MRMB 3UB4A 3E9CA 2VQEB 3UMYA 3G79A 2BFFB 3PDWA 5JCJA 3TLZA 3TB4A 1L5LA 5CT9A 2CNDA 3QV2A 3EPLA 4FWIB 3TQOA 2YXEA 1F0KA 2AX3A 1CQIB 2VNIA 3CU5A 3EMKA 3OWHA 4PTZA 3HKBB 4Y1RB 2JHGA 3LLVA 1HMPA 3S2EA 3F2IA 1XQVA 2I78A 5MFZA 2ZM5A 1Z35A 4DVGA 2BMFA 3DDNA 3BPSA 3M82A 4I6GA 5A4JA 1G6OA 3OA0A 1WUHS 1UDCA 1U7FA 1XMVA 2G0AA 4QTZA 3PF8A 2RK3A 4TXJA 4JXKA 2W6JA 4URWR 4LFAB 4LRSB 3M4XA 3GIWA 3H9GA 3PUKA 3RRXA 4YY3B 1J0XO 3ENQA 1NYRA 3KALA 4H77A 3L0OA 1PZXA 4EMTA 4OFZA 3QPAA 4OY3A 3CG4A 1L5HA 3V34A 2YMPA 3DE1X 1XDWA 2W6JD 3VOAA 2JGLA 3PLNA 4EGAA 3Q88A 4ROSA 3U40A 3JYHA 5FI0B 2X0JA 1CV2A 2AHRA 4BX0A 4DQLA 1QF9A 3HBAA 1JR3E 2HMTA 2N46A 5H7XA 1SHJA 2ATCA 2ZJ8A 3NPMA 1NE2A 3NETA 2XGOA 4J49A 4ZQFA 5ALJA 3ZG6A 4BLRA 4F38A 4JDPA 4ND6A 1VL0A 1IBLB 4ZCIA 2VUSA 1I14A 1X77A 1GGHA 1XP8A 1QDLB 1J39A 1CQPA 1QWSA 2G76A 3TAUA 3UAYA 4BFUA 7REQA 1NLFA 5ICGA 1OA1A 3TVDA 5FAKA 1NMEA 3FIJA 1PVOA 3AHFA 4O8ZA 1PQYA 1T3HA 3WNVA