3V96B

Complex of matrix metalloproteinase-10 catalytic domain (mmp-10cd) with tissue inhibitor of metalloproteinases-1 (timp-1)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
MPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloproteinase inhibitor 1
publication title Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 49
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.22: Stromelysin 2.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3v96B00
1YOUA 4PKTA 1CXVA 3OHLA 1DTHA 4WKIA 1C7KA 4EFSA 2YIGA 1Y8JA 5D1TA 5CXAA 2OY2A 1D8MA 1PWQA 3ZUKA 3VI1A 2RJQA 2OXZA 1R54A 1G49A 3F15A 1Z3JA 1MMQA 3G42A 4Q1LA 2XS4A 4I35A 3LILA 2OW0A 4AYKA 1XFVA 1AYKA 3TT4A 4FU4A 3TS4A 1PWUA 5I2ZA 2OXWA 3K7LA 2W14A 4JQGA 3DL1A 3OHOA 3AYUA 5D1UA 1FM1A 4XM6A 3L0TA 1XURA 2J83A 4JIJA 1Y93A 1KUIA 4L63A 1GE5A 1KUHA 3KRYA 5B5OA 3N2VA 1FBLA 4ILWD 3CKIA 3EDZA 5D1SA 1GO8P 4AXQA 4DPEA 3F18A 3K7NA 3RTTA 2DDFA 3B8ZA 1EB6A 1G12A 1KUGA 1HY7A 3DWBA 2DW0A 1Y0VA 4PKQA 5I3MA 1GKCA 1XUCA 3MA2A 3ELMA 4I03A 3RTSA 1RM8A 3P24A 1HTDA 3DPEA 1IABA 4PKVA 1MMRA 1SLMA 3LIKA 5CUHA 3TVCA 2X3AA 2OVZA 3F19A 1R1JA 1R55A 4IUWA 3HB2P 1EAKA 1KUFA 4H2EA 3WV2A 2MLSA 3Q2HA 3U1RA 1L6JA 1AF0A 1CGEA 4CTHA 2OY4A 1BKCA 2O36A 1UTZA 1K7IA 3HBVP 5D7WA 1IAEA 5LABA 1R1HA 2PJTA 1CQRA 1KBCA 1JANA 2MZIA 1IAAA 1OS9A 1A85A 1QJIA 4PKSA 3I7GA 4GF1A 5H8XA 1JKYA 4L6TA 4IN9A 1BKCE 4WKEA 1JAPA 1O0TA 4ZR5A 1G9KA 3SHIA 2I47A 1JH1A 1QICA 4JA1A 1ZVXA 4PKRA 4H84A 3EWJA 1B8YA 2N8RA 1PWWA 2DW2A 2POJA 3P1VA 3GBOA 3DPFA 1D7XA 456CA 3VTGA 3F17A 4G0DA 1CK7A 2L0RA 2A8HA 2OW9A 2OZRA 3V96B 1BZSA 1GE7A 2FV9A 3HDBA 3KEKA 1CAQA 2DDYA 3LIRA 3ZXHA 1MMBA 3I7IA 3HBUP 2JNPA 2ERQA 2JT6A 1OM8A 1JIWP 2J0TA 3LE9A 4DV8A 1I76A 966CA 3LQBA 4GUYA 1ZXCA 2WO9A 2W15A 5BOYA 4H49A 1YP1A 2CLTA 3AIGA 4PKUA 2X3BA 4WF6A 1AKLA 2E2DA 4GWMA 3KECA 3L0VA 2YB9A 2Y6CA 3LJZA 3LUMA 1IAGA 5CZMA 4XBHA 1R1IA 1SATA 1BQOA 2WO8A 4HX3A 4FVLA 2K2GA 2MZHA 1JAQA 1UMTA 1SRPA 1OMJA 2Z2DA 4JPAA 1CGLA 1BM6A 2RJPA 4AUOA 5L7FA 2CKIA 3LK8A 2X3CA 2FV5A 3USNA 3EDGA 2W12A 3HY7A 830CA 4GR8A 1ZP5A 1XFZA 5I4OA 3B2ZA 1DMTA 1OM7A 2DW1A 1XFUA 2HU6A 2WOAA 2ERPA 2SRTA 1J7NA 4A7BA 1H71P 1PWVA 4R3VA 2JSDA 1I1IP 1I73A 1ASTA 3N2UA 1JK3A 1CIZA 4FXQA 4DD8A 3LMCA 1QIAA 1G05A 1ROSA 3LEAA 1A86A 1K7QA 3DSLA 4DF9A 1IADA 4GWNA 1GE6A 3DNGA 2OXUA 1MMPA 1BUVM 1ND1A 4PKWA 1GO7P 2USNA 3WV3A 1QIBA 3UVCA 1KAPP 5D3CA 1Q3AA 3Q2GA 3B92A 4XCTA 1UEAA 4H30A 1XFXA 1IACA 3F1AA 4H76A 5B5PA 2W0DA 3NX7A 3F16A 3KEJA 1EUBA 3ZVSA 4WK7A 1CGFA 1XUDA 1ZTQA 2XS3A 2Y6DA 2JT5A 2MLRA 1ZXVA 1OS2A 1QUAA 3LUNA 2V4BA 2K9CA 3EDIA 4XM8A 1YCMA 1KUKA 3LKAA 4GR0A 2JIHA 1ATLA 2E3XA 3EHYA 2X7MA 1D8FA 4JP4A 5I0LA 1XFYA 4ON1A 3WV1A 4A3WA 1PWPA 1S4BP 1SMPA 5L79A 1RMZA 2O3EA 4WZVA 1BSWA 1SLNA 4G9LA 4J4MA 1BIWA 4H82A 4QKZA 1YQYA 3LGPA 1HV5A 3HY9A 1WNIA 3LJGA 3E8RA 1HFSA 2TCLA 1UMSA 3LJTA 4XM7A 1XFWA 1GKDA 4GR3A 1BKCI 2OI0A 1GXDA 3KMEA 4L19A 5I43A 1HOVA 1USNA 1JIZA 2KRJA 1ZS0A 3O64A 1MNCA 3KHIA 2OW1A 4FXYP 4H3XA 5BOTA 4AIGA 5BPAA 1C8TA 2QPJA 1UTTA 3EHXA 1HFCA 2D1NA 3KWVC 4IJOA 3EDHA 3AYKA 2AIGP 3HDAP 1JJ9A 2AYKA 4H1QA 1BUDA 3O2XA 2EROA 2OVXA 1O0QA 1OM6A 4GQLA 4HMAA 1OO9A 1B3DA 2W13A 3TSKA 5JMYA 1D5JA 1K7GA 3LQ0A 1FLSA 3G5CA 3HYGA 1QJJA 1SU3A 3BA0A 2MZEA 3KMCA 1G4KA 1C3IA 2OW2A 5I12A 5D2BA 1BQQM 2D1OA 1JAOA
chains in the Genus database with same CATH superfamily
1YOUA 4PKTA 1CXVA 3OHLA 1DTHA 4WKIA 1JAOA 1C7KA 4EFSA 2YIGA 1Y8JA 5D1TA 5CXAA 2OY2A 1D8MA 1PWQA 3ZUKA 3VI1A 2RJQA 2OXZA 1R54A 1G49A 3F15A 1Z3JA 1MMQA 3G42A 4Q1LA 2XS4A 4I35A 3LILA 2OW0A 4AYKA 1XFVA 1AYKA 3TT4A 4FU4A 3TS4A 1PWUA 5I2ZA 2OXWA 3K7LA 2W14A 4JQGA 3DL1A 3OHOA 3AYUA 5D1UA 1FM1A 4XM6A 3L0TA 1XURA 2J83A 4JIJA 1Y93A 1KUIA 4L63A 1GE5A 1KUHA 3KRYA 5B5OA 1TVIA 3N2VA 1FBLA 4ILWD 3CKIA 3EDZA 5D1SA 1GO8P 4AXQA 4DPEA 3F18A 3K7NA 3RTTA 2DDFA 3B8ZA 1EB6A 1G12A 1KUGA 1HY7A 3DWBA 2DW0A 1Y0VA 4PKQA 5I3MA 1GKCA 1XUCA 3MA2A 3ELMA 4I03A 3RTSA 1RM8A 3P24A 1HTDA 3DPEA 1IABA 4PKVA 1MMRA 1SLMA 3LIKA 5CUHA 3TVCA 2X3AA 2OVZA 3F19A 1R1JA 1R55A 4IUWA 3HB2P 1EAKA 1KUFA 4H2EA 3WV2A 2MLSA 3Q2HA 3U1RA 1L6JA 1AF0A 1CGEA 4CTHA 2OY4A 1BKCA 2O36A 1UTZA 1K7IA 3HBVP 5D7WA 1IAEA 5LABA 1R1HA 2PJTA 1CQRA 1KBCA 1JANA 2MZIA 1IAAA 1OS9A 1A85A 1QJIA 4PKSA 3I7GA 4GF1A 5H8XA 1JKYA 4L6TA 4IN9A 1BKCE 4WKEA 1JAPA 1O0TA 4ZR5A 1G9KA 3SHIA 2I47A 1JH1A 1QICA 4JA1A 1ZVXA 4PKRA 4H84A 3EWJA 1B8YA 2N8RA 1PWWA 2DW2A 2POJA 3P1VA 3GBOA 3DPFA 1D7XA 456CA 3VTGA 3F17A 4G0DA 1CK7A 2L0RA 2A8HA 2OW9A 2OZRA 3V96B 1BZSA 1GE7A 3KEKA 2FV9A 3HDBA 1CAQA 1XM5A 2DDYA 3LIRA 3ZXHA 1MMBA 3I7IA 3HBUP 2JNPA 2ERQA 2JT6A 1OM8A 1JIWP 2J0TA 3LE9A 4DV8A 1I76A 966CA 3LQBA 4GUYA 1ZXCA 2WO9A 2W15A 5BOYA 4H49A 1YP1A 2CLTA 3AIGA 4PKUA 2X3BA 4WF6A 1AKLA 2E2DA 4GWMA 3KECA 3L0VA 2YB9A 2Y6CA 3LJZA 3LUMA 1IAGA 5CZMA 4XBHA 1R1IA 1SATA 1BQOA 2WO8A 4HX3A 4FVLA 2K2GA 2MZHA 1JAQA 1UMTA 1SRPA 1OMJA 2Z2DA 4JPAA 1CGLA 1BM6A 2RJPA 4AUOA 5L7FA 2CKIA 3LK8A 2X3CA 2FV5A 3USNA 3EDGA 2W12A 3HY7A 830CA 4GR8A 1ZP5A 2YUFA 1XFZA 5I4OA 3B2ZA 1DMTA 1OM7A 2DW1A 1XFUA 2HU6A 2WOAA 2ERPA 2SRTA 1J7NA 4A7BA 1H71P 1PWVA 4R3VA 2JSDA 1I1IP 1I73A 1ASTA 3N2UA 1JK3A 1CIZA 4FXQA 4DD8A 3LMCA 1QIAA 1G05A 1ROSA 3LEAA 1A86A 1K7QA 3DSLA 4DF9A 1IADA 4GWNA 1GE6A 3DNGA 2OXUA 1MMPA 1BUVM 1ND1A 4PKWA 1GO7P 3DTKA 2USNA 3WV3A 1QIBA 3UVCA 1KAPP 5D3CA 1Q3AA 3Q2GA 3B92A 4XCTA 1UEAA 4H30A 1XFXA 1IACA 3F1AA 4H76A 5B5PA 2W0DA 3NX7A 3F16A 4L7AA 3KEJA 1EUBA 3ZVSA 4WK7A 1CGFA 1XUDA 1ZTQA 2XS3A 2Y6DA 2JT5A 2MLRA 1ZXVA 1OS2A 1QUAA 3LUNA 3DTEA 2V4BA 2K9CA 3EDIA 4XM8A 1YCMA 1KUKA 3LKAA 4GR0A 2JIHA 1ATLA 2E3XA 3EHYA 2X7MA 1D8FA 4JP4A 5I0LA 1XFYA 4ON1A 3WV1A 4A3WA 1PWPA 1S4BP 1SMPA 5L79A 1RMZA 2O3EA 4WZVA 1BSWA 1SLNA 4G9LA 4J4MA 1BIWA 4H82A 4QKZA 1YQYA 3LGPA 1HV5A 3HY9A 1WNIA 3LJGA 3E8RA 1HFSA 2TCLA 1UMSA 3LJTA 4XM7A 1XFWA 1GKDA 4GR3A 1BKCI 2OI0A 1GXDA 3KMEA 4L19A 5I43A 1HOVA 1USNA 1JIZA 2KRJA 1ZS0A 3O64A 1MNCA 3KHIA 2OW1A 4FXYP 4H3XA 5BOTA 4AIGA 5BPAA 1C8TA 2QPJA 1UTTA 3EHXA 1HFCA 2D1NA 3KWVC 1OZ9A 4IJOA 3EDHA 3AYKA 2AIGP 3HDAP 1JJ9A 2AYKA 4H1QA 1BUDA 3O2XA 2EROA 2OVXA 1O0QA 1OM6A 4GQLA 4HMAA 1OO9A 1B3DA 2W13A 3TSKA 5JMYA 1D5JA 1K7GA 3LQ0A 1FLSA 3G5CA 3HYGA 1QJJA 3DTIA 1SU3A 3BA0A 2MZEA 3KMCA 1G4KA 1C3IA 2OW2A 5I12A 5D2BA 1BQQM 2D1OA 1XAXA
chains in the Genus database with same CATH topology
1YOUA 4PKTA 1CXVA 3OHLA 1DTHA 4WKIA 1C7KA 4EFSA 2YIGA 1Y8JA 5D1TA 5CXAA 2OY2A 1D8MA 1PWQA 3ZUKA 3VI1A 2RJQA 2OXZA 1R54A 1G49A 3F15A 1Z3JA 1MMQA 3G42A 4Q1LA 2XS4A 4I35A 3LILA 2OW0A 4AYKA 1XFVA 1AYKA 3TT4A 4FU4A 3TS4A 1PWUA 5I2ZA 2OXWA 3K7LA 2W14A 4JQGA 3DL1A 3OHOA 3AYUA 5D1UA 1FM1A 4XM6A 3L0TA 1XURA 2J83A 4JIJA 1Y93A 1KUIA 4L63A 1GE5A 1KUHA 3KRYA 5B5OA 3N2VA 1FBLA 4ILWD 3CKIA 3EDZA 5D1SA 1GO8P 4AXQA 4DPEA 3F18A 3K7NA 3RTTA 2DDFA 3B8ZA 1EB6A 1G12A 1KUGA 1HY7A 3DWBA 2DW0A 1Y0VA 4PKQA 5I3MA 1GKCA 1XUCA 3MA2A 3ELMA 4I03A 3RTSA 1RM8A 3P24A 1HTDA 3DPEA 1IABA 4PKVA 1MMRA 1SLMA 3LIKA 5CUHA 3TVCA 2X3AA 2OVZA 3F19A 1R1JA 1R55A 4IUWA 3HB2P 1EAKA 1KUFA 4H2EA 3WV2A 2MLSA 3Q2HA 3U1RA 1L6JA 1AF0A 1CGEA 4CTHA 2OY4A 1BKCA 2O36A 1UTZA 1K7IA 3HBVP 5D7WA 1IAEA 5LABA 1R1HA 2PJTA 1CQRA 1KBCA 1JANA 2MZIA 1IAAA 1OS9A 1A85A 1QJIA 4PKSA 3I7GA 4GF1A 5H8XA 1JKYA 4L6TA 4IN9A 1BKCE 4WKEA 1JAPA 1O0TA 4ZR5A 1G9KA 3SHIA 2I47A 1JH1A 1QICA 4JA1A 1ZVXA 4PKRA 4H84A 3EWJA 1B8YA 2N8RA 1PWWA 2DW2A 2POJA 3P1VA 3GBOA 3DPFA 1D7XA 456CA 3VTGA 3F17A 4G0DA 1CK7A 2L0RA 2A8HA 2OW9A 2OZRA 3V96B 1BZSA 1GE7A 2FV9A 3HDBA 3KEKA 1CAQA 2DDYA 3LIRA 3ZXHA 1MMBA 3I7IA 3HBUP 2JNPA 2ERQA 2JT6A 1OM8A 1JIWP 2J0TA 3LE9A 4DV8A 1I76A 966CA 3LQBA 4GUYA 1ZXCA 2WO9A 2W15A 5BOYA 4H49A 1YP1A 2CLTA 3AIGA 4PKUA 2X3BA 4WF6A 1AKLA 2E2DA 4GWMA 3KECA 3L0VA 2YB9A 2Y6CA 3LJZA 3LUMA 1IAGA 5CZMA 4XBHA 1R1IA 1SATA 1BQOA 2WO8A 4HX3A 4FVLA 2K2GA 2MZHA 1JAQA 1UMTA 1SRPA 1OMJA 2Z2DA 4JPAA 1CGLA 1BM6A 2RJPA 4AUOA 5L7FA 2CKIA 3LK8A 2X3CA 2FV5A 3USNA 3EDGA 2W12A 3HY7A 830CA 4GR8A 1ZP5A 2YUFA 1XFZA 5I4OA 3B2ZA 1DMTA 1OM7A 2DW1A 1XFUA 2HU6A 2WOAA 2ERPA 2SRTA 1J7NA 4A7BA 1H71P 1PWVA 4R3VA 2JSDA 1I1IP 1I73A 1ASTA 3N2UA 1JK3A 1CIZA 4FXQA 4DD8A 3LMCA 1QIAA 1G05A 1ROSA 3LEAA 1A86A 1K7QA 3DSLA 4DF9A 1IADA 4GWNA 1GE6A 3DNGA 2OXUA 1MMPA 1BUVM 1ND1A 4PKWA 1GO7P 3DTKA 2USNA 3WV3A 1QIBA 3UVCA 1KAPP 5D3CA 1Q3AA 3Q2GA 3B92A 4XCTA 1UEAA 4H30A 1XFXA 1IACA 3F1AA 4H76A 5B5PA 2W0DA 3NX7A 3F16A 4L7AA 3KEJA 1EUBA 3ZVSA 4WK7A 1CGFA 1XUDA 1ZTQA 2XS3A 2Y6DA 2JT5A 2MLRA 1ZXVA 1OS2A 1QUAA 3LUNA 3DTEA 2V4BA 2K9CA 3EDIA 4XM8A 1YCMA 1KUKA 3LKAA 4GR0A 2JIHA 1ATLA 2E3XA 3EHYA 2X7MA 1D8FA 4JP4A 5I0LA 1XFYA 4ON1A 3WV1A 4A3WA 1PWPA 1S4BP 1SMPA 5L79A 1RMZA 2O3EA 4WZVA 1BSWA 1SLNA 4G9LA 4J4MA 1BIWA 4H82A 4QKZA 1YQYA 3LGPA 1HV5A 3HY9A 1WNIA 3LJGA 3E8RA 1HFSA 2TCLA 1UMSA 3LJTA 4XM7A 1XFWA 1GKDA 4GR3A 1BKCI 2OI0A 1GXDA 3KMEA 4L19A 5I43A 1HOVA 1USNA 1JIZA 2KRJA 1ZS0A 3O64A 1MNCA 3KHIA 2OW1A 4FXYP 4H3XA 5BOTA 4AIGA 5BPAA 1C8TA 2QPJA 1UTTA 3EHXA 1HFCA 2D1NA 3KWVC 4IJOA 3EDHA 3AYKA 2AIGP 3HDAP 1JJ9A 2AYKA 4H1QA 1BUDA 3O2XA 2EROA 2OVXA 1O0QA 1OM6A 4GQLA 4HMAA 1OO9A 1B3DA 2W13A 3TSKA 5JMYA 1D5JA 1K7GA 3LQ0A 1FLSA 3G5CA 3HYGA 1QJJA 3DTIA 1SU3A 3BA0A 2MZEA 3KMCA 1G4KA 1C3IA 2OW2A 5I12A 5D2BA 1BQQM 2D1OA 1JAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YOU A;  4PKT A;  1CXV A;  3OHL A;  1DTH A;  4WKI A;  1C7K A;  4EFS A;  2YIG A;  1Y8J A;  5D1T A;  5CXA A;  2OY2 A;  1D8M A;  1PWQ A;  3ZUK A;  3VI1 A;  2RJQ A;  2OXZ A;  1R54 A;  1G49 A;  3F15 A;  1Z3J A;  1MMQ A;  3G42 A;  4Q1L A;  2XS4 A;  4I35 A;  3LIL A;  2OW0 A;  4AYK A;  1XFV A;  1AYK A;  3TT4 A;  4FU4 A;  3TS4 A;  1PWU A;  5I2Z A;  2OXW A;  3K7L A;  2W14 A;  4JQG A;  3DL1 A;  3OHO A;  3AYU A;  5D1U A;  1FM1 A;  4XM6 A;  3L0T A;  1XUR A;  2J83 A;  4JIJ A;  1Y93 A;  1KUI A;  4L63 A;  1GE5 A;  1KUH A;  3KRY A;  5B5O A;  3N2V A;  1FBL A;  4ILW D;  3CKI A;  3EDZ A;  5D1S A;  1GO8 P;  4AXQ A;  4DPE A;  3F18 A;  3K7N A;  3RTT A;  2DDF A;  3B8Z A;  1EB6 A;  1G12 A;  1KUG A;  1HY7 A;  3DWB A;  2DW0 A;  1Y0V A;  4PKQ A;  5I3M A;  1GKC A;  1XUC A;  3MA2 A;  3ELM A;  4I03 A;  3RTS A;  1RM8 A;  3P24 A;  1HTD A;  3DPE A;  1IAB A;  4PKV A;  1MMR A;  1SLM A;  3LIK A;  5CUH A;  3TVC A;  2X3A A;  2OVZ A;  3F19 A;  1R1J A;  1R55 A;  4IUW A;  3HB2 P;  1EAK A;  1KUF A;  4H2E A;  3WV2 A;  2MLS A;  3Q2H A;  3U1R A;  1L6J A;  1AF0 A;  1CGE A;  4CTH A;  2OY4 A;  1BKC A;  2O36 A;  1UTZ A;  1K7I A;  3HBV P;  5D7W A;  1IAE A;  5LAB A;  1R1H A;  2PJT A;  1CQR A;  1KBC A;  1JAN A;  2MZI A;  1IAA A;  1OS9 A;  1A85 A;  1QJI A;  4PKS A;  3I7G A;  4GF1 A;  5H8X A;  1JKY A;  4L6T A;  4IN9 A;  1BKC E;  4WKE A;  1JAP A;  1O0T A;  4ZR5 A;  1G9K A;  3SHI A;  2I47 A;  1JH1 A;  1QIC A;  4JA1 A;  1ZVX A;  4PKR A;  4H84 A;  3EWJ A;  1B8Y A;  2N8R A;  1PWW A;  2DW2 A;  2POJ A;  3P1V A;  3GBO A;  3DPF A;  1D7X A;  456C A;  3VTG A;  3F17 A;  4G0D A;  1CK7 A;  2L0R A;  2A8H A;  2OW9 A;  2OZR A;  3V96 B;  1BZS A;  1GE7 A;  2FV9 A;  3HDB A;  3KEK A;  1CAQ A;  2DDY A;  3LIR A;  3ZXH A;  1MMB A;  3I7I A;  3HBU P;  2JNP A;  2ERQ A;  2JT6 A;  1OM8 A;  1JIW P;  2J0T A;  3LE9 A;  4DV8 A;  1I76 A;  966C A;  3LQB A;  4GUY A;  1ZXC A;  2WO9 A;  2W15 A;  5BOY A;  4H49 A;  1YP1 A;  2CLT A;  3AIG A;  4PKU A;  2X3B A;  4WF6 A;  1AKL A;  2E2D A;  4GWM A;  3KEC A;  3L0V A;  2YB9 A;  2Y6C A;  3LJZ A;  3LUM A;  1IAG A;  5CZM A;  4XBH A;  1R1I A;  1SAT A;  1BQO A;  2WO8 A;  4HX3 A;  4FVL A;  2K2G A;  2MZH A;  1JAQ A;  1UMT A;  1SRP A;  1OMJ A;  2Z2D A;  4JPA A;  1CGL A;  1BM6 A;  2RJP A;  4AUO A;  5L7F A;  2CKI A;  3LK8 A;  2X3C A;  2FV5 A;  3USN A;  3EDG A;  2W12 A;  3HY7 A;  830C A;  4GR8 A;  1ZP5 A;  1XFZ A;  5I4O A;  3B2Z A;  1DMT A;  1OM7 A;  2DW1 A;  1XFU A;  2HU6 A;  2WOA A;  2ERP A;  2SRT A;  1J7N A;  4A7B A;  1H71 P;  1PWV A;  4R3V A;  2JSD A;  1I1I P;  1I73 A;  1AST A;  3N2U A;  1JK3 A;  1CIZ A;  4FXQ A;  4DD8 A;  3LMC A;  1QIA A;  1G05 A;  1ROS A;  3LEA A;  1A86 A;  1K7Q A;  3DSL A;  4DF9 A;  1IAD A;  4GWN A;  1GE6 A;  3DNG A;  2OXU A;  1MMP A;  1BUV M;  1ND1 A;  4PKW A;  1GO7 P;  2USN A;  3WV3 A;  1QIB A;  3UVC A;  1KAP P;  5D3C A;  1Q3A A;  3Q2G A;  3B92 A;  4XCT A;  1UEA A;  4H30 A;  1XFX A;  1IAC A;  3F1A A;  4H76 A;  5B5P A;  2W0D A;  3NX7 A;  3F16 A;  3KEJ A;  1EUB A;  3ZVS A;  4WK7 A;  1CGF A;  1XUD A;  1ZTQ A;  2XS3 A;  2Y6D A;  2JT5 A;  2MLR A;  1ZXV A;  1OS2 A;  1QUA A;  3LUN A;  2V4B A;  2K9C A;  3EDI A;  4XM8 A;  1YCM A;  1KUK A;  3LKA A;  4GR0 A;  2JIH A;  1ATL A;  2E3X A;  3EHY A;  2X7M A;  1D8F A;  4JP4 A;  5I0L A;  1XFY A;  4ON1 A;  3WV1 A;  4A3W A;  1PWP A;  1S4B P;  1SMP A;  5L79 A;  1RMZ A;  2O3E A;  4WZV A;  1BSW A;  1SLN A;  4G9L A;  4J4M A;  1BIW A;  4H82 A;  4QKZ A;  1YQY A;  3LGP A;  1HV5 A;  3HY9 A;  1WNI A;  3LJG A;  3E8R A;  1HFS A;  2TCL A;  1UMS A;  3LJT A;  4XM7 A;  1XFW A;  1GKD A;  4GR3 A;  1BKC I;  2OI0 A;  1GXD A;  3KME A;  4L19 A;  5I43 A;  1HOV A;  1USN A;  1JIZ A;  2KRJ A;  1ZS0 A;  3O64 A;  1MNC A;  3KHI A;  2OW1 A;  4FXY P;  4H3X A;  5BOT A;  4AIG A;  5BPA A;  1C8T A;  2QPJ A;  1UTT A;  3EHX A;  1HFC A;  2D1N A;  3KWV C;  4IJO A;  3EDH A;  3AYK A;  2AIG P;  3HDA P;  1JJ9 A;  2AYK A;  4H1Q A;  1BUD A;  3O2X A;  2ERO A;  2OVX A;  1O0Q A;  1OM6 A;  4GQL A;  4HMA A;  1OO9 A;  1B3D A;  2W13 A;  3TSK A;  5JMY A;  1D5J A;  1K7G A;  3LQ0 A;  1FLS A;  3G5C A;  3HYG A;  1QJJ A;  1SU3 A;  3BA0 A;  2MZE A;  3KMC A;  1G4K A;  1C3I A;  2OW2 A;  5I12 A;  5D2B A;  1BQQ M;  2D1O A;  1JAO A; 
#chains in the Genus database with same CATH topology
 1YOU A;  4PKT A;  1CXV A;  3OHL A;  1DTH A;  4WKI A;  1JAO A;  1C7K A;  4EFS A;  2YIG A;  1Y8J A;  5D1T A;  5CXA A;  2OY2 A;  1D8M A;  1PWQ A;  3ZUK A;  3VI1 A;  2RJQ A;  2OXZ A;  1R54 A;  1G49 A;  3F15 A;  1Z3J A;  1MMQ A;  3G42 A;  4Q1L A;  2XS4 A;  4I35 A;  3LIL A;  2OW0 A;  4AYK A;  1XFV A;  1AYK A;  3TT4 A;  4FU4 A;  3TS4 A;  1PWU A;  5I2Z A;  2OXW A;  3K7L A;  2W14 A;  4JQG A;  3DL1 A;  3OHO A;  3AYU A;  5D1U A;  1FM1 A;  4XM6 A;  3L0T A;  1XUR A;  2J83 A;  4JIJ A;  1Y93 A;  1KUI A;  4L63 A;  1GE5 A;  1KUH A;  3KRY A;  5B5O A;  1TVI A;  3N2V A;  1FBL A;  4ILW D;  3CKI A;  3EDZ A;  5D1S A;  1GO8 P;  4AXQ A;  4DPE A;  3F18 A;  3K7N A;  3RTT A;  2DDF A;  3B8Z A;  1EB6 A;  1G12 A;  1KUG A;  1HY7 A;  3DWB A;  2DW0 A;  1Y0V A;  4PKQ A;  5I3M A;  1GKC A;  1XUC A;  3MA2 A;  3ELM A;  4I03 A;  3RTS A;  1RM8 A;  3P24 A;  1HTD A;  3DPE A;  1IAB A;  4PKV A;  1MMR A;  1SLM A;  3LIK A;  5CUH A;  3TVC A;  2X3A A;  2OVZ A;  3F19 A;  1R1J A;  1R55 A;  4IUW A;  3HB2 P;  1EAK A;  1KUF A;  4H2E A;  3WV2 A;  2MLS A;  3Q2H A;  3U1R A;  1L6J A;  1AF0 A;  1CGE A;  4CTH A;  2OY4 A;  1BKC A;  2O36 A;  1UTZ A;  1K7I A;  3HBV P;  5D7W A;  1IAE A;  5LAB A;  1R1H A;  2PJT A;  1CQR A;  1KBC A;  1JAN A;  2MZI A;  1IAA A;  1OS9 A;  1A85 A;  1QJI A;  4PKS A;  3I7G A;  4GF1 A;  5H8X A;  1JKY A;  4L6T A;  4IN9 A;  1BKC E;  4WKE A;  1JAP A;  1O0T A;  4ZR5 A;  1G9K A;  3SHI A;  2I47 A;  1JH1 A;  1QIC A;  4JA1 A;  1ZVX A;  4PKR A;  4H84 A;  3EWJ A;  1B8Y A;  2N8R A;  1PWW A;  2DW2 A;  2POJ A;  3P1V A;  3GBO A;  3DPF A;  1D7X A;  456C A;  3VTG A;  3F17 A;  4G0D A;  1CK7 A;  2L0R A;  2A8H A;  2OW9 A;  2OZR A;  3V96 B;  1BZS A;  1GE7 A;  3KEK A;  2FV9 A;  3HDB A;  1CAQ A;  1XM5 A;  2DDY A;  3LIR A;  3ZXH A;  1MMB A;  3I7I A;  3HBU P;  2JNP A;  2ERQ A;  2JT6 A;  1OM8 A;  1JIW P;  2J0T A;  3LE9 A;  4DV8 A;  1I76 A;  966C A;  3LQB A;  4GUY A;  1ZXC A;  2WO9 A;  2W15 A;  5BOY A;  4H49 A;  1YP1 A;  2CLT A;  3AIG A;  4PKU A;  2X3B A;  4WF6 A;  1AKL A;  2E2D A;  4GWM A;  3KEC A;  3L0V A;  2YB9 A;  2Y6C A;  3LJZ A;  3LUM A;  1IAG A;  5CZM A;  4XBH A;  1R1I A;  1SAT A;  1BQO A;  2WO8 A;  4HX3 A;  4FVL A;  2K2G A;  2MZH A;  1JAQ A;  1UMT A;  1SRP A;  1OMJ A;  2Z2D A;  4JPA A;  1CGL A;  1BM6 A;  2RJP A;  4AUO A;  5L7F A;  2CKI A;  3LK8 A;  2X3C A;  2FV5 A;  3USN A;  3EDG A;  2W12 A;  3HY7 A;  830C A;  4GR8 A;  1ZP5 A;  2YUF A;  1XFZ A;  5I4O A;  3B2Z A;  1DMT A;  1OM7 A;  2DW1 A;  1XFU A;  2HU6 A;  2WOA A;  2ERP A;  2SRT A;  1J7N A;  4A7B A;  1H71 P;  1PWV A;  4R3V A;  2JSD A;  1I1I P;  1I73 A;  1AST A;  3N2U A;  1JK3 A;  1CIZ A;  4FXQ A;  4DD8 A;  3LMC A;  1QIA A;  1G05 A;  1ROS A;  3LEA A;  1A86 A;  1K7Q A;  3DSL A;  4DF9 A;  1IAD A;  4GWN A;  1GE6 A;  3DNG A;  2OXU A;  1MMP A;  1BUV M;  1ND1 A;  4PKW A;  1GO7 P;  3DTK A;  2USN A;  3WV3 A;  1QIB A;  3UVC A;  1KAP P;  5D3C A;  1Q3A A;  3Q2G A;  3B92 A;  4XCT A;  1UEA A;  4H30 A;  1XFX A;  1IAC A;  3F1A A;  4H76 A;  5B5P A;  2W0D A;  3NX7 A;  3F16 A;  4L7A A;  3KEJ A;  1EUB A;  3ZVS A;  4WK7 A;  1CGF A;  1XUD A;  1ZTQ A;  2XS3 A;  2Y6D A;  2JT5 A;  2MLR A;  1ZXV A;  1OS2 A;  1QUA A;  3LUN A;  3DTE A;  2V4B A;  2K9C A;  3EDI A;  4XM8 A;  1YCM A;  1KUK A;  3LKA A;  4GR0 A;  2JIH A;  1ATL A;  2E3X A;  3EHY A;  2X7M A;  1D8F A;  4JP4 A;  5I0L A;  1XFY A;  4ON1 A;  3WV1 A;  4A3W A;  1PWP A;  1S4B P;  1SMP A;  5L79 A;  1RMZ A;  2O3E A;  4WZV A;  1BSW A;  1SLN A;  4G9L A;  4J4M A;  1BIW A;  4H82 A;  4QKZ A;  1YQY A;  3LGP A;  1HV5 A;  3HY9 A;  1WNI A;  3LJG A;  3E8R A;  1HFS A;  2TCL A;  1UMS A;  3LJT A;  4XM7 A;  1XFW A;  1GKD A;  4GR3 A;  1BKC I;  2OI0 A;  1GXD A;  3KME A;  4L19 A;  5I43 A;  1HOV A;  1USN A;  1JIZ A;  2KRJ A;  1ZS0 A;  3O64 A;  1MNC A;  3KHI A;  2OW1 A;  4FXY P;  4H3X A;  5BOT A;  4AIG A;  5BPA A;  1C8T A;  2QPJ A;  1UTT A;  3EHX A;  1HFC A;  2D1N A;  3KWV C;  1OZ9 A;  4IJO A;  3EDH A;  3AYK A;  2AIG P;  3HDA P;  1JJ9 A;  2AYK A;  4H1Q A;  1BUD A;  3O2X A;  2ERO A;  2OVX A;  1O0Q A;  1OM6 A;  4GQL A;  4HMA A;  1OO9 A;  1B3D A;  2W13 A;  3TSK A;  5JMY A;  1D5J A;  1K7G A;  3LQ0 A;  1FLS A;  3G5C A;  3HYG A;  1QJJ A;  3DTI A;  1SU3 A;  3BA0 A;  2MZE A;  3KMC A;  1G4K A;  1C3I A;  2OW2 A;  5I12 A;  5D2B A;  1BQQ M;  2D1O A;  1XAX A; 
#chains in the Genus database with same CATH homology
 1YOU A;  4PKT A;  1CXV A;  3OHL A;  1DTH A;  4WKI A;  1C7K A;  4EFS A;  2YIG A;  1Y8J A;  5D1T A;  5CXA A;  2OY2 A;  1D8M A;  1PWQ A;  3ZUK A;  3VI1 A;  2RJQ A;  2OXZ A;  1R54 A;  1G49 A;  3F15 A;  1Z3J A;  1MMQ A;  3G42 A;  4Q1L A;  2XS4 A;  4I35 A;  3LIL A;  2OW0 A;  4AYK A;  1XFV A;  1AYK A;  3TT4 A;  4FU4 A;  3TS4 A;  1PWU A;  5I2Z A;  2OXW A;  3K7L A;  2W14 A;  4JQG A;  3DL1 A;  3OHO A;  3AYU A;  5D1U A;  1FM1 A;  4XM6 A;  3L0T A;  1XUR A;  2J83 A;  4JIJ A;  1Y93 A;  1KUI A;  4L63 A;  1GE5 A;  1KUH A;  3KRY A;  5B5O A;  3N2V A;  1FBL A;  4ILW D;  3CKI A;  3EDZ A;  5D1S A;  1GO8 P;  4AXQ A;  4DPE A;  3F18 A;  3K7N A;  3RTT A;  2DDF A;  3B8Z A;  1EB6 A;  1G12 A;  1KUG A;  1HY7 A;  3DWB A;  2DW0 A;  1Y0V A;  4PKQ A;  5I3M A;  1GKC A;  1XUC A;  3MA2 A;  3ELM A;  4I03 A;  3RTS A;  1RM8 A;  3P24 A;  1HTD A;  3DPE A;  1IAB A;  4PKV A;  1MMR A;  1SLM A;  3LIK A;  5CUH A;  3TVC A;  2X3A A;  2OVZ A;  3F19 A;  1R1J A;  1R55 A;  4IUW A;  3HB2 P;  1EAK A;  1KUF A;  4H2E A;  3WV2 A;  2MLS A;  3Q2H A;  3U1R A;  1L6J A;  1AF0 A;  1CGE A;  4CTH A;  2OY4 A;  1BKC A;  2O36 A;  1UTZ A;  1K7I A;  3HBV P;  5D7W A;  1IAE A;  5LAB A;  1R1H A;  2PJT A;  1CQR A;  1KBC A;  1JAN A;  2MZI A;  1IAA A;  1OS9 A;  1A85 A;  1QJI A;  4PKS A;  3I7G A;  4GF1 A;  5H8X A;  1JKY A;  4L6T A;  4IN9 A;  1BKC E;  4WKE A;  1JAP A;  1O0T A;  4ZR5 A;  1G9K A;  3SHI A;  2I47 A;  1JH1 A;  1QIC A;  4JA1 A;  1ZVX A;  4PKR A;  4H84 A;  3EWJ A;  1B8Y A;  2N8R A;  1PWW A;  2DW2 A;  2POJ A;  3P1V A;  3GBO A;  3DPF A;  1D7X A;  456C A;  3VTG A;  3F17 A;  4G0D A;  1CK7 A;  2L0R A;  2A8H A;  2OW9 A;  2OZR A;  3V96 B;  1BZS A;  1GE7 A;  2FV9 A;  3HDB A;  3KEK A;  1CAQ A;  2DDY A;  3LIR A;  3ZXH A;  1MMB A;  3I7I A;  3HBU P;  2JNP A;  2ERQ A;  2JT6 A;  1OM8 A;  1JIW P;  2J0T A;  3LE9 A;  4DV8 A;  1I76 A;  966C A;  3LQB A;  4GUY A;  1ZXC A;  2WO9 A;  2W15 A;  5BOY A;  4H49 A;  1YP1 A;  2CLT A;  3AIG A;  4PKU A;  2X3B A;  4WF6 A;  1AKL A;  2E2D A;  4GWM A;  3KEC A;  3L0V A;  2YB9 A;  2Y6C A;  3LJZ A;  3LUM A;  1IAG A;  5CZM A;  4XBH A;  1R1I A;  1SAT A;  1BQO A;  2WO8 A;  4HX3 A;  4FVL A;  2K2G A;  2MZH A;  1JAQ A;  1UMT A;  1SRP A;  1OMJ A;  2Z2D A;  4JPA A;  1CGL A;  1BM6 A;  2RJP A;  4AUO A;  5L7F A;  2CKI A;  3LK8 A;  2X3C A;  2FV5 A;  3USN A;  3EDG A;  2W12 A;  3HY7 A;  830C A;  4GR8 A;  1ZP5 A;  2YUF A;  1XFZ A;  5I4O A;  3B2Z A;  1DMT A;  1OM7 A;  2DW1 A;  1XFU A;  2HU6 A;  2WOA A;  2ERP A;  2SRT A;  1J7N A;  4A7B A;  1H71 P;  1PWV A;  4R3V A;  2JSD A;  1I1I P;  1I73 A;  1AST A;  3N2U A;  1JK3 A;  1CIZ A;  4FXQ A;  4DD8 A;  3LMC A;  1QIA A;  1G05 A;  1ROS A;  3LEA A;  1A86 A;  1K7Q A;  3DSL A;  4DF9 A;  1IAD A;  4GWN A;  1GE6 A;  3DNG A;  2OXU A;  1MMP A;  1BUV M;  1ND1 A;  4PKW A;  1GO7 P;  3DTK A;  2USN A;  3WV3 A;  1QIB A;  3UVC A;  1KAP P;  5D3C A;  1Q3A A;  3Q2G A;  3B92 A;  4XCT A;  1UEA A;  4H30 A;  1XFX A;  1IAC A;  3F1A A;  4H76 A;  5B5P A;  2W0D A;  3NX7 A;  3F16 A;  4L7A A;  3KEJ A;  1EUB A;  3ZVS A;  4WK7 A;  1CGF A;  1XUD A;  1ZTQ A;  2XS3 A;  2Y6D A;  2JT5 A;  2MLR A;  1ZXV A;  1OS2 A;  1QUA A;  3LUN A;  3DTE A;  2V4B A;  2K9C A;  3EDI A;  4XM8 A;  1YCM A;  1KUK A;  3LKA A;  4GR0 A;  2JIH A;  1ATL A;  2E3X A;  3EHY A;  2X7M A;  1D8F A;  4JP4 A;  5I0L A;  1XFY A;  4ON1 A;  3WV1 A;  4A3W A;  1PWP A;  1S4B P;  1SMP A;  5L79 A;  1RMZ A;  2O3E A;  4WZV A;  1BSW A;  1SLN A;  4G9L A;  4J4M A;  1BIW A;  4H82 A;  4QKZ A;  1YQY A;  3LGP A;  1HV5 A;  3HY9 A;  1WNI A;  3LJG A;  3E8R A;  1HFS A;  2TCL A;  1UMS A;  3LJT A;  4XM7 A;  1XFW A;  1GKD A;  4GR3 A;  1BKC I;  2OI0 A;  1GXD A;  3KME A;  4L19 A;  5I43 A;  1HOV A;  1USN A;  1JIZ A;  2KRJ A;  1ZS0 A;  3O64 A;  1MNC A;  3KHI A;  2OW1 A;  4FXY P;  4H3X A;  5BOT A;  4AIG A;  5BPA A;  1C8T A;  2QPJ A;  1UTT A;  3EHX A;  1HFC A;  2D1N A;  3KWV C;  4IJO A;  3EDH A;  3AYK A;  2AIG P;  3HDA P;  1JJ9 A;  2AYK A;  4H1Q A;  1BUD A;  3O2X A;  2ERO A;  2OVX A;  1O0Q A;  1OM6 A;  4GQL A;  4HMA A;  1OO9 A;  1B3D A;  2W13 A;  3TSK A;  5JMY A;  1D5J A;  1K7G A;  3LQ0 A;  1FLS A;  3G5C A;  3HYG A;  1QJJ A;  3DTI A;  1SU3 A;  3BA0 A;  2MZE A;  3KMC A;  1G4K A;  1C3I A;  2OW2 A;  5I12 A;  5D2B A;  1BQQ M;  2D1O A;  1JAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...