3V8SA

Human rho-associated protein kinase 1 (rock 1) in complex with indazole derivative (compound 18)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
395
structure length
395
Chain Sequence
ETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based and structure-guided discovery and optimization of rho kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Rho-associated protein kinase 1
total genus 123
structure length 395
sequence length 395
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v8sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v8sA01
3JYAA 1P5EA 4WOVA 3FMNA 3QTIA 5H8BA 1A06A 5EM7A 5ETAA 3IK3A 1CKJA 4BB4A 3RAWA 5JFSA 4DCEA 3CD8A 5E8YA 4DT9A 2VTOA 1SVGA 4I21A 3TUDA 4I4EA 2VGOA 1OB3A 4AN2A 2Q0NA 4KBCA 4UMTA 3V6RA 1MQ4A 1W82A 5EOBA 4HYIA 2RIOA 4NL0A 3Q4UA 1J1BA 4PDYA 3E87A 2WMXA 3OCSA 3UQGA 3U6JA 2FH9A 4PUZA 3T3VA 5IUHA 2UZUE 4PWNA 3ZSIA 3I5ZA 3JVRA 3ET7A 1YOJA 2C6KA 3T9IA 2C4GA 5CQWA 4I1ZA 4CCBA 5A9UA 1WZYA 2YISA 4UYAA 3QUEA 4QYEA 4RVKA 4RZWA 3VBTA 3PWYA 3ZXZA 3D83A 4EH2A 4AGCA 2WQMA 4E4MA 3PSDA 2O63A 4KIPA 4XBUA 3H9FA 1XH7A 3IW4A 4DEBA 2LGCA 5K9IA 4M13A 2WQNA 3R1SA 3R30A 5IEVA 1LUFA 4IW0A 3DU8A 5AP4A 3A7IA 3RGFA 2W1HA 3JR1A 2R3KA 2VO0A 2BAKA 4RJ5A 4APCA 5CQUA 5HOAA 5DIAA 1Q8WA 2BDWA 1O6YA 5CX9A 4BCPA 1FBNA 4YU2A 2OJGA 4DFYA 1RJBA 5CWZA 2QOFA 2JAMA 3Q32A 1XO2B 5KX8A 4RFMA 2Z60A 4JG6A 5AV0A 1V1KA 2XCHA 4DTAA 2CLQA 5LARA 3AC3A 2DWBA 4V01A 5HO8A 4C61A 4FTOA 1OM1A 1V0OA 2PVNA 4XRLA 4MH7A 3UQCA 2PE2A 4FE2A 2XVDA 3OXTA 2B53A 4QP3A 5GNKA 3VS7A 3VUMA 1O6LA 3WF8A 5HD4A 4YJOA 2VWWA 4IM0A 2YERA 1UNHA 1KUTA 3MIAA 3SXFA 3QZGA 5EHOA 4P5QA 4F9YA 5CSXA 4PDSA 3QTWA 2JKMA 3VRZA 2QOBA 3QTUA 3LQ8A 4IZ5A 4L7FA 4QMXA 3RP9A 3C0IA 4O0SA 5L6PA 4C3PA 4LUDA 5AIKA 4YHFA 3CE3A 3HV3A 1PXLA 1UWJA 4NEUA 4YJUA 4HVGA 3ZUUA 4FR4A 2CNQA 4NKAA 4L8MA 4RWLA 1ZYSA 4I6FA 4F9AA 3N4VA 1OIQA 1ZYLA 4ZJVA 4FIFA 1O6KA 4LUEA 5CAVA 2B0QA 4O82A 3NMUF 3CSVA 5JH6A 5LMAA 4IMYA 3PJ2A 3LM5A 4B8LA 5HX6A 1NT2A 3QX4A 4HZSA 3LCTA 4EONA 2P3GX 2JITA 1KOBA 4GYIA 4EQCA 3NUSA 3A7GA 3UMXA 4NM3A 4QYGA 2WMQA 4TN6A 4DFXE 5LVOA 3PP0A 3I6UA 2BHEA 3LXNA 1PMVA 4K8AA 3LFBA 1H0WA 4JDJA 3SRVA 2XP2A 1G8SA 5CU4A 3ZFXA 3PTGA 1BLXA 1YVJA 2W5HA 2ITPA 5TF9A 3P23A 2GFSA 5KUPA 2A19B 3I6WA 4F0FA 4BF2A 3CGFA 4DITA 4XHKB 4CRSA 3A7HA 5LMBA 4FV9A 3I0QA 4CLIA 2EWAA 2VUWA 4PDOA 4XV9A 5EM6A 3RNIA 3FI3A 2IZUA 3GU8A 3HP5A 4RFZA 3SW7A 4C4GA 2GNLA 3F3WA 5IQHA 3F2AA 3AC2A 2JIUA 3KRXA 3VS0A 3FMLA 3IONA 4X2KA 4UWBA 3F3TA 3E3BX 1LPUA 2G1TA 2J5EA 4OT5A 3H10A 3E63A 3PRIA 3SQQA 4AOJA 4PP7A 1XHAA 1OL2A 3FSFA 2WTVA 1H28A 2WTWA 4L53A 5CU0A 4L00A 3RCDA 2W7XA 2JKOA 2XEYA 4DGLC 3PJ8A 1ZLTA 4J96A 4OTDA 3O50A 3H3CA 4UV0A 4IJ9A 3LVPA 3VJNA 3K2LA 4C34A 1H1SA 2FUMA 1H24A 4BL1A 5CYIA 2CKEA 4NW6A 3O7LD 3HEGA 5BYZA 4DH3A 3EH9A 4EBWA 5M56A 4UWCA 3NS9A 4MD8E 1IASA 1ZOEA 1GZ8A 2F2UA 2GTMA 5A3XA 4RJ3A 4E8AA 1BL6A 5ETCA 4EORA 2BKKA 1PYXA 3ULIA 3VUHA 4EOSA 5IISA 4QQTA 3HRFA 4HCUA 3D7ZA 3MWUA 2XJ2A 1ZY4A 1WBNA 4FV1A 4MD9E 4XP2A 3R9OA 2YHVA 4DFUA 4FSTA 4TPTA 4O1PA 4S34A 5D7VA 4BCMA 3I79A 3GU4A 3HA8A 3QD3A 5CZIA 3FKOA 5CEOA 2EXCX 1UA2A 3KXNA 4QMWA 4X3FB 3TIYA 3FMJA 4E6CA 1URWA 4ONAA 5ETIA 4DC2A 5GZ8A 5CALA 2NPQA 3P0MA 4NFMA 5FEDA 2ITVA 3DBQA 3PXQA 3DJ7A 3POZA 4J53A 4XV3A 5DMZA 3HMMA 4XRJA 3H9RA 4P2KA 1M14A 1J7IA 3UPZA 4BICA 1PHKA 3OF0A 3OW3A 5ICPA 4AAAA 3EQIA 5BMMA 4F4PA 3BYMA 4F7JA 5BX0A 3PFQA 4BCQA 4RVTA 2HCKA 5I9UA 2I6LA 5AX9A 4CFWA 3MY5A 4AACA 4FEQA 4FKUA 3WILA 5I0BA 4EOPA 4XOYA 4MBLA 3WYXA 4TWNA 2YM6A 2QQ7A 1LEWA 3ZYAA 2W0JA 4W4WA 5A6OA 1LEZA 3EQGA 4J52A 1ZOHA 4MCVA 3Q2MA 3IDCA 3RPOA 4BDAA 3M11A 2W4OA 5IEYA 4FEWA 4FG8A 3TDWA 3FXXA 3HRBA 3GQLA 4YZDA 3IW7A 3BYSA 3V5JA 2J5FA 4KKEA 4BRXA 4CZTA 4E20A 5HCYA 4TW9A 3LE6A 5HU3A 3MDYA 5M09A 2QI8A 2G01A 1ZWSA 1JKLA 5EI2A 3KVWA 4YNEA 4KBAA 3ZSHA 5A14A 5ANOA 5HVJA 5HO6A 2QG5A 3CEKA 3OW4A 4GW8A 5T6KA 4TWCA 2QNJA 3O8PA 4GT3A 5DBXA 3S0OA 1Q3DA 4I5HA 5AUYA 4LRKA 5BUEA 3EL7A 4F7SA 4DE4A 2PMLX 5BVEA 4MNEA 3ORPA 4F09A 1QPEA 4IX4A 1OUKA 1SM2A 2EXMA 3O8UA 3RBWA 4C0TA 2VD5A 4GK2A 4ZSJA 4AGDA 4E6AA 2XCKA 4E5AX 4LGDA 2R9SA 3MPMA 2YZAA 2XS0A 4RC4A 2LAVA 3DBCA 3COKA 4FTQA 2PVHA 2YA9A 4KAOA 4KKGA 3TCPA 4HVHA 5IA4A 3D7TA 4YJQA 3SHEA 3TNHA 5JSMA 5GIPE 3PIXA 3EYHA 1OGUA 2OG8A 4BY9E 4CV9A 3UZRA 4MQ2A 4FTLA 5DHJA 4FNWA 4DEHA 2C0TA 4XG6A 5HCZA 2CKOA 4IANA 2OLCA 3BWJA 1YHVA 1WMKA 1CKIA 4ZOGA 4NIFB 3FY0A 3RPYA 2FO0A 3E5AA 4WBOA 2BR1A 3OEZA 4FL2A 4J71A 4WSQA 3CP9A 4N6ZA 3QALE 5CVHA 3WZUA 3OT3A 5CY3A 2B9FA 3L9MA 3OBJA 2YDJA 4MHAA 4AOIA 2V55A 2GTNA 4ACMA 3OEFX 2QLQA 2XIZA 3AG9A 3V5TA 3TKUA 2RKUA 4RLLA 1ATPE 3HMNA 5AR7A 3RZBA 2AC5A 1NA7A 4OTRA 4HNFA 4X2JA 4AX8A 4USEA 3VBQA 2HWOA 2CKQA 4CG9A 2RFNA 3FY2A 3NUYA 4I23A 3U9NA 3WZDA 2ESMA 1OIRA 4NM0A 4OTWA 5I3RA 4IB0A 3QA8A 4NTSA 5IZFA 4IZYA 4YLJA 4YURA 3PXRA 2WIHA 5EW3A 3FQEA 5JQ5A 3W2PA 1KE8A 4W9WA 3TWJA 1IRKA 2J0KA 3P9JA 4XYFA 1JBPE 5JFVA 5JT2A 5IPJA 4D2VA 1U54B 5HG7A 4C36A 4ZY5A 3FLSA 4F1MA 5IDNA 4DFBA 2UZDA 3HUBA 5JN2A 2GQSA 4YZCA 4L46A 1SVHA 2V7AA 2PUUA 3P5KA 4U43A 3HP2A 2FVDA 4N0SA 4AT5A 4BWPA 4Z7GA 3OS3A 5AM6A 5GIOE 5CS6A 5DR6A 3VS5A 2JLDA 2QURA 3OZ6A 4AZFA 2F7ZE 3DKOA 5AMNA 3WZJA 2YWVA 2PMOX 2UZVA 2HOGA 5KO1A 4GFGA 4F6UA 2J90A 4JXFA 3OWPA 3MN3A 2AUHA 5H8GA 2YM4A 2CCIA 2J4ZA 5ANKA 4EH6A 4FSWA 5HICA 3W2RA 3U6IA 3KB7A 3MH1A 2WMWA 3MVLA 4NCTA 4F9WA 3VF9A 4Y8DA 3ZDIA 3NUAA 4D55A 5IQCA 2ITNA 1BX6A 4FKIA 4NM7A 2HXQA 4KIKA 4RT7A 3A99A 3BHVA 4D2WA 5CXZA 1KV2A 3ATTA 3WE8A 2XH5A 2BTRA 1OL7A 3ZRKA 5IF1A 5DA3A 3CGOA 4JLCA 3GCPA 1XKKA 1R0EA 3F5GA 2OZAA 4WNKA 3VW8A 4N6YA 3KMUA 4TWPA 4EYMA 4ZSEA 4CFVA 2ITYA 4J97A 1GY3A 4HCTA 3VBYA 5LWMA 5FTOA 3RKBA 2YIYA 4M68A 1XH9A 3OWJA 4ZTLA 1M2RA 3AD6A 5L8KA 3OOGA 5HZNA 4R5YA 5AP6A 3NUPA 5C26A 4YJTA 3K3IA 5B0XA 4KRCA 3UP7A 3E3PA 1FQ1B 2WKMA 5E90A 4O7RA 3G6HA 3FI2A 1DAWA 3N51A 3I1AA 5EFQA 2JDSA 2JAVA 2GNJA 2B52A 3LXLA 1PW2A 3IS5A 3TI1A 3R8ZA 5LXMA 3SKCA 3BU3A 4A9TA 4L68A 4Z9LA 3PPKA 5CT7A 2RF9A 2BDFA 1OL1A 4I41A 4YPDA 4ZTRA 2E9VA 5KKRC 3OVVA 4ASDA 4O22A 4LFIA 2QONA 4GG5A 5HI2A 1U4DA 4EWHA 5E9EA 4BI0A 5J8IA 4BTFA 4AWIA 5HD7A 4KIOA 5FXQA 4CG8A 1OIYA 3IDBA 3G9LX 1ZMWA 4UWYA 3ODYX 4BIDA 3SA0A 3ZTXA 4G31A 3SXSA 4CNHA 4DAWA 2OKRA 3FXWA 5ACKA 4HVSA 3C5IA 4J98A 2VWIA 2QG7A 4U44A 5FBOA 4JVGA 4QTAA 3F7WA 4RC3A 3TNPC 5L2TA 3PDTA 2OIDA 2R7IA 4FODA 5E8TA 5DVRA 3RCJA 4QP4A 3ATSA 3TACA 3LMGA 4F1OA 1KWPA 4NU1A 2C3KA 1MUOA 2GCDA 3RPVA 4ZZNA 5KHWA 5I9YA 3CS9A 5IQGA 4BTMA 3NW7A 2C5OA 3NYNA 5C1QB 3ULZA 1JQHA 4FSUA 2VU3A 2YJSA 4UY9A 2F9GA 4QMZA 3NWWA 5AP2A 3RALA 1A9UA 1H0VA 3ENHA 3PJCA 2QLUA 4QNYA 4RGJA 4Y83A 5T3QA 3C5UA 3N9XA 4QP7A 1H1PA 1RDQE 4DG3E 2F7EE 3PVWA 2C5YA 2RL5A 5FP5A 3RK5A 4AA5A 3E8DA 1BL7A 3BQRA 3DBFA 3FXZA 3KXZA 4BDDA 2PE1A 1ZMVA 4YTFA 5D12A 4JG8A 3OC1A 4DINA 4RX7A 5IQFA 3LAUA 3QRTA 4HPUE 3BZ3A 3FMHA 3H0ZA 3R7OA 4S2ZA 5AAGA 5HG5A 2O5KA 3KMMA 4ZAUA 5EOLA 3DJ5A 1SZMA 3PPZA 1OKWA 4EOMA 3CBLA 1H01A 4JQ8A 5AAEA 5JMSA 3NVKI 4WG3A 4CTCA 3AC1A 5HU9A 5I9ZA 4MD7E 3TEIA 4CZYB 3FKNA 2YM8A 3IKAA 4FV4A 4MBIA 3D7TB 3DCVA 4IM2A 5C9CA 3TTJA 1YI3A 2IZSA 2WOTA 2B54A 3SOAA 4BTKA 5HVYA 3VS6A 5EG3A 3E7VA 3IQ7A 4LL0A 2WMAA 1KE5A 5C4LA 2EB2A 4IDVA 4FEUA 4WIHA 2Z2WA 4MNEB 4C35A 3FZSA 3FV8A 4PV0A 2OBJA 3CD3A 4CV8A 4IFGA 4KUJA 5EHLA 1B38A 4ERKA 5CEIA 2XBAA 3QC9A 5F94A 3BYVA 1XH8A 1B6CB 4FKWA 3C1XA 5CAOA 1LP4A 1H1QA 5DRBA 2WELA 4C02A 3CKXA 1G3NA 4A06A 3QTZA 4EYJA 2BZHB 3MVJA 2OSCA 2UVYA 3R7GA 4R7IA 5JFWA 3R8VA 3COIA 4JAJA 2GDOA 5J1WA 4YBJA 4YC3A 4F9CA 4AXAA 2UZWE 4UN0C 4M97A 3GGFA 1AQ1A 2BALA 4BBFA 4Y73A 4R1VA 4GL9A 3QKLA 3FYJX 4M67A 4RZVA 5TO8A 1IR3A 2XNEA 3WOWA 4BDBA 5M4FA 5GINE 3RAHA 3RPRA 1J7LA 4U5JA 4BDCA 2F57A 3R8LA 1KOAA 4M15A 3BU5A 4YZNA 4AN3A 4RLKA 2R3FA 3KF7A 4PL5A 1TKIA 1Z9XA 4R77A 1PY5A 3QCQA 4U6RA 2V22A 2FA2A 2XUUA 4ZTQA 3W32A 2UW5A 4M12A 2NO3A 3BU6A 4WBBB 3TTIA 3C4ZA 2XA4A 2E9PA 4ANNA 3KQ7A 4JQEA 4G5PA 1F0QA 2X4ZA 3V8WA 3TXOA 1ZAOA 2YJRA 5HTIA 2XKDA 5K5XA 3C4XA 3R7EA 4Y46A 4JT3A 2BFYA 1W83A 4EUTA 1Q8ZA 1IG1A 4BDGA 3S3IA 4WG4A 3BBTB 2A0CX 3MBLA 4X0MA 4HGSA 5LVLA 3FEGA 4DH8A 1Q4LA 5KHXA 3EQBA 4B8MA 3VHKA 4I92A 3RZFA 2CDZA 2ZVAA 3R0TA 5HVKA 4HPTE 4I94A 4L9IA 3LCDA 4QTDA 3MPTA 4E93A 3DPKA 5IA1A 2A4LA 3ZOSA 3D0EA 3BELA 3MY0A 2Y4PA 4GKHA 1Q62A 3R04A 5FTGA 2YABA 3WIKA 3THBA 3QZFA 1FGKA 3BYOA 4OW8A 2PL0A 2O0UA 5AP3A 2HW7A 3SX9A 4IX6A 4XLIA 3WBLA 3MH2A 4B99A 3LJ1A 4GU6A 4QRCA 3FZ1A 4XNEA 4R1YA 3Q2JA 2IG7A 4FVRA 3VUGA 1PXIA 3BGQA 3DKFA 5T68A 3W18A 2JBPA 3ROYA 5HX8A 3R7VA 4NTTA 1P4FA 2VNYA 4Z3VA 1KE6A 4FI1A 3DK3A 4MXOA 3LM0A 3SG8A 1PXNA 1Z57A 3E8CA 4YJNA 4H36A 3HECA 3UDBA 3ZM9A 3OMVA 3KCFA 4QMVA 5A4QA 4EBVA 3LXPA 4OR5A 5JRQA 2VTJA 4WNMA 5TT7A 3CIKA 3W8LA 4DBXA 4FTAA 4B9DA 5IQAA 3OT8A 4W8EA 3UYTA 3MGYA 3NNUA 2VX3A 2PMIA 4IC8A 2GQGA 2OO8X 2OZAB 4QP6A 5HGIA 4H3PA 3KL8A 5DE2A 3EIDA 3GCQA 4NYEA 1TQIA 3CXWA 1K2PA 3IDPA 3QYZA 4FGBA 1FVVA 3QKMA 4IWDA 4RX9A 2Z7QA 3MH0A 3VN9A 2ZV2A 4RIOA 5DT0A 5JGBA 1PMEA 2OF2A 3ZHPC 4AOTA 4QYFA 3LKMA 3NIZA 3QQUA 4GUEA 3EHAA 4FIIA 5ANJA 4EOKA 4HZRA 5C8MA 4XP3A 5TOZA 4RFYA 1GOLA 3R28A 4WUNA 3COHA 5LVPA 3G0EA 4EJNA 4IIRA 1U54A 2CGVA 3Q60A 2QKWB 5E4HA 3QLGA 5CT0A 3TNIA 2XNMA 2RFDA 2C5XA 3ZZEA 3R73A 2W17A 4ZSAA 1J1CA 4GS6A 4H39A 3ETAA 4D9TA 3KK8A 4RVMA 2X4FA 5BVFA 1QPJA 5EYKA 3EQCA 1E9HA 2OZOA 3R8UA 5AR2A 5CSVA 3UIUA 4D2PA 5E8SA 5F9EA 5HEZA 2VO7A 3KC3A 4IJPA 3ENMA 4YLLA 2GNGA 3W2SA 4ASXA 4A4LA 3VNTA 2OH0E 3MJ1A 4USDA 4F99A 3ELJA 2CNVA 3UODA 1OPLA 4BC6A 4BIEA 3P79A 3PPJA 3KULB 4BYIA 3CCNA 3UOJA 4BCGA 2XYNA 2ETMA 1UV5A 4TYGA 2ZMCA 1P14A 4JNWA 1FOTA 4QMLA 3B8RA 2Q0BA 4PPAA 2RG6A 2PVRA 4FT7A 4IWPA 4X2NA 2P2HA 3DBEA 3L9PA 4J99A 4NJDA 3EB0A 4EJ7A 4BFMA 1UU8A 2PUPA 2JFMA 3QFVA 4LGGA 4QMNA 1XBCA 2Y4IB 1PXPA 4PQNA 1XJDA 2R7BA 4W8DA 4YLKA 3W8QA 4I0RA 4KABA 3T9TA 5J95A 3AMYA 3ORXA 3R1QA 1PMUA 3RWQA 3L8SA 2YIWA 4EC9A 3QAME 5B7VA 3AT2A 3ORZA 4L45A 2GHLA 3EQHA 2X8EA 2JEDA 3AC4A 4O96A 2Z7RA 4R8QA 4U81A 5D11A 5AR3A 2BIYA 3FL4A 2WGJA 4CMTA 4QP2A 4S33A 3WARA 4ZLYA 3HMPA 3PVUA 3PP1A 3VQUA 1AGWA 4CMUA 4V04A 1AD5A 2YM3A 3QQJA 5A4TA 4CKJA 3QRUA 2X7OA 4IAIA 1YHWA 2OF4A 3BEAA 3S00A 3LXKA 2WNTA 4CT1A 2X7GA 3CY2A 2GHGA 4DLJA 3QRKA 3CQWA 3HA6A 3FWQA 2WHBA 2ZB1A 1YHSA 3PXZA 3FHIA 4LRJA 2YM5A 5HNBA 2VWUA 2PYWA 4QPAA 3FMEA 4ZTHA 4BCHA 4R3CA 5I9VA 4KRDA 3ZLSA 1Q8TA 4ZS4A 3KREA 3BGZA 5EYDA 2QOIA 1XR1A 3A60A 4MWIA 4RA4A 4A9YA 1K3AA 3EN6A 4FSZA 4FV7A 4CMOA 2QHNA 5FDPA 4R6VA 4TT7A 4I20A 3Q9WA 2J0MB 4UYNA 2IW9A 1QPDA 3E92A 2W06A 1XH5A 1FGIA 4G3GA 2IVUA 4YZ9A 3KXGA 4DGOA 3V5QA 4XH6A 3DXPA 1TVOA 1BKXA 3VJOA 5HIEA 2J0LA 2ITTA 4PTGA 4DH5A 4UMQA 2OFUA 2EB3A 3ERKA 2BFXA 3KEXA 3PXKA 1GIIA 3CPBA 4RIYA 3R2BA 4IVCA 4AW0A 3W10A 3KXXA 5AV3A 4N70A 3SW4A 4ZZMA 2R3OA 2OJFE 5DPVA 4O81A 3U51A 5AA8A 4BI1A 5A46A 4K0YA 5HLNA 3KKVA 5D10A 4JBVA 2RSVA 4EH4A 5CEMA 4KINA 5M07A 2VTMA 4GIHA 5CXHA 4F65A 3GBZA 4LV8A 2G9XA 3QHRA 3LMHA 4PMPA 3LJ0A 3O96A 2IJMA 4HNIA 4X3FA 3UYSA 4H58A 4EUUA 3AQVA 5HESA 5HTBA 4G6NA 5AJQA 3SXRA 3NUXA 4JDHA 4XEYA 3QUDA 4BGQA 5CU3A 2H8HA 4F1TA 3DTWA 3UIXA 4FG9A 1PJKA 1ZOGA 2P55A 2XKCA 2VTIA 2CGXA 3G2FA 3HMOA 4LM5A 4EZ3A 2YAAA 1V0PA 2EUFB 4BKZA 4PMMA 5CANA 4QYYA 3DK7A 3UZPA 1WVXA 4DGNA 1GZOA 3O51A 3M42A 4FKSA 3TG1A 3OHTA 4CYIA 5D9HA 5M53A 3R9RA 2Z7LA 1PXKA 3CLYA 4JQ7A 4GJ2A 3CJGA 2OXYA 4PF4A 3IGGA 4ITJA 4C3FA 5CAUA 2HYYA 3I7CA 4H1JA 3ZO2A 3ZONA 5KMJA 3KY2A 2ITXA 3I81A 4FSNA 4C38A 1H00A 4XCUA 4UZHA 4XV2A 2CLXA 3FHRA 4FOCA 3I4BA 2X2LA 5CASA 5AP5A 4OTIA 5ACBC 4ZSGA 2C6EA 5LWNA 2PU8A 4K6ZA 3RHKA 3ZFMA 2NNWB 4CQEA 3QD0A 4JR7A 2HZ4A 2OK1A 2QOLA 3G0FA 4JOAA 5HBEA 3LOKA 4Q2AA 5IQEA 2A1AB 3UVPA 2W4JA 3LW0A 3K54A 2X0GA 2X6EA 1R3CA 1YQJA 1REKA 3DZOA 4FK6A 2XBJA 4DGGA 2QOHA 4Y85A 4QO9A 5DOSA 1U5QA 4KIKB 3DXQA 2FB8A 3MVMA 2ZM4A 2W4KA 2XZSA 3C7QA 1K9AA 4EQMA 3O17A 1IAHA 5J9LA 5M06A 2J51A 4Y5HA 5DLSA 4MBJA 2RFSA 4DCAA 1OPJA 1FINA 3GP0A 3EFWA 3KRJA 4X6QC 3WZEA 2BVAA 4GH2A 3GXLA 1YI4A 2PZ5A 4K1BA 2Y4IC 4XG4A 4PPCA 3TIZA 3ACKA 3P1AA 3PG3A 5HG8A 4C4FA 5HQ0A 5CI7A 2VX1A 3NW5A 1UVRA 4O1OA 2UW3A 3LCOA 4JIKA 4IAZA 1X8BA 3KN5A 2BMCA 3WF7A 3NYOA 4YTCA 5AEPA 1YWRA 1B39A 2PWLA 3PLSA 4WO5A 4YHTA 2C30A 3F3ZA 3R02A 4GMYA 5GZ9A 2ERZE 3DQWA 5GHVA 4DGMA 4O38A 4ALUA 4ZJIA 1WFCA 4YO4A 2R64A 2Z8CA 1KV1A 4D1ZA 1BI8A 4RQKA 4IH8A 4FIJA 4IWQA 4LOPA 4MXAA 4B6LA 2J0IA 4MEDA 5B2LA 2CCHA 1M2QA 2H96A 2OIQA 2W5AA 2XIXA 2HZIA 3BLHA 3FZPA 3NZ0A 3Q04A 5FEQA 4O6LA 4EH9A 3NRMA 5BUIA 4N57A 3KRRA 4QOXA 3ZMMA 1WVYA 3LZBA 3DDQA 3MTFA 4IACA 5A4CA 3KULA 4K2RA 4NWMA 3UO6A 4RX5A 3VBWA 4Q5EA 2DUVA 4NKSA 4OTFA 5F1ZA 2OFVA 3GU7A 2YIXA 4CRLA 4EH8A 4FBXA 3ANRA 3GCSA 3Q5IA 3ALOA 3A7FA 4O21A 1ZZ2A 3BV3A 3FLNC 2GS6A 3JUHA 2FSOX 3R9DA 3P08A 1OVEA 3KN6A 4HYHA 4RJ4A 3TT0A 4CFNA 4F0GA 2P33A 4C4EA 4IXPA 4QTCA 4NCTC 2BRMA 3Q4TA 4PY1A 5FP6A 3OOMA 2CSNA 2WXVA 2IVVA 3VBVA 5J5SA 3TN8A 1SNXA 2R3QA 3KRLA 3NPCA 3SD0A 1J3HA 1LR4A 1GIJA 4FZAB 3F5PA 2ZV9A 4IWOA 5D41A 4ZLOA 2GMXA 4U7ZA 3FQHA 4IE9A 4FF8A 3CJFA 2NP8A 4YTIA 4PPBA 1PXJA 4FV3A 5C27A 4EL9A 2R3JA 5HIDA 4FUYA 3HL7A 3KU2A 4CD0A 1OPKA 4PTEA 4MX9A 2IN6A 3P78A 4DH7A 2B55A 4P5ZA 3R1YA 3IG7A 3R2YA 2HZNA 4IZ7A 2XKFA 2CMWA 1P4OA 5HHWA 4BCOA 4F6SA 4L52A 3AXWA 4LYNA 5FQDC 5ITAA 3JY0A 3WE4A 2W05A 3FLYA 2VWVA 3EQPA 4MXXA 1DM2A 1JKSA 3BPRA 5CNOA 3DKGA 3TV6A 4XG7A 4DLIA 2VX0A 4HVDA 3VS2A 4D5HA 1CTPE 3FLQA 5EM8A 3GB2A 4K11A 2VWXA 3AGMA 4F7NA 3D2IA 4WRGA 1H1RA 5EDRA 4R7BA 2VWZA 1M2PA 4D2TA 1G5SA 2R3LA 2XK9A 1UU7A 5AR4A 5CEQA 4E5BA 3BHYA 5DNRA 4I5PA 4DN5A 3G33A 4ZZOA 1YXTA 2XK7A 5A6NA 3ORMA 3IOPA 2BAJA 3OWKA 4X7QA 3FAAA 4F64A 4ZY4A 3UGCA 4J1RA 5IQIA 5J7BA 4JBQA 4G3DA 1XBBA 2FSMX 3B2WA 3VF8A 1KE9A 4IM3A 4X21A 2PHKA 2HWPA 2WTIA 2XNBA 3GCVA 3EOCA 3GC7A 4R5SA 5HE3A 3D5XA 1WBTA 4GG7A 3UO4A 3R00A 3II5A 1P2AA 3NNWA 2C6TA 1JSVA 1NVQA 5TE0A 4CCUA 5CSPA 3LFFA 2VTPA 4FTIA 4J8MA 4DFNA 1XWSA 3GT8A 3BKBA 3Q96A 4FVPA 4YP8A 3VIDA 4X3JA 3ZO1A 1ZYCA 1H8FA 3PZHA 3GOKA 5EI6A 5EYCA 4FEXA 4ZMEA 5G6VA 3OXIA 1UKIA 3RWPA 3SOCA 1DAYA 1Q8YA 2HELA 3VVHA 5FXRA 4AZSA 1ERKA 2IZTA 5EI8A 3F5XA 2RFEA 4KBKA 5M51A 3GOPA 4A9SA 4TZRA 4FVQA 4XX9A 5J7HA 3F82A 2Y7JA 2UVXA 5IEXA 4ALVA 4ZXTA 3CKWA 3NNXA 4QT1A 3ZRMA 5A54A 4FKVA 3GFEA 5KMIA 1Y6AA 1W7HA 4M66A 3D5VA 4U41A 2JDRA 4DTKA 4IFCA 5LVNA 5B2KA 2G2FA 4NM5A 5EM5A 4HJOA 4W4YA 3RMFA 3LQ3A 3NSZA 4XG9A 4CFFA 3E93A 3KA0A 4H05A 4EH7A 1CDKA 4MF1A 3PRFA 5AV1A 5CSWA 1OBGA 1MRYA 2VWBA 3RPSA 5KBQA 4ZTSA 5D1JA 3Q4CA 5IU2A 4BCFA 3TNQB 4QPSA 2UW0A 4O6EA 5BVNA 4MF0A 4G3FA 5FLFA 1R1WA 4FTJA 4J8NA 4I22A 4KWPA 4KS7A 4LMUA 1MP8A 2C69A 3A8XA 3NR9A 2PVYA 4R3PA 2HAKA 3AT3A 3MI9A 4NT4A 2GNHA 2JC6A 2VWYA 3ANQA 2OGVA 1NXKA 3CQEA 1WBPA 4YSMA 5AX3A 5AR5A 4FIGA 1NW1A 2VTRA 1OUYA 2WIPA 4IVDA 3KXMA 3RI1A 3NLBA 4G3CA 4MNFA 2JFLA 4QPMA 4B7TA 4BN1A 3AD4A 4MQ1A 3ZBFA 3LFAA 3W1FA 4AZEA 4IX3A 4F7LA 2P2IA 4L3JA 3U55A 4XG2A 3QL8A 3KXHA 1WVWA 4ERWA 2B7AA 2YACA 2VTQA 4FIHA 3S2PA 5KZIA 4BCJA 4FT9A 2W1EA 4NH1A 4B4LA 4E26A 3DFAA 1S9IA 2CKPA 3QQKA 4YUQA 5HCXA 4GT5A 1YXVA 2V7OA 4YNOA 3SVVA 2WTKB 5FTQA 5KCVA 1JKTA 1HCLA 3T8OA 4U3ZA 2F7XE 5DYJA 1YXXA 4PTCA 4AQCA 3AT4A 1L8TA 4F63A 4DTBA 3AC8A 2XM9A 2XEZA 1JNKA 1HOWA 3F69A 4ARKA 4EZ7A 4HW7A 3DS6A 2O2UA 5HNGA 2OJIA 3VS3A 5CEKA 4KNBA 2WMBA 3EN4A 1UU9A 3PA3A 3ZSGA 3A61A 5AP0A 2WPAA 1UNGA 1OITA 4FKOA 1OKYA 4IB1A 2W96B 3LFSA 4ZTMA 3OTVA 4FV8A 3QWJA 1YW2A 4U9AA 3UNJA 1H4LA 5L3AA 4BR3A 2G2IA 3AMAA 4L01A 3GI3A 4IAAA 3NCZA 3P4KA 5DEYA 4QYHA 3V8SA 3HUCA 4IVBA 3E7OA 4GT4A 3R7YA 1WBOA 3GU5A 4S32A 5IDPA 2JKQA 1DI9A 3FMKA 3DBDA 1HCKA 3NYVA 3OFMA 4QQJA 4DEIA 3NIEA 2PUNA 4CFUA 2J9MA 3R22A 4HYSA 5K3YA 2WMUA 4R3RA 4P7EA 5A4LA 5BYLA 4YC6A 1Q41A 3UO5A 4UB7A 4BHNA 4AA0A 2XNPA 4F0IA 2XK3A 4IAFA 4E5WA 3KF4A 1PYEA 1JWHA 4RPVA 2GFCA 2IO6A 3TNWA 2XRWA 2WU7A 2O3PA 5C8KA 2V62A 2CJMA 4EOQA 4O7YA 4O7SA 3IO7A 2OXDA 5HE0A 4BGHA 1IA9A 3BE9A 4FNZA 4JR3A 2REIA 1WBSA 4YPSA 4BDEA 1U5RA 5JKGA 1R39A 3EN9A 2WTJA 3L9NA 3R01A 3V51A 3FLWA 3EMGA 4Z7HA 4OBOA 2Z7SA 3OCGA 3HNGA 4GU9A 4QP8A 3ZDUA 3H30A 4E3CA 2I0YA 5AA9A 4AUAA 3JPVA 1M7QA 2IW8A 4Y95A 1YWNA 3VW6A 5JFXA 4OAUC 4CTBA 5HIBA 5CAQA 5D7AA 5L4QA 2R3PA 4ZTNA 2JDOA 1JSTA 4TNBA 4IZAA 5H3QA 2DS1A 2QR8A 3B8QA 1MQBA 3R21A 3UOHA 3QZHA 5HO7A 3BE2A 3BGPA 2DYLA 4BWXA 3CY3A 5F95A 4ENXA 2XIKA 2VV9A 3TV7A 2OJ9A 4AP7A 4RC2A 1J7UA 4FKRA 2UZBA 4D2SA 1MRUA 3D2KA 5GJFA 3Q3BA 2FSTX 1QMZA 3UG2A 5JGDA 3RM7A 3BQCA 2HZ0A 4ITHA 4EWQA 3OY1A 5DFPA 1FMKA 2JKKA 5E8VA 3HAMA 1H25A 3PWDA 4O0YA 2UZEA 3QWKA 4J95A 4D2RA 2E9OA 4GKIA 4JBPA 4MXZA 4JRNA 4CT2A 3H4JA 3OY3A 2OXXA 4K77A 4DBNA 2GSFA 4J7BA 5L8LA 4RSSA 5HORA 3BHHA 3LHJA 5CU2A 2XJ0A 3EN7A 3FI4A 4AN9A 4II5A 3E62A 4G6LA 4H3BA 5DGZA 3ZU7A 4G9CA 4QP9A 4CFXA 5CEPA 4WSYA 3F9NA 3ORNA 4O0TA 4PMTA 4EOIA 4I93A 4QMTA 5FGKA 3C50A 3R7UA 1NVSA 1WAKA 3D9VA 2ITUA 2QO7A 2VAGA 5HLPA 4AFEA 1Q3WA 2KULA 5IA0A 2UV2A 2ZDUA 5KMMA 5L2WA 3A4PA 4D28A 4U3YA 4OTPA 5DG5A 3D94A 4JL9A 4A7CA 4Q9SA 5HE2A 5ANGA 3S4QA 4RIYB 4CXAA 3VRYA 5CF6A 3Q5ZA 3QRJA 5HNIX 3MESA 4OT6A 3C0HA 3ZM4A 5ETFA 4M7IA 1STCE 4FKPA 4I6HA 4L67A 5CU6A 4PX6A 1UNLA 3K5UA 4G1WA 5ANIA 5B2MA 4E6DA 3BIZA 3HV5A 4E4LA 2ZYBA 1ZRZA 4FTKA 4MK0A 2HW6A 3UP2A 2YEXA 1MRVA 2QC6A 4D4SA 3FMMA 3FPMA 2J0JA 1OECA 4KSPA 3BCEA 4FZFB 3UIMA 2VO6A 4A9RA 5E8XA 3UOLA 5TR6A 3A2CA 1O9UA 1BUHA 3UBDA 4CKIA 3NW6A 3TUBA 4IQ6A 2C5VA 3BHUA 1GZNA 2C1AA 3HYHA 5DR9A 4WA9A 5J9YA 1F3MC 4GVAA 5H9BA 4HGTA 5BYYA 3PLAE 2GHMA 3QTQA 5E1EA 3U4UA 4AU8A 4APPA 3F3UA 3ZEWA 1XBAA 1ZYDA 3KCKA 4FL3A 4K33A 5CI6A 4EEVA 1ZMUA 4YSJA 2I0HA 4RMZA 3RHXA 3ZLXA 3MH3A 4D0XA 3HX4A 1W8CA 3OUNB 1NVRA 3CC6A 5BVOA 3TV4A 5AUTA 2I1MA 2X2KA 3Q9YA 5E7RA 5EYMA 5JK3A 4LGHA 3K3JA 2VN9A 3G90X 3D4QA 1SYKA 3R1NA 2E2BA 3DLSA 3F7ZA 2W1FA 2GNIA 4LI5A 4XBRA 4AZWA 4RJ7A 3FZOA 5HLWA 2YWPA 1YOLA 3L8VA 2YFXA 3CTJA 4F08A 4I4FA 3PXYA 2WMRA 2CPKE 2UZNA 4EOJA 5CTPA 3U54A 4RJ8A 3GUBA 4Q9ZA 2BHHA 3FBVA 2HXLA 3V01A 2VRXA 3HDMA 3NGAA 3QD2B 4FT5A 2XIRA 1IEPA 2WO6A 2B9HA 2WU6A 4O0VA 5DT3A 5IA3A 1UU3A 4C58A 3U8WA 2XKEA 4FSMA 3OP5A 3CPCA 4ZK5A 3BLRA 2JD5A 4WKQA 3DTCA 4JRVA 4OTHA 4ZJJA 3WF6A 4FT3A 2B9JA 3PXFA 2QOCA 4GV1A 5I4NA 4DEDA 5FBNC 1OKVA 4NUSA 3S95A 3U6HA 4FICA 2JIVA 4U42A 2C6LA 5J1VA 2CHLA 1YI6A 3SG9A 3EKNA 3MV5A 4TYJA 4C4IA 4U0IA 3QXOA 1J91A 5EDPA 4YMJA 4ITIA 2VTNA 3GQIA 2G15A 3VBXA 4U97A 2PVKA 2R5TA 3FC1X 5G1XA 3PE1A 4O2ZA 1G8AA 2PVJA 4S30A 2QU6A 1XH6A 3NX8A 3QRIA 4FYNA 5AIRA 4I0TA 5LOHA 2A27A 2YLFA 3F6XA 4RBLA 4FV0A 4HOKA 5KMOA 2ONLC 3QX2A 5AADA 2ITOA 3HV6A 3PIYA 5BPYA 1RW8A 2WMTA 4EKLA 1OKZA 4EK8A 4KA3A 2C3IB 5I5ZA 1U59A 3MW1A 3R8PA 2YZLA 3UC4A 3VS4A 2BCJA 3MA3A 5AUVA 4AA4A 3BWFA 5CVFA 4AW5A 4GFOA 4RWJA 5ANDA 2CGUA 3MFUA 2WZJA 3PVBA 4FNXA 1RE8A 3HKOA 3Q53A 4OAVB 3FZTA 1ZARA 3NAXA 2XM8A 2B1PA 4WG5A 3ORKA 1E1VA 3RAKA 4UZDA 4DEAA 3ZCLA 4ASEA 4AZVA 4DF3A 3UPXA 3F2RA 2WD1A 1Y57A 2AYPA 4XOZA 4G2FA 4HCVA 5HBJA 3FLZA 2WB8A 3WI6A 2PK9A 3DT1A 5K4JA 3F88A 4A9UA 5EK7A 1W84A 4FC0A 4FEVA 4FKJA 1Z5MA 4O7LA 5L2IA 1H07A 4PL3A 2ZMDA 4GUBA 5EH0A 4ACDA 4YJPA 5IMEA 4FG7A 4BDIA 3ZC5A 1JOWB 2IW6A 3DAJA 5TKDA 1OL5A 4C2WA 4NJ3A 3R9NA 3D15A 3TJDA 3ALNA 2UZLA 3KVXA 2JBOA 2R3GA 3QTXA 4LOOA 2BKZA 4FTMA 2BZIB 3A62A 1SVEA 4M69B 2XF0A 3AMBA 2Z02A 3QQHA 2Y8OA 5M55A 4EH3A 3I0OA 4BIBA 5KNJA 4FNYA 3R71A 4GK4A 5HKMA 3L1SA 4E4NA 2PVMA 5FG8A 2I0VA 2WEIA 4EQUA 2A2AA 3LFDA 2PZRA 4QQ5A 3ORIA 2BIKB 5FWKK 4YO6A 2W1ZA 3R83A 5M57A 2AC3A 2XK4A 2I0EA 2XIYA 2R0IA 2HENA 3MA6A 3MFTA 3QQGA 4L44A 3RJCA 4AGUA 4ANMA 3BX5A 3CTHA 1R0PA 4QTEA 4BCIA 3LLTA 2QOKA 2ETRA 5DI1A 2XNGA 4AE6A 3UNZA 1H26A 2EU9A 3SV0A 3V5WA 2YCSA 1UWHA 4CKRA 5H2UA 5LCJA 4C62A 1YDRE 1H1WA 3Q52A 3SDJA 1I09A 4IAYA 4EZ5A 2X6DA 2C6OA 5IH4A 4OBQA 3QF9A 4GEOA 4IDTA 3ZC6A 5CAPA 4FSQA 3U87A 1W0XC 3C51A 3EYGA 1OBDA 1GIHA 4U80A 4A4XA 2OH4A 4HVIA 2BPMA 5GJGA 3RNYA 4EOOA 2VTHA 3OG7A 3QUPA 4NFNA 3V6SA 3VUIA 4TWOA 4ASZA 2O64A 3BLQA 3UVQA 5EQPA 4UEUA 3VO3A 5AM7A 2RG5A 1JSUA 2UW6A 4CZUA 5IA2A 2UVZA 4E73A 2WAJA 4PNIA 3F61A 4UXLA 4EOLA 4I0SA 4WT6A 1FVTA 3LQ5A 4LQMA 5EQEA 3NYXA 3BYUA 3KFAA 4RIWB 3LMIA 3VWAA 5EQYA 3DGKA 3E64A 5F4NA 4F9BA 4O0WA 2VTTA 3DOGA 5FXSA 2W99B 1JKKA 2Y0AA 3MS9A 4MTAA 2IVTA 2YCFA 3FPQA 3HMIA 1WBVA 4BCNA 4YZBA 4JS8A 4JIAA 5BNJA 3F3VA 3NAYA 3QBNA 5M4IA 3G15A 4DFLA 3POOA 2VTAA 1YOMA 5JZJA 5KKRB 3QGYA 4QD6A 5AUUA 1YRPA 3QU0A 5FD2A 3JY9A 4DT8A 5KZ0A 3QCYA 4EHEA 4MKCA 3BRBA 5EKOA 4O0RA 4R7HA 1OZ1A 3IPHA 3UQFA 1FPUA 4TYHB 4FKTA 5A4EA 3ZO3A 1E1XA 2V0DA 2C5NA 2QCSA 5F20A 3JXWA 5I9XA 3QQLA 3GFWA 4YC8A 4B0GA 5KBRA 1UKHA 3CQUA 3V3VA 3QCXA 2C6MA 2F4JA 4FTNA 3QTRA 4ZEGA 4O7NA 5E8UA 2WQEA 3VUTA 3IECA 3FKLA 3RK7A 4AGWA 5IH6A 1Q99A 4CLJA 2CN5A 4MVFA 3C4CA 5BVDA 1IA8A 1VJYA 1Y6BA 4GFMA 4D1XA 4QMQA 4DHFA 3W33A 3DJ6A 4QQCA 4C59A 3ZH8A 3TDVA 1YXSA 5AUWA 4CGAA 3QC4A 2ETKA 3DK6A 3HRCA 4RA5A 4XP0A 3GEQA 1JVPP 2NRYA 3OTUA 2G2HA 5CSHA 4A07A 5EKNA 5KMLA 2PULA 1L3RE 4RG0A 5J9ZA 4GIIA 1BI7A 4DH1A 4YGAA 5K5NA 4I6QA 3C9WA 1H27A 2R3IA 3LIJA 4RVLA 1YKRA 1DS5A 4LG4A 4JAIA 2QKRA 3EQFA 3R6XA 4OBPA 3SRVB 3UE4A 4ZSLA 4PP9A 2ZDTA 4P4CA 3C4WA 4ZS0A 2ZM3A 3EZVA 3DQXA 3DAKA 3I60A 5FEEA 2ITWA 3PG1A 3DA6A 4M3QA 4QMYA 2C3LA 2XB7A 4AZTA 5AUZA 1ZYJA 3PJ1A 4C8BA 3DNEA 3QZIA 4CQGA 2FSLX 4OTGA 2QO9A 4FOBA 4KS8A 4WHZA 3DKCA 3RAIA 4FSRA 3OUKA 4C3RA 4DG2E 2CN8A 4D9UA 3DB6A 4MXYA 2C0IA 5EW8A 4FV5A 3BI6A 4AT4A 1OIUA 3VC4A 1KE7A 2WQBA 4O27B 4U45A 4EK3A 2I40A 4CEGA 2Y6OA 2BROA 1Y8YA 3N4UA 2EVAA 2YLEA 2PVLA 2ZV8A 3QLFA 5L6OA 3SAYA 4Z16A 2X2MA 3FJQE 5FRIA 3A4OX 4U79A 3DAEA 3QKKA 4DFZE 4EHVA 3W55A 2ZOQA 4UMUA 5BQ0A 4L3PA 5CF4A 4WRSA 4BDHA 4G6OA 4BZNA 3BEGA 3FI8A 4GSBA 2EXEA 4E7WA 1ZXEA 2I7QA 3VAPA 2HK5A 3EQDA 3DB8A 3EJ1A 3TZMA 5JGAA 3OD6X 4PMSA 3PA5A 1R78A 5JRSA 1FVRA 2VTLA 3ZBXA 4BKYA 2ACXA 4CYJA 4Z55A 4EHZA 3QYWA 2PZPA 4GYGA 4TRLA 5IKWA 3PY0A 4OLIA 3KMWA 3G51A 4W4VA 3WYYA 4UMRA 4G9RA 3R63A 2OIBA 1CKPA 4BGGA 4QMUA 4U8ZA 3EQRA 3PZEA 4TY1A 3REPA 4LMNA 5M08A 4KKHA 3C4FA 3PIZA 5HG9A 4TL0A 4FZ6A 5IQBA 2P0CA 3UJGA 3W2CA 4UMPA 2GNFA 2QODA 2XK6A 1FMOE 4D4YA 4TYIA 2JDTA 4XG3A 4XV1A 4AE9A 5DRDA 4QNAA 5L2QA 2J2IB 4WNOA 4BWKA 3SGCA 5AFVA 5IUIA 3ACJA 5KMNA 4G34A 1PKDA 5E91A 4KB8A 2JIIA 4FUXA 4RIXB 4E1ZA 1YXUA 4RJ6A 3ZO4A 4C37A 2Y9QA 3KRWA 4FZ7A 2X9FA 2UZTA 2ZV7A 4BCKA 2QD9A 3N4TA 1EH4A 2X81A 5JZNA 2BRGA 4XS2A 4C57A 3DXNA 4G3EA 2DQ7X 3TZ9A 2IWIA 4NZWB 2HIWA 1IAJA 4AS0A 5IH5A 5DWRA 4V05A 2UW9A 4PDPA 3QHWA 4W4XA 2J7TA 2YCRA 4CSVA 1NY3A 1S9JA 2OU7A 2W1IA 3HLLA 5AV2A 4EK4A 4ID7A 3V8TA 2WTKC 4JDIA 4ZP5A 4JDKA 3Q9XA 1PXOA 4XLVA 4FTUA 3RK9A 5C03A 4GCJA 3OCBA 4QMSA 1BMKA 4TTHB 2JDVA 4TNDA 3UVRA 4DYMA 2SRCA 2IVSA 4LRMA 1QCFA 4C33A 5JEBA 2XK8A 4UBAA 4O84A 2YIQA 2WTCA 2PZIA 4D58A 2XJ1A 2BRHA 2R3HA 2J50A 3O0GA 3CR0A 1M52A 4UXQA 3Q9ZA 4V0GA 4NSTA 4QP1A 1CMKE 2PZYA 3P7CA 1I44A 2C68A 2X1NA 2XNOA 4M0YA 5GJDA 4UX9A 4WNPA 5AUXA 1YWVA 3G5DA 3GC9A 4BI2A 3Q4ZA 4D0WA 4I24A 4R78A 3BBWA 3C13A 4GRBA 4IEBA 4RX8A 3NDMA 3UG1A 3O7LB 3W2QA 4BZOA 3PY3A 5IMXA 5BVWA 4FTCA 4O0XA 2UUEA 2W1CA 4XG8A 4ANQA 1ZZLA 5HBHA 5LCKA 4I3ZA 3GC0A 3DFCB 4D4VA 4E6QA 1DI8A 1TQPA 3W2OA 3HZTA 2C3JA 1BYGA 2RGPA 4HGLA 3EL8A 1M17A 5LVMA 1WCCA 2VTSA 4IB3A 5E8WA 4QMOA 5IG1A 3IW8A 2R3RA 3ORTA 3AD5A 5IA5A 4ALWA 5DN3A 4DEEA 3OCTA 4GJ3A 5C8NA 4JBOA 5CF5A 3MB7A 2V5QA 1Y8GA 2BDJA 1JAMA 2X39A 4RIWA 4YJVA 5DT4A 3FL5A 1OI9A 4DA5A 3I7BA 3ZZWA 4AW2A 4BDFA 5K0XA 5ANEA 5C01A 4X2GA 4BDJA 4LL5A 2BUJA 1Q97A 1OMWA 3TUCA 4Y5QA 5BMSA 2PUIA 2YCQA 4G17A 3GC8A 4KD1A 1T45A 2NRUA 4AW1A 1PXMA 3PSCA 5KE0A 4NK9A 1PF8A 2W1GA 3ORLA 3D5UA 4KIQA 2PE0A 3C4EA 3O2MA 3O71A 4PNKA 5EHYA 3UC3A 4FYOA 1CM8A 3MTLA 4YTHA 4YHJA 3GENA 4FV6A 2W5BA 2PTKA 4FA2A 4Y72A 4RRVA 3M1SA 1VR2A 3L8PA 2OW3A 3LPBA 2R3NA 2H34A 5HE1A 4QTBA 5KMKA 4M84A 2R4BA 4JI9A 4LV5A 3PE2A 3GCUA 2FGIA 3EN5A 3FC2A 2H6DA 5BUJA 2WEVA 3BV2A 3MSSA 1V0BA 4TKSA 3FYKX 2UW7A 3OXZA 4ZY6A 2ZM1A 4FV2A 2ZAZA 3E8EA 3VUDA 5L2SA 3TZ8A 2C1BA 3DNDA 5EW9A 5J79A 3ZFYA 2Y6MA 2XRUA 4IC7A 2QR7A 1Q8UA 2ONLA 4S31A 2X8IA 3R7IA 1Q24A 5M44A 3EFKA 3P86A 3TJCA 3BHTA 3MB6A 4BYJA 4O7TA 4O0UA 2HY0A 4YJRA 3P7BA 2E9UA 3A8WA 3T3UA 4F6WA 3V04A 3NNVA 3EWHA 3QQFA 3FMDA 4IBMA 4M69A 5IQDA 3PJ3A 4HYUA 4IVAA 1GJOA 2ITZA 2X8DA 4M8TA 4JG7A 4MXCA 4YJSA 4D5KA 2C6DA 2WFYA 2PY3A 3ZRLA 1XH4A 4C4JA 4IADA 2XYUA 4D1SA 2BILB 3UZTA 3UTOA 3TZ7A 2CNUA 3Q6WA 4EHGA 4O83A 3B2TA 2VO3A 5IUGA 3PUPA 2WQOA 1ZY5A 4EH5A 4ACGA 3TL8A 2YITA 3LFCA 2WMSA 3KK9A 4H1MA 3U9CA 3G9NA 4E4XA 4EI4A 3LFEA 4FZDB 4ENYA 3SC1A 4FTRA 1CSNA 2YIRA 4M14A 5AWMA 1URCA 4D4RA 3NVMB 5DH3A 3MFRA 2F2CB 3IW5A 1SMHA 4G16A 3P7AA 3RVGA 4X6RA 3O23A 1JLUE 4M0ZA 3JS2A 4KSQA 4RIXA 4BBMA 4HGEA 4EK5A 1KSWA 4L3LA 3PYYA 4L7SA 2GS7A 2UZOA 1VYZA 4GK3A 2GS2A 3ODZX 1TQMA 5JQ8A 5FM3A 3DZQA 4XJ0A 4OTQA 5CZHA 5CF8A 4JJRA 4C7TA 3QGWA 2OICA 2W9ZB 3F5UA 2WOUA 4K9YA 4FGRA 4X2FA 3UNKA 5C4KA 1Y91A 4ANSA 2IPXA 3V5LA 4UALA 5I9WA 5EDQA 1YDSE 3COMA 3UIBA 5LMKC 3FDNA 5K4IA 2O8YA 3NUUA 1GZKA 4YBKA 3GNIB 2HY81 3MFSA 5GZAA 2GU8A 4YR8A 3FZRA 2BRBA 3ID6C 5CLPA 2UW4A 4CFMA 3EFLA 3RINA 3R9HA 3F66A 3TKHA 4QMMA 4RQVA 3L9LA 2YDIA 2ZB0A 4LOQA 3LLAA 4ZLZA 3QD4A 3SLSA 1APME 2VGPA 3FSKA 4NW5A 3NEWA 3E8NA 1REJA 2KTYA 3FE3A 2ERKA 4MAOA 4Q5HA 2QOOA 1PRYA 2QOQA 3DV3A 3F2NA 1GNGA 3EFJA 4FL1A 5LMKA 4FT0A 3VS1A 3AOXA 5M4UA 3AC5A 3MIYA 1W98A 1VYWA 5FM2A 5CNNA 2BZJA 3MJ2A 1XQZA 3IGOA 4W9XA 4I5CA 1U46A 1PKGA 5BVKA 4H3QA 4IX5A 5FDXA 3ZLWA 3O8TA 3VULA 3L8XA 3AGLA 5E92A 1ND4A 3I5NA 3TM0A 4AFJA 3QTSA 4DG0E 2QU5A 5M4CA 3W16A 3H0YA 2B9IA 4JX7A 4WD5A 4JX3A 3ZS5A 4FK3A 3HGKA 3PA4A 4FKGA 3RM6A 4AF3A 4ANOA 3H9OA 2BAQA 3MYGA 4C2VA 5LQFA 4TYHA 4L6QA 3ZUVA 4O7WA 4ANBA 3ITZA 2QVSE 2C47A 1JPAA 2PSQA 3WZKA 3ZEPA 5I3OA 3D5WA 4BKJA 2WTDA 4ZIMA 3R8MA 2UW8A 4BHZA 3CTQA 5L8JA 4RWKA 5E1SA 3FQSA 2VNWA 3EKKA 4L43A 2QHMA 4FIEA 1QPCA 4TYEA 3OWLA 1H08A 2FYSA 2YAKA 3G6GA 1YDTE 5J87A 3ROCA 5DR2A 2E9NA 3UMWA 4I5MA 5LJJA 2GQRA 3HDNA 3NUNA 3MY1A 3GU6A 1T46A 4FMQA 4L42A 4NIFA 3TKIA 4OUCA 5CENA 4EKKA 3C0GA 2W1DA 4EK6A 4FX3A 2OWBA 4I6BA 4XMOA 3ZLYA 2P4IA 3DLZA 1Q61A 3PY1A 4EC8A 3IW6A 4O7ZA 4N4SA 3IOKA 4AG8A 2JGZA 1M7NA 1GAGA 1A48A 3PVGA 4P90A 5H8EA 2C6IA 3GVUA 3LCKA 3HV7A 4FTTA 2C0OA 5DEWA 3E88A 4BBEA 2F49A 1VZOA 4AT3A 2ITQA 3KGAA 2VZ6A 4OGRA 4ACCA 1SNUA 3Q6UA 4BTJA 2IZRA 1OL6A 4G5JA 2X9EA 2WMVA 2Q83A 3EZRA 3LCSA 3U4WA 2YN8A 2YM7A 4PRJA 2J6MA 4XUFA 2YDKA 2BRNA 4FSYA 1Q5KA 5E8ZA 2BZKB 4PL4A 5AP7A 2XMYA 4TXCA 5HTCA 3PSBA 3LJ2A 4GVJA 3MPAA 3ZXTA 3FUPA 5CVGA 4ANLA 2QO2A 2W9FB 3A7JA 3HVCA 4DEGA 3OROA 4MWHA 3HV4A 4BZDA 3D14A 3VHEA 3LFQA 3WF5A 3QA0A 4FKQA 3ZUTA 2B4SB 2PMNX 4V0GB 1WBWA 3RTPA 5L6WL 1F5QA 2H9VA 5AR8A 4ORKA 3JVSA 4WUAA 3VQHA 4BDKA 2PVFA 4O86A 1QL6A 1VEBA 2X7FA 4MYGA 3DDPA 5AP1A 3VUKA 5AAFA 3UOKA 3HAVA 4K18A 4O2PA 4YZMA 5K0KA 3QXPA 2O65A 4ZMFA 2R2PA 3MVHA 3K5VA 4QMPA 4A4OA 3WIGA 2PPQA 2OI4X 5FUTA 4F70A 4U40A 2GPHA 2CGWA 3S1HA 4IAKA 4BVUA 2OJJA 1PMNA 4IHPA 4RWIA 2R0UA 3OBGA 3DY7A 3M2WA 5J5TA 4C4HA 4USFA 4CVAA 2BTSA 3LFNA 4ACHA 3QCSA 4X3FC 4FKLA 3V5PA 2R3MA 2XNNA 4O7VA 4O91A 5AV4A 3WF9A 3NCGA 2ZJWA 4IB5A 1RQQA
chains in the Genus database with same CATH superfamily
3JYAA 1P5EA 4WOVA 3FMNA 3QTIA 5H8BA 1A06A 5EM7A 5ETAA 3IK3A 1CKJA 4BB4A 3RAWA 5JFSA 4DCEA 3CD8A 5E8YA 4DT9A 2VTOA 1SVGA 4I21A 3TUDA 4I4EA 2VGOA 1OB3A 4AN2A 2Q0NA 4KBCA 4UMTA 3V6RA 1MQ4A 1W82A 5EOBA 4HYIA 2RIOA 4NL0A 3Q4UA 1J1BA 4PDYA 3E87A 2WMXA 3OCSA 3UQGA 3U6JA 2FH9A 4PUZA 3T3VA 5IUHA 2UZUE 4PWNA 3ZSIA 3I5ZA 3JVRA 3ET7A 1YOJA 2C6KA 3T9IA 2C4GA 5CQWA 4I1ZA 4CCBA 5A9UA 3TMOA 1WZYA 2YISA 4UYAA 3QUEA 4QYEA 4RVKA 4RZWA 3VBTA 3PWYA 3ZXZA 3D83A 4EH2A 4AGCA 2WQMA 4O4EA 4E4MA 3PSDA 2O63A 4KIPA 4XBUA 3H9FA 1XH7A 3IW4A 4DEBA 2LGCA 5K9IA 4M13A 2WQNA 3R1SA 3R30A 5IEVA 1LUFA 4IW0A 3DU8A 5AP4A 3A7IA 3RGFA 2W1HA 3JR1A 2R3KA 2VO0A 2BAKA 4RJ5A 3PUFC 4APCA 5CQUA 5HOAA 5DIAA 1Q8WA 1W2FA 2BDWA 1O6YA 5CX9A 4BCPA 1FBNA 4YU2A 2OJGA 4DFYA 1RJBA 5CWZA 2QOFA 2JAMA 3Q32A 1XO2B 5KX8A 4RFMA 2Z60A 4JG6A 5AV0A 1V1KA 2XCHA 4DTAA 2CLQA 5LARA 3AC3A 2DWBA 4V01A 5HO8A 4C61A 4FTOA 1OM1A 1V0OA 2PVNA 4XRLA 1XMMA 4MH7A 3UQCA 2PE2A 4FE2A 2XVDA 3OXTA 2B53A 4QP3A 5GNKA 3VS7A 3VUMA 1O6LA 3WF8A 5HD4A 4YJOA 4FRFA 2VWWA 4IM0A 2YERA 3BLAA 1UNHA 1KUTA 3MIAA 3SXFA 3QZGA 5EHOA 4P5QA 4F9YA 5CSXA 4PDSA 3QTWA 2AQXA 2JKMA 3VRZA 2QOBA 3QTUA 3LQ8A 4IZ5A 4L7FA 4QMXA 3RP9A 3C0IA 4O0SA 5L6PA 4C3PA 4LUDA 5AIKA 4YHFA 3CE3A 3HV3A 1PXLA 1UWJA 4NEUA 4YJUA 4HVGA 3ZUUA 4FR4A 2CNQA 4NKAA 4L8MA 4RWLA 1ZYSA 4I6FA 4F9AA 3N4VA 1OIQA 1ZYLA 4ZJVA 4FIFA 1O6KA 4LUEA 5CAVA 2B0QA 4O82A 3NMUF 3CSVA 5JH6A 5LMAA 4IMYA 3PJ2A 3LM5A 4B8LA 5HX6A 1NT2A 3QX4A 4HZSA 3LCTA 4EONA 2P3GX 2JITA 1KOBA 4GYIA 4EQCA 3NUSA 3A7GA 3UMXA 4NM3A 4QYGA 2WMQA 4TN6A 4DFXE 5LVOA 3PP0A 3I6UA 2BHEA 3LXNA 1PMVA 4K8AA 3LFBA 1H0WA 4JDJA 3SRVA 2XP2A 1G8SA 5CU4A 3ZFXA 3PTGA 1BLXA 1YVJA 2W5HA 2ITPA 5TF9A 3P23A 2GFSA 3UDTA 5KUPA 2A19B 3I6WA 4F0FA 4BF2A 3CGFA 4DITA 4XHKB 4CRSA 3A7HA 5LMBA 4FV9A 3I0QA 4CLIA 2EWAA 2VUWA 4PDOA 4XV9A 5EM6A 3RNIA 3FI3A 2IZUA 3GU8A 3HP5A 4RFZA 3SW7A 4C4GA 2GNLA 3F3WA 5IQHA 3F2AA 3AC2A 2JIUA 3KRXA 3VS0A 3FMLA 3IONA 4X2KA 4UWBA 3F3TA 3E3BX 1LPUA 2G1TA 2J5EA 4OT5A 3H10A 3E63A 3PRIA 3SQQA 4AOJA 4PP7A 1XHAA 4QEBA 1OL2A 3FSFA 2WTVA 1H28A 2WTWA 4L53A 5CU0A 4L00A 3RCDA 2W7XA 2JKOA 2XEYA 4DGLC 3PJ8A 1ZLTA 4J96A 4OTDA 3O50A 3H3CA 4UV0A 4IJ9A 3LVPA 3VJNA 3K2LA 4C34A 1H1SA 2FUMA 1H24A 4BL1A 5CYIA 2CKEA 1G8JA 4NW6A 3O7LD 3HEGA 5BYZA 4DH3A 3EH9A 4EBWA 5M56A 4UWCA 3NS9A 4MD8E 1IASA 1ZOEA 1GZ8A 2F2UA 2GTMA 5A3XA 4RJ3A 4E8AA 1BL6A 5ETCA 4EORA 2BKKA 1PYXA 3ULIA 3VUHA 4EOSA 5IISA 4QQTA 3HRFA 4HCUA 3D7ZA 3MWUA 2XJ2A 1ZY4A 1WBNA 4FV1A 4MD9E 4XP2A 3R9OA 2YHVA 4DFUA 4FSTA 4TPTA 4O1PA 4S34A 5D7VA 4BCMA 3I79A 3GU4A 3HA8A 3QD3A 5CZIA 3FKOA 5CEOA 2EXCX 1UA2A 3KXNA 4QMWA 4X3FB 3VONA 3TIYA 3FMJA 4E6CA 1URWA 4ONAA 5ETIA 4DC2A 5GZ8A 5CALA 2NPQA 3P0MA 4NFMA 5FEDA 2ITVA 3DBQA 3PXQA 3DJ7A 3POZA 4J53A 4XV3A 5DMZA 3HMMA 4XRJA 3H9RA 4P2KA 1M14A 1J7IA 3UPZA 4BICA 1PHKA 3OF0A 3OW3A 5ICPA 4AAAA 3EQIA 5BMMA 4F4PA 3BYMA 4F7JA 5BX0A 3PFQA 4BCQA 4RVTA 2HCKA 5I9UA 2I6LA 5AX9A 4CFWA 2XANA 3MY5A 4AACA 4FEQA 4FKUA 3WILA 5I0BA 4EOPA 4XOYA 4MBLA 3WYXA 4TWNA 2YM6A 2QQ7A 1LEWA 3ZYAA 2W0JA 4W4WA 5A6OA 1LEZA 3EQGA 4J52A 1ZOHA 4MCVA 3Q2MA 3IDCA 3RPOA 4BDAA 3M11A 2W4OA 5IEYA 4FEWA 4FG8A 3TDWA 3FXXA 3HRBA 3GQLA 4YZDA 3IW7A 3BYSA 3V5JA 2J5FA 4KKEA 4BRXA 4CZTA 4E20A 5HCYA 4TW9A 3LE6A 5HU3A 3MDYA 5M09A 2QI8A 2G01A 1ZWSA 1JKLA 5EI2A 3KVWA 2X0OA 2XAOA 4YNEA 4KBAA 3ZSHA 5A14A 5ANOA 5HVJA 5HO6A 2QG5A 3CEKA 3OW4A 4GW8A 5T6KA 2XALA 4TWCA 2QNJA 3O8PA 4GT3A 5DBXA 3S0OA 1Q3DA 4I5HA 5AUYA 4LRKA 5BUEA 3EL7A 4F7SA 4DE4A 2PMLX 5BVEA 4MNEA 3ORPA 4F09A 1QPEA 4IX4A 1OUKA 4QDVA 4DHIB 1SM2A 2EXMA 3O8UA 3RBWA 4C0TA 2VD5A 4GK2A 4ZSJA 4AGDA 4E6AA 2XCKA 4E5AX 4LGDA 2R9SA 3MPMA 2YZAA 2XS0A 4RC4A 2LAVA 3DBCA 3COKA 4FTQA 2PVHA 2YA9A 4KAOA 4KKGA 3TCPA 4HVHA 5IA4A 3D7TA 4YJQA 3SHEA 3TNHA 5JSMA 5GIPE 3PIXA 3EYHA 1OGUA 2OG8A 4BY9E 4CV9A 3UZRA 4JMQA 4MQ2A 4FTLA 5DHJA 4FNWA 4DEHA 2C0TA 4XG6A 5HCZA 2CKOA 4IANA 2OLCA 3BWJA 1YHVA 1WMKA 1CKIA 4ZOGA 4NIFB 3FY0A 3RPYA 2FO0A 3E5AA 4WBOA 4AXCA 2BR1A 3OEZA 4FL2A 4J71A 4WSQA 3CP9A 4N6ZA 3QALE 5CVHA 3WZUA 3OT3A 5CY3A 2B9FA 3L9MA 3OBJA 2YDJA 4MHAA 4AOIA 2V55A 2GTNA 4ACMA 3OEFX 2QLQA 2XIZA 3AG9A 3V5TA 3TKUA 2RKUA 4RLLA 1ATPE 3HMNA 5AR7A 3RZBA 2AC5A 1NA7A 4OTRA 4HNFA 4X2JA 4AX8A 4USEA 3VBQA 2HWOA 2CKQA 4CG9A 2RFNA 3FY2A 3NUYA 4I23A 3U9NA 3WZDA 2ESMA 1OIRA 4NM0A 4OTWA 5I3RA 4IB0A 3QA8A 4NTSA 5IZFA 4IZYA 4YLJA 4YURA 3PXRA 2WIHA 5EW3A 3FQEA 5JQ5A 3W2PA 1KE8A 4W9WA 3TWJA 1IRKA 2J0KA 3P9JA 4XYFA 1JBPE 5JFVA 5JT2A 5IPJA 4D2VA 1U54B 5HG7A 4C36A 4ZY5A 3FLSA 4F1MA 5IDNA 4DFBA 2UZDA 3HUBA 5JN2A 2GQSA 4YZCA 4L46A 1SVHA 2V7AA 2PUUA 3P5KA 4U43A 3HP2A 2FVDA 4N0SA 4AT5A 4BWPA 4Z7GA 3OS3A 5AM6A 5GIOE 5CS6A 5DR6A 3VS5A 2JLDA 2QURA 3OZ6A 4AZFA 2F7ZE 3DKOA 5AMNA 3WZJA 2YWVA 2PMOX 2UZVA 2HOGA 5KO1A 4GFGA 4F6UA 2J90A 4JXFA 3OWPA 3MN3A 2AUHA 5H8GA 2YM4A 2CCIA 2J4ZA 5ANKA 4EH6A 4FSWA 5HICA 3W2RA 3U6IA 3KB7A 3MH1A 2WMWA 3MVLA 4NCTA 4F9WA 3ML1A 3VF9A 4Y8DA 3ZDIA 3NUAA 4D55A 5IQCA 2ITNA 1BX6A 4FKIA 4NM7A 2HXQA 4KIKA 4RT7A 3A99A 3BHVA 4D2WA 5CXZA 1KV2A 3ATTA 3WE8A 2XH5A 2BTRA 1OL7A 3ZRKA 5IF1A 5DA3A 3CGOA 4JLCA 3GCPA 1XKKA 1R0EA 3F5GA 2OZAA 4WNKA 3VW8A 4N6YA 3KMUA 4TWPA 4EYMA 4ZSEA 4CFVA 2ITYA 4J97A 1GY3A 4HCTA 3VBYA 5LWMA 5FTOA 3RKBA 2YIYA 4M68A 1XH9A 3OWJA 4ZTLA 1M2RA 3AD6A 5L8KA 3OOGA 5HZNA 4R5YA 5AP6A 3NUPA 5C26A 4YJTA 3K3IA 5B0XA 4KRCA 3UP7A 3E3PA 1FQ1B 2WKMA 5E90A 4O7RA 3G6HA 3FI2A 1DAWA 3N51A 3I1AA 5EFQA 2JDSA 2JAVA 2GNJA 2B52A 3LXLA 1PW2A 3IS5A 3TI1A 3R8ZA 5LXMA 3SKCA 3BU3A 4A9TA 4L68A 4Z9LA 3PPKA 5CT7A 2RF9A 2BDFA 1OL1A 4I41A 4YPDA 4ZTRA 2E9VA 5KKRC 3OVVA 4ASDA 4O22A 4LFIA 2QONA 4GG5A 5HI2A 1U4DA 4EWHA 5E9EA 4BI0A 5J8IA 4BTFA 4AWIA 5HD7A 4KIOA 5FXQA 4AXDA 4CG8A 1OIYA 3IDBA 3G9LX 1ZMWA 4UWYA 3ODYX 4BIDA 3SA0A 3ZTXA 4G31A 3SXSA 4CNHA 4DAWA 2OKRA 3FXWA 5ACKA 4HVSA 3C5IA 4J98A 2VWIA 2QG7A 4U44A 5FBOA 4JVGA 4QTAA 3F7WA 4RC3A 3TNPC 5L2TA 3PDTA 2OIDA 2R7IA 4FODA 5E8TA 5DVRA 3RCJA 4QP4A 3ATSA 3TACA 3LMGA 4F1OA 1KWPA 4NU1A 2C3KA 1MUOA 2GCDA 3RPVA 4ZZNA 5KHWA 5I9YA 3CS9A 5IQGA 4BTMA 3NW7A 2C5OA 3NYNA 5C1QB 3NFFB 3ULZA 1JQHA 4FSUA 2VU3A 2YJSA 4UY9A 2F9GA 4QMZA 3NWWA 5AP2A 3RALA 4DHJA 1A9UA 1H0VA 3ENHA 3PJCA 2QLUA 4QNYA 4RGJA 4Y83A 5T3QA 3C5UA 3N9XA 4QP7A 1H1PA 1RDQE 4DG3E 2F7EE 3PVWA 2C5YA 2RL5A 5FP5A 3RK5A 4AA5A 3E8DA 1BL7A 3BQRA 3DBFA 3FXZA 3KXZA 4BDDA 2PE1A 1ZMVA 4YTFA 5D12A 4JG8A 3OC1A 4DINA 4RX7A 5IQFA 3LAUA 3QRTA 4HPUE 3BZ3A 3FMHA 3H0ZA 3R7OA 4S2ZA 5AAGA 5HG5A 2O5KA 3KMMA 4ZAUA 5EOLA 3DJ5A 1SZMA 3PPZA 1OKWA 4EOMA 3CBLA 1H01A 4JQ8A 5AAEA 5JMSA 3NVKI 4WG3A 4CTCA 3AC1A 5HU9A 5I9ZA 4MD7E 3TEIA 4CZYB 3FKNA 2YM8A 3IKAA 4FV4A 4MBIA 3D7TB 3DCVA 4IM2A 5C9CA 3TTJA 1YI3A 2IZSA 2WOTA 3AKKA 2B54A 3SOAA 4BTKA 5HVYA 3VS6A 5EG3A 3E7VA 3IQ7A 4LL0A 2WMAA 1KE5A 5C4LA 2EB2A 4IDVA 4FEUA 4WIHA 2Z2WA 4MNEB 4C35A 3W0SA 3FZSA 3FV8A 4PV0A 2OBJA 3CD3A 4CV8A 4IFGA 4KUJA 5EHLA 1B38A 4ERKA 5CEIA 4QDEA 2XBAA 3QC9A 5F94A 3BYVA 1XH8A 1B6CB 4FKWA 3C1XA 5CAOA 1LP4A 1H1QA 5DRBA 2WELA 4C02A 3CKXA 1G3NA 4A06A 3QTZA 4EYJA 2BZHB 3MVJA 2OSCA 2UVYA 3R7GA 4R7IA 5JFWA 3R8VA 3COIA 4JAJA 2GDOA 5J1WA 4YBJA 4YC3A 4F9CA 4AXAA 2UZWE 4UN0C 4M97A 3GGFA 1AQ1A 2BALA 4BBFA 4Y73A 4R1VA 4GL9A 3QKLA 3FYJX 4M67A 4RZVA 5TO8A 1IR3A 2XNEA 3WOWA 4BDBA 5M4FA 4O4BB 3BL7A 5GINE 3RAHA 3RPRA 1J7LA 4U5JA 4BDCA 2F57A 3R8LA 1KOAA 4M15A 3BU5A 4YZNA 4AN3A 4RLKA 2R3FA 3KF7A 4PL5A 1TKIA 1Z9XA 4R77A 1PY5A 3QCQA 4U6RA 2V22A 2FA2A 2XUUA 4ZTQA 3W32A 2UW5A 4M12A 2NO3A 3BU6A 4WBBB 3TTIA 1W2DA 3C4ZA 2XA4A 2E9PA 4ANNA 3KQ7A 4JQEA 4G5PA 1F0QA 2X4ZA 3V8WA 3TXOA 1ZAOA 2YJRA 5HTIA 2A98A 2XKDA 5K5XA 3C4XA 3R7EA 4Y46A 4JT3A 2BFYA 1W83A 4EUTA 1Q8ZA 1IG1A 4BDGA 3S3IA 4WG4A 3BBTB 2A0CX 3MBLA 4X0MA 4HGSA 5LVLA 3FEGA 4DH8A 1Q4LA 5KHXA 3EQBA 4B8MA 3VHKA 4I92A 3RZFA 2CDZA 2ZVAA 3R0TA 5HVKA 4HPTE 4I94A 4L9IA 3LCDA 4QTDA 3MPTA 4E93A 3DPKA 5IA1A 2A4LA 3ZOSA 3D0EA 3BELA 3MY0A 2Y4PA 4GKHA 1Q62A 3R04A 5FTGA 2YABA 3WIKA 3THBA 3QZFA 1FGKA 3BYOA 4OW8A 2PL0A 2O0UA 5AP3A 2HW7A 3SX9A 4IX6A 4XLIA 3WBLA 3MH2A 4B99A 3LJ1A 4GU6A 4QRCA 3FZ1A 4XNEA 4R1YA 3Q2JA 2IG7A 4FVRA 3VUGA 1PXIA 3BGQA 3DKFA 5T68A 3W18A 2JBPA 3ROYA 5HX8A 3R7VA 4NTTA 1P4FA 2VNYA 4Z3VA 1KE6A 4FI1A 3DK3A 4MXOA 3LM0A 3SG8A 1PXNA 1Z57A 3E8CA 4YJNA 4H36A 3HECA 3UDBA 3ZM9A 3OMVA 3KCFA 4QMVA 5A4QA 4EBVA 3LXPA 4OR5A 5JRQA 2VTJA 4WNMA 5TT7A 3CIKA 3W8LA 4DBXA 4FTAA 4B9DA 5IQAA 3OT8A 4W8EA 3UYTA 3MGYA 3NNUA 2VX3A 2PMIA 4IC8A 2GQGA 2OO8X 2OZAB 4QP6A 5HGIA 4H3PA 3KL8A 5DE2A 3EIDA 3GCQA 4NYEA 1TQIA 3CXWA 1K2PA 3IDPA 3QYZA 4FGBA 1FVVA 3QKMA 4IWDA 4RX9A 2Z7QA 3MH0A 3VN9A 2ZV2A 4RIOA 5DT0A 5JGBA 1PMEA 2OF2A 3ZHPC 4AOTA 4QYFA 3LKMA 3NIZA 3QQUA 4GUEA 3EHAA 4FIIA 5ANJA 4EOKA 4HZRA 5C8MA 4XP3A 5TOZA 4RFYA 1GOLA 3R28A 4WUNA 3COHA 5LVPA 3G0EA 4EJNA 4IIRA 1U54A 2CGVA 4AQKA 3Q60A 2QKWB 5E4HA 3QLGA 5CT0A 3TNIA 2XNMA 2RFDA 2C5XA 3ZZEA 3R73A 2W17A 4ZSAA 1J1CA 4GS6A 4H39A 3ETAA 4D9TA 3KK8A 4RVMA 2X4FA 5BVFA 1QPJA 5EYKA 3EQCA 1E9HA 4AAYA 2OZOA 3R8UA 5AR2A 5CSVA 3UIUA 4D2PA 5E8SA 5F9EA 5HEZA 2VO7A 3KC3A 4IJPA 3ENMA 4YLLA 2GNGA 3W2SA 4ASXA 4A4LA 3VNTA 2OH0E 3MJ1A 4USDA 4F99A 3ELJA 2CNVA 3UODA 1OPLA 4BC6A 4BIEA 3P79A 3PPJA 3KULB 4BYIA 3CCNA 3UOJA 4BCGA 2XYNA 2ETMA 1UV5A 4TYGA 2ZMCA 1P14A 4JNWA 1FOTA 4QMLA 3B8RA 2Q0BA 4PPAA 2RG6A 2PVRA 4FT7A 4IWPA 4X2NA 2P2HA 3DBEA 3L9PA 4J99A 4NJDA 3EB0A 4EJ7A 4BFMA 1UU8A 2PUPA 2JFMA 3QFVA 4LGGA 4QMNA 1XBCA 2Y4IB 1PXPA 4PQNA 1XJDA 2R7BA 4W8DA 4YLKA 3W8QA 4I0RA 4KABA 3T9TA 5J95A 3AMYA 3ORXA 3R1QA 1PMUA 3RWQA 3BL9A 3L8SA 2YIWA 4EC9A 3QAME 5B7VA 3AT2A 3ORZA 4L45A 2GHLA 3EQHA 2X8EA 2JEDA 3AC4A 4O96A 2Z7RA 4R8QA 4U81A 5D11A 5AR3A 2BIYA 3FL4A 2WGJA 4CMTA 4QP2A 4S33A 3WARA 4ZLYA 3HMPA 3PVUA 3PP1A 3VQUA 1AGWA 4CMUA 4V04A 1AD5A 2YM3A 3QQJA 5A4TA 4CKJA 3QRUA 2X7OA 4IAIA 1YHWA 2OF4A 3BEAA 3S00A 3LXKA 2WNTA 4CT1A 2X7GA 3CY2A 2GHGA 4DLJA 3QRKA 3CQWA 3HA6A 3FWQA 2WHBA 2ZB1A 1YHSA 3PXZA 3FHIA 4LRJA 2YM5A 5HNBA 2VWUA 2PYWA 4QPAA 3FMEA 4ZTHA 4BCHA 4R3CA 5I9VA 4KRDA 3ZLSA 1Q8TA 4ZS4A 3KREA 3BGZA 5EYDA 2QOIA 1XR1A 3A60A 4MWIA 4RA4A 4A9YA 1K3AA 3EN6A 4FSZA 4FV7A 4CMOA 2QHNA 5FDPA 4R6VA 4TT7A 4I20A 3Q9WA 2J0MB 4UYNA 2IW9A 1QPDA 3E92A 2W06A 1XH5A 1FGIA 4G3GA 2IVUA 4YZ9A 3KXGA 4DGOA 3V5QA 4XH6A 3DXPA 1TVOA 1BKXA 3VJOA 5HIEA 2J0LA 2ITTA 4PTGA 4DH5A 4UMQA 2OFUA 2EB3A 3ERKA 2BFXA 3KEXA 3W0OA 3PXKA 1GIIA 3CPBA 4RIYA 3R2BA 4IVCA 4AW0A 3W10A 3KXXA 5AV3A 4N70A 3SW4A 4ZZMA 2R3OA 2OJFE 5DPVA 4O81A 3U51A 5AA8A 4BI1A 5A46A 4K0YA 5HLNA 3KKVA 5D10A 4JBVA 2RSVA 4EH4A 5CEMA 4KINA 5M07A 2VTMA 4GIHA 5CXHA 4F65A 3GBZA 4LV8A 2G9XA 3QHRA 3LMHA 4PMPA 3LJ0A 3O96A 2IJMA 4HNIA 4X3FA 3UYSA 4H58A 4EUUA 3AQVA 5HESA 5HTBA 4G6NA 5AJQA 3SXRA 3NUXA 4JDHA 4XEYA 3QUDA 4BGQA 5CU3A 2H8HA 4F1TA 3DTWA 3UIXA 4FG9A 1PJKA 1ZOGA 2P55A 2XKCA 2VTIA 2CGXA 3G2FA 3HMOA 4LM5A 4EZ3A 2YAAA 1V0PA 2EUFB 4BKZA 4PMMA 5CANA 4QYYA 3DK7A 3UZPA 1WVXA 4DGNA 1GZOA 3O51A 3M42A 4FKSA 3TG1A 3OHTA 4CYIA 5D9HA 5M53A 3R9RA 2Z7LA 1PXKA 3CLYA 4JQ7A 4GJ2A 3CJGA 2OXYA 4O4CA 4PF4A 3IGGA 4ITJA 4C3FA 5CAUA 2HYYA 3I7CA 4H1JA 3ZO2A 3ZONA 5KMJA 3KY2A 2ITXA 3I81A 1ST4A 4FSNA 4C38A 1H00A 4XCUA 4UZHA 4XV2A 2CLXA 3FHRA 4FOCA 3I4BA 2X2LA 5CASA 5AP5A 4OTIA 5ACBC 4ZSGA 2C6EA 5LWNA 2PU8A 4K6ZA 3RHKA 3ZFMA 2NNWB 4CQEA 3QD0A 4JR7A 2HZ4A 2OK1A 4LV7A 2QOLA 3G0FA 4JOAA 5HBEA 3LOKA 4Q2AA 5IQEA 2A1AB 3UVPA 2W4JA 3LW0A 3K54A 2X0GA 2X6EA 1R3CA 1YQJA 1REKA 3DZOA 4FK6A 2XBJA 4DGGA 2QOHA 4Y85A 4QO9A 5DOSA 1U5QA 4KIKB 3DXQA 2FB8A 3MVMA 2ZM4A 2W4KA 2XZSA 3C7QA 1K9AA 4EQMA 3O17A 1IAHA 5J9LA 5M06A 2J51A 4Y5HA 5DLSA 4MBJA 2RFSA 4DCAA 1OPJA 1FINA 3GP0A 3EFWA 3KRJA 4X6QC 3WZEA 2BVAA 4GH2A 3GXLA 1YI4A 2PZ5A 4K1BA 2Y4IC 4XG4A 4PPCA 3TIZA 3ACKA 3P1AA 3PG3A 5HG8A 2X0QA 4C4FA 5CI7A 5HQ0A 2VX1A 3NW5A 1UVRA 4O1OA 2UW3A 3LCOA 4JIKA 4IAZA 1X8BA 3KN5A 2BMCA 3WF7A 3NYOA 4YTCA 5AEPA 1YWRA 1B39A 2PWLA 3PLSA 4WO5A 4YHTA 2C30A 3F3ZA 3R02A 4GMYA 5GZ9A 2ERZE 3DQWA 5GHVA 4DGMA 4O38A 4ALUA 4ZJIA 1WFCA 4YO4A 2R64A 2Z8CA 1KV1A 4D1ZA 1BI8A 4RQKA 4IH8A 4FIJA 4IWQA 4LOPA 4MXAA 4B6LA 2J0IA 4MEDA 5B2LA 2CCHA 1M2QA 2H96A 2OIQA 2W5AA 2XIXA 2HZIA 3BLHA 3FZPA 3NZ0A 3Q04A 5FEQA 4O6LA 4EH9A 3NRMA 5BUIA 4N57A 3KRRA 4QOXA 3ZMMA 1WVYA 3LZBA 3DDQA 3MTFA 4IACA 5A4CA 3KULA 4K2RA 4NWMA 3UO6A 4RX5A 3VBWA 4Q5EA 2DUVA 4NKSA 4OTFA 5F1ZA 2OFVA 3GU7A 2YIXA 4CRLA 4EH8A 4FBXA 3ANRA 3GCSA 3Q5IA 3ALOA 3A7FA 4O21A 1ZZ2A 3BV3A 3FLNC 2GS6A 3JUHA 2FSOX 3R9DA 3P08A 1OVEA 3KN6A 4HYHA 3W0RA 4RJ4A 3TT0A 4CFNA 4F0GA 2P33A 2ZFYA 4C4EA 4IXPA 4QTCA 4NCTC 2BRMA 3Q4TA 4PY1A 5FP6A 3OOMA 2CSNA 2WXVA 2IVVA 3VBVA 5J5SA 3TN8A 1SNXA 2R3QA 3KRLA 3NPCA 3SD0A 1J3HA 1LR4A 1GIJA 4FZAB 3F5PA 2ZV9A 4IWOA 5D41A 4ZLOA 2GMXA 4U7ZA 3FQHA 4IE9A 4FF8A 3PFYA 3CJFA 2NP8A 4YTIA 4PPBA 1PXJA 4FV3A 5C27A 4EL9A 2R3JA 5HIDA 4FUYA 3HL7A 3KU2A 4CD0A 1OPKA 4PTEA 4MX9A 2IN6A 3P78A 4DH7A 2B55A 4P5ZA 3R1YA 3IG7A 3R2YA 2HZNA 4IZ7A 2XKFA 2CMWA 1P4OA 5HHWA 4BCOA 4F6SA 4L52A 3AXWA 4LYNA 5FQDC 5ITAA 3JY0A 3WE4A 2W05A 3FLYA 2VWVA 3EQPA 4MXXA 1DM2A 1JKSA 3BPRA 5CNOA 3DKGA 3TV6A 4XG7A 4DLIA 2VX0A 4HVDA 3VS2A 4D5HA 1CTPE 3FLQA 5EM8A 3GB2A 4K11A 2VWXA 3AGMA 4F7NA 3D2IA 4WRGA 1H1RA 5EDRA 4R7BA 2VWZA 1M2PA 4D2TA 1G5SA 2R3LA 2XK9A 1UU7A 5AR4A 5CEQA 4E5BA 3BHYA 5DNRA 4I5PA 4DN5A 3G33A 4ZZOA 1YXTA 2XK7A 5A6NA 3ORMA 3IOPA 2BAJA 3OWKA 4X7QA 3FAAA 4F64A 4ZY4A 3UGCA 4J1RA 5IQIA 5J7BA 4JBQA 4DHZA 4G3DA 1XBBA 2FSMX 3B2WA 3VF8A 1KE9A 4IM3A 4X21A 2PHKA 2HWPA 2WTIA 2XNBA 3GCVA 3EOCA 3GC7A 4R5SA 5HE3A 3D5XA 1WBTA 4GG7A 3UO4A 3R00A 3II5A 1P2AA 3NNWA 2C6TA 1JSVA 1NVQA 5TE0A 4CCUA 5CSPA 3LFFA 2VTPA 4FTIA 4J8MA 4DFNA 1XWSA 3GT8A 3BKBA 3Q96A 4FVPA 4YP8A 3VIDA 4X3JA 3ZO1A 1ZYCA 1H8FA 3PZHA 3GOKA 5EI6A 5EYCA 4FEXA 4ZMEA 5G6VA 3OXIA 1UKIA