3V8RA

Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-8-bromo-5'-deoxyadenosine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
264
structure length
258
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDELSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
molecule tags Transferase
source organism Listeria monocytogenes
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
total genus 69
structure length 258
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8rA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8rA01
1Z0ZA 5DHRA 2I2DA 3VZDA 2I29A 4DY6A 3S40A 5EJHA 2I2BA 3V8PA 2BONA 1Z0SA 3V8QA 2I1WA 4L02A 2QVLA 1Z0UA 1Y3HA 3AFOA 1U0RA 3V8NA 5EJGA 2I2AA 2I2CA 2AN1A 5DHUA 2JGRA 3V8MA 5EJFA 1Y3IA 3T5PA 3PFNA 3V7YA 1U0TA 3VZCA 4HAOA 5EJIA 5DHSA 2P1RA 3VZBA 3V8RA 5DHQA 2QV7A 3V80A 1YT5A 1SUWA 3V7WA 4WRRA 2Q5FA 5DHTA 4WERA 4V24A 3V7UA 5DHPA 2I2FA
chains in the Genus database with same CATH superfamily
1C9KA 2DSNA 3AEZA 3DUWA 1CYDA 1GGHA 1N5IA 2DTXA 3B1YA 3ICWA 4KE6A 4WHMA 2HLHA 2V6BA 4DBLC 2KB4A 1VG9B 2VHEA 2R1UA 3KR2A 3P9IA 3LV8A 3SVZA 3KKMA 4H6PA 3CKKA 1U8FO 4CV1A 3RLFA 2FCAA 2XKJE 4FNMA 1BGVA 2XNHA 1E8NA 3V1KA 3WIDA 3OFVA 4AUEA 2XXAA 2JS7A 3E61A 3DE0X 2JFNA 2VNHA 2ZSFA 3PI6A 4Q02A 1AKMA 3E9QA 4LRYA 4V1CB 1U0BB 3FFTA 4UMFA 2V9ZA 4DDHA 4XRGA 4ZZ0A 5ICGA 1GZDA 1JHMA 1O5TA 4M88A 1WPXA 5BOSA 4MGEA 4UTXA 4GWKA 2GN8A 3OQIB 1DIGA 1YT5A 3LY5A 3EDCA 1QCCA 1G6GA 2GJSA 2HMSA 2XTJA 3F67A 4DV2B 3GP8A 4YNBA 1USKA 5D2CA 4YMTA 5DNCA 2WLSA 4WY5A 5JIBA 2O8FB 3UMMA 1RAIA 3IRUA 4IDPA 5HGXA 3SFTA 2G17A 1XVTA 2VPTA 1MB9A 3HBNA 4JLNA 4W4TA 2PVPA 4KV9A 4Y2TA 3RSSA 2JIMA 1RZRA 5DYNA 1GG2A 3WFJA 2IE0A 4WX2B 2XDAA 2H5LA 3L40A 4R9PA 4J8PA 1GNQA 1L6RA 1H2WA 4PQYA 4I14A 1SVNA 2L18A 4LRSB 4MUEA 3WLHA 4R1UA 4REQA 2GNAA 1CRZA 4JENA 5ADUS 1HNZB 5BV1A 1D2MA 1AK9A 1O6FA 1PO7A 1JTVA 4OHVA 1GTJ1 1Q6ZA 2J7PD 2VQFB 1LC3A 2GN4A 2WE8A 4X20B 2HA4A 1E79D 2EJBA 2ZE5A 3LO5A 2I34A 3I4LA 4HVAA 3VOTA 2ZBGA 3TQFA 3VVMA 3OOWA 2IYFA 4Q3OA 3MBIA 4BMXA 3D8RA 4DIKA 2PUWA 2F8LA 1PW7A 2QEQA 4DLVA 3KD2A 4QUEA 5HIIA 2Z3VA 4LIPD 2GJ4A 2EWWA 2ZRDA 2CYCA 2BHRA 3LZ6A 3ND8A 4JODA 2DBZA 2VWHA 4RFVA 3TPCA 4R7GA 5DTJA 5KNDA 2Z6AA 2H1SA 2X4DA 4UC0A 3UOTA 1Y8QA 2D0PB 3ZCVA 1LJLA 5AUQA 4K6FA 2GYUA 4LCBA 2VUHB 4E5SA 3CLRD 3GVIA 5KNBH 3IIMA 1FE8A 1R64A 2DAPA 3C3XA 5K03A 2B21A 2D54A 2FUEA 2B2CA 3MSCA 5DFAA 3KL4A 3LT0A 2ZRLA 4KFSA 5LLSA 4AVYA 4E30A 5ICSA 5KOIA 2Z2JA 3OEYA 5IKEA 2EL9A 2WKSA 3GRAA 3Q3IA 1GITA 4R2KA 1E7SA 3ENZA 3QKRA 3COSA 2G1LA 1YASA 3FFXA 2Q0XA 4RPHA 1PJRA 1UPXA 4MR9B 3RRJA 1YS2X 1V8PA 3B6ZA 3LKVA 3GLIE 1ZD4A 2NO0A 3CZ4A 3O8OA 4FC6A 3VH2A 1J99A 2YV3A 4WN9A 2ZXUA 3F5QA 4FJ1A 1R4NB 3R76A 3ILVA 3C2QA 3LECA 4BBAA 5IASA 4MYDA 1IQRA 1U9CA 4KXWA 1P18A 3ZHXA 2VYFA 3VO1A 3LP5A 4DW8A 2YWJA 1VE3A 3T8YA 5KDOA 3C0KA 4EMSA 2JDID 4RGQA 3HXOA 2D0DA 2OBNA 1RWMA 3B5IA 4C0WA 2WIBA 1H3EA 1JDNA 3PLNA 4IXDA 1TEHA 2WM2A 4PW0A 4WKPA 3HMKA 2AKEA 5HFJA 1CB7A 1UC5B 2HU8A 1J9ZA 2Q9CA 1OXMA 3HCNA 4MQFA 2P4QA 2XNDA 3IDSA 4I50A 4B6RA 3SLKA 4RNCA 5GADl 4E5PA 1WDKA 1GA6A 2G80A 2XH8A 2ID4A 1TA4A 1ZL0A 2F3QA 3HB5X 1E3QA 3G7UA 3UHOA 4AJ9A 4FXPA 4HWPA 1PTJA 1M2JA 2LXNA 4MS4A 1CNMA 4D9EA 4PFJA 5B2FA 3U4QA 2P75A 4GLBA 1B2RA 1QP4A 4NP6A 4E15A 5K0TA 1LW6E 4HLNA 4AQYB 1DUVG 4KSCA 1KK0A 3OICA 1JJAA 1RP7A 3CMMA 4KLNA 2HSZA 4GWGA 1OH7A 4X66B 3PFIA 4CM6A 3VPGA 1WPGA 2NM0A 3BHMA 7MHTA 1KR5A 1TF7A 1F6WA 4DL9A 1QFZA 2QTTA 2IVFA 1P19A 4MV1A 2XWPA 2GRJA 2ACKA 1NYLA 2C5HA 2KQUA 2ZOSA 4ZO8A 4CIDA 5HKAA 4NAHA 1WTAA 1KZYC 2L42A 4LGVA 4MJLA 5KKAA 5A2QA 2P4EA 1UC9A 1T5TA 4YP6A 3EK2A 4BNMA 2Z6UA 4GPZA 4NV0A 1RAGA 4I08A 1BN7A 2C7BA 2ZWMA 4RS4A 4BXOA 1KFEB 3NUQA 2VFAA 3V4LA 5HKKD 1F7VA 4TTJA 5KYYA 3JQDA 4W9NC 3WBBA 2ZXEA 3DTTA 1W5SA 2FZGA 2ON6A 1P1IA 4KWTA 1C0PA 5DHRA 5HEKA 5AM3A 1EVJA 1KQOA 4PRLA 1K3JA 3QNMA 4JP1A 5CTJA 2IDJA 3TTWA 4HDCA 3H84A 4CU5A 3NGLA 3TI9A 1OX6A 3F6YA 3OEHA 1J8YF 1HLDA 1UDWA 1GA1A 1YE8A 2DJ5A 4TKLA 1K08A 2JNWA 3I92A 4O5OA 1E3SA 5JSYA 3WK4A 2XB4A 3A14A 4LDQA 3FOBA 2ZRHA 3PT9A 1PVDA 2CJPA 5AJTA 2M6KA 3LFHA 4CGZA 5H3HA 1QPZA 1FXWA 1HYQA 1MC1A 1MJ5A 4MRMA 5IKXA 1KYIA 1M2HA 4A36A 5C5DA 4FMDF 4G5FA 1Z37A 3URMA 4GEGA 5KYKA 1TF5A 5EQJB 5J2UF 4AY2A 4MCJA 4QPDA 3CUTA 2WICA 3AEKB 3TLGB 2EFHB 4RANA 1E9FA 1D7AA 3MUNA 2EKLA 1WULS 3BRCA 5E4JA 4QCJA 4US2R 2QTHA 4HNVA 1P5RA 3D5QA 3OQ6A 2JEZA 3TTTA 3WYFA 1Z88A 3NRBA 4IIFA 1P1KA 4R54A 2WSBA 4G9GA 4RA9B 4TV8B 1EXDA 1NNUA 4NENB 3O9ZA 5KBYA 1DD1A 1DAOA 1E6WA 1PR6A 2JHCA 1AK2A 4RKRA 3R7AA 1SXHA 4B0OA 3N2ZB 4EG1A 5DGXA 4YRBA 4PLYA 1BXRB 1YZKA 1B3RA 2GA8A 4TT3D 3FPSA 3E3OA 3HJAA 4JDUA 3GJ4A 1JAZA 1LWNA 2VYNA 4JLBA 1NBWB 4DYDA 4EFLA 5K5EA 1XRQA 1TXGA 4JS0A 4J0EA 4WZBB 1TLFA 3RFUA 3WBFA 3C14C 2W6IA 2YCLA 3JQBA 5DHQA 4MPRA 5CNMA 3CEAA 4UCFA 3H5WA 4D74A 2PY6A 5H16A 3C5VA 1UP7A 2F59A 2R8ZA 5L51A 2VQ6A 4TXNA 3I30X 3D7LA 4Z4GA 2C5LA 3KV3O 5EWMB 3EARA 4K6OA 2AFHA 2HIGA 3W8NA 1JIVA 4J7CA 4EGXA 3AP1A 3EOZA 1TM7E 5BMVB 1UBKS 2ZWIA 1GIAA 3TNDA 1RCUA 1E3LA 2AEEA 2D2IA 1I4EB 4Y9UA 1SKAA 2ET6A 4TT8A 1OIXA 1RE0A 5FWXB 1MH1A 3NP9A 1ZN7A 4YWHA 2PSFA 4JN6B 1ZXLA 2VPWA 4D43A 3CVXA 4B17A 2RSLA 3VA7A 1E4EA 3LGXA 4LBVA 1TAQA 4TV9B 1GGEA 2G5PA 3BG5A 4IV5A 5FTNA 3QA3E 1FC0A 4ZO9A 4MUIA 1MO4A 2XQVA 4QFDA 1EI9A 3SEQA 1JHAA 1JIXA 4O2AF 2RHHA 1KDRA 2RH4A 5I7UA 2IK8A 5ADHA 3TOZA 4LGCA 2QA5A 3F7MA 4QUKA 8ABPA 3CNNA 3I2GA 3ZBUA 3L6EA 4J7XA 2F00A 1RQ2A 2AMLA 2IKSA 2DF8A 3K73O 1CHNA 3NASA 4KN5A 1Z5GA 2BHTA 4M9XA 1E3WB 2PMDA 4RPKA 1KFJB 2PQ0A 2BHNA 2OSBA 4HH4A 3GELA 5JI3E 2DT5A 4GZ6A 3KAKA 4D3YA 4P3PA 4URZR 4MCIA 4PTZA 3HL4A 2PIDA 3OFND 1QP0A 1NF3A 1HE2A 4E4YA 1M0WA 4G84A 2PLNA 2RFLA 4JOBA 4JC4A 4CGYA 5JV5A 1LK5A 2XEDA 1KO8A 1P3DA 1VB3A 3ZS9A 4BNZA 1TDJA 3CX7A 2ZK7A 5B3JA 3K6SB 3EUFA 1YR2A 3RC9A 3QWHA 2AH5A 3RHZA 3W79A 4RX1A 1M6HA 3M6FA 4LYYA 5DULA 4LF8B 5AW7A 3EUWA 3E1GA 4JLJA 2IYVA 4NVRA 5AHWA 1UQRA 4JOQA 3G1WA 2DRIA 2WKWA 3VQTA 4YMUA 5C8YB 4MGIR 2X0DA 1NXPA 2QMEA 3G1TA 4L4UA 1XCMA 4MAAA 4WOJA 4BKQA 2H1VA 2JLVA 1GN8A 2Z08A 4J3FA 1OLOA 2UUBB 3D8UA 1MVLA 1UT6A 1PQWA 1QZTA 2Y0EA 3MB5A 4KLRA 1TOAA 1Y3IA 1K1EA 3TLAA 1QRUA 1ZC4A 4JHLA 4JXXA 4XZ3A 3N7UA 2WJWA 3GFQA 1V8DA 3CZ5A 4W8OA 3MVEA 3HJNA 3IJEB 5TQ0B 3JWIA 3ESZA 1TT5A 1V11B 1W94A 4GOMD 5HCUA 1I80A 4F9FA 1ZRSA 4QQRA 5T8KA 1GKLA 4J3JA 4IQ4A 3S8MA 2O8VA 3L8CA 1O6GA 4JHXA 3V8BA 4TTRA 3R5KA 1EHYA 2MT9A 4FR2A 2C61A 3DEHA 4JROA 3BERA 5FI1B 2BKLA 1KYWA 4YA6A 2ZJBA 1ODIA 4OQFA 4FYYA 1NNLA 3VYVA 3X43A 4BKRA 2WUDA 5CHYA 4S1PA 1KARA 5JXGA 3R2JA 5CT8A 1B15A 4XUDA 1AMOA 4NS4A 3RS9A 5GZ1A 1AT1A 2JBAA 3TIXB 4O2BF 2IPNA 4YGYA 2PH7A 3P9SA 4N47A 4A15A 3HWWA 3SOPA 4M7PA 1M7HA 1XEXB 3Q8WA 3NOOA 4QODA 3BXGA 3REQA 3AR8A 5HTOA 2G72A 1CRPA 5CDFE 2JQIA 2C29D 1FVXA 2WUEA 5JC8A 3H9EO 4P92A 1JJBA 2QX8A 1DTSA 4WLNA 1V11A 1UBFA 4HGRA 3NUGA 4JNCA 2RHJA 4NU5A 3S2IA 2I2BA 2GM4A 4IDEA 4NIMA 4ZAXA 1YZHA 2GDJA 2QRMA 3B89A 2EKBA 1T8UA 3NHAA 2PZGA 2B1IA 3ET5A 5CVCA 4U3JA 2JA2A 4OK6A 2A5YB 2FG7C 1BH2A 2BZ0A 3IP5A 3VPBA 3R5XA 2VUSA 4F6CA 4CKWB 4OYYA 3O2QB 4FOOA 4QVGA 1A4IA 2DP4E 3QVUA 2QN3A 1DKLA 4C1NA 1G6HA 1K6XA 3RJMA 4QYIA 3JQAA 4RZ3A 4XVRA 1YL7A 3V97A 5JSZA 2VT3A 5A1TA 2IIQA 1FTNA 3TW8A 1OV6A 2DPXA 2VF8A 2XAUA 1EFLA 2H0RA 4FGKA 5ARCA 5L7WA 1QGAA 2YWXA 4I4TF 1R66A 1KH3A 3B36A 1CZRA 2YY6A 1IXRC 4DR1B 1C30A 1C4OA 5CNJA 2B3DA 1YCGA 3N70A 3S27A 3VR3A 4I3HA 1N92A 2J3EA 1LB1B 4FGLA 4DZTA 5DW0A 3GNQA 3UCEA 2SCUB 2GN1A 1U2GA 4I19A 5C0OE 1G21E 4YRCA 4UUBA 1C9YA 2A1IA 4HXGA 2GESA 2DTDA 4H7JA 1QU3A 3VJLA 3N53A 5TMPA 2VSOA 4QOHA 3LYHA 1K97A 3ZQ4A 4DQ0A 4KO4S 5SZHB 1UC8A 4NK5A 3T7AA 1ZNXA 1VMAA 3E22B 3HNOA 5AHKA 3UXYA 5EFZA 5B1DA 2BFNA 2ZGVA 4GX5A 1ZW1A 1RDFA 3RWBA 4FLFA 3P45A 5F12A 1TJ4A 3S2GA 1GZSA 1NQVA 1GRNA 4LNUB 3WE7A 4EYSA 1Q16A 4GZMA 4JIVD 4S0XA 2YRWA 2XT6A 3P5BA 3OTQA 4LTNA 4P0TA 3RJ9A 4R2MA 1FXSA 2LW7A 1PUXA 1GZ7A 2QTLA 4OMDA 1HDEA 1M3SA 1UAGA 3C7AA 4R2XA 3VBEA 3LXUX 1BWSA 4O25A 1AMNA 2W2PA 4TYWA 4BN0A 1DT3A 2APJA 4WLVA 1SKMA 3DDZX 1USWA 4E4RA 4E2ZA 2A5JA 4CMBA 1IM5A 2BFEB 1QYRA 3WQRA 1KHHA 1RE1A 4JJZA 5DMXA 2B5OA 5F23A 2V9CA 4Z8YA 5E1BA 2VK8A 3MJSA 1DCFA 3H8JA 4PHGA 5HX7A 2Q6IA 3VNBA 1SKYE 1K9VF 3QSYA 2F8TA 1A71A 1R74A 2WQZA 4K2AA 3LVQE 3R7WA 2I4MA 2IHJA 2WVAA 2BGNA 3WNZA 1PIWA 3WBJA 1KYZA 3AUSA 3D7KA 5F5NA 2ZYVX 4YP9A 1N0UA 1KOJA 1TLTA 2V4MA 3AEQB 1SHTX 1AB5A 2DFTA 2I03A 5F9FA 5A9RA 3AT1A 3P7MA 4KFRA 2KWIA 5LQSA 4D25A 1PZMA 1T6ZA 4PAOA 3RUDA 3VR5A 2FUG6 4QQKA 3KZNA 1R0YA 2D2FA 2NZUG 3BMXA 4M89A 1H3FA 1N2ZA 3NM5A 4CF7A 5CDYA 1U9IA 3O31A 1U8AA 5M5BA 1QJCA 3DBLB 4ZA2A 1ULAA 1FFYA 3R7DA 2KI5A 2H31A 4JQCA 2ZIGA 5FULA 2CZCA 2B4RO 3LUKA 4LQCA 5U4QA 2DU8A 3WDKA 1P6UA 4PG5A 4KRFA 2H2DA 2FOLA 1XF9A 4OQ4A 1K0UA 1OBHA 1JDUA 3IEPA 3CZ9A 3RM3A 2ACVA 2C5SA 4H1WA 3NT4A 4XQCA 3A28A 1DKQA 1S96A 4FOLA 4YONB 2WF8A 1PWHA 4EATA 3SYNA 1ZH8A 2GB4A 4RSHA 4UU8A 4UVIA 1E4OA 3GQBB 4KIJA 1FBNA 4D9BA 3PFFA 4G0XA 2QVCA 4GX0A 3ILXA 1G6OA 3CB4A 1DEOA 3EDOA 5DGIA 1PD0A 1LK7A 1L8OA 4TGLA 3DAPA 1BRMA 2B8NA 1V5IA 4EUEA 1DXYA 3JX9A 3K15A 1EP1B 3FMGA 2ZI9A 4LX0A 1EXMA 2H1HA 5TSDA 4LJ9A 3GLGB 4UARA 2Q27A 2IOQA 2GEJA 3QLUC 4FLEA 4XEHA 4CV0A 2GN6A 1QWSA 1WZCA 5IJ9A 2N1MA 2PJUA 4QGSA 1V8FA 1ZICA 2B61A 1J0CA 1V8OA 4LXHA 5AQEA 3F8WA 5JQWA 2I4LA 4HAIA 4PAMA 5DM4A 1Y9ZA 3M82A 1UMDA 1TU0A 3AJDA 3RRXA 1KSHA 4KITB 2OHVA 2FZKA 5IP5A 1QX4A 3UICA 1G7SA 2HEGA 2O2JA 3FOFC 5GZ3A 3ESDA 3RYFA 2FEAA 5FBHA 4HXFB 4QSHA 2OT3B 4UAVA 3MUEA 2I91A 1OR8A 4J3NA 5K0LA 3FBGA 3QNUA 2Q46A 4WNCA 3EBLA 4QA9A 1HX7A 1MGOA 3O8NA 3IUNA 4YMLA 3JQEA 1LK0A 4LCEA 5EIEA 2BN4A 5E2BA 3RKRA 4DSZA 1Z28A 3IMEA 3ZD9A 4BGIA 4RULA 1DC5A 5L3QB 5JT1A 3INGA 2P0AA 3QFFA 1PT5A 2IHVA 2FR1A 4NMWA 1RYYA 3L7KA 2BZSA 2ZTVA 3H17A 4KWIA 3RWOA 3B9RA 2FJ0A 3UJCA 2L0XA 4PICA 3LDUA 4LE0A 3RROA 1E4VA 4RF5A 3B2QA 2QYSA 1TI7A 3GVCA 2IOFA 4NBSA 3HB9A 4C76A 1I36A 3U56A 3GZTB 1VJ0A 4EI7A 1WJGA 5JERA 1M1UA 4W7SA 2KKLA 2F9MA 5ALGA 3KP1A 5FPHA 1CEQA 1GYRA 4MITA 3DEZA 4OJYA 3MAAC 5B37A 2NSHA 3CCCA 2LDBA 1JG4A 1YD7A 2E2WA 1JALA 5FKJA 4AMGA 1MK2A 2H7CA 3N2GA 5U1PA 4BUZA 3CUVA 5CPFA 5KPJA 4UTRA 3TVDA 3UUWA 4OYRA 1Q19A 2P9GA 2EZUA 1MB3A 2C7QA 4KQ6A 3EGEA 1K4MA 3ZIAD 5H83A 1PJTA 3NV9A 2WMOB 3F6PA 3HKCA 3K71B 1SIBE 4ACAA 2NADA 3MXTA 4I3FA 4KU4A 3JQ9A 4EG7A 1ACLA 4WK4B 3T4EA 3HY6A 4ERNA 1W5TA 5JY1A 1H1DA 5T4FA 1JSZA 4PLVA 1JFLA 5E4TA 5BSEA 3BE8A 1N1DA 4IRUB 4CV3A 1GUYA 1EM6A 2FW6A 3BXEA 3H0EA 3INTA 4IGEA 2ZRMA 3CXUA 5IBQA 5EE3A 4CL0A 2I2XB 5FH9A 3KQKA 3JVDA 4EHLA 1Z83A 4OLJA 3L5KA 3RU7A 1NW7A 1UPAA 1KAQA 1RM3A 2VVTA 1Z0DA 1SFRA 4M55A 3ZGVA 1PJ3A 2GWRA 3KOXA 3B85A 4QC2A 5HA5A 2Y1FA 1KBOA 3CN9A 4E5DA 1HETA 1LI4A 4HYYA 4WNIA 5CITA 1QTNA 2VYVD 3DZCA 2C8JA 2NU7A 1T3SA 3ZU3A 4G25A 4MRAA 5THXA 5ANRB 3P27A 2JZNA 2FSFA 2YIDA 2ZJFA 1KETA 5GVRA 3EXFA 2G9NA 4E5MA 1NYTA 3V3TA 3GN1A 2HPZA 1YZTA 5FNVA 3IUYA 1C1DB 3W6PA 3UKOA 5I7RA 5AVUA 3HY4A 2J59A 3Q2IA 1SXJD 4JCCA 3RS2A 1KZ1A 3RSLA 4BP9A 2Y1CA 3L1VA 2MOKA 3X1JA 3PYXA 3I6ZA 1XJ5A 3PU6A 3VHQA 3KKZA 5A8IA 1GR1A 1E2UA 4GVXA 4TV9A 1QG2A 1RYBA 1VRCA 4XKJA 5SY4A 3T35A 5LFAA 2E1PA 4KPUB 3VYSB 4AKHA 1E9RA 1JHVA 1HT3A 2QD2A 4FHFA 1DBQA 4UULA 1RADA 1DBVO 3T3HA 5JW6A 3KT0A 1LC0A 3H1TA 4GQAA 3F6BX 5CD1A 1IN4A 3DMDA 5J2TF 1YMUA 1PAUA 2NT4A 1UWLA 1PDWA 5DIZA 3N8NA 1TC2A 1WKCA 1E5LA 2H7YA 1WBBA 3BD7A 2A4MA 2CFTA 4FZ3A 3MJ4A 2XGGA 4INOA 1IONA 4LGYA 2FYTA 4DR4B 2I3BA 2GX6A 2P9HA 2G7MC 1YZUA 3N2KA 3PQ7A 4QUIA 1JKJB 2IBSA 1PV1A 2OKCA 3FWNA 2JH8A 2QP4A 1Q3HA 4UDYX 1SUPA 3NAQA 2VH1A 4A2CA 4ZI7B 1J5EB 4BP1A 5DYWA 3WKEA 2FVYA 3LT4A 3ROPA 2NV2B 1K6JA 4CKCA 5FFNA 2ORYA 1DO0A 1G20E 1P29A 1YHZA 3VR6A 1YONA 1U8UA 4EB3A 4LRXA 4XUCA 3IKVA 3KOMA 1Q1GA 2C5AA 5TIIA 4C4PA 1XQ1A 2QJRA 2XMBA 4I81A 1BE0A 1JL3A 3N0RA 2X0IA 5L4SA 2NXCA 4I6EA 2JI4A 5BW4A 1EP2B 3ZNOA 1NTRA 4JSTA 3DF9A 4AZ3A 3V4RA 3QLUA 4HWOA 2IHUA 1NN0A 1PJQA 2EFCB 2IDKA 5CA0B 1PF7E 1EFHA 1A2BA 1BDMA 5HZHA 5JISA 3DONA 3PHCA 5IABA 2FSSA 1EBBA 2WINI 1G7TA 3UOAB 1AK1A 4JYPA 3T95A 3WZMA 3E27A 1ZM4A 3HLKA 1L5SA 3NKFA 4MV6A 3PUVA 1P0QA 4LSMA 2CVQA 4QTXA 4ZHSA 3WZ2A 4EHNA 3AVOA 4HMQA 3RK1A 3ZDBA 2O7QA 4B80A 2I2FA 5DYGA 1K7FB 5I9IA 3GLHA 1A82A 1V1RA 2IEGA 2XQKA 1ES9A 2IXAA 4IILA 3GGDA 3U26A 4CMAA 4YT5A 1X87A 2RGNA 3PRYA 2AN3A 2ORWA 3SYKA 1CUZA 2QBYA 3MRTA 4FT2A 2QGNA 2PXHA 5JWOA 5KWEA 5AIAA 1WUJS 5KYNA 4I1VA 2B4YA 4OK5A 4YT8A 4FKMA 1KMMA 1T3ZA 3ESBA 1TFRA 1E7YA 2Q2WA 3F4BA 4CFSA 1B0UA 4HG2A 4HQLA 4MDHA 1KC1A 3AETB 5J3JA 1QH1B 3RKSA 4EGAA 5LLTA 1DBRA 1UXIA 2DLNA 3DZJA 3FN4A 4CT5A 4DSAA 1VKJA 4KAJA 3KAJA 3U4GA 1LNSA 3FBTA 3KE8A 5KOYA 4BFYA 1Y1RA 1FX1A 1V45E 1GYPA 1TIKA 4LZAA 4UHFA 4ZT3A 1SGWA 1A3CA 1USIA 3DMTA 2JFHA 4DARA 3IMGA 5ICEA 1E2BA 2RIRA 2GBLC 1E20A 1E9VA 4PYNA 1E2GA 3LDHA 2ES4A 4EKIA 4KC0A 4GOKA 5KX5B 3CRMA 4L07A 2Q1XA 2XXAB 1Y1KE 3MQ2A 3U0VA 4UE6A 4UNNA 1USUA 2P2NA 1Y8RB 4FZRA 1FS4A 4RC9A 4GE0A 2DBQA 4QDJA 1N1EA 3KUUA 5HFNA 5A05A 3I9V6 3GRVA 3HDJA 3TYXA 5ILOA 2UZAA 3KWJA 1CUBA 1DJOA 2BDEA 3LCCA 4J90A 2NU8B 3VKUA 4C4AA 3AVWA 5E1DA 3T5MA 1F6DA 1OTHA 1RABA 4M9ZA 3OJFA 2Y0DA 3AGPA 5DH9A 2YZKA 4ZMRA 5B4UA 3W4IA 1N6LA 1AA6A 4HFNA 2O8EB 2P2SA 4DM3A 1BQEA 3NRJA 4K6MA 4ATNA 1QBGA 3FDXA 3VKGA 1W25A 1P4JA 1CBUA 1E2JA 1WU8A 4N3CA 2ANCA 5FPYA 1YL5A 1PGOA 2Z98A 1T6XA 1PI3A 4MUHA 3TIGA 2FETA 5BSMA 3ZDQA 3GVXA 2IU6A 1FZTA 4TX1A 4KBGA 3L4BC 4LZNA 4OHUA 2YZGA 4N0PA 2ODAA 4DDUA 4X9XA 5DM70 1CG6A 5K0FA 3Q3EA 2Q5JA 3B1KA 3Q9SA 4FZJA 3E53A 3OLXA 1EFPA 5ALRA 3TB4A 3A1EA 2QL9A 4P54A 1XIVA 5DCUA 4QIHA 3U7FB 1KYVA 1Y6RA 2BAGA 3U7HB 4TTSA 2RAVA 1L4HA 2HK8A 4JI3B 1N5RA 4TUYA 1EP3B 2ONCA 4ML3A 4MS3A 1X0XA 5E6SA 2XNSA 1H2BA 4PIVA 3IIEA 3PUWA 3BHJA 4HQOA 3WNBA 3RG8A 1RTKA 1GRQA 3CVJA 2E55A 2HRCA 1WQ4A 4HNGA 1CYEA 1MD9A 2PIAA 3AUAA 3L7LA 1T9AA 5GM2A 5CAEB 3N2GB 2XUPA 1XQYA 3Q7SA 4URFA 3TJZA 1NDUA 2RAUA 2PT7A 5J23A 1H0SA 3ZOKA 1SZJG 1R4MA 1RKXA 3GLTA 3MTIA 2IPOA 1WX1A 1X9GA 1Z5OA 4IS3A 2N1BA 3O6VA 4NNPA 4V02A 5FBLB 1EG7A 2O7NA 5KTMA 3FAZA 3E7FA 5EMHA 3JSXA 4L9WA 4BAZA 1GZ3A 3NUZA 1RLMA 2RI1A 1E2KA 3RVSA 3TR6A 2QRVA 1NQAO 4E09A 4QFBA 1Z36A 3R20A 3JQGB 2GDZA 2F55A 2I29A 2JEOA 1K5HA 3DXZA 5BPFA 5HJ7A 2WTAA 2VJPA 2WJ4A 4DIMA 2ZVJA 1U81A 2BGMA 3DBRA 4OBEA 3T1YB 4A6PA 5C4VA 5JAHA 1U5CA 1KI9A 3E48A 3IBSA 2WPDD 5IDXA 2ZM5A 2C7PA 1RIIA 2AYYA 1R6TA 4IF6A 3KTFA 2PT6A 5J5CA 1KP9A 1OWPA 1HH4A 5K6AC 1IUOA 4L76A 4ZXFA 3U80A 2OD2A 1J8DA 4UOEA 2IWRA 4NCBA 3ED5A 3VZCA 1D1TA 1UBJS 3DFZA 3NHWA 5HTKA 3O1LA 4D0SA 3PV0A 4RIIA 4BFXA 1H0RA 2CEKA 2GM3A 3GROA 4MWBA 4ZIRB 1CUAA 3T9AA 1GN9A 5KIAA 1Z47A 4FTWA 3GLVA 1D5WA 5CDUA 3MDBA 2EL7A 1F48A 1KH1A 2X7JA 5K3FA 1SXJE 4ZTZB 1G5HA 1NVKA 3E22A 4NBWA 1ZISA 4YROA 4CLDA 1ACJA 4OL9A 1O94A 1L5QA 3BXHA 4IUDS 4H6WA 1NURA 1XQWA 1N0WA 1V3VA 4OOEA 4QAQA 3C3CA 3T3MB 3TOXA 1H1TA 4MYTA 4I46A 5HGJA 1UBGA 2RHLA 4WVFA 3WMRA 4BECA 4BCDA 1WF6A 2SNIE 4BFCA 2YKGA 2IEZA 5I5GA 4DY4A 1II0A 2QQFA 2I3DA 2G76A 1ST2A 4V0OA 5ILQA 4R9SA 1LLQA 1VGVA 5CU7A 4C5CA 4JKYA 4RFLA 4JL5A 3KJGA 2XTNA 3DC2A 2QOEA 3CH5A 2C9BA 4J4HA 1NX6A 2CJWA 1U8XX 4HN9A 1NVTA 3AC0A 3KYDB 4O4IF 4P35A 4FMCB 3ZKAA 2YJGA 3N2YA 4QGGA 1IUPA 4UHKA 4WCFA 2BY4A 3Q1LA 2G9RA 2FSVA 3CLUD 3ER6A 5CG2A 1QZ3A 3OO1A 3GA7A 4FBMA 5P21A 4UXIA 1LSUA 2R6AA 4X5OA 2IEAA 3GJ0A 4E70A 5HQ3B 3U4MA 4R5HA 1UZMA 2CT8A 1AZWA 1FSZA 1X8JA 3PTZA 1LBTA 3H16A 1JEAA 2BONA 1PYDA 1PHPA 1FFSA 3OTHA 1GNRA 3UANA 1X14A 1KVTA 4IRXA 3QEAZ 3BKXA 5F2NA 4QDUA 4YRTA 1D07A 1OZ0A 2PU5A 4J7UA 5EHNA 2PE5A 3FETA 2ZRPA 5IH7A 3RRFA 4EQZA 5FOQA 2IVZA 4H3HB 1GKYA 3JXEA 2A5GA 3IP1A 1BNCA 5EJ5A 2D1YA 1ULSA 221PA 3A8TA 4NCXA 1W85B 4XTCS 2J85A 1ATZA 3P2KA 2QV0A 2V9PA 2GCIA 1Y1TA 3GUUA 4M8KA 2Q3EA 5IC5A 4WD3A 1KO1A 2R60A 2WT9A 2PMKA 3EPHA 3SC2B 1J4LA 1VJGA 1MO6A 1HTBA 5LOVB 2GSDA 2AN4A 2BFCB 4HEHA 3AMVA 3RPEA 3W2TA 3TPZA 1ZIOA 2ETVA 4Q9IA 4RE5A 5H8WA 2FGJA 5LP6C 4RHXA 4CM1A 1NMXA 3TJRA 5E7IA 3EY9A 3IT0A 1AKVA 3JQCA 3KKLA 2C0PA 3AXTA 4Y67A 1XZIA 3EG5A 1EFCA 4HSGA 5E4FA 4YAGA 3O2NA 4IVPA 4LNAA 4BNIA 4UCQA 4WTOA 4AJKA 4BNUA 4PN3A 2JLYA 3PUKA 3M2TA 1NW6A 3P9CA 2UUPA 1KI8A 4URHA 3JQ9C 5HF6A 1PYGA 3EGXB 1WW3A 4J03A 1T0JB 2I62A 2ZSDA 3I3OA 2BM8A 2AV6A 4I9GA 4JJ7A 1KU0A 3EQ9A 4O4IB 2ODEA 1V7QA 3OPYB 5C1BA 2R1VB 4HMOA 4MQ5A 4O59O 3PEWA 1T6BY 3CRRA 2L69A 2CLKB 2PKYX 3F8SA 3HL0A 5TMBA 1X74A 3ICQB 1FYFA 3EVCA 3F4KA 3MGAA 4R41A 1CJVC 1OH8A 1DG9A 1G21A 2BF7A 1GGJA 2XVAA 3ZNQA 1GGKA 3VR4H 3RI3A 1JSLA 5JSQA 2GBPA 4P5EA 4AJOA 8MHTA 3RRBA 3OEHD 4IZOA 3IILA 3UAYA 4XWAA 2NYRA 3OF5A 1OYWA 5B7QA 1P73A 4MVWA 2JQJA 3ICOA 4ENSA 1XDSA 4IMIB 1T0PA 3D02A 2J0EA 1QFYA 4IOKA 4EY7A 2HHCA 3TD6A 4HDSB 2OCLA 3QUAA 3R8XA 4A6XA 1IY2A 2V4ZA 4E5KA 5DKFA 3RHTA 1IC6A 4KVFA 1L5LA 3W4KA 1WM1A 2J5XA 2P9BA 4ED9A 4WZBE 1SU7A 1YS7A 2JFBA 2N0SA 4IFIA 4IQ0A 4WFKA 3IPCA 3ORYA 5FBWB 4YB8A 1A9OA 3ZU5A 1LQ2A 2TMGA 2NTEA 1NYRA 2W4IA 3I9MA 3NCHA 3LUFA 5ALMA 4OI0A 1E64A 1Y8RA 3H6KA 2XRYA 2ICAA 1ZG3A 1OXSC 2UYQA 4EARA 4CWAA 4ZT2A 2ZB2A 2C3UA 3ZWKA 4D0RA 4M38A 5K2OA 1JH9A 3B1JA 1YWGO 4PO1A 1IN7A 1B76A 1DPGA 1QYCA 1TJYA 4U6QA 4L5IA 4RTJA 2QTNA 3SU8A 2OXCA 4Y2QA 1UPCA 3VTFA 3QUSA 4Y2YA 3TSOA 3F7NA 1MQAA 5C51B 1YHNA 2J67A 4J1NA 2B99A 3IAAA 4FNAA 2J5QA 3N75A 3PDCA 4RM3A 2AFHE 1UKBA 1TEXA 2ZIXB 3NYIA 3JPYA 4RVUA 1GPYA 5H7XA 1WHSB 4C3UA 4BE7B 5IJ0B 2ST1A 4RA9A 1TAGA 2ZI6A 3JTMA 4FB5A 4PIPA 2BPOA 3JZAA 4OB7A 1KFCB 1FSSA 4PE5B 4AO6A 2OSVA 1EU1A 1JA0A 4EF6A 3AJ8A 4BY9E 2DOKA 1YZYA 3TLZA 1SNYA 2X5OA 2AN5A 4X8MA 3BJRA 5EP3A 5HCNA 2BEWB 4MUYA 5D7NA 2QX9A 4CLOA 5DDIP 3ZHUA 1CVLA 3GD7A 3NWEA 3DBLA 1XE3A 4C4OA 4IX9A 1OILA 2IGTA 2BWJA 3X1MA 3RIEA 5BRJA 3ZCPA 1B42A 2ARKA 2Q3DA 2QT9A 1MOPA 1PWZA 4G56A 5CJ2A 2C07A 5JNSA 3VSAA 1H0HA 2IODA 4F5EA 5F3RA 1DXHA 1J8VA 4PX9A 1Z0ZA 4QTTB 1KI2A 2BGKA 2JAPA 2PZ8A 3GZNB 1Z08A 1EFVA 2AW5A 1TGVA 2A5FA 1ZGGA 4IV0A 5BUSA 3D7MA 1HG0A 2IPXA 5DBFA 5EWJA 2ADFA 3IHTA 5J59A 4US1R 1L5OA 5TPWB 2ISSD 2ZG6A 3DVRX 2HWKA 4AN0A 1FEZA 5FL3A 5A5FA 1NOJA 2QX7A 1VFNA 1Q74A 1W35A 2QJTA 2MSKA 4YAFA 3TLKA 3ZWQA 1RC1A 2HR1A 3EXHA 2NU6B 2EJCA 3D3JA 4G01B 1ZQ1A 1RZUA 3V8RA 3H2YA 4RW0A 2ODWA 4BB9A 3LLSA 3CR8A 4XVUA 5DWVA 5L3SB 4TYYA 4JNKA 3LL4A 1M0TA 3BDIA 3GBPA 3A3KA 3QYFA 4MA0A 3K5HA 1UPBA 1DRVA 3PE6A 4BKOA 4QBKA 2ZWOA 1Y7PA 4UQOA 5ENZA 2YOGA 1DIHA 3CQ9A 4IR7A 1TJNA 4K26A 1YB4A 2XRMA 4AG3A 1X7YA 1CR4A 4P93A 4EYOA 3CVUA 1OWOA 4AUMA 1E60A 3LCMA 5ETJA 4PNPA 1P61B 2IXBA 3IMKA 4Q48A 3ZX4A 1B3BA 4LRUA 4OIFA 1ZGHA 2PSSA 3L7JA 2NAPA 3DV0A 1SUBA 3NBXX 3VDQA 1K7SN 4U2DA 3R5HA 1GPH1 2AG6A 3RV3A 1BKSB 4MOWA 4L5AA 4WBNA 3GCGA 3ZK9A 4J1TA 1DINA 1ZP6A 3EPRA 3THOA 2GPSA 3EULA 1U0NA 3OLVA 1A8PA 2J45A 4F5WA 5CRIA 3PQ2A 2VNKA 5BW8A 2OHIA 3DWFA 4OXYA 2P65A 1V4NA 3OT5A 5LP6A 1J8QA 2E48A 5DNVA 3AVPA 4AJNA 3THXA 1RPAA 1SA0B 3LLUA 2ZJ7A 3QPDA 5TPZA 2H4WA 3G0HA 2R1TA 1AA9A 1L3BA 4RLSA 2X0FA 2WTNA 1OYOA 5D00A 3T5BA 4KYUA 1J25A 3IUBA 4RHYA 4E51A 3L46A 4Q05A 4TTIA 5K3SA 1SG6A 1DGQA 4PZ0A 3WL3A 4GLFA 4D4HA 4EGSA 3C1AA 2G9UA 5LA6A 4QLBA 1A4XA 1WSBA 1DKNA 2OO5A 4IAOA 4E4TA 1AHHA 1EVYA 2RG7A 1YKSA 3OD5A 3PNLA 4F4FA 2RONA 1A9XA 2C92A 3N0TA 2M32A 3RTDA 2WFAA 1JDJA 1ZR4A 1USGA 2GAIA 1B2LA 3PX2A 4IZ6A 2GPYA 4L08A 3KR9A 5DBOA 2OV2A 4U7DA 4BEVA 2GPNA 1KY2A 2CUNA 3E9YA 4M7RA 4R68A 3Q88A 1OF1A 1HQCA 3NAMA 2O2XA 4K9LA 4M7WA 3H04A 5DI3A 3U9TA 3GEPA 1Z4IA 2Y2UA 2PUJA 4G86A 4WNYA 5JD5A 2B98A 4QOFA 2WTXA 3OUNA 1Y80A 2GZ3A 3MWKA 3B3QA 5HIMA 3TOVA 1QV7A 5BNFA 4YRZA 2C9MA 3TCXB 1W4AA 4Y18A 5FEUA 3PUHA 5MGBA 1GSHA 4P4NA 2Y1GA 4C2UA 1R12A 2Q3HA 1RKVA 2Q5OA 2NZ2A 3PHLA 4XX1A 4C04A 2FPUA 1KAEA 1N9GB 1ZOQA 3S8EA 3WWYA 1LZLA 3GAMA 4NLLA 3HR4A 5TNXA 4DT1B 1Z0AA 3B9PA 1BDJA 1IK4A 1V8ZA 1TNDA 4Y1EA 3IXMA 4YRMA 5H3LA 2C2OA 5J40A 3AKCA 1EG2A 4J0CA 1K88A 3F8TA 4DMFA 2E4AA 2RGUA 2VCEA 5CYFA 1KHXA 3EFOB 3NLLA 2O2GA 3WGLA 2W6PA 1EAYA 3TEFA 5H0IA 4PG8A 5C5EA 4IDQA 4IKEA 1JGTA 1DQRA 2Q1UA 3QVWA 1M76A 2ZYGA 1ZXXA 2R7NA 4JCOA 1YJAA 4O4JB 1J1ZA 1JKMA 3SI7A 1QHHA 5J2TB 1Z2PX 3EOBI 5KB3A 3WGVA 3BA1A 4EI9A 4RENA 4RTQA 3U44B 4IMPA 3MWYW 4CIBA 1G2QA 1DG3A 4LOIA 3V00A 1KA9H 1R8YA 2I1VB 3EF0A 4WOKA 4FGZA 1L9XA 4P4LA 3UA4A 2EJWA 3KHTA 1TIPA 5KWVA 2DULA 3FNEA 2QNRA 3OQ1A 4QNNA 3IDQA 3FZYA 1XVUA 5L7YA 1I7SB 4PGAA 3WC4A 2I54A 3CX6A 3SEAA 3H97A 1W2GA 4U4AA 2OLKA 5AM5A 4D02A 2WV7A 4L3WA 2FNAA 4XGKA 2PRSA 2ZJZA 4ZPXA 4A4YA 1YRLA 3NHRA 3AF5A 4Y6PA 4H4DA 3HBMA 2N75A 3OUTA 4R83A 1COWA 1JFRA 2WB4A 2ZRQA 3LF1A 4I8XA 2WF9A 2BEKA 4JA2A 2Q99A 2HSJA 4Z2AA 3HA7A 4L1KA 1IJBA 5AI8A 1J0BA 2XLCA 4G2TA 5JZMA 4RDIA 5HW0A 2WAMA 3O8CA 5A4AA 4MRNA 4XVHA 3FHLA 2QKYA 1FLVA 3ITEA 5J47A 1YR3A 2C0QA 2PRIA 4Q4HA 1RWPA 1E5XA 2BM0A 1IN8A 1HBJA 2CLIB 2J3QA 1TMYA 3PHJA 3R75A 4F91B 1UINA 2VCHA 3BSSA 4KN8A 5IH3A 2GEDA 2H1IA 3QVSA 3Q3CA 4YAEA 5H5JA 3N74A 1Q0RA 2XTZA 3ISJA 1A95A 2ZPUA 2TMYA 2Q3BA 2XVZA 3TNYA 3WGJA 1U9YA 3FX2A 4I1IA 9LDBA 2EOAA 1N3IA 3GFVA 4UD6A 4FDTA 1Y9EA 5BVGA 2QLMA 2IHNA 4Z8XA 2OV3A 4Y9DA 1KFBB 1N6OA 5NULA 5CP8A 3TVTA 4ALJA 1AUVA 1SU4A 3BCUA 2AOTA 4B34A 4AJIA 5HNKA 4AZ3B 1QCYA 3N8KA 3PQ8A 3DMGA 2VXOA 1H8EA 4J9VA 4KDCA 1PBTA 1RJGA 4MX8A 4PCUA 5CFMA 3DM9B 4R2LA 5KOJB 5LPNA 2PUAA 5AVTA 1XHEA 1M6YA 1OWLA 2K7ZA 4G0WA 2QWXA 4A6DA 3CKMA 3L01A 4GZ5A 5T6BA 4F84A 1GKIA 5EJ7A 2X2FA 4F97A 1ZD3A 5B57C 3BBLA 3JD0A 4BX2A 1LGYA 2BE7A 1N8TA 1JDTA 2QRZA 4GI7A 4Z9YA 3ESAA 4QKQA 2MSEB 1F2UB 5CMLA 5JSUA 3CB2A 3PFBA 1BHSA 3NH6A 2LCQA 3AVYA 1C4KA 3OHPA 5TT1A 3ELWA 5IS2A 3T3OA 4ZYZA 3WB0A 4FEYA 3RBVA 1YZ3A 5AW1A 4ZRNA 4LX8A 3OLWA 3GRKA 4D3DA 2RE8A 1GGMA 2AZDA 3FSEA 3R7BA 1AN9A 3ETDA 5I5EA 5TARA 4AY4A 3QVKA 1I2MA 3FUWA 3F90A 2NQ8A 1VG8A 2CWWA 3RQIA 6ABPA 1Z2OX 3HYSA 5IF3A 5EKXA 2UZ1B 3ND6A 4MKZA 3LHDA 1ODLA 1Y8QB 2AXQA 3ZOZA 3IVAA 3ZCXA 5LWHA 1ISGA 1AMUA 3KVYA 1O57A 2RAFA 2QM0A 1N5OX 2NP6A 4DCOA 3DZ8A 3EA4A 4HWSA 3OF2A 4WFIA 4A0SA 1E3MA 1V1JA 6CHYA 2DUWA 2VQ3A 2AXEA 4L6AA 2VAPA 1PL6A 1EZZA 1B1CA 1HE1C 3R5FA 3H65A 2B9EA 3EY4A 4CEHA 3U61B 3IEKA 1B26A 5DX8A 3KQUA 2QAJA 1ETUA 2GYWA 4URWR 1H22A 3SFVA 1YBFA 2C82A 4LZLA 5C46F 3BFPA 4FFNA 4X92A 4BV3A 2ZUUA 4O8CA 1H5NA 5D7BA 5LA6B 3A7DA 3PIRA 1WHSA 4IBOA 1NASA 2YHIA 3KKQA 3MINA 4ILEA 1OH5A 4L0DA 4NZPA 1LEHA 3E84A 1NFFA 1UKZA 2AGVA 4N5HX 2EYUA 1FNBA 2Q3MA 2V5UA 3H9JA 4B6OA 4ZHQB 2LPMA 3LYAA 1D04A 3O82A 4LNUA 3BRWD 4MH0R 4Z86A 2ZUWA 2GSWA 3H1BA 3T61A 3ZEIA 3O2JA 1U0TA 4B7XA 1IXYA 3UNMA 1XNHA 3FVQA 4P4UA 5GV8A 3RVBA 3TS1A 4X6LA 2JJ1A 1DKRA 5LBIA 1J2JA 5EJ9A 2H54A 2X86A 4EUKA 1K8RA 4PCLA 2CNDA 2W2QA 1ICEA 1GVHA 2ZJOA 4FK8A 4C4XA 4EQ6B 1SOAA 2R65A 4OQDA 4RACA 2PMBA 3A1FA 4RKFA 4QUHA 1TTPB 1P0PA 4JEIA 2CXTA 4PYJA 1QHXA 2WTUA 4QD3A 1LBSA 4TLCA 1QIFA 1G88A 2A6PA 1G4HA 4PLZA 3DEKA 3OECA 3WKAA 3F96A 3OWHA 3OMLA 5CT5A 1ZVQA 1AGXA 3JD4A 3EN0A 3RABA 1KI6A 3LUAA 4PLFA 2XE6A 1EFRA 3TK1A 3AEUB 1Q0LA 4PBSA 2FCRA 3RTGA 2FXIA 2EKZA 2Q2VA 1QHYA 1Y37A 3ZEAA 4C6SA 4OX9Y 5GOZA 4AX8A 2QMZA 1G60A 4PZZA 3ZXUB 3BUSA 4B3SB 1QF7A 3UAVA 3QW2A 2GCOB 4BGUA 3HDHA 1SBZA 3TUIC 1C7EA 4KO3S 4P2BA 5H3CA 4AYWA 1LPOA 2H08A 2CHVA 1XVIA 3ZWNA 4G0VA 4BN5A 4U5XA 1NJ8A 1S2IA 2HPVA 3EA5A 1GV0A 1XDUA 1J5XA 1F6BA 1U7WA 1XD8A 2PD6A 3IPYA 2Z5GA 1ND6A 3DDHA 3DJFA 5K45A 5CVVA 2QL5A 5EE5B 2PWBA 4EB0A 2GZAA 3SIWA 3GCDA 5L3QA 1NNI1 5I7EA 4IQFA 4F3KA 4GI2A 3LHIA 2Q7XA 4MLCA 4BMYA 2V0GA 2J0UB 3H0CA 2XKKA 3ZHYA 3U1BA 1QZXA 4LA4A 1CNFA 1ZOPA 2AFIA 5F1KA 3ZVLA 3IAHA 4ZVOA 4B4VA 4G0UA 4JX9A 4BB6A 4PNZA 5E1OA 5LJLA 5K0SA 4H1VA 4NNJA 2H0AA 1ZK4A 3GRUA 3OPYI 4W99A 4YLEA 3I2FA 2GD0A 1T9BA 5T4EA 4AIRA 5FR1A 3NBKA 5DPMA 1BXZA 2RGYA 5HDBB 5I45A 4KFCA 4KRYA 3U4DA 3FUUA 4B79A 1VHQA 3ASUA 2AJTA 1NQWA 3HPRA 3UXHA 3VM6A 4D26A 2RGNC 1J24A 3QEMB 1ESNA 3NIGB 4FI3F 4KI7A 4W8GA 4E07A 1OAOA 3IDAA 5CGQB 1UMCA 4C6TA 1RSZA 2BMEA 2CE2X 1KVSA 4IH9A 5TQJA 5IJ9B 1MC8A 3OIDA 3Q7RA 3AESA 1OBFO 1GV1A 4ZCQA 1SR8A 4XPIA 1N7IA 2FV8A 3W3AA 1GXCA 3K0KA 1U0FA 2JB9A 5ALHA 1VG1A 4C5AA 2C8KA 4EG5A 4WEOA 4ENVA 2GZRA 3HY3A 4INJA 2VK2A 4HPWA 1LPPA 4Q0MA 3UO8B 4EITA 5K8VA 2FZWA 1K8ZB 4DQUA 5DK6A 4B7AA 2XCLA 3HXTA 3DS8A 1IOWA 1S4QA 2XOKD 3OT1A 5BSKA 5IJAA 2P9CA 4DLSA 2VDRB 2JL1A 5JNVA 2OAP1 3L04A 1J90A 2WYIA 4BNYA 3KQSA 1R0ZA 4G37A 5JVDA 1WVGA 3IUMA 2HF8A 5C3UA 3V2HA 3VI3B 3IHKA 4OP1A 2X41A 1Z6PA 4QICA 1SHKA 3A6GA 3G8AA 2XF8A 4MULA 4JEUA 3VC3A 2WYUA 5ITWA 4QEKA 4QARA 2Q2OA 3F3YA 1YMVA 2A9RA 3QKSA 1S9DA 3N0XA 4FS3A 3EQZA 1BKDR 1CJMA 1R15A 1L1QA 1UJBA 2J8ZA 3FVTA 1FP2A 1NLUA 3IP8A 4HHEA 4Q18A 4V0NA 1Z5VA 3NVKI 5JS1A 3IT1A 4N7BA 2NN3C 5DTQA 2CXUA 2HMTA 1WMAA 2OFWA 1K7CA 3Q4GA 3LGSA 5D5PA 4YAKA 3U9LA 1OU0A 2CLLB 4ZQFA 1D0VA 4WIAA 3RHFA 3WYCA 4FB4A 3KYJB 3HN7A 4BX0A 1U63A 2D62A 4UNSA 1NAIA 1NBOA 4LYFA 1GILA 4Z9XA 2QRGA 1QVZA 2ZBFA 3HO6A 3QHQA 2QTCA 1PR2A 1Y3AA 4NFLA 3A6DA 4IGKA 2YDXA 3IYLW 2OYCA 3OQPA 4MQ4A 3A3OA 3I5MA 4BNDB 3AUYA 2G4CA 3DQPA 3GEIA 4JVSB 4LUCA 5A6SB 3ZJUA 1IDN1 4W9NA 1U80A 5DF1A 2JFWA 1I5OA 2BFWA 4KEAA 3VXKA 2NWQA 1JLSA 2R87A 4HQFA 2YVAA 1MXFA 4B75A 4BZPA 4JITA 4LI3X 4PZLA 1XGKA 3CWZA 2XWBF 4MW9A 3FNGA 5L8VA 5BV8A 2PDAA 3R77A 3TRIA 1RYMA 1TK2A 2O0HA 3IL2A 2BDTA 2CXXA 3CE9A 4YJ2B 3BE4A 1FP7A 2CHGA 2ZS7A 4M3NA 4RTSA 4XCXA 4V1CI 1U1FA 2CDBA 2OE2A 1GQRA 1X92A 1NRWA 1AV7A 2G77B 2C4KA 3EGCA 2AXNA 2VDQB 1THTA 3MCVA 3VFDA 4LJ5A 4CUKA 4D9GA 2FTKE 2IHKA 3C4QA 3DAHA 3ZK8A 1GFWA 1VB5A 2CLSA 2Q4OA 1YJ8A 1JMVA 1UPTA 3EWSA 1KNQA 5BWCA 1EQ2A 2O2IA 4EG4A 3RU9A 4I8DA 2J5KA 4C7VA 2IEYA 3F98A 3F71A 1ZKDA 1FXWF 2HA2A 2PUFA 2J7KA 1UEIA 2EZ9A 2ZJ6A 3RAGA 2YFKA 2X8JA 2YNMC 2H5IA 1DX4A 1V4BA 3FROA 3HVKA 4XRRA 4KG7A 1QVWA 2WHQA 3GZNA 4B1FA 1NBME 1ZCBA 3OCCA 4JJKA 5DHUA 1H8HD 2GCGA 2HREA 3AUKA 1BIFA 2F3SA 2P0EA 3F2IA 2XQIA 3TTSA 4HYTA 4QTZA 3M9XA 5BV0A 1SCKA 3IQEA 1JLLA 3EEIA 1Y7IA 2ZBDA 2GPTA 2HSWA 4OVKA 4L4SA 4R7TA 4EG6A 5C5IA 2HIHA 3IDOA 5C5CA 4HNHA 2VHTA 3K4HA 5AICA 1W6RA 3QXHA 5ALNA 4H1HA 1IVYA 3F6SA 1I0LA 2EGUA 3V8VA 1E79A 1WMEA 1KWGA 5JMOA 2V7UA 2P68A 3RSHA 1AC5A 4GU5A 5KOHB 3UH0A 1Q0QA 1P91A 2VTDA 3G2NA 2IHTA 3HSKA 3UF0A 1WKBA 3F5DA 4A2PA 1SULA 3U13A 2A0FA 5HUQA 4DMGA 1XDZA 1RQXA 2KX7A 3INNA 4OHWA 4OUKX 2B2NA 4KAFA 5IVKA 4ZRMA 3NOXA 1R21A 3I01A 1K5GA 2FUCA 3CRZA 2XQGA 4KO8A 4L3VA 3O3OB 5CM8B 2O8CA 3EZ2A 5TPZD 4H0CA 3CTMA 1NI4B 4EJ0A 2ZTMA 4H2DA 4AO8A 1F3LA 4RK0A 4YK7A 4MPPA 3PPXA 1NULA 4TXMA 4ZQCB 3K94A 3R23A 4BX8A 2GYYA 4FCVA 3PFHA 1GPMA 2OPBA 3W7AA 3ZDEA 3WGZA 1L5NA 1GAEO 3KZKA 5JH7F 3G8CA 3G7SA 4J91A 4BKMA 2J3HA 3B1ZA 4HLQB 2PZBA 4OP2A 3TMYA 1Y5IA 1ZRNA 4UTPA 2R4UA 2BGRA 4QDTA 4GX1A 1VCOA 1AXRA 4QXQA 1PUIA 2JFQA 1BW9A 4A2WA 4EMBA 5BWNA 2O8EA 1Y7HA 3ZWVA 4ZVQA 2FPLA 3B48A 3C6KA 2Q62A 4J43A 4U9HS 4F9EA 5H70A 3W90A 1RI2A 3WYNA 3ND5A 1XLUA 2F4NA 2H4XA 4XSGA 1W93A 2BUCA 1Q7BA 2O8BB 3A0RB 4LBYA 2F17A 4NJEB 4A8JB 4CQLB 2ACEA 4LV8B 2JVJA 5MFZA 2HDHA 3RTAA 2VHCA 3UJNA 2GQ0A 3IPLA 1UM9B 2PBFA 3JWPA 2P5SA 3L79A 1YUMA 1E77A 1VPDA 5KNDH 3WI7A 3ZBQA 1ZJ6A 1BRTA 1QPGA 1VKZA 2GNOA 3PXBA 4FGJA 3DFUA 4UBOA 2C7GA 5HPYB 1VL0A 2QN9A 1SC6A 3DEFA 3E35A 3ZY2A 4CT0A 1RHJA 1CRWG 1Z3CA 2FMKA 3CGWA 1TAHA 3HCOA 1EJ0A 3MT9A 4Q5IA 4REMA 4UPDA 4X41A 3DLCA 3D6FA 3FDZB 3OLCX 2QUIA 3D54D 3CY6A 5BSUA 1QH8A 4TKUA 1JR6A 3R1IA 3G59A 1KERA 4LC1A 3PNMA 3AV0B 4TMWA 1UDBA 2C4WA 2XUGA 4MWTA 4QXMA 3GA0A 2O07A 2QPLA 2RHMA 3M1LA 3QQ5A 4QU5A 5B6IA 4JYBA 4RL4A 4DAOA 4R8SA 2GF2A 3R8FA 3M3PA 3MWEB 3NEPX 3JALB 1U90A 1SXGA 2DHCA 3JR7A 3KJHA 2P2YA 1YKFA 4P80A 4YFYA 5HM6A 3CU5A 5B53A 3TCNA 2R8YA 2D1FA 2G5TA 3A32A 4EEXA 2XMRA 3FPJA 4YDHB 3G5TA 5JEEA 1PFQA 1E5TA 3DB1A 1ID8A 1OCEA 3WICA 3QE2A 3V7YA 1QIGA 3WQQA 2XA2A 2R66A 4BE4A 1V5WA 2QAGA 2QD4A 2B36A 4R5MA 1U2ZA 4FN5A 4HB4A 1N2CA 4MWGA 1G1MA 3IUPA 4FFBA 4OKIA 4LYHA 5JAUA 4ND5A 1QBKC 3ZDDA 2KS6A 3DE2X 5ICMA 5U4XA 3USES 1G8HA 3DWGA 1V25A 4LHSA 3VTKA 4A8TA 4IEFB 1ZMTA 4ZICA 3ZLJA 3CIFA 2I9KA 1N32B 2YYYA 4M53A 5KJEA 4EA6A 1IEQA 3KUXA 4YDRA 2C2YA 1J07A 2D2VA 1CDOA 1Z75A 3GDGA 5F52A 1U2TA 2NO6A 3LNCA 1RFGE 2HXSA 2QL7A 1CJKC 1JMYA 2PMEA 1DIOB 1VHWA 4PQEA 5JASA 3DKPA 4FYKA 1US8A 4UE3S 1KO7A 1L7EA 3BEOA 3ZYZA 3K5IA 1RJWA 2WJVA 2HI0A 3FG9A 3KHKA 3A37A 4PVCA 4RHCA 4X63A 1X3SA 5GJCA 5IAOA 3ZCUA 4DJJA 4LHWA 4BTVA 1NT2A 2YYSA 2XUFA 3G2QA 3KSMA 4FW9A 1HC7A 2JJ2D 3NJ8A 1TW3A 2P6MA 3GVHA 2F43B 4JBNA 1QYXA 5D1NA 5KAMA 5JJBA 3QBDA 4HVTA 3AWDA 4O08A 3G9QA 3WX0A 3GEMA 3D3WB 3F7OA 3WKCA 4BPRA 5CXSA 2OMEA 4RWEA 5HJ5A 3RIGA 3RVDA 1HK7A 4MKXA 2FZ5A 2O0LA 3FPHA 4WDQA 1QGUB 4A7PA 1LLDA 3CX4A 3L8HA 1U9IC 2DH6A 3ORRA 2OD7A 3UCXA 5J63A 4ALLA 4J7AA 3KAQA 1N2JA 4XIJA 3S1LA 4KMMA 5DXJA 5A62A 2O4UX 1DE0A 4RVFA 1MZPA 3IIIA 3MMPA 4IXMA 3CM0A 3PJDA 4MR7B 1J39A 3DITA 1R16A 2OZVA 3L02A 1Y48E 3QE4A 1JAHA 1ONPA 1QKJA 4I6GA 4GZ3A 4NOJA 3RUAA 3SBDA 1BHQ1 3EXFB 3PVZA 1E7WA 3QP9A 4UEKA 1JH8A 3CJRA 5FIUA 2DVMA 3A7EA 4ARIA 3H2KA 3DD5A 1U2DA 1WDLA 4W7IA 5LQKA 3R0ZA 1I7LA 3T12A 1TVKB 3DVSX 1A9QA 3NAGA 3S8YA 2PSHA 5DK4A 3RVJA 3EGDA 1GPBA 1TM4E 4FYVA 2ISCA 4C0XA 4HP8A 1RQGA 5FPKA 3E3MA 2JH3A 4OAPA 1KRXA 2QUKA 5DNEA 1XHLA 1W5FA 1ABBA 4G5GA 1RRCA 1DU4A 3DCYA 1RRPA 2BFDA 3HH8A 4J29A 1UAYA 4P81A 3OPXA 3A6FA 5JO9A 5D5HA 3ZX5A 1SUCA 2Q1TA 3T3GA 3DOHA 5J2UA 5IVPA 3L0YA 5CCEA 3I64A 3MIZA 4KLZA 5SYMA 2RAPA 2V6IA 3F3KA 4JA0A 4NBUA 5LBUA 4W5NA 1YQEA 1JW9B 4ZGGA 5KTKA 3UHAA 3EPPA 3GXOA 3T0GA 1Z6YA 3SJUA 3CVVA 1RTTA 3U5TA 3PQ5A 2VA9A 5CA0F 4CDMA 1SG0A 3GJYA 3RUPA 1BH6A 1WXEA 2AI3A 1NW9B 4B73A 5KNCD 1QH0A 2X1LA 4LY9A 4DCCA 3LS2A 3AEKA 1XZGA 1BU5A 5I7WA 3KT9A 1J21A 3GPBA 3CUYA 2FMXA 2VHUA 2JI6A 3JWGA 3DR5A 4PCAA 1XMQB 1P2GA 2ATXA 5LP1A 1HLPA 1E1CB 3I45A 3WJ2A 2HJ9A 2QSJA 3K9NA 4XM0A 2AOUB 1QRTA 5B2EA 3CUSA 2Q7OE 3NAZA 3DVQX 3W2IA 5BY2A 3GLQA 2HU5A 2IZ7A 1FBTA 1TZBA 2FMUA 4YCJA 5FPTA 5FPQA 4BJ1A 1ABFA 4Z7QB 1W47A 2ADMA 2JGFA 4D92A 4IIHA 1RNLA 2VAWA 2HQ1A 2ENWA 3RBZA 2C3MA 2CD7A 2VDOB 4HLUA 2Z2YA 2AR9A 2CYBA 2LVBA 3I4CA 2EH0A 2NPOA 3R6TA 4GRAA 1QHGA 2C1ZA 3NATA 3FPAA 2AN1A 3K70C 4P6VF 3NT2A 4B09A 2PLRA 1ISRA 4HDRA 4ZALA 1EFTA 2VI5A 4TTAA 4MICA 2CC2A 4RY0A 1TYBE 1YI0A 2OXRA 2IF2A 1KS9A 3C8UA 5JE8A 4QG3A 2G88A 4TSRA 3PKJA 1C3XA 1R4AA 4Q4JB 3ZCQA 1JI0A 4JP8A 4MMXB 1ODFA 5FTWA 2P7HA 3VVBA 1MNQA 2LZ0A 3EIOA 3GFFA 2XAAA 4MA4A 3WMEA 1XELA 4BB5A 1N2IA 2OZKA 4O2AA 2GZSA 2YICA 4KGVA 3HZZA 5E7QA 5ERXA 3CCFA 3BORA 3C7CB 3W5DA 2VNAA 2ZR8A 3KTAA 1YIOA 3H2JA 2I2CA 1M1NA 4EAAA 4RTOA 2Q5IA 3KTAB 3AHGA 2AJBA 3F6CA 3ZHSA 3HDQA 3BTOA 3O91A 4K9MA 2WD8A 3EZ9A 1IHYA 5CYOA 1SK9A 1V95A 4YIKA 5SZIA 4BNNA 2JLXA 4M36A 3MMNA 3JPWA 4WMLA 2CVPA 3I37X 2WSSD 3L0IB 2Q7DA 1JVBA 1SN7A 2W43A 4O0LA 4QXRA 2I76A 3NETA 4WUTA 1FQWA 3WVNA 2COUA 1WXHA 4ZQEA 5DLQC 2EARA 2VUIB 2OZEA 1LLFA 1K66A 2SBTA 4KUGA 1Y9AA 1J97A 2J33A 1AKEA 4UBLA 1GP2A 4UDNA 5AKIA 1TKBA 1O94C 2JHFA 2QJOA 2PUCA 2VF5X 3ANSA 5B7NA 2DFPA 4WKNA 4LN1A 1UJ5A 5A04A 2BFPA 1UBEA 2XCQA 3QXJA 4KQ1A 2QRNA 4Z2YA 3VKWA 2WWIA 1JG3A 1R8JA 2VP6A 1E89A 4NU8X 4RLHA 4EB6B 2D8MA 1ICIA 2WIAA 2B4AA 3M9LA 1ZOIA 1N6NA 4EPXA 1HL3A 1O4VA 4IY1A 4CUZA 3S99A 4FEEA 1IIBA 5AUOB 1T2EA 2VS1A 2WYOA 2BTQA 3PNQA 4F6RB 4IDBA 4GP7A 1Q1EA 5BOSB 1CV2A 1SO8A 2ZYDA 3FJOA 5KZMB 4BNFA 1OAOC 2YHIB 2YV5A 1HQKA 3MINB 5EQTA 1CJSA 4DBZA 3ADCA 1DKPA 4LF6B 3THYB 1UJ6A 3FYUC 3CEHA 1JAIA 4D9MA 1WWKA 3GGGA 1DRUA 2VDWA 3GCZA 4NAUA 3VR2D 4QPZA 1YFZA 4WUVA 4ZPJA 2WOOA 3JQFC 2CGEA 1PR1A 1JSRA 2QYOA 4EY5A 1B8UA 1UDAA 1X77A 3FDFA 3L9XA 2G4VA 2P91A 1N9GA 1F1BA 2JFZA 1NVGA 2P67A 4BV8A 4ZTBA 4DDTA 4DWWA 3JYLA 3VZBA 2QX4A 3AP2A 4UE2A 2F3TA 1G291 4O4HF 5MHTA 3SX4A 1X7XB 4FEGA 4KH1A 4BTLA 1ZNQO 2WPDA 4AECA 4W1QA 1Y5LA 3AEYA 2CDAA 3F5MA 1GTRA 1N2CE 3EXAA 4TL8A 3OQMA 1GADO 1TD9A 4BS9A 2IZOA 3GOHA 3WLNA 3HA3A 3E15A 4D0GA 2Z9DA 4JL8A 4W63A 3TZ6A 3I9JA 4HVLA 1ZLYA 1S2OA 1XXLA 2EERA 3HSSA 5ALLA 2O2SA 4RGVA 5D01A 5DGCA 1PR0A 5COQA 4WWHA 3L49A 2QM8A 4DLAA 4NDNE 3UGTA 1PFYA 2OHXA 3VNRA 2VJDA 4J1QA 4QHTA 1V6SA 2WSIA 3DQZA 1ORHA 4RXUA 1KORA 4Z1MA 1L5GB 1LBHA 3ZQUA 4Z4HA 4AQDA 3GJTA 4F2HA 4MQEB 1BJKA 1XQ9A 1F2DA 1ZOOA 1PEYA 4N18A 4BRUA 1RJ9B 2V03A 3QOWA 1DZIA 4HRAA 5HILA 3GJZA 5MN6A 4YMVA 5JS6A 1TK3A 4PC1A 3HRIA 2QUAA 2MCFA 4DVJA 2IH2A 5FBKA 1Z4QA 5IF9A 1TUEA 1DTEA 2B35A 1QC5B 1V6AA 2NUTB 3KU1A 3A1WA 4IQGA 3RDPA 3VGPA 3GPDG 4ZYVA 2ERCA 4TZTA 2X40A 3DFIA 4V39A 5CM2Z 3RVNA 1BN6A 3K1AA 2BMWA 1YVEI 4FQ5A 1BX1A 2EQBA 1RVV1 1Y9DA 2WJAA 1STOA 1Y34E 2OQ2A 2IITA 3BT7A 3GMIA 1AOXA 3IOBA 1XTSA 2AX3A 3R44A 1EINA 2E5FA 1OGJA 2H2AA 3ESQA 4ZDIA 1A8HA 2X5XA 3N3BC 4CF3A 2MMCA 3BF7A 1VHLA 2X0RA 4OAQA 5HG0A 5LYJB 3DUFB 3GB9A 5AVYA 4Y6OA 4I50F 4EJ2A 1HXHA 4RVNA 3DW3X 4DY6A 3OIGA 2GXQA 5BYJA 3N6VA 3CF4G 2OXTA 1ZJYA 3QBEA 4FE7A 4RK7A 3ISTA 2XTMA 3UV3A 5DI9A 1PL7A 3RS7A 1JDBC 4HZIA 4OA5A 1W4BA 3A26A 1Q3KA 4MJ3A 4YHBA 2XT9A 3RYCB 2W22A 4RVHA 1ZWKA 5BSGA 5EYPA 1XDDA 3GFGA 4IV8A 1L8LA 1A96A 1KI3A 4HDMB 5THKA 3RQSA 4BHTA 2H11A 3WY9A 3BH0A 3LPCA 4D3SA 3KSBC 4IDDA 4V2IA 1T4MA 2NAFA 1JP7A 2GBLA 1O0BA 3SVLA 4AXXA 2JEYA 2Y1WA 1Y42X 5GONB 4JU9A 3ZGYA 3B8EA 5EFOA 1S8AA 1I10A 5A3SA 3WAJA 2ZSHA 5A4IS 4G5OA 4E6EA 3SQXA 1N4DA 4PX3A 3V9AA 3M6IA 2QMYA 2IUFA 1F0KA 3OPQA 1NVBA 2FZVA 3SEFA 3DXFA 3HJHA 4BNTA 1YJMA 4FONA 1XPRA 5L6LB 3TKYA 3P9PA 1DO2A 3L8YA 1KZ6A 2VPZA 3IA2A 3TLGA 4BLUA 4MUKA 3NBZC 3ZDZB 1EUCB 2H59A 1W4CA 1KBZA 3AB8A 3J7TA 3T0FA 4U6SA 3U49A 1MJHA 2AC2A 5G0SA 2FPIB 1BDIA 3IRVA 4JKOA 3ER8A 1TKRA 1B16A 3EXIB 5BO5A 1FDWA 4NL4H 4K9NA 4Z4FA 5CLLA 2FG5A 3EZXA 3MNFA 4J6EA 1N5KA 1GXSA 4CL8A 5IFLA 3DVAB 5JEJA 1OLUA 4JYZA 3NBFA 4J1SA 3U31A 4NDZA 4G85A 2NUAA 2P3LA 1W88B 3DHEA 3PSHA 4BLQA 2J07A 5B5SA 4KGXA 2I33A 3V8QA 2HAEA 2P3OA 5DT2A 3TWOA 3EXEB 4WGGA 1P62B 5KHAA 3HS3A 2HK6A 1CS0B 4G26A 2F62A 5B1EA 2CXHA 5KSPA 1SG9A 3B3JA 4S1VA 3Q5DA 1VPTA 4KWEA 4B2YA 1YR8A 2F1IA 2BKVA 3V1YA 3KJQA 3S5UA 3V7FA 1U2PA 1LF0A 2GFIA 4MZXA 4PWZA 2RHDA 4GM4A 1EFDN 5IYZF 3IC5A 3I72A 1GPWB 1BMTA 2C94A 1KJJA 4P58A 1CIVA 3HWSA 5EWLA 4ZCLA 1VZ2A 3T52A 4CF6A 3U16A 3UBTA 4ND1A 1NMYA 5G0UA 3G0DA 2FZCA 3I0NA 3DFFA 1IB0A 2QG9A 4ZC8A 3V7WA 4RY9A 4KCGA 4WEQA 2GFHA 2CK3D 4AWXA 1I4OA 3AILA 3O83A 2DGDA 1VKHA 2XYRA 4RSRA 2E9SA 1GCUA 4AF8A 2WG2A 4RD2A 5HMLA 1IEWA 3D0OA 4NFSA 3DCIA 5K0NA 4X6XA 5K51A 1XMIA 2Q5CA 5EC8A 1COWD 3L41A 3PDIB 3NNNA 1T8RA 1E1RD 2ETXA 3GEEA 2LTAA 1M2VA 2ZWAA 3FYSA 4MQBA 1ZIXA 1FNMA 4R2JA 4D4KA 2XRZA 1SQ6A 2OG2A 4GDFA 2PGJA 3E8XA 3ZHOA 3EC2A 1GL3A 4M8SA 3MK31 2EFYA 1QGED 1VBMA 2OB1A 1DAMA 3OZAA 1R0SA 1G63A 2QXUA 7AT1A 5JZSA 1O3YA 2HOQA 3C4JA 2Q4RA 1UZUA 4WADA 1XDBA 2ID9A 4IJ5A 5FQNA 3SLGA 1PG0A 2VF7A 4JQSA 3VPSA 3RU3A 1GO2A 3IAFA 4K0RA 4NF2A 1FDSA 4GPEA 4IOMA 4ARBA 1PV2A 1XD9A 1KJIA 2B6HA 1E2NA 3Q8XB 3IMCA 2QHXA 2RBGA 4GP6A 4FDLA 3TQTA 3ZI4A 3P2EA 2YWDA 2JIZD 3L0OA 1BOFA 3TW0A 5BWOA 3QW4B 4B6GA 5CLHA 2XUAA 3OLYA 5L40A 1U99A 2WJPA 2R4TA 3E3NA 4CTOA 1UKCA 4G4GA 5BSWA 3QOXA 1J2UA 3FRIA 4ZT6A 1WV1A 1T24A 4OKNA 3ZHZA 2PLAA 2ZQZA 4CQMB 1L4YA 2J5BA 1DCMA 1DAIA 1NIPA 2H2IA 3VH4A 1XVVA 3LK6A 2GZDA 4N3BA 3IALA 1KK3A 1EFAA 3D1JA 1IY8A 1E94E 5BSHA 3BWYA 4P2GA 2IOHA 1C4WA 3THSA 2VXBA 3PJGA 3MT7A 1WCWA 2JW5A 2WHPB 3PPIA 2AD1A 3ROZA 4J2HA 3E9EA 3AHEA 5EZSA 2GTHA 3H4IA 3TEJA 1ISSA 2Z83A 1I4WA 3B5EA 1AGRA 2ZAOA 2ZSUA 4NS1A 4D3ZA 4GOOD 3GNLA 2RKBA 4W5WA 4XR9A 2HJGA 2W6ID 1IZ0A 3R7WB 2G40A 4BNLA 3N7AA 2QIOA 5IJ0A 1A5BB 2ZRKA 4DYHA 1XF1A 1DWQA 4BZQA 5EKDA 3UA3A 4KPYA 2AJLI 3ADBA 2GKOA 1E99A 3PXUA 4XDYA 4XGIA 2ZWVA 4H0FA 3AP3A 4XSVA 2I2DA 2YW9A 3JQRA 1ZH4A 3DMFA 3EBOA 4WLUA 5ALJA 1X7ZA 1ZOLA 4DV4B 1LX6A 3PVSA 1GPDG 2YDYA 1I3NA 3HP4A 3KLBA 3N86A 4LHYA 3O03A 3L77A 2Q1WA 3HMQA 1OD6A 1LY1A 1O6CA 1U5AA 2DZDA 1O96B 1U4OA 2ODPA 2VH2A 3SE0A 1W9HA 1L3CA 1HOXA 1F0YA 5JSKA 4Q1AA 1MOQA 2XEXA 2GHIA 1H9AA 2PN1A 2X23A 2FPGA 1RW4A 4WPGA 2O8DB 1CUDA 1WU7A 3B8HA 5ESDA 2GZMA 3U6BA 3RF6A 4LGMA 3KEQA 4BP8A 4RQBA 5LZ2A 1U4NA 1QQTA 2OUKA 1K2WA 2C4NA 2HNAA 2VA8A 2JZCA 3BZBA 1MFZA 3LUBA 4HB3A 1EIZA 4IM7A 3FLBA 4RPCA 3GAZA 4L5YA 4KGDA 3MPOA 3UWOA 5KKCA 4BVFA 5AIBA 2W6MA 3GD5A 3KQNA 1N5MA 3CZPA 5A6VA 3SXUB 3DT9A 121PA 4DF3A 4C0LA 3SXUA 5M29A 4AS2A 2RHCA 4ZCPA 4DLRA 8ATCA 1G59A 1K98A 3G2HA 2II6A 2HHAA 2REXB 4Q9DA 4UXHA 4D9HA 3H4VA 4D82A 1QCZA 1G4UR 2VWGA 2CUZA 1L0BA 4K9SA 3DO8A 4Y8VA 4ZVKA 4QXPA 3JCZA 4R69A 1NQXA 4RV5A 4DJAA 3ORFA 1OFTA 1RJFA 1RPNA 2C9CA 3C1UA 3PEUA 4NYJQ 4ZJUA 1OT3A 1T4CA 4NXMB 1YE3A 4BAUA 3M81A 1U7XA 1BD4A 3IKJA 2UZIR 3IXLA 4KPGA 2BMFA 4TV9F 4E3ZA 3ASVA 1A8UA 4DVGA 4BZWA 3FWHA 3SC3A 5FUXA 3O4GA 5JAMA 2FEOA 2CXOA 4YAWA 5BSRA 3KEGA 5EJGA 4E3WA 2ZKLA 1U04A 2OBMA 3UUFA 4B4OA 1MC5A 1RLUA 4GVPA 3U19A 4NCKA 1S2GA 1TUBA 1UF9A 1X6VA 1ZD8A 2HPHA 3UPTA 3S5JA 5F3WB 1N78A 3ZLUA 3LX8A 4UAGA 4IWYA 1K75A 1L7XA 1PFGA 4TVOA 1JG1A 1TYEB 2XWQA 4J0DA 5L3RA 3Q8LA 3C6BA 1PZXA 3DO5A 3VHRA 1XRMA 3QU7A 4IKPA 1FIUA 4OSOA 1XCLA 2AQHA 2JANA 2XWSA 3CZCA 3GFTA 5IKMA 5BQOA 1C7QA 5FQOA 1X15A 3NBUA 3P19A 2IHBA 4O4IA 5TQVA 4ESVA 1ULZA 3CNBA 5D86A 3TJMA 2A4KA 3O4IA 2R5NA 5FV4A 4RTRA 4E0BA 2JGAA 3RRMA 2R00A 3TDNA 3QSGA 1UCFA 4FFMA 4B3CA 5AD1A 4M8LA 3BIWA 3CBGA 4X1KA 4X64B 1YZVA 3IESA 1U0LA 1RC0A 3QYPA 5AT1A 2DKFA 3AETA 3X1KA 3C5WP 3DZHA 3QJYA 2JJQA 1R4NA 4YC7A 1SHLA 2D5CA 1VJCA 1XNGA 2IW3A 1DDGA 5AW2A 2C4UA 4WW0A 4EX7A 4LPSA 3PGVA 1ZESA 3IE2A 1JJIA 1GXSB 2B4KA 5HKOA 1GLNA 3BD6A 3F97A 5JXWA 5FLKA 3WHIA 5FOTA 2PTHA 3OY2A 1FS6A 2H4YA 4Y1RA 5DSTA 2CXNA 2AOUA 2VHQA 5GOTA 1XA3A 2JIBA 2OFXA 2PZLA 2QRJA 2FN9A 2PANA 4H3SA 4L4ZA 4MMZB 4POOA 2FFJA 3KZOA 4MUJA 3QVTA 3DCNA 2YWHA 3KJXA 4MA5A 2OXIA 2I80A 3SYLA 1BS2A 1TIBA 3H9CA 3HU5A 4QPNA 4DR7B 4JT2A 2E0IA 4ZJPA 1I4LD 1YRQA 1FDVA 2MYNA 4FYPA 5EOVA 1AV6A 1I5EA 2XGMA 4C4YA 2AB0A 2X4IA 1UEXC 4YQFA 2OV6A 2RHTA 1XHFA 4R8RA 4ZYTA 3MF4A 4XIFA 4GD3Q 1WHTB 2WKRA 3VSBA 1IZYA 3DDSA 5KYYB 1PLLA 1M0SA 2YS6A 3GZ4A 4UUQA 4WA8A 5AVKA 3R7SA 5IBCA 2PTGA 3SNHA 3PITA 3P4XA 2OGTA 7MDHA 4WE3A 5KS2A 5EXTA 3QTLA 1XXHE 3K1YA 3ZV7A 5KVCA 3AVTA 1XG5A 2HIMA 1A7AA 1PHRA 1Z4MA 1XAIA 2BH9A 3EDQA 4YJ3B 3WGGA 4EHJA 3KYDA 3Q0EA 5DGHA 1OFIA 5AHXA 4UD2A 4ZDKA 4JC8A 1T4CB 4OQMA 1DEXA 1ENOA 1ZHHA 2J87A 3CCBA 3DMYA 1MG5A 4HAOA 5EJIA 1H1LA 2GHRA 3LCUA 4V3BA 4PR0A 4MW1A 4OLFA 1CQJB 1Q0SA 2QQ0A 2LIVA 3AJAA 3Q7PA 4UQPA 3UUGA 7REQA 3A2KA 1GU0A 3T7TA 3EWIA 5C1PA 3CUEF 2Z43A 4Y9TA 1P9LA 4X44A 5CLJA 3SHVA 2IYWA 5AR1A 2PNJA 4AUNA 4OXRA 2IDZA 5EWLB 1RAEA 1MEJA 1L8XA 4CHTA 2CSUA 1OLXA 4M0PA 3L7DA 3UJ8A 3POAA 1O5OA 5GQSA 2IELA 3OE5A 4F72A 1E2LA 7ABPA 2Q6TA 5JDCA 1K3QA 1JEDA 1G8GA 3DE1X 2FSIA 3K1AB 4LYJA 4HATA 1WCYA 1Q1QA 1YR6A 2X3UA 3WLEA 3HACA 1JEQB 2QRQA 1PGNA 3L43A 2XB9A 3FPGA 5H9WA 2FEPA 2GCPA 2AFHB 2Y9MB 1TRHA 4GUDA 1GG8A 1VJRA 3HZHA 1FUKA 5K1ZA 3N5KA 5BN1A 1WIWA 2WJ6A 4OMFG 2UU9B 1R3DA 3H1FA 5DN6A 4UBNA 4MZDA 3HCWA 1GAJA 3RYIA 2O5RA 1N7GA 3S7TA 1UXGA 1N36B 4ZVMA 1NOIA 2BGWA 2H9YA 2BFMA 5TVGA 4A1FA 1UMBA 4I36A 4P9NA 1YXMA 3OE4A 3ZU2A 2BP7A 1RXEA 4LVCA 4K1LA 3R6GA 4EL0A 5C35A 4IO1A 4BFWA 1LX7A 4OXQA 2GEKA 3SQDA 3V4FA 1ID1A 3MEQA 2JAUA 3VHLB 3BH7A 4YP1A 9ABPA 5C53B 1YO6A 3VR5D 2BOVA 1S7CA 4QSMA 1O08A 4RPGA 3QV2A 3KIPA 4KXQA 3ROQA 1DSSG 2ZS8A 1ISFA 1YDGA 4J2OA 1RHUA 3U7IA 4E11A 2E18A 2GHTA 5BYKA 4CI0B 3ZQKA 1S8FA 1L8AA 3GGOA 3V1MA 4RHFA 3VISA 2VT7A 5KU7A 4BC0A 4DHEA 1UKEA 2A9OA 2VHXA 3GRFA 3EMBA 3ECAA 2B0CA 4IX1A 4NRDA 4QU9A 5KMGB 3N5CA 1JU9A 5GJBA 3I3SR 1NP7A 2CLEB 2VNJA 3EC1A 2CKDA 4B6PA 1AXGA 4PS0A 5LU9A 3FB4A 4HDQB 2C7OA 1ODJA 3AM5A 4L9RA 4QLOA 3I01M 2NVUB 3FFWA 4YRLA 1E4YA 2DHDA 3UMYA 4HRXA 2A0WA 1GG9A 2DG2A 4C05A 5EMMA 1JR4A 2ASEA 4NJMA 3OI7A 1SIOA 1C50A 3UT0A 3LYLA 4PX5A 1G5QA 1N2OA 1CE8B 1U7UA 2BUBA 4D3XA 5ELMA 3V3KA 3SVTA 1Y89A 2GD2A 1ULBA 2DB3A 2AOTB 3BAFA 3ZUPA 5L7TA 1P8AA 3KT6A 3FYTA 5C7OO 2Z8XA 1QYWA 4GDMA 1GNVA 1HEUA 1TK9A 4L5BA 2MIIA 5K4AA 4UEOA 1RCFA 1JIIA 3IPAA 2QLJA 5CEFA 5AOAA 1Z5NA 5EXDA 3TR0A 1NP6A 4JELA 1ZIPA 1Z0FA 3HYRA 4FT4A 4O5AA 1QO0A 4A0FA 3R9WA 1KSJA 1SUIA 2JKVA 3BGVA 2Z5FA 1MT0A 3I6IA 2ZU6A 4KKXB 4NYJR 5E9QA 5AW5A 3R7FA 3TG8A 2WU3A 3D2BA 3SYMA 1L4GA 2BRUA 2F1RA 5CB4B 5LL6P 1NV9A 1GZ4A 1Q7EA 3IERA 3K9HA 4RF3A 1G17A 1N6KA 1KK2A 2TECE 4RQTA 1L5RA 1NZDA 1MENA 2ORIA 1T36A 2IV2X 1JTFA 4HAZA 4K1XA 5KCZA 3O75A 3B6MA 4LWOA 3V46A 1NOKA 4JOCA 1H2ZA 3QH4A 3TFQA 4CLRA 3NC4A 3W5HA 1K8YB 5E9AA 1NXQA 3UATA 1QJ4A 2IYPA 4Q1CA 1V96A 4HLDA 3PI7A 3OCWA 2R6ZA 4NJEA 4GBMA 4RY2A 3VZSA 2Q41A 4A8JA 1EDZA 4YY3B 4RVOA 1ZNWA 3OBBA 4J49A 4ZCRA 5FWYA 5EAIA 5E38A 5DYIA 2FEZA 3G85A 1JPUA 3H5OA 1TM2A 4MHSA 1V26A 3KVOA 4H17A 1CX9B 5J4LA 5HP4A 2GAAA 5LP6F 1VE5A 1G7RA 3MGCA 3U3JA 3A11A 1KMQA 1UK6A 5DP2A 4CBVA 4XQEA 3LX5A 3NFRA 3DYVA 5HKBA 1N3LA 3HKDB 4CCAA 4Y6GB 3JARB 2NX2A 2E7ZA 3AVQA 1NSYA 1LD3A 1MORA 1C3LA 4MQFB 2CKMA 4ND4A 3OTGA 4I1UA 5HJ2A 3X2FA 3WGUA 3L4EA 4M0DA 5SZKB 1RWBA 4MRPA 3WYEA 4B44A 4DNQA 1QHFA 4ZT5A 1B43A 3UB4A 1B6SA 4D7AA 2PUTA 5B7GA 1PEAA 1S89A 1XC7A 3I73A 3OLQA 1HRKA 4MW4A 2IIVA 5H81A 4EVRA 2DHQA 1UANA 1P2TA 2WF6A 3KEFA 4FNOA 3NWOA 4IUCS 4TL9A 1IJEA 5IG2A 1AKWA 2O0KA 4XX0B 1U2EA 4WDRA 1V7CA 1VCNA 2ZYSA 2X8BA 3L3BA 4J0QA 1N2EA