3V8QA

Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-5'-deoxyadenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
263
structure length
257
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYGEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDELSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
molecule tags Transferase
source organism Listeria monocytogenes
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
total genus 68
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8qA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8qA01
5DHPA 5EJHA 5DHRA 3PFNA 2I1WA 4V24A 1Y3HA 1Z0SA 2I2FA 1SUWA 2BONA 3S40A 3VZBA 1Z0ZA 4HAOA 3V8RA 4DY6A 3V7YA 1YT5A 5EJIA 5DHUA 5EJGA 3V8MA 3V8QA 2I2CA 2QVLA 2AN1A 3VZDA 2I2DA 3V7UA 2I29A 2I2AA 2P1RA 3T5PA 4WRRA 1U0RA 4L02A 1Z0UA 3V8NA 5DHQA 4WERA 1Y3IA 5DHSA 3V80A 5DHTA 2QV7A 3VZCA 3V7WA 2Q5FA 3AFOA 1U0TA 5EJFA 3V8PA 2I2BA 2JGRA
chains in the Genus database with same CATH superfamily
3EEFA 4XDYA 2IELA 1DGQA 3KPJA 2H2HA 1SCKA 1HLPA 3LA6A 1RPJA 3CZ9A 3IPLA 3UKJA 4MVXA 5JCZA 1G20E 1A82A 5FOXA 1BCSA 5B2FA 2J46A 1UZUA 5BT8A 3ENVA 4NDNE 1C8BA 2VK1A 3SR0A 1TIPA 2NU6A 3MWDB 3NM6B 4GG1A 3K9WA 2BUCA 4CTMA 3AFNA 4DRXB 3Q5EA 4NNJA 1DWOA 3DE7X 3I01A 5JO9A 4KNYA 5CB8A 3HGMA 3SXUA 1IFXA 2A9FA 1YV9A 1AS0A 2DCMA 4WGGA 3SKXA 4PZCA 4CTKA 2B92A 2QPTA 4A0GA 2DR0A 4UBLA 3KTAA 1UAAA 1IWOA 3EARA 3GGCA 4OQXA 2X86A 3ROFA 2JFGA 2J3LA 1QG6A 3M89A 3D3EA 3WYNA 4NBRA 1K7XB 3BD7A 3DEFA 3WYFA 2QTMA 4UUPA 4NOLA 5JWRA 3CF6R 2J4FA 4ZOAA 3WL6A 3GU3A 4WK6A 2CBGA 3K9BA 5CHYA 2ZG6A 1DRUA 1U2ZA 3DR3A 4TKMA 4UM9B 4JR0A 2QTVB 1BAPA 3BQMB 3VKHA 4C20A 1KU0A 3UGKA 1V1JA 4P98A 4R8SA 4FNGA 3SS7X 4B45A 1GLGA 1QHFA 5JU6A 1PGPA 3QW2A 1K06A 1RQRA 3GDFA 1D4FA 1GLNA 2W6QA 2FMKA 2WYVA 4F0JA 5AW8A 3FFXA 4J03A 3FHOA 1I3OA 1SZPA 2JFVA 3GRAA 3ONVA 5KVQA 2CCJA 2Q0HA 1A4RA 4OJYA 2CB9A 1QYXA 3PL1A 8ADHA 4JLSA 4X65B 1YOVB 4QQRA 1G21A 4NIMA 4ARZA 4MPTA 4QDZA 5FL3A 3PDCA 3KUXA 1D6MA 1TM4E 1Y98A 4K9NA 4KDEA 1SOWA 1LRLA 3IVMA 1G2PA 2YW9A 1G42A 2X9NA 5EE9A 1JQ3A 3EGDB 5ENVA 1SK8A 2QTBA 4ALJA 1LGQA 3MB5A 4ZT3A 5L3SB 4MNTA 1NC3A 3KE9A 3I42A 3BWMA 1JBQA 1QV9A 2JAQA 1JZQA 2C3OA 3MTQA 2Q5QA 1Q17A 2YZ7A 3I28A 3HSSA 2AJCA 4PZPA 2IITA 5AKJA 1ZM9A 3LO5A 5F21A 1Z0KA 3JALB 5IC4A 3AVTA 2QIPA 1PZMA 1RZRA 4XD2A 1C9YA 1YGPA 1ESDA 5AVVA 3ZU4A 1Y48E 1CZLA 1S4QA 4DLTA 4U63A 4OYHA 3A9VA 3JYQA 3BFXA 4KSBA 2D4HA 2PX6A 2AEEA 1GAQA 3U3XA 1RWQA 2ZTHA 2VJQA 5BORA 3ZU6A 4BN4A 4NPAA 4EZIA 2W6JD 5A04A 1PJ8A 1QQ7A 3GA5A 4M0MA 1BCRB 1JU4A 3R3YA 3R8CA 1KJNA 1WMSA 2YOGA 3M4ZA 2X8LA 3W8RA 1FRZA 3NAQA 4HZIA 3WK6A 4B3HA 5TR9A 2XUIA 3WJ1A 3UMYA 3DV0B 3A1UA 3PNOA 4GI2A 1SFRA 1ZD1A 1Y7IA 4BLOA 3AM4A 5GJVC 1NJSA 4B8WA 1FLDA 1G9SA 4JC5A 1O8CA 1X8KA 1YMUA 2OBLA 1OV6A 2VYND 4MS3A 2J5QA 2YIMA 5KYXB 1C1YA 2O3QA 1Z0SA 2Q6IA 3TBKA 1NFFA 4MKXA 1CEQA 2YQ5A 5KWIA 3NHWA 5ESDA 4MJLA 4GRAA 3GFBA 2X41A 3VSEA 4CQLB 4UASA 3CLTD 4LK2A 5G0WA 4TXHA 2GZ3A 1YDWA 2ZUEA 3BBPA 4XVCA 2AJTA 2XDQB 1KHTA 4WY8A 2OA0A 4R2IA 5JCJD 4TL8A 4KI7A 2LNDA 5DSZA 4BX8A 3VAYA 1MJ5A 5LXTA 1E61A 3BC1A 1SRQA 3U7QB 3HRHA 2FDRA 3B2NA 4D3FA 5HM8A 2MOKA 1F0KA 4ZJPA 1E5XA 4TKUA 3T12A 1NUSA 3GT0A 5B36A 2KX7A 1ZD9A 5GOTA 3VPSA 3AHDA 3MCZA 2WA2A 3DNMA 1RWXA 3TD2A 1AKWA 4JK3A 4CU2A 4B4KA 2D7CA 2IZOA 4Q37A 5JYDA 2Q0SA 1Q95A 5EJMA 3OICA 3H0CA 5HE8A 4INZA 3V5NA 4D80A 4GP6A 3ESDA 4GMFA 1DB3A 1WX1A 4GYJA 4JH0A 3IULA 4MMXB 4UDNA 5TPZD 1UWVA 1QB7A 1E6UA 3IAS6 5ELLA 3TH5A 5LL6P 1EP1B 3NWJA 4J29A 1BVHA 4TMYA 4TVOA 1TUEA 3AI7A 1E5TA 2DQSA 3M1AA 1QGED 1X9IA 4WOCA 1ISIA 1I33A 1O6GA 3U60B 2V7QD 5F7ZA 5JEJA 4PXAA 3AONB 4R41A 4FX2A 2RGCA 1X2BA 3O47A 1DTWB 2B2NA 4L2IB 4LZJA 4OLAA 1LC0A 3OTHA 4HH4A 4XWTA 1Y3HA 3GNQA 3OKCA 3W2FA 4JONA 2FFJA 3OQVA 5KPDA 2WVHA 1YTLA 4OFZA 3GRVA 3LUAA 3IESA 4A2QA 2DWCA 4PY2A 1U3DA 2OLEA 4OEHA 2AWNA 2GO7A 3RUFA 5DM70 4I3GA 1J56A 3CLSC 3Q0TA 3A4IA 2HBYA 1BWRA 3PQFA 3TTWA 2YXBA 2GAJA 1WEHA 5T6MA 1IIRA 4BUJA 5L7TA 3N28A 2C7PA 2WD8A 3VPAA 3BF7A 3OCXA 3STXA 2GQ0A 2XCIA 1XRQA 2RHGB 3OC0A 4DV1B 1PT7A 2O2IA 3A27A 3GP5A 3G2MA 1TGVA 3NHUA 2WFLB 4MVYA 3LM8A 3ROKA 5KTTA 3ZNPA 1GNVA 1JKJB 1OASA 2IF0A 4IJQA 1BMTA 4DIKA 1OU4A 4IDDA 2CB0A 2BR5A 4DJ5X 2ROQA 5I7SA 4UZEA 2HUPA 3QEJA 4NX2A 1TNDA 4L76A 5TF0A 1EXDA 3DZJA 1EGMB 3OIFA 1KK3A 3WLTA 3QMVA 4XDHA 1HQDA 2P11A 3WWYA 4QCJA 3H2SA 5K0EA 1JRLA 2A67A 4BZXA 2D2XA 2O52A 3CX7A 3L0IB 4HNQA 2O50A 2WUDA 3G0OA 3H2GA 4F3YA 1N9KA 3RVJA 5ECGC 3OEED 4D96A 3MMSA 3VBEA 1E89A 2EFHB 1IZ7A 3KOZA 2XIJA 3PBKA 2DEUA 4I9GA 3VKFA 4U7DA 1TADA 5AKYA 4KDCA 1VPTA 4DG8A 2RGWA 1UPBA 2QI9C 2WM3A 2OBYA 1U7OA 1RCFA 1UAYA 2ZSJA 3Q9SA 1Y1QA 5JNSA 2BY4A 3IMCA 4LOIA 3R24A 2Q2NA 3BZWA 1DKLA 1LPNA 5K09A 3QF7A 1JDUA 1EFAA 1FDWA 2DQYA 3QOWA 4NQRA 2DY0A 1CV2A 3FMFA 3PPXA 3QWAA 1SIBE 4DV3B 2I4NA 4F2GA 2OP1A 2QYTA 3FB4A 4MGEA 1TJNA 4J07A 3VO8A 4H2DA 3MZ0A 3PJRA 3VPHA 1U02A 4LRSB 2ASVA 5IJ9B 2J3DA 2JDIA 5J9FA 1Y63A 1GTSA 2ZETA 4S1PA 2C4MA 2I4RA 3QV2A 1QWOA 1XL0A 1P1BA 2QW0X 1PFQA 4E3ZA 4F21A 1FJHA 3P71T 5IJ0A 4BP1A 4GWGA 3DLHA 3FMOB 5I7WA 4KPFC 2GBLC 4JOCA 1SUSA 5JPDA 1U7TA 4U7GA 3TD6A 3ZE0B 3SHTA 3TW4A 1GQYA 3GFGA 1WR8A 3LHIA 4LF8B 2C4WA 3LZDA 4J7AA 1H3FA 4UFOA 1W96A 5LJLA 2Z8XA 3GA7A 4QFCA 4RHTA 2DLDA 1KH1A 4PPGA 5A0VA 3R5HA 2BMWA 3T1HB 2DY1A 1HZJA 2WG1A 2EDAA 2JFQA 4HBZA 4RGVA 4N0PA 4RD1A 4YRSA 2Y99A 3H5RA 1G8MA 1RJ9A 1X7HA 1KMMA 2GERA 2BGKA 1G64A 2ETVA 3BIOA 1NJGA 1RAAA 3P2OA 2AOTB 4ZVNA 3AR8A 2QOEA 4PFSA 2Z6QA 1PZGA 1GFWA 2OEPA 3H6KA 5ALIA 1BRMA 3F1KA 5JTTA 3A7DA 1A9RA 2AFRA 5FNVA 2BFNA 5LMZA 1H3NA 3ZOZA 1M1YB 1DMSA 3A0UA 4K2HA 1L4UA 1CUJA 2B3DA 1CUGA 1N3LA 4MMZB 3QJ5A 5AJHA 4PG5A 1AM4D 3LCUA 5ILOA 4AIRA 3Q8MA 3HU2A 2DPHA 1EE1A 1HZZA 2H2DA 1Z68A 4JBYA 1U11A 4BIMA 2DWUA 1DARA 4TYPA 4M49A 2FVXA 1YMQA 3B60A 3R9KA 5JD4A 1YFJA 2QWXA 2WM9B 3LQ1A 1WD7A 4GOKA 4F7DA 1UBKS 3CPJB 5KYUB 2RHRA 4FT4A 1IAVA 1KFEB 3HH8A 4BEVA 4JBGA 3EC7A 3O3MB 2CV0A 2QM8A 5DLDA 3JZIA 3X2SA 2PUHA 5ICGA 1AUOA 2E48A 3B1XA 4ETMA 1PVVA 1PZNA 2G71A 3MXTA 2HADA 3EQ9A 1Z07A 4J6EA 1O57A 2VSQA 4BQPA 3P4XA 3S7TA 5KHOC 4E94A 1MJNA 3C7KA 1LTHR 2DZDA 1TW3A 1J0BA 1X7ZA 2OILA 5HIMA 4TLEA 1RI4A 2KS6A 1ZD3A 2IYEA 3IKVA 4WFKA 1CFZA 2JHFA 4A1OA 3WGVA 4OK5A 3AVOA 4EF5A 1A9XA 2PJUA 4D3SA 1MQSA 4UM8B 4CKBA 5FA5A 1DV2A 2NV2B 1L5LA 5CDFA 3T95A 2YZMA 1WQ4A 3L2OB 1TPYA 1YQ9A 2ESRA 2I3GA 3QGMA 3QVSA 3HCDA 2ZANA 1L4HA 1KEEA 3M4YA 2CMHA 3GLQA 4AS2A 5DNCA 5CEFA 5U4XA 3SJBA 1Z9BA 3LLSA 1PLKA 4KH1A 4NEHB 4W9RA 3WIBA 2L42A 1TF5A 3A70A 3Q88A 3VVBA 3ZDXB 1YCGA 1J5XA 3MUFA 4ZOEA 4W5QA 2B98A 4E88A 5BVHA 3FDIA 3HFSA 1COWA 2YFHA 2QX7A 3EQ6A 5BSFA 4AMGA 3ZOKA 621PA 1RPTA 4O02B 3GX1A 3CNBA 3TLJA 3O4IA 1KQOA 2QPOA 3DVLA 1M2JA 3NHKA 5GPBA 5K5EA 6NULA 1P2TA 3INRA 1SCJA 1K6JA 1YJCA 1E1DA 4H0FA 2PUVA 4B46A 3K6RA 1QU5A 3ICWA 1F6BA 4RXTA 1IHOA 3I1IA 1R21A 4RVGA 1TL7C 4DLYA 1J22A 4PS0A 3FA2A 5AYVA 1O94A 3TJRA 2WIKA 4JASB 2BGWA 2JRLA 1NF2A 1W9MA 2Q29A 3B5JA 1MX1A 1V6AA 2YCLA 1ONNA 1QC5B 1N5LA 1RHMA 1WAMA 4NU8X 3SX2A 4CL2A 1ZPDA 3KZMA 1JHVA 2OSBA 3N2GA 3Q7TA 2R1VA 1HFWA 5TJ9A 1T8PA 2JQIA 1TT5B 1E4EB 3CGGA 1I3LA 2WLTA 1D4OA 3HGTA 5C3MA 5I8WA 3WI7A 1Y8QB 5JELA 2A92A 2UVPA 3L7KA 3ND6A 5AOCA 3ZDBA 1BKYA 3ZD9A 1QH1B 2ICAA 1DAFA 2ZUFA 2ODBA 3GVXA 4B76A 1I0LA 1XRPA 4RD4A 1NP3A 2Z2KA 1DI0A 3FR7A 1Z74A 4JI8B 3ENZA 3D43A 5BOSA 5BWOA 3I9KA 2HSEA 3AKYA 3L82B 1F14A 2DFNA 3E58A 5DP1A 5TMDA 4HMPA 1W35A 3G7UA 3AR6A 2JFBA 4JMPA 2P90A 2IVZA 4XB6B 5IDYA 5FWNA 1LPAB 4ZDKA 4WVLA 5JWHA 4YLEA 4EAAA 1IE3A 1T6XA 4QLAA 4XIYA 5KHLB 3DLBA 4DYHA 3A1WA 3KPUA 1KGDA 1WJGA 3CLRC 1GL9B 3PR1A 4G5SA 4QO8A 3SDSA 1CEYA 4LS3A 1QOQB 4DG9A 3VYVA 4Q1VA 4E2WA 4ILKA 1FK8A 3QELA 3CUKA 4MLDA 2H1OA 4G8JA 4OBXA 5A6VA 5CFRA 4UM7A 4LX0A 4BQQA 3EJ6A 2IH5A 4D57A 4P08A 2C5SA 1BX0A 2FRXA 1KU6A 3TPCA 2JKVA 3ZY4A 4LVUA 2GM4A 3OMWA 3QPAA 1NWCA 4IIJF 4TL7A 3L7CA 3RYIB 3UPUA 1DHRA 1UK6A 2OY0A 2Q9UA 4LJ8A 1DFGA 3Q7PA 4YONB 1EGQA 1SHTX 1Q0PA 3L7BA 1FDTA 1KS9A 3LP8A 3M6WA 3PA6A 1SKBA 4FLMA 4IMPA 4JX8A 4PLYA 4TSFD 4FDMA 1GAEO 4DIEA 1CUWA 4O2LA 3VTAA 3T1TA 3NUGA 1O5TA 4PLWA 3FY4A 2W58A 1WXXA 3AU8A 1R4MA 3B20A 3H17A 4ZXPA 2GRAA 2Q50A 3NM5A 2D3TA 2D5LA 2VRCA 1K7CA 2Z1MA 2BEVB 4EZBA 3KJIA 3KEGA 4OV6B 1QHHA 3ZHUA 1KKUA 4DGQA 3EFOB 4IYJA 5CXQA 4QQFA 2QK4A 1H85A 5I9NA 5AP9A 4FQ7A 4TS1A 4L22A 1X7XB 4N12A 4JI1B 1KOGA 2H06A 2WKSA 3V9PA 2AG5A 3UHOA 5CFZA 1CBUA 1JHXA 4BGUA 5DBGA 2POCA 2WSLA 4FMCF 5A7GA 1YASA 3ZDFA 5DGIA 3V4OA 2GXQA 3BHNA 4C22A 5JCJA 3VV3A 2F4VB 3FI9A 4F1KA 1TF7A 3WP0A 3V4FA 3BN3A 2AOUA 1FPQA 1ULBA 3HDTA 3M9LA 4I4CA 1YR2A 2BFEA 5GGYA 1LI7A 4ZT5A 1GDHA 4ZTBA 1IC6A 4FHFA 1Y7HA 4DY4A 2JGAA 2W2NA 2G9QA 3DSHA 1AXGA 2WU1A 4CV2A 1ULAA 2RJNA 2YZGA 3MIZA 3W9BA 1W2WB 3AEYA 2GZ1A 5HBRA 4Z86A 2G4CA 1OI2A 4JJFA 4B6QA 5HQ3A 5JEMA 2JAHA 2WOJA 1M34A 2RH8A 1XWIA 3LBFA 4Q1EA 4BFYA 4DC0A 4MI9A 3W5JA 3T4UA 3WKAA 4MDFA 1NVMB 3KLNA 3N2KB 3CA8A 4L6AA 4LDQA 5FUYA 4MVJH 4DCUA 4F1JA 1U9CA 1BXGB 2RC6A 3VHRA 2Q2QA 3AHIA 4FD3A 3AUJB 4GLOA 4V38A 4L5AA 1IBKB 3EXAA 3OE7D 1MX3A 1XKQA 3OFNA 4DV2B 2HT6A 1Q0SA 4OYYA 1MD9A 3MERA 3OF3A 2AUMA 1DC4A 4YAIA 1GM5A 4DSUA 3HKEA 3QWBA 4FIZA 5D3KA 3FDZA 3QU5A 3TCXB 3IMKA 4FZJA 4YMWA 1X7WB 4D8VA 5SZJA 3V8BA 3IP5A 3K5PA 1ADGA 3IA7A 3ZDZB 1IMJA 1R15A 1CJSA 3WMWA 3OI7A 1ECLA 4XGRA 4GQIA 5HJ2A 5LBIA 1UC9A 4MIKA 5A5FA 2CDAA 1LDEA 1JYSA 1BCRA 1P2SA 3WG9A 1OZGA 1ODJA 4FK8A 4GOJA 1UEIA 1Z4OA 4HAYA 2C7RA 1FMFA 3IQZA 1NJFA 2DJ5A 2CL7X 2JGMA 4Q7MB 1BD4A 3REQB 3TZQA 1TKCA 5EXTA 1DE0A 1SVOA 1ZCJA 3E5HA 4MI3A 1OT3A 5KYXA 3NOVA 1ZMTA 4K9DA 4RLSA 1L4LA 1E20A 1F20A 1U8FO 3BH0A 1APBA 3DTVA 4IEEA 4JYZA 3KCNA 2UYHA 2ATEA 4EQ6B 4JLAA 3M4JA 5CBPB 2XOEA 2EQAA 1JLRA 2X9VA 1GV1A 3GIDA 2SICE 3CJRA 1HPLA 4UQOA 1X8XA 3W2IA 3W7BA 3V7YA 2I03A 4PSVA 3F5QA 3C8UA 3PNSA 2IUTA 3RRFA 4DV6B 3I2IA 3RWBA 5EJ6A 4UE3S 4BNWA 1YB2A 1SUWA 4UOQA 5DKFA 1IQUA 1OZFA 1PG5A 2NO9A 2PIEA 3OZEA 5EZYF 3KB8A 1ZG3A 3WWOA 2QHXA 2I6FA 3EGXA 1NTOA 1GKIA 1ISSA 4G1UC 2WWTA 3I4FA 2BM0A 3GAZA 3ANLA 4KB5A 4NF2A 1PSDA 2VT7A 3AT1A 2ZIUB 5DCWA 5FKJA 5KTOA 1J5EB 4KFCA 3U81A 4OP3A 3RFCA 2X1VA 3VSDA 4BXOA 2NSLA 5G40A 2HXGA 1JB9A 1YJXA 2RARA 4WJKB 1SCUA 2HA6A 4K2AA 5FB3A 1XPOA 1WV3A 2GNPA 2DPLA 4E12A 1F12A 2UUAB 4ZDIA 3HXOA 1TB4A 2JFHA 4PANA 3GEEA 3NFRA 1I0ZA 1GRRA 3CRNA 4DW8A 2MIIA 4JVOA 5EUBA 3WRXA 3HM9A 4TZ0A 5DMHA 1X1EA 1P39A 1SC6A 3GJRA 2GUGA 2JDID 4E32A 4PQGA 4EHNA 1HXHA 4QPPA 1Y1KE 2BHNA 3NTUA 4CKCB 4ZCMA 4MB6A 3T7CA 1BRTA 2Y27A 3EZXA 4DV5B 2D5BA 3S8EA 4QXAA 3G0CA 2I2DA 2E4VA 2H9AA 1SUFA 3LUKA 4IBOA 4KYIB 3NAGA 3P5BA 4L4RA 2IJGX 2ZE5A 1HQYE 1W59A 4MLZA 4R4JA 3RARA 2OESA 3E8XA 1M2HA 1OQAA 3LUDA 3PT5A 4MROA 4NCNA 3QA3E 3ZE2B 2JLWA 4LOAA 1NBWB 4FNAA 4X9XA 3DXZA 4BE4A 5CA0A 2OUIA 3BJEA 3QKRA 4KRGA 5J47A 4EMSA 4MKZA 4EJMA 3K71B 5KO2A 3IOBA 4RLHA 3A2MA 2VP4A 3MSXA 4MLPA 3H13A 2JLBA 3LBNA 2CLOB 3NVDA 2ZIXA 4D0RA 5IRCD 3ADBA 1K92A 3BXFA 4C78A 1CTQA 3O90A 1DC3A 1OX6A 1RSZA 2ZYWX 4AYWA 5TMEA 2BI4A 2CZCA 2DKNA 2VYVA 5JATA 1DG1G 3PO8A 4E2ZA 3ZTWA 2IXFA 2XUZA 2ANCA 1EK1A 3WAKA 4DMUB 1WZUA 2I54A 4HVAA 2ZYDA 1EJ6A 3DAGA 5LKRA 1A1SA 1MB9A 3BEOA 4KXUA 5C4VA 3HI4A 1ZS9A 3NXSA 5LDHA 1W8DA 3F6SA 4OX9Y 4EY7A 5I7UA 5K8IA 5E4JA 3DE2X 4CF3A 4EGSA 5EHZA 1AY0A 4MS4B 1KJYA 2FMIA 3LCMA 1QKKA 5AVOA 4R40A 2ZJ1A 3N2LA 3RKSA 1BZYA 4IW3B 4FINA 2QZPA 5E1BA 3RUPA 5JG7A 2E6UX 2VQFB 3WMEA 4DDHA 4HAIA 4RPCA 3RV3A 3K0SA 6ADHA 3E9NA 2VHUA 3RSQA 2DR3A 1ML3A 1ORVA 1B3RA 2VYQA 3GT4A 1Z4JA 2MYPA 4RADA 5I4KA 5BR8B 4O2RA 2VPPA 3DLTA 3WYAA 2X0IA 2NXJA 2Y4OA 4E13A 1TE2A 1ZHHA 1OMOA 1NVKA 1U3TA 3JX9A 4JB2A 3KJGA 2EV9A 3IQEA 2QBYA 3VU1A 2UZ1A 4DEXA 1W0KA 2FPOA 3L8EA 4NTZA 1XTKA 1OYWA 2FEPA 4KLCA 1ZK1A 3ASVA 3GLSA 3MJRA 2QGNA 4OI2A 4F2PA 3V80A 3TOCA 3C5EA 4BRSA 3VO1A 4C3UA 1WXWA 3V4LA 4WOKA 1O9BA 2V6FA 2ZIFA 3H05A 4JT2A 4C03A 3BFJA 4WKPA 4X94A 4YALA 4MHOA 1E66A 5TARA 1G8HA 2TMGA 2XB8A 3QBDA 4EP1A 1VXRA 5JRJA 4YRAA 2H4ZA 1GN8A 2EGHA 4CT4B 3FTFA 2J5XA 3T15A 1G7CA 1Q7RA 2O7RA 2WYIA 2XODA 1UR5A 1KR2A 1N2CA 4UNSA 2ZCVA 4A82A 2HK6A 4RPHA 1N0WA 1TAQA 2BOVA 1WNTA 4DC9A 3TPZA 1HDZA 1M2VA 5JOQA 1J90A 1E3EA 4P82A 1FW8A 3PQDA 4OUKX 2Z6AA 1IBRA 2IUFA 4I1RA 2YMQA 3LLUA 3OLQA 4LN1A 2OCGA 1LSUA 1PUIA 3WFIA 4B80A 5ENZA 2V6MA 1HDXA 5DGHA 4HTAA 1GRCA 2D3WA 4LJ5A 2HY7A 3OLZA 5ES3A 2QS9A 2AUTA 2W2PA 2CSUA 3P9SA 1AQLA 3IALA 3H11B 2O2YA 2XRMA 4MQ6A 4A91A 5TE9A 4BU1A 3VH4A 3KQQA 1DO2A 2P78A 4RFLA 4GOXA 4C87A 1E6LA 1UWCA 4ZI7B 2XTMA 3W2EA 4ER7A 3D3KA 5K3FB 1MG5A 3GIWA 1SKYB 3KJZA 3VPYA 3M1IA 1FQKA 4WXPA 3EVDA 1IONA 1S02A 3AB8A 4N3GA 4TYMA 3UXYA 2UKDA 2YXEA 4UXJA 5GWXA 3B1ZA 4EA9A 4KHPB 5C7LO 4BU0A 5KJCA 1DFHA 5LLSA 3CNLA 1HNWB 3ZDYB 1VTKA 1C2TA 3TFQA 4CFZA 5I9SA 4YDHB 3V2HA 4YP6A 2ILVA 3VDRA 4MUNA 1EDBA 2CLFB 2QLTA 1DX9A 4O4IF 1GGNA 4XFDA 3SC2B 3K53A 1WBDA 4L07A 4E15A 1UKEA 3RFFA 1F2UA 4G5GA 3MA0A 4H3SA 1I1QB 4KIJA 3NDBB 1MENA 3VR1A 2A3RA 2QXTA 1GQOA 1M7BA 2NUTB 2VCYA 2WZCA 1XCPA 5TMPA 2CLDX 3OU7A 1Y6FA 3QXHA 3RRYA 1Z6AA 5DW0A 4Y2YA 1OTHA 3PC4A 1WUIS 3EWAA 1V11B 1JAXA 4D9IA 2LP4Y 5EJ9A 5IT0A 1H2YA 2FWIA 2GILA 3LG2A 3HN7A 4Z9BA 5K0CA 2AZMA 3JQQA 1XP8A 3CNNA 4RHCA 1SG0A 3G0BA 4OLHA 1E7WA 1UDRA 3PC7A 1X7ZB 4JD5A 5LP6C 2FW9A 5F5XA 1IN1A 2O6LA 3IRUA 4RKWA 2J0EA 1V3TA 3AB3A 3AV0B 1BH6A 3BK7A 1QRSA 2XXAA 4GXQA 4CKBB 1JLHA 2XF2A 1XOIA 2W98A 3CBQA 1EB8A 5I7AA 4FYJA 5JMOA 1WCIB 2IYUA 1C9DB 5H83A 2LDXA 8ABPA 5A02A 4KE7A 4U39A 1JFTA 2C57A 4JA2A 2L82A 3LOQA 5MDHA 2PQMA 1RI2A 4JOBA 4XGNA 4AJ4A 1ZVVA 4PWZA 1CR4A 3U39A 2IP4A 5BQFA 4BTVA 3BIXA 1MVOA 3BM5A 1JDBB 3PIIA 2GA8A 5IC6A 3LHSA 5BVHB 1FL9A 1ORDA 2PFKA 3B85A 1E60A 1U1DA 2PJDA 1WXEA 4HMOA 4TWRA 1AKMA 4WLEA 4AW9A 1J25A 1R1DA 2KE5A 3W90A 5IFLA 5A3QA 4YQFA 2AIRA 3VH3A 5AKEA 1RRVA 3OLWA 5B58C 1I2BA 3IJPA 3M1LA 3E7XA 1NONA 1HT3A 4ACBA 5ALSA 3ZVMA 2M98A 1EUCA 3PNPA 2C8JA 4O2BB 3SEQA 2JAXA 2FR8C 3AV3A 3L07A 2J0VA 4ZQBA 2ODWA 1P6XA 1B2RA 3RS7A 2QB5A 5E3IA 4G0NA 9GPBA 2NG1A 4MS1B 2IXAA 2JW5A 2HJHA 5G3YA 3G9TA 2FW1A 1QU2A 3R9XB 3HDGA 4RDCA 3V2GA 4XM0A 1NXXA 3DTTA 1Z63A 1U8CB 4BLPA 1FUKA 1R4AA 4R7GA 3RS3A 4CMIB 2V3WA 1RZUA 4O4HA 2JC3A 4H7HA 3H99A 2R6ZA 2O2XA 2H5LA 3N2GB 1KVSA 1CLUA 3A2LA 3N6XA 4V3CA 1H93A 3AUSA 2ZYRA 2WSBA 1TT5A 3FCCA 2FN3A 2ZU6A 1X94A 5LOVA 4RVFA 1TZBA 1FNNA 1MABB 1XKLA 2Y4NA 3A31A 4V24A 2K87A 4W8HA 1ZLYA 5CLFA 1YZ3A 2G0TA 3ZWVA 4BMVA 4CIDA 4W8GA 2IHBA 4URHA 4DIFA 2RHJA 2ZR0A 3B36A 3A32A 3EIHA 4L6IA 1N4AA 1YRHA 3ORQA 2GPJA 4FLFA 4UMFA 4JMLA 4EMUA 2PEYA 1K5DA 1Z0JA 421PA 1WG8A 4KI0A 3ANYB 1U7UA 1LD3A 1O5OA 2IYLD 2KQUA 2CJYA 5GVRA 4DYVA 3PQ8A 1C8KA 2JRCA 5EE1A 4N8DA 3DGFC 2P41A 4EHKA 2QQ0A 5A7FA 2RC5A 1TQ6A 1VBNA 4LJ9A 4CYMA 1GPUA 2AC4A 4URZR 3C5CA 3FGNA 3QELB 4WFIA 5LQSA 4C3OB 2YZ2A 1G5QA 2XQJA 2R85A 1ND5A 4O5AA 3RTEA 1ODTC 5ELMA 5AW9A 2JBHA 3LF1A 1XFAA 3RU2A 1U2DA 5JYCA 4UJ5A 4C7OA 1V1RB 1TJ5A 3QVVA 5K9ZA 5LP6A 1YK0A 5F3WB 1VFPA 4YJGB 3KVYA 2C20A 4YPVA 5KQMA 1Q16A 4UVIA 1N78A 4QTUB 5B7PA 2E4XA 3CCBA 1Q1NA 3W4IA 1ISPA 1G1AA 1PD0A 2YX1A 3ZD8A 2WWHA 4ENPA 3KSAC 5CYOA 3CMCO 5H3CA 5CVUA 4E5UA 1YFLA 4ICIA 4JZKA 4S3MA 3D5TA 3MTAA 4IUBS 3PR2B 1Y4ZA 3IDAA 4Y0VA 4Q3CA 2ZDGA 2ETXA 2J07A 4WMLA 3QBTA 1XP5A 3KOOA 3CU5A 3OWHA 5TNXA 1EWTA 3RTAA 2VWPA 1FNMA 2TMDA 5T4EA 1QPZA 2IEBA 4NC9A 1JN0A 5ABPA 5C81A 2C3MA 1VA5A 3T6KA 5E4FA 4HLCA 4BMZA 2OFOA 2XNHA 4R3WA 1XTRA 1ZGGA 3CMMA 2WHPA 2E4YA 4TTIA 4EDHA 2ATCA 3NYRA 4RXMA 4QLBA 5K0JA 3T1YB 3ND8A 1WSBA 5CH8A 5HF6A 4X85A 4LZOA 3FOAA 3HFGA 1QK3A 4QXRA 1YBAA 1J00A 1ZQ9A 2X2OA 1UFQA 3ROXA 3VZQA 3A1CA 3CRZA 1A72A 1E1QA 1Z18A 4IICA 4RIIA 1SIWA 3LQ4A 2CYAA 1KE1A 1BMQA 1E9CA 1R88A 4AL4A 3D7MA 1ZVJA 1WVMA 3QNUA 4BYGA 3S5JA 2G25A 4GUAA 3UK2A 1UT8A 2QAJA 3CZPA 1ENYA 3ROGA 5THQA 2R44A 4FX5A 4U2EA 4CEIB 1SCBA 3L0YA 2HHJA 3NG1A 2LUOA 3W3ZB 5JD6A 1UZLA 3MFYA 4CMBA 1KETA 4DQLA 1Y8AA 4OHBA 4W5OA 4UMEA 1GGKA 1N6HA 4QOFA 3TBFA 2VCHA 4HOYA 2XRZA 3DTNA 4R98A 2J3IA 1SWWA 2BZGA 2AFHE 2XKJE 4MR9A 2EP8A 3WQBA 3QI2A 3FPSA 4US2R 3UV7A 3EZ2A 1P0PA 4U0JA 4ZO4A 2J9YB 2Q9AA 4TRJA 1YS4A 1G6GA 3JZDA 4GLLA 4AQ7A 4JI2B 1EVZA 1FYWA 4HGRA 3WK8A 1X80A 2P5YA 3N0TA 2D5CA 4M21A 3NHLA 4Y1FA 4P4SA 1GZDA 2WTUA 5TY0A 1E8NA 1O94C 2GN0A 2JI9A 3IKMB 1TMGE 3GFQA 1CUZA 1P9OA 4GXTA 2E37A 3PQ4A 2DHRA 2C5HA 3CF0A 4NZMA 5A3SA 2FSHA 4BWFB 4KVFA 4CT0A 2AN1A 4MW5A 4U8GA 1YR7A 2OZLB 5AJZA 1E6CA 4FKMA 1EMDA 4PLPA 2PFGA 2VSFA 3BREA 3D2LA 2PNJA 3T0GA 4DUPA 5KX5B 2V1UA 1EVIA 4YMHA 5CEEA 2AT1A 1RWBA 2IU3A 3KU4A 3RLIA 1RZ3A 2WFZA 2X0FA 1KVUA 2DPYA 4FYYA 1M1UA 5FJIA 3LKZA 4MO9A 5GIPE 5JEOA 2CXSA 2EBFX 4YN3A 2QVGA 4CETA 3JQGA 3U6BA 4BLRA 5C8XA 3ZLUA 2IGTA 4BMXA 1C0KA 2AI2A 1RWNA 2R11A 2J4CA 2JCGA 4PWYA 2ARKA 1J4KA 1KXJA 3CEJA 3MWLA 2QD1A 4DZTA 1U6IA 2J0UB 2ODQA 4QX6A 4R9SA 3R7FA 1WCXA 3O6VA 1V37A 2FSFA 1XQ9A 4EB6B 4PCAA 4PO9A 3VA4A 1DXQA 4J8PA 4L4YA 4N7MA 4IIJA 4UBIA 3HU1A 4OQNA 4AC9A 4IDGA 2WAMA 2HJ9A 2OD2A 4DSZA 3Q0EA 4GNKA 4D0SA 3EULA 4K0RA 5ILQA 5TQJA 3R75A 3V34A 2IY7A 1XO1A 2BCGY 3BXGA 4JSRA 4XVQA 3WGYA 2FA9A 4GYWA 3WZLA 2O5VA 1YVPA 2J41A 2YJGA 1C30A 4WECA 1OXVA 5GJCA 1XDBA 1Z7EA 5A03A 3GLVA 5KS2A 2G1UA 1WZ2A 3BAZA 1TAGA 2ISQA 1IY9A 2IY9A 2JJ8A 4XEUA 2ZAOA 1MO5A 3FROA 3HJTA 4MWCA 3WA7A 5DN9A 1H1LA 2IQ5A 2I4OA 2M1ZA 4KGZA 3OSZA 5AHRA 1EM6A 2QZJA 5LNK1 1KH2A 1S5PA 1TU3A 3AY3A 3G9ZA 2FQQA 4GPEA 4MVJE 3OQNA 3BCRA 3PFHA 4OHUA 4CKCA 1ZJ5A 3WHLA 5IXSA 1G7TA 1EUZA 2ZIAA 3EA4A 4PINA 3VZCA 3NTVA 5LDDC 5MGBA 3C87A 1OCEA 3LRTA 2WFMA 1HV8A 4POAA 3X1WA 5KJFA 4YRJA 4CLEA 4ZCLA 4HXYA 3BWXA 4YA6A 3G2PA 2ISCA 1HG0A 4TYYA 4OH7A 4YUXA 4JLKA 1R6XA 1VHWA 2B8WA 2VDVE 3EZYA 4HJXA 2YHBA 5B2ZA 2E49A 3RTBA 4AKGA 2QZSA 5AVSA 4G37A 3ZWDA 4WUTA 1BA2A 2C9YA 1ORRA 1ACMA 2QXUA 3AHCA 2HJGA 3KJFA 3RODA 3UWOA 1CERA 5FPQA 3AERB 2DTXA 1EINA 1T8YA 2XYPA 4X91A 2VYNA 1LBSA 2O4CA 2G04A 2VF5X 1MX5A 3CBGA 3H3JA 4LGCA 1GEEA 4LWQA 3RVRA 3ZYCA 4ALKA 1N36B 3FOFC 2BFCA 5ER6A 2AEFA 3HR7A 1ZWLA 4BQEA 3QX9A 4OXXA 4WN9B 1L7VC 2GLUA 1AKEA 2M6SA 2MYNA 4IMRA 3BTSA 4JI3B 3EAFA 4FGZA 4W82A 3WYDA 3ZI4A 1E2LA 2CHGA 4FFBA 5JZMA 2LIPA 3OZBA 4X61A 1TYCA 4ZARA 3LFUA 1HDCA 2GD1O 1GGJA 1ZLXA 2LCIA 4JJEA 1KBZA 3RVQA 2IIQA 2Q8QA 3H9QA 4M0KA 5CMLA 1Y6GA 4ZXFA 2OK8A 3ZI7A 2AE1A 1VHDA 1RRKA 5JMWA 3M0EA 2EATA 1YRAA 3ZX5A 4E2XA 3KWLA 3NT5A 2FW6A 5BP7A 1TJYA 4PFQA 2KKLA 3NORA 1Y3DE 2OG2A 4LTMA 3OBIA 4DWWA 4BMDA 2FR8A 4KTVE 5KU1A 4I08A 4MUBA 3W6NA 4I5GA 4WXRA 5KSOA 4DDWA 3CR8A 1FS6A 4BP3A 1E2EA 2QEQA 4R68A 4ZU6X 2P2LA 3E8SA 1S3FA 3QUQA 2ZOSA 3D6UA 3TSYA 3FNEA 3RJMA 4E1BA 4G65A 2Y68A 1NC1A 2VNSA 5E0OA 2GESA 1X39A 3UXHA 4F2WA 2EKDA 2XXBA 4DA6A 4Q21A 1IPFA 2G77B 5ED0A 3V4PB 3WJ2A 3O7MA 4Q4LA 5C35A 1KC1A 2QD2A 1WPGA 1NJ6A 5EE5B 3L79A 4B3XA 2MT9A 3KYDA 3IDQA 3RSCA 3O4VA 1GQ2A 1KMHB 3N8IA 3NTQA 4G9BA 1US8B 1NY6A 1RRFA 1JE0A 2BHLA 2IUEA 3BJMA 5DN6D 1M33A 5H7XA 2WZDA 1EZ4A 3VC1A 4WXHA 1FCJA 3NWPA 2AN4A 1N2CB 2ZRJA 3WLOA 4Q7QA 1Z12A 2D06A 2PCLA 3LU1A 1ECCA 3HX1A 4BAGA 1GPNA 2PQ2A 2GM3A 2HOQA 4IMIB 4ZVLA 3JQBC 1QZ3A 1RAHA 3QFSA 3U4GA 1K1EA 4KE8A 1DIOB 1YAJA 3PCXA 5EL0A 4ZU1X 3FTPA 2RKOA 3AH8A 3EUFA 3FYCA 5LLTA 1CUIA 4EJSA 1AQYA 3AIOA 2PRKA 4HK4A 1CUXA 4WBNA 4AY4A 5HZGA 4JLWA 4I2VA 5FNVF 1UXOA 4R7TA 4DXDA 1E63A 2XB4A 3D3QA 4EFNA 3QPUA 5FWYB 4V0OA 4QOSA 5HKLA 1QWTA 1QAMA 1NRWA 2I1LA 2BPOA 5MFZA 3DL4A 5CYFA 3A1DA 1SUDA 3DNPA 3KR0A 3L4KA 3USES 5FLEX 3ZN2A 1YRBA 1AV6A 3ZK8A 2Q5LA 2R1UA 3CLVA 1JG4A 1H6DA 3LPAA 3NHAA 2A2ZA 4UMDA 2ZS7A 4E07A 5K6TA 1M7HA 1E7MA 2AA3A 1A04A 1A1VA 4DTCA 2RGBA 2ZYVX 2BL4A 1GTG1 2A1TS 1LDYA 4HUJA 3R1IA 2C1ZA 4F2HA 4L15A 4PGMA 3IRVA 4L27A 4YXFA 2C1EA 1O87A 3MJEA 3HNRA 4Q18A 3R7SA 5DCUA 1NLUA 3RIHA 1PJAA 4U6QA 4LEIA 3NTRA 4JYAB 3G82C 2RJ3A 1SZCA 3Q12A 2QMQA 2ZRCA 3AG5A 4J0FA 4OK3A 3PUHA 5G1NA 2DBVO 2YJTD 5H59A 3SS9X 4EVIA 1XTVA 2KMLA 3RFXA 3CG0A 4UHFA 1Y1TA 2BKLA 2CNOA 1ZQ1A 1ES9A 1N25A 1D5CA 1VDMA 3ED1A 1K0FA 4FZVA 3D4LA 2BTQA 2CL6X 1FU8A 2W2VA 3O31A 3K0FB 3PX2A 5LIRA 3G2IA 1RHQA 5ETJA 3N7UA 1BU8A 1J06A 2DLNA 5D7BA 2E4AA 4FPXA 1KI6A 5KCZA 4V1CB 4H6VA 4UVHA 1YJ5C 4ZEWA 1F1BA 1QBKC 2CVOA 3SN6A 3F6PA 3JY6A 2Z9CA 3H87A 1IPHA 2O8EB 5TPWA 5IPFA 2X8JA 1NXQA 5GMOA 2DTDA 1AKVA 1Q50A 2D4AA 4O2AA 3U31A 5FYDA 1C7ZA 2Q27A 3L49A 1XVUA 4FKZA 3RADC 2MINA 1E3SA 2WFLA 2QVCA 3ELUA 1CYEA 1E7RA 4LYGA 4D44A 5JXJA 3UFXA 2F9MA 3ANXA 3HEBA 1E0SA 3T34A 4WRRA 5BQPA 2X7JA 4I81A 2GSDA 3AX6A 5EWMA 4ZQHA 2H1WA 3HJUA 1H2HA 2BJWA 3OZWA 4WESA 2CKMA 3D4BA 4BKRA 2G9ZA 1XXHE 2NTJA 2XB9A 3ND9A 3V4ZA 4AKTA 1PWXA 2JCBA 1FDRA 1FYDA 1TPZA 2C03A 1GZSA 1W36C 1JHMA 2NZJA 4US0R 1L7DA 4ZI2A 5CM8B 3V55A 1SUIA 4IDOA 2WAAA 4JITA 1JAYA 2AXNA 2HIAA 4R1NA 1E3JA 2O1XA 2FEWB 3JAKA 3LRPA 1N3BA 4I1IA 3IC5A 4W7HA 4BQNA 2YINC 4DG5A 1GITA 5E95A 5FORA 3GRYA 4NBKA 4EB8A 4JCCA 3B9PA 4M7OA 3ZPXA 3MT0A 1GNSA 2KSQA 3HSYA 3NXKA 3T7TA 2YWJA 3RF7A 4B0OA 2J3HA 5KNDA 2P9QA 4N3NA 4MINA 2RI1A 1QX3A 3OZCA 2OBMA 4XGQA 1C3XA 3CXUA 1UMBA 2FRDC 2P0YA 1JFFB 2YDXA 5LMNB 1ZVKA 3NZEA 3K8ZA 3GJ0A 2BM8A 3CY6A 2AJ8A 2A3NA 3RPEA 2CFCA 1AHNA 1QGYA 1XU7A 2CN1A 2BZSA 3OX4A 4FDAA 2CNDA 3OIWA 4G8CA 4GX5A 4H7FA 4QU0A 5A9SA 4GF5A 1EVLA 1W52X 3KAQA 1T6BY 1AOXA 1E6EA 1UXKA 1M2WA 1OZAA 3QE4A 3RVMA 2I7CA 2NNLD 3CURA 4JP5A 3BX1A 3G85A 1HSOA 3WZ2A 1QVVA 3H7IA 4TLDA 5KINB 2OK7A 5LC1A 5EJ2A 2AD1A 2QU8A 3O4RA 4RL6A 5KNBD 3SICE 3SWWA 5IUNC 1KF0A 1U8YA 1G291 4KX3A 1R3DA 1L2TA 4RF3A 1YR1A 4BB6A 1XMOB 2AYZA 1V39A 2BKXA 2XR1A 1HZZC 3IVRA 4N3CA 1X0XA 2BEWB 3LDHA 2EQ5A 3QIVA 4IG9A 4W7SA 5DYWA 3ZKAA 4LZLA 4BGVA 2OVFA 4UFPA 1TEHA 3ONFA 2O23A 2I3ZA 1YS7A 3Q3JB 4G2SA 3C7DB 1YZFA 1OBOA 4FCVA 2OOKA 2D0DA 3BE5A 3RK4A 2PHZA 1IOWA 3SYMA 4ACAA 4DMHA 3AEQA 4OHVA 5DZSA 1PZEA 4FYKA 3FYTA 3V8MA 2BGIA 2HNKA 1N1MA 3MJDA 4DA7A 5C8YB 4KV7A 4XIGS 3JR7A 3UJ7A 4YACA 5DTIA 2QG9A 5KTMA 1PR4A 3PHIA 2B4AA 2LGJA 4B3CA 3LD9A 3SF8B 3BDAA 4G2TA 3STVA 1KAOA 5EMNA 5LXTF 1MZPA 2DUUA 3GMDA 2H4WA 2P2YA 1BA3A 3PTAA 1F7VA 3AP3A 2A35A 4MRAA 1L7XA 3CZCA 3Q9LA 3WK7A 2A84A 5IAKA 5AK4A 3NRCA 2GKGA 1CZOA 1K2NA 3KO8A 4MTCA 3CSSA 5ICEA 4BVAA 3HP7A 1XELA 2GZAA 3GG2A 4M38A 3WGQA 3K92A 2A5YB 2UYGA 5BR1A 3HI6A 3S1AA 2OGZA 3C6KA 3D31A 3DZHA 3HZRA 3JATB 1NN0A 3LC2O 3MOSA 4PLFA 3SQOA 5CB4B 1NBMA 4EI8A 3AETB 4CKWA 4YUWA 4RH0A 4U9IS 2RFLA 1MF7A 1F1JA 1OBFO 3F6RA 3P9QA 3THXA 4QYXA 2C2GA 5T57A 3RJ5A 2AR7A 4ESOA 4HFNA 3L6BA 2XI4A 2R1TA 4RMHA 3T5MA 1G59A 4TWZA 4WBNB 3OP4A 4NBUA 5FP0A 1A9XB 4NL4H 3ZHBA 1J4OA 2W93A 2ZKLA 3AWIA 3LE8A 4I5EA 4X1OA 1JHOA 4M1TA 3S40A 1MN6A 4YMTA 1GPWB 1KQ3A 3R6WA 3MG9A 5I9IA 2WJWA 1Z08A 2A5GA 4RQBA 3QEKA 3PC8C 5JLAA 4UHEA 4ETNA 1OLSA 4XLTA 1U9JA 5AKHA 2NX2A 2JFUA 1UOQA 2N42A 4AVYA 2C4KA 3E9MA 1ZGHA 2H1IA 5AKXA 5AK0A 2IEZA 2NSYA 1KMQA 2GXSA 1REQB 2RAPA 3O0TA 3QOFA 2V9CA 5A3RA 1J7KA 3DSRA 2V6JA 1MHPA 2QROA 3DKKA 3L0PA 2XTJA 3RANA 1P2DA 3HLTA 3IO5A 4LRTB 1L1EA 2VRBA 4FCWA 3URKA 2VP0A 4RTQA 2BGJA 1ENOA 1Y1LA 2P5UA 1KP3A 2X8AA 4Q66C 3N2IA 1YQUA 3IIKA 1DWQA 4YWJA 2BISA 4AYTA 5KJEA 4JCOA 3AEUA 2FPIA 4INAA 3MOIA 4Q48A 1WOYA 2EIXA 3ZWPA 4NJMA 2HWKA 5KOIA 2ONZA 1K7YA 2WIFA 2KPOA 5EIEA 1CHDA 4DNQA 1OD6A 4YRGA 4HDCA 4MHSA 1EH5A 3DKRA 2GD0A 3OD1A 2CLMB 2FZEA 2C88A 2EEPA 1LZLA 3ZHCA 3ADCA 4YJ2B 3PA8A 1NVUQ 4MUFA 3FTCA 4ID9A 2PZGA 4HQRA 1YUNA 1R16A 5CCEA 2PZFA 2OG1A 1RLUA 2COEA 5F73A 3G7SA 3LPNA 4GVLA 3RS0A 1KY2A 2CY0A 1KBOA 1ZK0A 3ZJ4A 3MLBA 1R10A 1X9HA 4YPOA 4YJHB 1YUBA 4FNOA 2BFOA 3BAFA 3OCJA 2C78A 1XXHA 2YS7A 3FCYA 4PLVA 4X1KA 2AV6A 3EWSA 1QIKA 2QR3A 3I5AA 1WDMA 1XZIA 2JFXA 4GGPA 3ZU2A 2CT8A 2F4NA 4K28A 1CS4C 4XLLA 3OKAA 4ZAYA 2Y92A 3DYBA 4I4IA 1Z38A 4EUHA 3G2OA 3C6ZA 4YRBA 4M8KA 1YS2X 2ZJ0A 2J8ZA 2Y77A 3OQIB 4XM1A 4O2AF 2ZAYA 1R74A 2GBLA 2JBWA 3PX7A 1LX6A 1GTJ1 4IOJA 4CF7A 1A96A 5EJ7A 3IR5A 3IOCA 1YA4A 3I0ZA 1T4CB 2YRXA 2H7VA 4NBTA 3C3WA 2J0UA 2FFAA 3DBOB 3FR8A 5FO1A 2QX4A 2EFYA 1MZKA 2BKUA 2O3UA 2JI8A 3E3MA 2VH2A 5F7JA 1YB1A 4KACA 2FUEA 4H27A 4IDBA 1EK2A 2GCIA 5CIYA 3AJ9A 4WV3A 2B7BA 3R9WA 1ODCA 2F3UA 1WD5A 3Q3GE 1AO0A 3I9V6 1BS2A 1OBCA 2Q3LA 4WSOA 5F52A 5B3AA 3W78A 1K86A 3BWBA 4AF7A 1KI3A 1H3EA 1ZIDA 1LX7A 2E5FA 2ZU0C 1HE8B 1QRAA 1JSRA 3A9CA 2G80A 5C2JB 3SQNA 5K3OA 1I2ZA 1LPMA 2H4XA 7GPBA 5EGNA 5C32A 3GQBA 1AH2A 4UCWA 1CEEA 3Q3IA 4CIAA 1XAIA 2PBLA 3UF0A 2NPIA 3AFIA 1VP9A 4PRZA 4PRKA 1ZONA 4TYQA 5BSHA 4DLPA 3U48A 2XCRB 4HYQA 2O3JA 4TVBA 3RHTA 3LFTA 1D8TA 2HCTA 2O2SA 4MKGA 2BFDA 2WNSA 1RRPA 3DMPA 1USGA 1R6TA 2RI6A 5DCYA 5JCOA 5C1IA 3T5DA 4BNDB 5KDOA 3NIFB 3S68A 3KRTA 1TCAA 3AUAA 1EXVA 1TVCA 2X4GA 3U3JA 3IQXA 1A95A 1BE8A 2QAGA 2W6ID 1T2FA 2R2GA 3BMQA 3QZUA 4PG8A 1MRNA 5A5DA 4X66B 1PYOA 4Q0MA 4AJPA 3PGKA 2KBFA 1V7CA 1DKOA 4HWSA 2CLEB 2WV7A 4D98A 4D8YA 5ITZB 2W3OA 4O3FA 3D0RA 1K3FA 4WQMA 1OLXA 2QUBA 4TMXA 5KX5A 1KVRA 4P5DA 1NW7A 3MTGA 4D56A 4F60A 3N58A 4HFMA 1G63A 4EGJA 4FDUA 2E6KA 1WDWB 2HRDA 3L93A 3STWA 3SFZA 3W2HA 4GBMA 5FTNA 4WVFA 4V0KA 5D87A 2FR0A 1U80A 2LVBA 2P6MA 2VAPA 4IYRA 1E2UA 2H7XA 2I6UA 2Z9DA 4FKBA 5F78A 3ROTA 4BNKA 3GJ7A 5BQ3A 1SY7A 5BWBA 1X0VA 3QU9A 3FTEA 3H4VA 3UK0A 1O8BA 2NUPB 2AL7A 3LBIA 4H1TA 4O4JA 4DA8A 1T8TA 5GIOE 3LY8A 3MD9A 3CM0A 4WN9A 2BELA 4BRWA 3IAM1 4AMVA 4OYRA 4GT1A 3GRKA 2OWEA 1F8UA 4WCFB 4AULA 2YVQA 4DLUA 1BWPA 1M6VB 3N8NA 5SZIA 5ALZA 3D8SA 1Q77A 1ZUNB 1NW8A 1U0EA 2LRHA 2GF0A 5A5GA 1JHUA 5JNTA 3EF0A 2G07A 4OB6A 2W6PA 1RIIA 1RAFA 1V26A 3PPWA 3DVRX 3IV6A 1VRWA 5DGTA 3I5XA 3SF0A 2QV7A 1D04A 1GQSA 1XN1A 1L3IA 2P7IA 3FBWA 4ZQIA 1PFUA 5DNDA 3V1KA 3I92A 4RTPA 3THWB 4DIMA 1JU3A 1Z8FA 1UKBA 1SD1A 1X1TA 2I9PA 2VLIA 3DV9A 3EXHC 3OFJA 4NKRA 5HIJA 4HGOA 3AR3A 2PUBA 5EKXA 2OTCA 1GSOA 2VDRB 3MJSA 4WXMA 5H3LA 5AKKA 2XUHA 3DGEC 1VMAA 4PICA 3VAAA 4AJIA 5BNZA 2OPHA 1K08A 3MHTA 2P3SA 4WCFC 5BSVA 1NP7A 1YO6A 1PP4A 4XQ0A 1SVMA 2DGDA 3LC0A 2ID9A 3TLBA 1J4QA 1RZRD 1UFKA 3H2BA 4C6TB 4JUCA 5FWAA 4RVNA 1CF2O 2PX4A 1MW9X 4LXIA 1DRKA 1KAMA 2G1AA 2NUBA 2FMHA 1N0VC 1EFLA 2JLSA 1US8A 1ZGBA 4XR4A 2WWYA 1X6VA 2VDQB 2J9ZB 4TWIA 4X95A 3S70A 3WQRA 5ALDA 4Y30A 4JROA 5CDGA 4R2XA 1ZW6A 1EWKA 1JVBA 3VHLB 2IU6A 4YUAA 3DO5A 3ZBPA 2A0KA 5EAIA 4YP1A 1RYZA 3CUTA 2C2XA 1NMZA 3E4DA 3D8TA 1O97D 4AWAA 4D99A 4FI3F 5JHGB 1U98A 2VHQA 3OU2A 3UJ8A 3SYKA 3QVGB 4QGHA 3NOQA 4IINA 2C9MA 4EVSA 4B81A 3RBZA 3H83A 1NYQA 2H2GA 2VUTA 5AVZA 2BBOA 1WP9A 2ZWMA 3BHIA 4DPLA 2Z3VA 3K6SA 1EKXA 1MC1A 4ALMA 5KOHA 1PW5A 1ZM4A 3QXJA 1B93A 7MDHA 2VYVD 1ZH2A 3NWOA 4ARUA 4EGAA 5WRFA 2A9QA 4LZPA 2Q2WA 3K0CC 4XIIA 3D6TB 5DX0A 1SQ6A 3IOYA 3DQQA 1KYWA 4F4DA 1ZH4A 4JEMA 4Y2VA 4PGAA 5DLQC 2VQ3A 4LJSA 1F7UA 5KOYA 3WLHA 3D02A 1WDLA 5BN4B 1A69A 1EDEA 3WK5A 2ZVPX 3ZIUA 4MWGA 3CLRD 1UC5B 4K86A 1I13A 2V7QA 1WU7A 2WWRA 4UAVA 2M6RA 3VPCA 4DBLE 3JQFC 4DWVA 5KWEA 1QRTA 1Q3HA 3NP7A 1T36A 3O74A 1A88A 2XE4A 3O3NB 3ZDEA 3JWHA 3LT2A 1CXZA 1WDKA 2OSVA 3CRVA 4I4TF 5CVVA 2GWHA 2ZUTA 3D4PA 1IRIA 3KNZA 4B84A 1MAHA 4WTOA 1KP2A 2SKEA 2CNNA 1P1IA 3E22B 3WAGA 3HU5A 4N76A 3FNHA 2O19A 3EVNA 3TJMA 2O8FB 4KQ1A 1GG8A 3ZCVA 3L0CA 3CPEA 5HQJA 4UOZA 5K8UA 4BPRA 1I24A 2B61A 2IDMA 3O8QA 5ICFA 1TEXA 4B3DA 2OP0A 1Q84A 1Z6GA 4ZK6A 3F9CA 2H7CA 4MTLA 5A62A 5I48A 2HUNA 1D2CA 1Z36A 1Z6YA 3FKQA 3PFBA 4IDCA 4JGBA 1TYAE 1M54A 2ZS8A 3GFRA 3H2IA 4N0EA 5P21A 4V1CA 4B7UA 4GPBA 2A1UA 4Q1CA 1WCV1 2PKQP 4YY3B 2IE8A 2ZIXB 4HRVA 1U7FB 4RHYA 2X40A 4M1WA 3COJA 3TUJC 5AJVB 5D3MB 3DCYA 4Q00A 5GQSA 4BP8A 2A7XA 2YNMC 5AHWA 8GPBA 5EXEA 1ZW1A 2MINB 3V1MA 5AQEA 4NE9A 4ZDWA 3WK9A 4YCAA 3C5WP 2CVFA 3I2JA 1MV5A 1Z5VA 2MDTA 3KSUA 2A9PA 2XDYA 3S8MA 4AICA 4HDKA 2VSOA 1SA0A 1O95C 1SN7A 2PUTA 2H8GA 2ZQ5A 4NS1A 1MTOA 3T7IA 1J21A 1OR8A 3MTJA 3R7DA 3MWGA 4N7JA 2QMOA 3WLEA 3WIDA 1J2EA 1RM4A 2JK1A 3FSGA 1IN6A 4ZOLF 3EXIB 1EVEA 2J31A 3JARB 3VJKA 4DE5A 4ND6A 4OJMX 4UNQA 5FRDA 4YMUA 1SBQA 2WWFA 1CVRA 3M82A 4HEA1 2IHUA 2J9RA 2HXYA 2Q1WA 2W6OA 4JJ4A 4Y2HA 4DMKA 3H8WA 3GC6A 4ZGGA 2WLSA 2P77A 3DDCA 1OIXA 2ZBEA 1ADYA 5JCXA 1I5EA 2J67A 3IQGX 4Q16A 2O57A 3N3AC 1SD2A 5DW3A 4QASA 2I1WA 4YRPA 5IT4A 4QULA 1QFSA 4IDQA 3SPXA 3NS7A 2AFHA 4A92A 1K4MA 3CUWA 4DR1B 4OSEA 2W0SA 2Q3HA 3JD4A 3F8SA 4BJ1A 3P0HA 2NTYC 3IIMA 4Y67A 3EVEA 1IUNA 1KYQA 1QHNA 2A78A 3B6MA 3WQQA 1J33A 3A26A 1T9HA 2RK6A 1UZAA 1MNQA 3IAXA 5A9SB 3WB9A 2CJXA 5HDQA 1N2ZA 2JKDA 1HLFA 3FDFA 4NHEA 5JBQA 2WB4A 1E2KA 2G7MC 3TRKA 3D1LA 2HV9A 4KLAA 3LSYA 3NALA 2F8TA 1V35A 3FWKA 2WMNB 5TVGA 2ZAGA 4RVCA 3GA0A 3GH3A 2Z43A 3V42A 1Q15A 4CM3A 4XWWA 3R7AA 3ACBA 3L4EA 1ZNQO 4IJVA 1MAVA 4F4CA 1ESZA 5IYZB 2NZ8A 3GZTB 1JJIA 4FZ5A 4B87A 2FWNA 1QF7A 3GZNA 3ZYZA 5LQJA 4KBFA 3JPYA 3UANA 1IHPA 3UJ9A 4R0MA 1B73A 4A0FA 4DUYB 5DHAA 4Q5IA 1PTJC 3KL4A 4UCFA 5ICSA 3MJTA 4C4YA 3IEUA 3IP7A 4U00A 3BA1A 2FPKA 3C4JA 2EEZA 1FZQA 2OHOA 3E81A 3OFSA 3QX7A 2X58A 2PWPA 4DJFC 3VU0A 1ZUHA 1XCMA 5FPHA 4Y6GB 5A5VA 1AMUA 1T3TA 1JEYB 1DC8A 1CWUA 3NPMA 3LECA 4HHEA 3OO1A 4KP7A 2ECKA 2NU8A 4AZTA 2JFPA 1ID1A 1A4UA 2Q62A 2ZREA 4YJ3F 1I3MA 4I1UA 3ZIAA 4B3GA 5G41A 3SF8A 3OZTA 4G36A 3L7LA 2DFTA 1QS0B 1PS9A 1SCAA 2FR1A 2WT9A 4LDPA 5COQA 3L46A 1E96A 1JQ5A 3IEMA 4C2TA 1U0GA 3OEWA 2EWWA 2EFGA 3NUZA 4AY6A 1LNQA 4LV6A 4LZZA 3UKDA 3IVCA 5CFPA 2VUIB 4DA9A 1JIQA 2IKSA 1L4FA 3G8BA 1P0QA 2PA0A 2DM6A 1WBBA 3WLAA 5MF6A 4A8TA 3ND7A 4CIXA 1SKMA 1EXNA 4XVUA 4CM4B 2FXVA 3WLIA 4G85A 2JIQA 1BMFD 1I4TD 1P0CA 3VGPA 2ZYHA 1OA1A 4PV7A 2VDOB 4C0XA 4QNNA 1KJIA 1HH4A 1P2BA 5HGJA 3WK4A 2WHXA 3I6MA 3QBEA 2GEJA 3AO0B 3Q5DA 4KRYA 5H16A 4Z4EA 3TCKA 1RJ9B 4KXLA 3QP9A 3RYFA 6ABPA 1MJSA 3OKFA 1Y1SA 1U4SA 3IAM6 3OPMA 1JB1A 1Y6QA 2PUEA 3LPLA 4Q4HA 4JXZA 4U7WA 2C00A 1XR3A 1K5PA 2Y1XA 3HR8A 3P20A 3PTLA 1IZ8A 1DKMA 2OCXA 2PGDA 4JJ7A 4F4FA 4RV9A 4DCCA 1WTCA 4I0WB 3SJ7A 2ATXA 4F6LA 5FR2A 1U7PA 2YN0A 4NMWA 1YF3A 1T1EA 1U04A 1P7CA 1VDZA 1XRJA 5BOVA 4URVR 1L5VA 2TS1A 3LO8A 3KJEA 4L4SA 2OORC 5IF9A 3BT7A 2PZMA 5KNCA 1RYYA 4FUTA 3FPFA 3MSCA 3QLVA 3KTAB 1MORA 1WZIA 5SYAA 4C4XA 1YU9A 4HB2A 3RGWS 1IM2A 4KHZA 4LGVA 4RA6B 1W9HA 2RHOA 4N4AA 4DRZA 3B70A 3N8HA 4Q4DA 3TEJA 4QUKA 3C1UA 3ESRA 3FJYA 4FXPA 1KHHA 1SKQA 3AHFA 4WASA 3HWSA 4Z3OA 4L02A 4TUYB 4J2TA 1A4IA 4OKNA 1S2IA 4J2OA 2Z5FA 4P54A 2JI6A 3PK0A 1RVDA 4LKRA 4TTPA 5PNTA 1CVLA 1ONOA 4CF4A 2IPOA 2AD5A 2FPPA 4KPUB 4LMBA 2G76A 4QQNA 1ZL0A 4L0MA 1VG9B 5AW1A 4ZGWA 5JSQA 3ENQA 2WE8A 3PUZA 1CR1A 4ZZ3A 4X8HA 1A7AA 2WWIA 3ABOB 3PGJA 5LA6B 3LKDA 2MSNA 3H9JA 2VPZA 5J5VA 2IEIA 5ARCA 1TVMA 3PLRA 2JJ1A 1D1TA 4Q3BA 1T0PA 1OX5A 3UQYS 1G3IA 1CUBA 1XXHB 1U7HA 3OJOA 9MHTA 1X9GA 1S3GA 5FXMA 4OBBA 1M1NB 1G21B 1Z5WA 3HVIA 4EW2A 4AU1A 4G63A 2CJFA 1T10A 3QE9Y 3OPYB 4WLNA 3ZWAA 1FFWA 2HLPA 2JGNA 3U3DA 1ZMBA 2C5EA 3AUFA 5AI8A 4A2CA 4R1MA 1UKAA 4G67A 2VWHA 5DISB 2OV2A 1IM5A 4JJ6A 5T7BA 2JCSA 4I9UA 4RSRA 3P0FA 2J0QA 5FOWA 4BV9A 1F5SA 5EYPA 3ABIA 3IEKA 1Q57A 1T29A 2EZTA 3T7JA 1YA6A 1RD4A 3V32A 4D41A 4M8SA 2PWAA 2FW8A 1OPXA 2ZJ4A 1KO8A 4PR0A 2IHZA 4N48A 2F1IA 4P3NA 2ZJFA 4MAAA 4NZYA 5JAHA 1G55A 3R20A 1X92A 4BAZA 4H1HA 3E0QA 4DT1B 2XBUA 4NH0A 1NLFA 1T2EA 3NVAA 2BBWA 2UYOA 3PS9A 4UARA 3GLFE 4XOUA 1KQGA 3EODA 3CVJA 3QIAA 4JNCA 2QQ5A 4Y2TA 3TVDA 1T1GA 4YIHA 2AG0A 1IQRA 2F8LA 1GUYA 1YQDA 5AW3A 3QRWA 2DECA 1WL8A 5ERYA 5ITVA 4IIBA 1LLCA 3CIFA 5LB4A 2HMWA 1EUDA 4OQPA 5B57C 3A3OA 3KYJB 2JGJA 1JEEA 1PNOA 1FNBA 2MJLA 1MDBA 2XNDD 3BDIA 3BZBA 3TSOA 3RSZA 1XROA 2P9JA 1VCNA 3K1AA 5HXAA 3OOEA 2B35A 2WAXA 3PNQA 4XX0B 1PQYA 1ZU4A 5ILGA 4EYKA 5FUMA 2E2WA 1FF9A 5CVTA 2NAPA 4JLBA 1G5IA 3H7AA 1S1CA 2HJWA 1SVSA 3O8NA 4LG1A 1RC8A 5CH5A 5FPPA 2VDJA 3D4OA 5IBCA 4C29A 1EDDA 2WD9A 3BB3A 2EJVA 5EXXA 2YVUA 2LCFA 3K35A 1WO8A 3P2KA 4KOEC 1UJ4A 1SXIA 1W29A 1S2NA 4EY8A 1YQXA 1ECGA 3G1UA 3ITDA 2NSHA 1N2IA 2IX9A 4UU8A 1C8LA 1TLTA 4RACA 4EELA 1SVUA 1KGSA 3W6ZA 2J3MA 2HPAA 3HYSA 5TEWA 1R66A 4CL8A 5EN4A 4A4YA 1XNJA 2R65A 2X3FA 4YV0A 4IX9A 4P31A 2QAGC 1NA5A 3ENNA 2JGEA 1M6VA 4WK2B 5CDTA 1R4MB 4UPDA 4G1EB 1UIRA 3GOQA 3RAGA 3LQYA 5A3JA 3QUSA 4WNCA 1F3LA 4NDAA 5AOAA 4XCQA 1K97A 2ODAA 2DB3A 2WTMA 3HY6A 2HCBA 2IXEA 4M86A 4EMTA 1U0JA 3GZJA 4H3HB 4YLYA 1ZR4A 2HD4A 3AW9A 3UEOA 3RVOA 4HWPA 1TM1E 3G02A 3MGBA 3T3IA 5JNLA 2WNIA 4RTRA 1P4RA 3EDYA 4GOMD 4GM4A 1PF7E 1YJ5A 4Y2PA 4L85A 2B3TA 3FRHA 5H68A 1L8XA 3WGHA 4X6XA 2FKNA 1V3QE 1X80B 2VSNA 1CY4A 5BMVB 4G07A 5FBWB 4A1FA 2HMUA 1P1RA 5KVVA 3IEVA 2EWVA 3OE7A 2ZJOA 1NVDA 1ORTA 4GLJA 4UEOA 5M2QA 2H9IA 1TUIA 2SHKA 4J1SA 4KZPA 3Q3EA 4YUZA 4WT7A 2RE8A 4CUJA 3EQZA 4ZO9A 3RH0A 5K4HA 1YK1A 3QKSB 1WPQA 2XGJA 4R05A 1CF4A 4RUKA 5EZYB 1FVFA 4XJTA 4P8RA 5DX1A 2H1CA 4J0IA 4W8OA 1R0RE 3I6QA 1VFNA 4LSMA 2PQ6A 5FOTA 3U13A 4AXBA 1SH7A 2R0QC 2G8NA 1TGYA 3GEDA 4CHTA 1GUFA 4C4ZA 4K03A 1J42A 2C5FA 2VG8A 5GONF 4DDVA 2LPMA 2WJPA 1PL0A 4FHEA 1OIWA 3L0OA 3DAPA 1Q1BA 1T2UA 2GLXA 4DVJA 1X13A 4G5YA 5DNEA 4WJLA 2SBTA 3N74A 2PGIA 3GVHA 4LVNA 1YC5A 1CUCA 2Q28A 4JVLA 3U16A 5ALTA 1GPKA 1NPYA 2F43B 2QN8A 1OVMA 4MRSA 1QDUA 2AXQA 5AKZA 2GN9A 2I2WA 2GHIA 2M1XA 2OENG 4B82A 1U1CA 1ZN7A 1TIBA 3C3EA 1GL7A 4DLSA 4YREA 1TA4A 5ALJA 4XWKA 1FEZA 4WPGA 4F3KA 4MAFA 3ABRB 1T9BA 1DV1A 2JA2A 2PUWA 3CQ9A 3DOEA 3GFPA 4LISA 4NZZA 5DDIP 5KWVA 5FBLB 3FHCB 4RNDB 1RXWA 1S9HA 4RPJA 1M67A 4QUDA 5LUAA 1RLMA 5K3SA 3L3BA 1DBVO 3N07A 3KZCA 1R4ZA 4XYEA 3AP1A 3VPDA 1OX4B 2R84A 3G5LA 1XIVA 1W75A 1X86B 2HMYB 1ZH6A 5K6RA 1OPRA 1HRDA 3G23A 3ZZUA 4QUHA 2IP1A 4PXSA 1XMSA 5JRZA 1AMOA 1L1QA 3KHTA 5EIBD 3KLBA 1B0AA 3MWFA 4QTYA 3OT4A 1YRLA 4OJQA 5IM4A 1PS0A 5ALKA 1SC1A 4GL2A 4LHYA 3UJ6A 5JJIA 4FILA 2NO6A 3ZUPA 3FDJA 4AJ2A 1M8KA 1LFAA 4A73A 1Y4SA 3HEAA 1U2PA 3ZWBA 3TSAA 4LMAA 2BI8A 5CAEB 4ITRC 3MMZA 3RBAA 3L1HA 4W5RA 4ITUA 3AOEA 1XE3A 4Q3LA 4RCZA 1UQRA 3AQ4A 3LP5A 1AQ6A 1RWPA 1WETA 4ID3A 4IVNA 5JDIC 1E4VA 3F3SA 3OJCA 2PR7A 3KXDA 2VEOA 4KQ2A 3WQHA 2H29A 1F6DA 1IXRC 4Y9UA 3KQHA 1P4GA 5JXGA 3TL6A 3DITA 1KJWA 3ITEA 1OFVA 1UINA 4TQGA 2H48A 4Z4QA 4RKYA 4CEHB 2BFCB 1UBEA 2XA9A 5IHPA 2AKEA 4KYVA 5ALYA 4GBGA 1Q6YA 2DCUA 1NQAO 1Z4KA 3LK7A 3NWEA 1WMEA 3CSDA 5KSWB 5CDUA 3DCJA 5FCDA 1QG4A 1PJTA 2J45A 2X2EA 1VP3A 2GBPA 2C1XA 2D1YA 4Q9IA 1KYZA 3TECE 3DOJA 4Z0PA 5BN3B 5LYJA 2I7XA 2YHUA 2XB2A 1XEXA 2B30A 5U4QA 3AHGA 2J7PA 1CRPA 4B3SB 1M2NA 2BGGA 4JUDX 3PDHA 3QUAA 3J81k 2PKCA 4QOEA 1OBHA 3A6FA 4K6GA 5AK5A 2G63A 3HP4A 1ZESA 2VPTA 3KWJA 4IJWA 2O3SA 4B5LA 3KDSE 1W49A 3DF9A 3QFTA 4LTDA 3GJZA 4QD3A 1I3CA 2R1ZA 2YUTA 3GRFA 4RD2A 4S1TA 5AIAA 1FQWA 3PHBE 1HQCA 3QKRB 4JT8A 4JUFA 4CCSA 1QIHA 1W2HA 1N1DA 2B1QA 3SYLA 3B1KA 1VL8A 3DDNA 3PDUA 3RHFA 3OJEA 1R8YA 1H42A 3WWEA 1G5PA 2AFHB 1EFPA 2DRIA 1P29A 3DBRB 3EDOA 1AA9A 1MFPA 2QRMA 3H4IA 5JI3E 3VO2A 5CDSA 1WLNA 2VDWA 2YHSA 3OT1B 2EHJA 4G5QA 4N39A 2WE7A 4WE3A 3WSWA 2IW1A 2PGJA 3GLGE 3M6MD 3SDZA 4ZYWA 2X6RA 2R7KA 3FCXA 1LS6A 2XMBA 3PHCA 1W4BA 5LP1A 3C3JA 1S8FA 3JQDA 4ZEOA 1UBOS 5CLHA 2YTZA 1MJGM 3CX3A 4NZNA 3HP1A 3HB0A 5JYEA 3ESQA 3FHTA 5CXUA 1DTEA 3R3UA 1XA3A 2CVZA 3C0KA 4EG4A 4LBYA 4ARSA 4E0BA 2D6FA 1KMCA 3OLXA 4ZT4A 1RR6A 1Q5PA 2G4VA 4RHUA 1ZN2A 5F23A 1QVZA 1F17A 3CN9A 1EG2A 4KXQA 2XEDA 4I4TA 4OD0A 1CE8A 2OFPA 2Y1DA 5BUSA 3AXTA 4LE1A 3TNLA 4EY5A 5FPKA 4BQOA 1Q2XA 2D2VA 3LUFA 4LI0A 3GMJA 1SKUA 3KTFA 3FOCA 1RC0A 1XXLA 1DRJA 3H1TA 4D82A 3NPAA 2MSEB 2VI5A 3T3OA 3UV0A 1DBQA 1II9A 1T5SA 2N46A 5L3VA 3RC8A 3F9RA 4LCEA 3H3XA 4MQEA 1Y5LA 2WYOA 3O1IC 1E5LA 5EZ6B 3TN7A 1KYVA 5JEKA 2UZ1B 4PYNA 2OB2A 2V7TA 1F38A 3X1ZA 4E7OA 5LQCA 2WP0A 4GEKA 1C0LA 2HBRA 4CJXA 3I04A 4RSHA 2Q6KA 1BFKA 1QNFA 2P1RA 3B3QA 1IUOA 1P4JA 1X87A 2OO5C 3MRTA 4OMFG 4A8HA 4ZO8A 4KSCA 4DAEA 1Z0UA 1ZOIA 2JVJA 1AKRA 2VQ6A 1HYGA 1Y3IA 2I7TA 2VC2B 3OC6A 1X7YB 2BFPA 4HNRA 4FOTA 1QUEA 2Q4RA 3I4CA 5HMLA 3ROEA 3QQPA 1L5WA 3QKTA 1NZJA 4PPFA 4TM7A 1DPGA 2YV4A 3H1BA 4PNEA 1AXEA 1MOPA 3IAS1 3PF8A 1RQ2A 1AU9A 2E4WA 4RANA 1VKJA 3WIEA 1K8RA 1WZCA 2AMJA 3D8HA 3LFHA 3WL3A 5IEJA 4E5DA 4MWSA 4N18A 4XQCA 1BWQA 2QPLA 4FI3C 3K2EA 2W43A 3UNNA 4GYYA 1R4NB 5REQB 4G4SO 4KEAA 3FFWA 1XAJA 1W30A 3I8OA 4PG6A 2XIQA 5I9BA 2TECE 2I5PO 3DF7A 4X7RA 3L9WA 5DBHX 5AKIA 5H5JA 5HG0A 2OO3A 5TQ0A 5TPWB 4IXWA 2NYUA 5E2AA 1AV7A 4N0DA 4QHYA 1YI1A 3G0GA 4KQKA 4C0AC 3D5QA 5CEJA 1MO4A 3OE4A 5E6UA 3CKYA 2FH5B 4B31A 4CWAA 4POOA 1XJCA 3IQDB 1M83A 4L08A 3SJZA 3TLYA 1CS0B 2FU5C 4LNUA 2HYIC 4FFRA 5L3QB 5LIPA 2PGLA 4X20B 4FHDA 2VJAA 5CT4A 5EJIA 3G59A 4RFVA 3UW3A 1U31A 2JLUA 1S2MA 4FDLA 3A4LA 3IURA 2ISSD 1QAOA 4RC9A 3NYQA 4NCXA 4JI5B 3O3CA 4F38A 5F77A 3QHPA 1YRQA 2WWWA 1FVHA 4AB1A 5J2TB 4L4XA 3QVOA 4ZMSA 4O8ZA 1PDVA 4CM6A 4DXAA 1BEUB 4AUNA 1L4BA 4NYIR 5CVEA 4C4SA 1JMKC 3LX6A 1OA0A 3TM4A 1PD1A 2JIMA 2ZVJA 4P2GA 5EFZA 3SI7A 3TW8B 4U5QA 1SVIA 4JB3A 3LA8A 4P2BA 5HNKA 4EIWA 3WLFA 4MW4A 3ESZA 4HAZA 1LPOA 1PNQA 4G81A 1N7JA 3CX6A 3UAVA 2CFIA 3FKJA 3ILHA 3RBXA 2B7CA 2NT3A 4PQRA 3MMPA 4N7BA 3X1MA 4BFXA 4CCYA 1ZOLA 4Q4JB 1SBHA 3MJFA 2B9EA 5IK2D 3V3TA 3H5WA 4KKVA 1E2FA 4ZEXA 1A9YA 3KLOA 3WGOA 3FNIA 4BNVA 3TTYA 3C6BA 5JPIA 3PUWA 1TUBA 3R6DA 3WGKA 2ZRBA 5DHPA 4NY1A 4Z9XA 1JVSA 2LTAA 4UVDA 4UEJA 3KQVA 4BUCA 4TS3A 3C43A 1KPHA 4NCHA 3OIGA 2IZ5A 4X92A 3ROQA 1J1ZA 2FF7A 3I5MA 4FEGA 4URXR 3U4QA 3DMFA 2WUGA 4PAGA 4PYRA 2H59A 1A5SB 2IBTA 2XWQA 4I8XA 4PZDA 1PUJA 4KNVA 5B53A 1JR6A 3L4BC 4P6VF 3SZUA 4B34A 2A88A 3NETA 3QMMA 2QLBA 1UJXA 1T5DX 3NCHA 4LWOA 3Q72A 1BXGA 3E35A 5EE0A 5KTYA 3O8OB 3WFZA 2A86A 3KT6A 4KAJA 1XZAA 2PD6A 2IW3A 2PXXA 3E5MA 1M10A 1DQZA 4L57A 3WBBA 4ZYZA 4IF4A 4UUAA 1WOMA 1L7OA 1ZCBA 3ETJA 1M76A 1EFKA 1Q92A 1YIOA 4O8CA 4B3FX 1ZHOA 2GRUA 3ENKA 1OXBB 1XEFA 2QRLA 2CD9A 5C53B 2HBQA 3LKVA 4DT1A 3OEYA 2G83A 4URYR 2ERYA 5J2UF 3T5BA 2PGOA 4G4GA 4P9NA 4QOHA 1VLJA 3PXGA 2O0MA 1XTQA 5AVWA 2D1RA 4TSRA 2GAOA 3N7AA 4J16A 4JDUA 3RI3A 3HWWA 3LS2A 4RV4A 1OSNA 1O2DA 1FFXA 1E2HA 1TJPB 1JQJC 2VZ9A 1Z8HA 4HC4A 4MYSA 3EFHA 1HL3A 1NIJA 2XZOA 1A7JA 2BGMA 4MOWA 1MA0A 3VYRB 2GF9A 1JJAA 1M9NA 2AMFA 3HXMA 1Q2UA 1GUZA 3RUAA 4BDSA 1LBTA 1AQJA 2WUFA 4I9FA 4KCGA 4U9UA 4DCSA 4OXKA 5KYYB 3HL0A 1YB5A 1KHXA 1XPJA 5DPMA 2BE9A 2GH1A 2OOSA 4U6SA 4ZV7A 2YYYA 5A9TA 3MELA 1FOEB 2BEUB 5ALEA 5FWXA 3RRJA 3ZG6A 1RQGA 5DTMA 4FOPA 1LLDA 1MQAA 3AIKA 3N0VA 4O1MA 3IUYA 4E2FA 2ZRAA 3K05A 4DWOA 4LMPA 2AN5A 3DLAA 3QXSA 4KYUA 3U1VA 4AKEA 5T4FA 1YKFA 5F35A 4E5SA 5TV2A 3UAYA 1JPJA 4XPIA 3VAZA 4C1BA 3O4FA 4BNYA 1AF4A 2Q3DA 1GHTA 1YZGA 5SY6A 1RMQA 4GDFA 5EQFA 4EKGA 4HQ6A 1SK9A 1M8PA 4RV5A 3WDLA 1N5MA 2RD2A 1OUMA 3SHOA 4AJ1A 2WQ7A 1XQXA 2EVWX 3ZK9A 1HOTA 1I4DD 2YH2A 3BRSA 5IS2A 4A16A 1MHTA 2YN2A 3W5DA 1NX6A 3NHZA 1YNOA 3O5AA 4NENA 5TVKA 4C7OB 1NQUA 5EWJB 2RMKA 3OUNA 1QTRA 1YRYE 2ZRDA 2PIDA 3TB6A 4Z2AA 3KFVA 1YJ8A 1KDRA 5F1OA 1RLJA 1QH0A 1K3QA 2V54A 1ESMA 5AIBA 1EFDN 1Y1PA 5KTNA 5K8JB 5D8DA 1C9KA 1OW3B 3ZWNA 3H6HA 1KOFA 1LNZA 2H85A 4N7RA 3WBKA 2P0AA 3IMEA 1SCIA 2Q9CA 2KW5A 4JVMA 3BJIC 2BIFA 4U3JA 4R8VA 2VJMA 3ER9A 2HO5A 4HDSA 1RQXA 1Z0DA 4YDQA 3V48A 1RPZA 2X4LA 1KAQA 1VSUA 4MUIA 1X42A 3ABQB 4YUVA 2W2LD 5A1JA 1HDGO 2P4UA 2VF2A 4MQMA 2BJHA 2XGOA 1SUPA 2HA0A 4LVOA 4PHFA 2Z57A 1WMAA 3LZ6A 3R5TA 1IN7A 1Y3FE 1AUPA 4MWOA 5DE3A 1PGJA 3Q6NA 3RKUA 1K2WA 2WSMA 5BMVA 2DH6A 4LV5B 1XI2A 4H0NA 4ED9A 1IZYA 3BMNA 4ECEA 2DYKA 4UUOA 2O0LA 3DT8A 3H97A 3KVRA 3MQ4A 3NBFA 4PS1A 5AW2A 2ASEA 5FUQA 1JTVA 1FYXA 1I1HA 2AW3A 4KG7A 4YWHA 1W5BA 1HDOA 1AUQA 1IH8A 1Y3CE 3DXFA 1P0MA 3IPYA 3UJ3X 1L4GA 5KYNA 3RU7A 2G9RA 5E8JA 1NQVA 4C30A 3PZBA 1Z47A 3EBOA 2EFCB 4MRVA 4WBXC 3RW9A 4R9VA 4BO1A 2WF7A 3OMLA 2Q7OE 3WYGA 4RLFA 4PPYA 2CMFA 1G6OA 1UJNA 3TQTA 3P9RA 2ODEA 2ZLBA 3HL4A 3D7RA 4J0EA 4R1LA 2HLNA 2VP3A 1NUQA 1VE7A 1II0A 2AOXA 2QRVB 4RMIA 1PK9A 2J3QA 3I8XA 4HFRA 6PFKA 4HDOB 2WW8A 4MUEA 5DYTA 2H4HA 4UBJA 3D6FA 4JT9A 5C7YA 5AT1A 1EZ1A 2GKSA 1Z2NX 3K20A 4WLUA 4Y3UA 3WLRA 4D92A 4R1QA 2DFLA 4L5CA 2JLVA 1LJUA 2ZUSA 3K3PA 5K0LA 4GZMA 4KMRA 5GOZA 1RTTA 3LYHA 3TZBA 1K98A 2C7QA 3JD3A 4QTXA 1BU5A 2GM9A 2ON6A 4K8RB 4P4SB 2I80A 3TRFA 1MRZA 4WOPA 5B6JA 5IX8A 5LZ2A 1P5JA 2ODPA 4QUGA 3U7EB 3P32A 4HDRA 1NMEA 2BGUA 3KUKA 5KYWB 5CB4F 4DA4A 3RFVA 5KVCA 4PW0A 1I2DA 3HKCB 5DSXA 4EFMA 2OHXA 1PR3A 4Z4CA 2GRJA 3CWZA 4DM3A 2FJUA 4YP7A 1YMVA 2EARA 4TMTA 5ESXA 3I3SR 3AEKB 4OSPA 3D4NA 821PA 3NX4A 3SE7A 1J4LA 1GRQA 4CU5A 2OCYC 4IV0A 3TLKA 4EARA 5AW0A 4PHGA 1CUYA 3BGWA 5DM2A 1QO0D 4D0LB 4NK5A 2VBIA 3S2EA 4ATNA 2AX3A 4GMHA 4CUZA 1P7WA 3ANNA 4NABA 3OOWA 1RRMA 1XEAA 3TKAA 5IT5A 2BMAA 2E87A 3ZCSA 3UH0A 5JHHB 5BO5A 3OOJA 2WNHA 1NXPA 1OLUB 1CUUA 1BX1A 3E84A 3PFWO 4GRIA 3HBNA 3SE0A 1RVV1 3ZWMA 3UG7A 3UJAA 3L77A 4RVOA 3C39A 1X8LA 1QXSA 3ENWA 3EGCA 1Q3TA 1Q7EA 1ZVMA 4YI3A 2ACKA 1V5FA 3PTZA 2QN3A 3H11A 2GOYA 2W37A 1KARA 2OE2A 4FZRA 1TCBA 3E03A 4KK4A 3P26A 4LJ7A 1T3ZA 4K87A 2WWVD 4BX3A 4C01A 3FUWA 1NNUA 2FPXA 4QEZA 4MW7A 3WYEA 3ROZA 2LWIA 2JFWA 2R4QA 1QMPA 4O4LF 2J32A 5JROA 1Q1EA 2FUNB 3EUEA 2VBGA 2NUPA 1MR1A 4O4JB 3OTIA 3V8NA 1QQ6A 3E18A 2HQOA 3GAMA 2P9BA 2ZAIA 1IAQA 2OHFA 4JLUA 1HMYA 5DRTA 4KLZA 1PRYA 1ORHA 2QU7A 5DXAA 3L1VA 1TK2A 3D2CA 3M6UA 1L1RA 3GELA 4DCNA 2G82A 3QOXA 1JQBA 2ZR9A 1GGMA 1NNI1 3W7VA 4UOEA 5KC8A 4KR2A 5BSTA 4CF5A 4CQMA 4DLXA 3LCCA 1ISHA 2QORA 4Z5XA 4AURA 1VIMA 2LKDA 5H9WA 3BL8A 3PFIA 4ZQCB 4YCSA 3ECCA 2FW0A 1YJAA 1UM9B