3VA3A

Crystal structure of rnase t in complex with a duplex dna product (stem loop dna with 2 nucleotide 3' overhang)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
205
Chain Sequence
QLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 58
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3va3A00
4B9MA 3SNNA 3V1RA 4L8RB 4KHQA 4Z4IA 4EP4A 4UQGA 4E7JA 1RDAA 4FZYA 3QNNA 4DU1A 3OYIA 4KREA 3VQBA 1SL2A 1WN7A 2ZQBA 5HBMA 3SPYA 3LP1A 4EZ9A 3O3GA 4FJKA 1VSEA 4FVMA 2G8IA 1CXQA 2HHUA 3JYTA 1EKEA 2P51A 3NF6A 1JLQA 4R5PA 2YNGA 3O3FA 3LP2A 4LH5A 4B8AB 2A1RA 2QKKA 1TK8A 5J2MA 2OPSA 1ZBFA 1LW2A 3I0SA 5HRPA 3VN5A 4HUFA 3TR8A 1KFDA 4BDZA 3KLEA 3P1GA 1JLAA 1NJXA 2D0CA 4C8KA 3KLFA 1U49A 2KFZA 5SWMA 3QLHA 4C8OA 1RILA 3P83D 1YTUA 4EP5A 4BDYA 4Q5VA 4F3TA 4HUEA 4CJQA 1JLEA 4RW9A 5DK5A 3RRHA 2LSNA 1U45A 3EY1A 3KKSA 2YHBA 4I2QA 3VQQA 3OYJA 2PZSA 3HT3A 1HMVA 4B9LA 4DF4A 4IKFA 1TVRA 3TANA 3F73A 3ULDA 5DMRA 3BGRA 4OPJA 4DTUA 4FJIA 4B3OA 1VSMA 3ITHA 1HQUA 4KI4A 4E7KA 1W9HA 3DI6A 1X9WA 3E01A 4KO0A 2Y1IA 2O4GA 4JLHA 4M3RA 3DRPA 3ZT2A 4CF9A 3RMCA 4CJ3A 4MFBA 5CZ2A 4DG1A 4DFJA 3B6PA 3TAQA 5C24A 3K5LA 1TL1A 4FCYA 1QQCA 4OKKA 1TKXA 2Z1GA 1RBVA 1VSIA 3LANA 3PUFA 4E1MA 4BE0A 4DS5A 3ZSYA 2HHVA 3ZSXA 1NJZA 2BGGA 4OGCA 4CEFA 3T3FA 2W42A 1XI1A 4CIFA 2YNIA 3DOLA 3KIOA 3U3YA 4OPKA 4E7IA 5CYQA 4CF8A 4CFAA 3QNOA 1J5OA 4FJ5A 3DMJA 1L3UA 3NHGA 3FFIA 4CHOA 1IKWA 4J2BA 3OY9A 4DTMA 1J53A 3C95A 3HPOA 3SYZA 3AO2A 4AHSA 2OPQA 1XWLA 3LWLA 2XY7A 1VSLA 4M3XA 3MAQA 4I7FA 4CJEA 4FJMA 5JS2A 3OYKA 4N47A 1S1UA 3DLKA 1BI4B 1SKRA 2DFHA 4CFCA 1VK0A 3QO9A 3OS2A 3VQ4A 1L3VA 2B6AA 3DLBA 1RBRA 3MXJA 3LDSA 3LAKA 1KTQA 4FLVA 2HVIA 5KI6A 4E7LA 4CEOA 4OKJA 5FDLA 4OKEA 4CJWA 1NKBA 1ZBUA 3KLGA 1FK9A 3VQCA 3ZCMA 2E6LA 4JRQA 1B92A 3NAEA 5J2PA 4E3SA 3NF8A 1U47A 1HYVA 1TL3A 1U04A 3HXMA 1CXUA 4IG3A 2HHXA 3RWUA 1JLCA 1A5XA 3AO3A 1RBSA 1RT6A 2VG7A 3ZT3A 3JSMA 4FXDA 1F21A 1CLQA 3NGZA 4NCAA 1LWFA 1KVAA 1HNIA 2Z1HA 1Z25A 3QEVA 1ASUA 1EP4A 4CF0A 4F4KA 4DQSA 2F8TA 1TKZA 3EYZA 4AHCA 3V9SA 3WNHA 3NFAA 2HNDA 3QIPA 4DSFA 4CGJA 1FKOA 4Z0UA 4CJRA 2PYJA 2HVHA 3TWHA 5KRTA 1L3SA 1SKSA 3V9UA 1KVBA 4CK1A 4M3TA 3D45A 4OLBA 1S6QA 1S5JA 1TV6A 4IBNA 1RDCA 3QEIA 1NOYA 3P5JA 1IKYA 2HNYA 3V6DA 4OGEA 1KVCA 1K6YA 1WAJA 1LWCA 3IG1A 3VQ6A 1I39A 1T8EA 4KKOA 2YKNA 3L2WA 1BCOA 4W5NA 5D3GA 1JL1A 3MXMA 3I0RA 4HVJA 2X6SA 1JL2A 4IG0A 4CK3A 2R7YA 3SQ2A 5FRNA 5J2NA 4M3YA 5HP1A 3ZSQA 4YNQA 4FJHA 1RDDA 1YVUA 4CGDA 1ZYQA 1NK8A 2G8KA 1B9FA 3AA4A 3K5NA 4JS4A 1VSJA 3HP9A 2ETJA 2IAJA 4LSNA 2PYLA 4FJNA 4FJ9A 2HNZA 2RN2A 4ZHRA 3OJSA 3AA5X 3SQ4A 4H4OA 1LV5A 1N6QA 3V1QA 4RW6A 5CY4A 3QINA 1VSFA 4MQ3A 4CHPA 4M3WA 2D0BA 3CFPA 1BI4A 2WONA 4KHWA 1FKPA 3MEDA 1BQMA 4O44A 4H4MA 1Q9XA 3KTQA 3V9WA 5J2QA 4LSLA 4FLTA 2HB5A 4Y1CA 1S9EA 3VQEA 4KB0A 2XY5A 4K8ZA 1REVA 1HQEA 4N5SA 2HMIA 1YT3A 3SV3A 1SL0A 4M3UA 3OYFA 3ZSZA 4WE1A 3AO1A 4IDKA 3M8QA 3NH0A 4H8KA 4DTNA 4DSLA 3DYAA 2X74A 3ZSWA 4DSEA 4DFKA 3QEXA 1VRTA 4I9QA 4C8LA 3TAPA 4G1QA 3K2PA 2Y1JA 1B9DA 3AVLA 2DY4A 1G15A 3HPHA 2KZZA 3SQ0A 4CEBA 4CGIA 3RR7A 2IGIA 2XO7A 1T05A 3VQ8A 2NUBA 3NBPA 3MEEA 4J2AA 2IC3A 3NGIA 4DFMA 1U48A 3HYFA 4BWMA 3ZT0A 2G8FA 2OPRA 1SUQA 4CFBA 3C6UA 5KGXA 5CYMA 1R0AA 3VQ5A 2DFFA 5FRMA 3S9HA 3VA3A 1T7PA 3UIQA 3DLRA 2E4LA 2JGUA 4BE2A 1BQNA 4B8CA 4CF1A 3SCXA 3HO1A 3U3GA 3QESA 3TAMA 1HPZA 4CJSA 1C1AA 5KRSA 3V81A 1VSDA 2B5JA 3SJJA 4DU3A 4M45A 1CZBA 4M41A 4FYDA 3L3UA 1RTIA 3K58A 3PY8A 1EX4A 1WSIA 1I3AA 1BL3A 2FC0A 5T7BA 3HM9A 4PY5A 2YHAA 1HYZA 1X9SA 4W5TA 3AVIA 3OYHA 5HRNA 3RMDA 4QOZB 4ID1A 4O0IA 5JS1A 2ITGA 2HHSA 2D0AA 4DTOA 1U4BA 4CIEA 3AVFA 4CJFA 3K57A 4RG8A 3VA0A 4CJKA 2WOMA 1A5WA 4FM2A 1T03A 4QCLA 2KQ2A 4KRFA 3MEGA 3NE6A 5FROA 3TAFA 4FM1A 4C8MA 1WNSA 2FBYA 1QSSA 2XHBA 2Q3SA 4GMJB 4ID5A 4O4GA 3WNEA 4DTPA 2F8SA 4PQUA 1WSGA 3LALA 1SV5A 4GVMA 3SUNA 2QXFA 5E41A 2Z1IA 3O4QA 1C1BA 3L3VA 4CJTA 1RTDA 2HHWA 4HUGA 2OZSA 4ELUA 3KLIA 1KSPA 4W5RA 4Z4CA 4W5OA 1RDBA 1S1WA 3CFOA 3IRXA 4RW8A 1KLMA 1GOCA 1NJWA 3OS1A 1X9MA 1D8YA 4KHSA 4OLAA 3LZIA 4DTSA 3BDPA 1S9GA 5I42A 3TI0A 4O5BA 4FZXC 4ELVA 1RTHA 3F9KA 4LD0A 3ALYA 3ZSOA 1QHTA 1C0UA 3KLHA 1IH7A 1ITGA 1Q9YA 2AJQA 3ZT1A 5EU7A 3LPUA 1YTAA 1RT3A 3OYCA 1BCMA 1S1VA 3MXIA 4DQIA 4CE9A 4DU4A 1JXEA 4FLWA 4J2EA 2XY8A 1EXQA 3DRRA 3OJUA 1RNHA 4DF8A 3PX4A 3ZSVA 1TK0A 4CHQA 1WSEA 4B9SA 4DSKA 4CHNA 3OYAA 3VQPA 3PO5A 3VQ7A 5I3UA 1UAXA 3HP6A 3OYEA 4KTZA 2OZMA 3RR8A 4FZZA 2PY5A 1VSHA 2QKBA 3HJFA 1Z26A 1TKTA 1C0MA 2JLEA 2P5GA 3CQ8A 2IS3A 2FBVA 3KK2A 1IO2A 3IS9A 4FW1A 3RMAA 3NH1A 3M8RA 3AVNA 3V9ZA 2YNFA 3VQ9A 4CESA 2ZD1A 3O4NA 4FW2A 2O4IA 2KW4A 4AHVA 1TAQA 3PV8A 1NOZA 4Q0BA 3DOKA 3KD5E 3NF7A 4QAGA 4CFDA 2HHTA 2B4JA 4FJJA 1KLNA 3ISNC 4AHTA 4DFPA 1NJYA 4FLYA 2X6NA 3B6OA 1TK5A 3HVTA 1NK5A 1RT7A 3NCIA 4KTWA 4DLGA 4FJXA 1ASVA 4DMNA 3SUPA 1JXBA 3DLGA 4KAZA 3S3NA 1BIUA 1LAVA 3T19A 4E0DA 2HW3A 4DTRA 4N41A 2G8VA 4F2RA 1WAFA 5C42A 3OYNA 3A2FA 3HL8A 1NK7A 3LPTA 4CCHA 2Z1JA 1KFSA 4CEZA 3CM6A 1ZBIA 2KTQA 2GBZA 4CEQA 3AA3A 4E7HA 3KK3A 3G0ZA 1QSLA 4FLXA 1KCFA 4CERA 5C25A 5HLFA 4ZTJA 1DTTA 4I9LA 2BANA 3AVKA 3SZ2A 2HHQA 4NCGA 4KB1A 3I8DA 3PX6A 3OYBA 1BGXT 1W0HA 3NH2A 3HSTB 3AA2A 4RW4A 2IDOA 3OYGA 4FLUA 3HVRA 4LY7A 4DLEA 3LP3A 4KPYA 1HYSA 3NDKA 3ZT4A 1BIZA 2E6MA 5KTQA 3TARA 1HRHA 2RPIA 4F3OA 3OYDA 4C8NA 1TAUA 3U6FA 3SUQA 2IOCA 4BE1A 3C6TA 3M8SA 4M42A 4Z4EA 4N76A 3SUOA 1NK4A 3SQ1A 3L8BA 3LAMA 3AVMA 2RKIA 4DSJA 4KHNA 4N56A 4DQPA 2QK9A 1BHLA 5CZ1A 1C6VA 3V4IA 4KHYA 2BE2A 2P1JA 4DQRA 4TSXA 4Z4GA 2YNHA 2OPPA 3KJVA 1UOCA 3OYLA 4JRPA 1S6PA 1GOBA 1RT5A 4O55A 4J2DA 4K8XA 2ZE2A 2VWJA 4KHUA 2I5JA 5HROA 1WSHA 4CJ4A 5HRSA 1Q8IA 4B9TA 4HCBA 1UA1A 1RT2A 4CJLA 1JKHA 3KK1A 3QEPA 1IG9A 2GUIA 1WLJA 1XHXA 3K5OA 3AVHA 3V9XA 3SI6A 4AHRA 3ASMA 1MU2A 4IFVA 4BACA 4FK2A 3AVGA 5HRRA 3SV4A 4XIUA 2BDPA 1D9DA 2A1SA 2FBXA 4CJPA 3DLEA 1LAWA 3CM5A 2G8UA 3HK2A 4CEDA 4CF2A 1NKCA 1KRPA 2XY6A 1BISA 3DRSA 4HCCA 1JLGA 1HNVA 4AILC 2OYQA 1RBTA 3CYMA 1QS4A 3MECA 3PO4A 3IAYA 1D9FA 1Y97A 3L2VA 4DQQA 3HPGA 1ZBLA 2YV0X 4NYNA 3QIOA 4E1NA 3AVJA 4DTXA 4F2SA 1D5AA 1QTMA 3AVBA 4CEEA 4LH4A 3CFRA 3L2UA 4F8RA 1LW0A 3G10A 3D0PA 3LZJA 1L3TA 3LWMA 1VRUA 1X1PA 1UWBA 4E89A 1XHZA 1SL1A 3H08A 3TABA 1NKEA 4EZ6A 1WSJA 3AO5A 1QE1A 3AVCA 4O0JA 3WNFA 3THVA 4FK4A 1S1XA 4E19A 2VWKA 4CJUA 3ZSRA 3SPZA 3S3MA 1L5UA 4M3ZA 1UA0A 2GV9A 4B08A 3L2QA 1C1CA 4AH9A 1TGOA 4CK2A 3QEWA 5SZTA 3K59A 4DS4A 5KGWA 1TKDA 4CGHA 4JS5A 1FXXA 4BDPA 4FJGA 1N5YA 4PA1A 4PWDA 2DFEA 2EX3A 2VG6A 2D5RA 4OJRA 3QETA 4FJ7A 4Z4FA 1NK6A 1JLBA 3S3OA 1IKXA 1QSYA 1RT4A 1O1WA 2EHGA 2YKMA 1RT1A 1DLOA 4BWJA 3K5MA 4CGFA 5K14A 4CHYA 3LP0A 3RMBA 1HJRA 3KKRA 4B9UA 3NGYA 4KV8A 5J1EA 1ZBHA 2RF2A 4PUOA 3AV9A 4CGGA 1GOAA 4ZTFA 1DTQA 1RCHA 4RW7A 1NK9A 3KD1E 1LWEA 1RBUA 3DLHA 4DSIA 4OVLA 4FJLA 3L2RA 3AO4A 2ATQA 2KZMA 1XC9A 4AHUA 4KTQA 1VSKA 4Z4HA 1EETA 4FJ8A 4CECA 4HHTA 4B9NA 2OA8A 3V1OA 4FLZA 4NCBA 1CZ9A 2VG5A 2F96A 3OS0A 3M8PA 3PX0A 4FM0A 3RTVA 2X78A 4CJ5A 2DTUA 3DM2A 1J9AA 4ICLA 2G8WA 3AVAA 4GW6A 1JLFA 2XRIA 4IFYA 3OVNA 4HTUA 3CG7A 4W5QA 4DWIA 4KI6A 1SKWA 1C0TA 4CHZA 3QERA 3RRGA 4B9VA 4ELTA 4DTJA 1A5VA 3NF9A 3VQDA 3EZ5A 4Y1DA 3TAGA 2FBTA 4CIGA 1RTJA 3VQAA 1NK0A 3T1AA 4FK0A 2KFNA 3WNGA 4CEAA 2G8HA 4I2PA 4YFUA 1WSFA 1S1TA 3TAEA 1ASWA 4KFBA 1IKVA 2P5OA 4CJVA 3O3HA 3OYMA 3C94A 1J54A 4NYFA
chains in the Genus database with same CATH superfamily
5JVHL 4B9MA 3SNNA 3V1RA 4JI2K 3QNNA 1MA9B 1QZ5A 4A2AA 4EZ9A 4FJKA 2G8IA 1CXQA 1EKEA 4R5PA 4LH5A 3CXCM 3VN5A 3TR8A 1YJWN 4LF4K 3O9RA 4C8KA 1R59O 5SWMA 1FJGK 3WXMB 4K43A 4Q5VA 4QS9A 4F3TA 4HUEA 2E88A 3RRHA 5AQGA 3CCLN 3EY1A 1D4XA 4CD3A 1XC3A 4B1YB 4WQ5C 1TVRA 3TANA 3F73A 5DMRA 4IOCL 3U9ZA 5C12A 4KI4A 3E01A 2A40A 3RMCA 5CZ2A 4DG1A 2D0PA 2NRRA 1TL1A 4OKKA 2Z1GA 1RBVA 3CHWA 4IOAL 3LANA 2ZJRL 3ZSXA 3SMPA 1ILYA 2W42A 5KQDA 4B1VA 4X64K 4CZLA 5ADXH 4MDBA 2YNIA 1J5OA 2O8CA 4E7IA 4CF8A 3QNOA 4OPAA 1L3UA 3U4LA 1VQKN 4J2BA 3C95A 3AO2A 4AHSA 2OPQA 3LWLA 2WTUA 3F2KA 3MAQA 4I7FA 3OYKA 1Q82O 2ZJPL 4WF9L 4CFCA 4FL9A 2B6AA 1RBRA 1NGHA 5AQWA 3TTFA 2HBLA 2NRXA 3VF4A 4CJWA 3DJCA 1ZBUA 1GLFO 3PSFA 3VQCA 4RTFD 3I55N 1NU0A 2P9NA 1CXUA 2AA4A 5M1PA 3FLCO 1T3VA 4H0TB 3JAMO 1KC8O 1RBSA 2YX6A 4FXDA 1OH7A 4B3TK 1HNIA 3G25A 2F8TA 3VMFB 4DQSA 4DB3A 3EYZA 4IEIA 5AQIA 3T69A 4AHCA 2HNDA 4DSFA 4Z0UA 4CJRA 4DV6K 3TWHA 4YDUC 2VQFK 3DLLL 3V9UA 4CK1A 4M3TA 1TYQB 3D45A 2HMPA 1TV6A 4JKHA 3QEIA 1NOYA 1IKYA 3C6AA 4OGEA 1KVCA 3GE1A 1I39A 4E1JA 1T8EA 4KKOA 1BCOA 3CJAA 1JL2A 4IG0A 3SQ2A 3HM8A 2W6KA 5HP1A 4LF8K 5M1KA 3CJ7A 2HHHK 1NK8A 2G8KA 1B9FA 4K0KK 1EQYA 3VF2A 2ETJA 4LSNA 2PYLA 4CBWA 1XNRK 3FE1A 3OJSA 3EZWA 4Y0WA 3ZX3A 5F2RA 3V1QA 3O9TA 3SJHA 4RW6A 5AQVA 2P9UB 1JCEA 3M3ZA 4BR5A 5TKYA 4CHPA 1TUYA 4O44A 1Q9XA 3V9WA 4FLTA 4Y1CA 1S9EA 4K8ZA 5C2DA 4DV7K 1SL0A 3OYFA 2GX9A 1BU6O 4BRAA 4MO5A 3ZSWA 2A41A 3QEXA 1OVYA 3BY5A 4G1QA 1B9DA 3AVLA 4DV1K 4DR7K 2QA4N 4AQYK 4JI7K 3U9DA 2W41A 2JWKA 5AQRA 3RR7A 2IGIA 3IMXA 2IC3A 1BOTO 4DHYA 3P38A 4BWMA 1KQSM 4O8UA 3VF6A 1R0AA 3VQ5A 3S9HA 4A57A 2JGUA 4B8CA 4CF1A 3HO1A 2WBNA 3QESA 1HPZA 3V81A 1VSDA 3SJJA 5M1NA 4M41A 1Z05A 4C23A 3K58A 5AQNA 2FC0A 5T7BA 4CZMA 3ENHA 4W5TA 3AVIA 1WOQA 4GV6A 1HNZK 2ZWHA 4DTOA 4JK7A 4RG8A 3WEEB 4CJKA 2WOMA 5AQTA 3MEGA 3FZMA 4BC3A 5FROA 3TAFA 4FM1A 4C8MA 1K9MO 2XHBA 2Q3SA 3WNEA 5GIOA 5LJWA 2QXFA 3ZEUA 2Z1IA 1C1BA 4CJTA 4HUGA 4ELUA 3KLIA 4ILHA 1IG8A 3CC2N 4KHSA 3TSPA 5GIPA 3TI0A 1RTHA 3CPEA 1QHTA 1DGKN 4H5RA 4JKFA 1IH7A 2A3ZA 1OH5A 1C0GA 3IKMA 2VQEK 4FLWA 4OO1J 5AQYA 3VEYA 1YJ9N 4WQ4A 1UAXA 3LDLA 5AQUA 4G9ZA 4FWOA 4XH5A 3HJFA 1Z26A 3A8YA 2VYPA 3FZKA 1XNQK 2CGLA 3CQ8A 2P9SB 2UUCK 3M8RA 3V9ZA 3GDQA 3VQ9A 4CESA 2ZD1A 4BROA 3O4NA 3ZX0A 4Q0BA 1NOZA 5AQKA 2HHTA 1W2BM 3T1YK 4DFPA 3J8AA 4V19S 1WBBA 4F2RA 5C42A 2V7ZA 5LMNK 4DV0K 1ZBIA 2KTQA 2GBZA 3AA3A 3ZLJA 3KK3A 3G0ZA 5C25A 4ZTJA 4BRLA 3SZ2A 3CCEN 4H0OA 4XH1A 3I8DA 4KB1A 4FLUA 2NRZA 2QW9A 3HVRA 4DLEA 3DXKB 2RPIA 4F3OA 1M1KO 3OYDA 1TAUA 3U6FA 3SUQA 4M42A 3QDKA 4N76A 3SUOA 3LAMA 3MN9A 5CZ1A 4R79A 3V4IA 2BE2A 2YNHA 1J6ZA 4JRPA 5CHIA 1X3NA 3HSCA 4K8XA 1LCUA 3J81O 1BWFO 4B9TA 1W7AA 1UA1A 3QEPA 4BQLA 4FK2A 4BACA 3AVGA 2O8FB 3UKUA 2BDPA 1D9DA 3D2FB 3DLEA 4CEDA 2F7TA 1BISA 3VEOA 3CYMA 3PO4A 2VGMA 4A5BA 4CZFA 4DQQA 3OTOK 1K8KB 3AVJA 4KH5A 3FZHA 4GV9A 1QTMA 1JCGA 4CEEA 3SAHA 3L2UA 1VHXA 3G10A 2W40A 2KKZA 3D0PA 3LZJA 1VRUA 1X1PA 4EZ6A 4E89A 1XHZA 3H08A 4X66K 3PIOL 5BPLA 1QE1A 4A2BA 4WFAL 4FK4A 4DR4K 2P9LB 2VWKA 3S3MA 2GV9A 5GAHP 4CGHA 1HPMA 1YXQA 2EX3A 2VG6A 3QBXA 3C65A 4Z4FA 5FLXO 4I6MB 3S3OA 1QSYA 4AM6A 1O1WA 4PL7A 2FSNA 3K5MA 4CGFA 4CHYA 1QQOA 3NGYA 4GNIA 2RF2A 2VWBA 1DTQA 4DSIA 2D0OA 4FJLA 3QICA 4MLHA 1DT9A 5BRFA 2OA8A 3V1OA 3CIPA 3K9JA 2VG5A 5F0XA 1J9AA 2IVOA 3HBTA 1JLFA 3FGUA 3LM9A 1C0TA 1YUWA 3NF9A 3MK6A 4CIGA 3VQAA 1XUPO 4CEAA 4I2PA 4YFUA 4GVEA 3TAEA 4KFBA 3C94A 1J54A 3H3NO 4B1ZA 4KHQA 4Z4IA 1HUXA 4PL8A 1RDAA 1NJIO 4DU1A 4KREA 1WN7A 1YF5L 5HBMA 1U6ZA 1Z6RA 1V4TA 3O3GA 1VSEA 4FVMA 3O08A 3TTCA 3O3FA 3AGKA 2OPSA 1ZBFA 3TSQA 5HRPA 3MCPA 3L6QA 3KZBA 1U49A 5GAEP 3H46O 4ISEA 1RILA 4CJ7A 4CJQA 4RW9A 3A5OC 2LSNA 1U45A 3KKSA 3OYJA 4FOIA 4DF4A 3BGRA 4FJIA 4DUYK 3ITHA 1HQUA 1W9HA 3DAWA 3BZKA 1X9WA 4H5VA 3DRPA 2E2OA 4CJ3A 2F9WA 4DFJA 3B6PA 2IVPA 5C24A 3K5LA 4FCYA 1QQCA 2ZGYA 5KPTA 1VSIA 2A5XA 3MN5A 4E1MA 4BE0A 1HKGA 4DS5A 2OTJN 3ZSYA 1QQNA 4BC4A 3OBYA 4CEFA 1XI1A 3CCSN 1HLUA 4IO8A 1XQSC 3KIOA 1N33K 4CFAA 1K73O 5HL7L 3DWLA 4CHOA 1IKWA 1IBMK 5JVGL 1S1UA 3THXB 1SKRA 1VK0A 3OS2A 1L3VA 3MXJA 3J7YP 4JK9A 4CEOA 3VEZA 4H5WA 4JV5K 4OKEA 3KLGA 1FK9A 3WUHA 1B92A 3BUZB 4WQ4C 3NF8A 3O8MA 1U04A 3HXMA 1WUAA 3RWUA 4LF6K 3ZT3A 1ASUA 4RCHA 1TKZA 3WNHA 3CI5A 3QIPA 3H1VX 1FKOA 5KRTA 3B8AX 3J7AP 4CBXA 1S5JA 4IBNA 1YIJN 3VGKA 3P5JA 2Q97A 4BC5A 1K6YA 1WAJA 1LWCA 4Z94A 3O1BA 2WFBA 3M1FA 4W5NA 3F9MA 5D3GA 4CVNE 3L4IA 2R7YA 3UE5A 3ZSQA 1ATNA 3F5TA 4BR4A 5AFUH 4LFAK 1VSJA 4H0PA 5M1OA 2PAVA 1Q81O 3RSEB 1HR0K 4ZHRA 4JHDB 1NBWA 1LV5A 1N6QA 2F4VK 5CY4A 5C2FA 3QINA 4IXCA 4MQ3A 4M3WA 5JLFA 5BRDA 4KHWA 3MEDA 3CF5L 1BQMA 3ULEB 2HB5A 3BF3A 4JK8A 1REVA 1HQEA 4PHTX 4JAXA 4N5SA 3SV3A 3ZSZA 4C1NI 4JI1K 4H8KA 4DTNA 4BRHA 4DSLA 4DFKA 4I9QA 3TAPA 3I8BA 2Y1JA 3GBTA 4JYAK 4IEEA 3HPHA 2UXBK 3SQ0A 4CEBA 4CZJA 3VQ8A 2NUBA 3NBPA 4GKKK 5A2QO 2UXDK 1QVFM 4CFBA 3CJ9A 3E9PA 5KGXA 1TYQA 2Q0UA 3TAMA 5KRSA 1C1AA 2B5JA 1YHQN 3LM2A 3EEQA 5BPMA 4FYDA 3U8XA 2A42A 3MCAB 5AQJA 4PY5A 2YHAA 4IWVA 4YORA 4U7BA 5FPNA 3OYHA 4QOZB 3RMDA 1MWKA 4WFNL 1H1VA 2HHSA 1U4BA 4CIEA 1IBLK 4EFHA 5C0YA 3VA0A 1YJNN 3CC4N 2FF3B 2KQ2A 1WNSA 2F8SA 4O4GA 4A62A 4GVMA 1SV5A 3SUNA 2P9UA 3O4QA 3CERA 4ISFA 1RDBA 1S1WA 3IRXA 4W5OA 1D8YA 4YHHK 3CCJN 2E2QA 4DTSA 5AZIB 3R1XA 1C0UA 4KH4A 1N8RO 1ITGA 1Q9YA 3LPUA 1BCMA 1S1VA 4DQIA 4J2EA 2XY8A 3DRRA 3OJUA 5MLCQ 1TK0A 5LJVA 4DSKA 4CHNA 3PO5A 3VQPA 3VQ7A 3HP6A 2OZMA 3RR8A 4K41A 3BZCA 3O9UA 1C0MA 3E9LA 2P5GA 2IS3A 4HWIA 1X3MA 3CMAN 2D1KA 4AHVA 1E4GT 4QAGA 2B4JA 1NJYA 1S72N 3HOTA 3HVTA 4IFEA 3NCIA 4KTWA 4DLGA 1ASVA 3DLGA 1BIUA 1NGDA 1WAFA 3OYNA 3HL8A 5JICA 3LPTA 4ILJA 1KFSA 5AQLA 5AQHA 1NGJA 4NXMK 2BANA 1EWQA 3AVKA 3C6HA 3WEEA 2HHQA 5KQ8A 1BGXT 3D2EB 4RW4A 3LDNA 4RWTA 1OH8A 1MWMA 2YCHA 4LY7A 1YI2N 3LP3A 4BR0A 3TARA 3MX5A 1YITN 1HRHA 4C8NA 2O8BB 2IOCA 4BE1A 3C6TA 1NK4A 3SQ1A 3L8BA 1KAXA 3AVMA 4DSJA 4KHNA 5AQQA 3PSIA 3TSUA 4TSXA 4Z4GA 3KJVA 3QBWA 1UOCA 3VETA 2UUBK 1S6PA 1RT5A 4O55A 2GTDA 4IZ9A 4KHUA 2I5JA 1WSHA 4BRMA 3QB0A 2O8DB 4H03B 4BRIA 2G8FA 4YOTA 1NG9A 4AHRA 2QWOA 3ASMA 5C10A 1OH6A 3FR0A 1HNXK 5HRRA 3SV4A 4XIUA 2FBXA 5F1XA 4CJPA 1HX1A 2YI1A 3VPZA 1NKCA 2P9SA 3ZX2A 2XY6A 4HCCA 3P31A 3QMLA 1JLGA 4AILC 5DM7L 1QS4A 3ENOA 3L2VA 3H6EA 4F2SA 1D5AA 3L0QA 2QWRA 4FWQA 4CZGA 4FWPA 3LWMA 4YOYA 1SL1A 1NKEA 3TABA 1WSJA 3AO5A 4O0JA 4E19A 1KAZA 4CJUA 5E26A 3UKRB 4M3ZA 5KPZA 4B08A 4CK2A 3VESA 3K59A 5B8HA 3C0BA 4JS5A 4BDPA 4PWDA 2DFEA 1NK6A 1JLBA 1IKXA 1RT4A 3DXKA 2WUSA 3NVKA 3THWB 1HJRA 1VAZA 3KKRA 2FSKA 4B9UA 1ZBSA 3PIPL 3T1HK 4CGGA 1GOAA 4ZTFA 3SMSA 1LWEA 4MO4A 2ATQA 1XC9A 1FW6A 4AHUA 1VSKA 3G6EN 4HHTA 4FLZA 4NCBA 1CZ9A 4NLCA 2Q31A 4IFYA 3OVNA 4DWIA 2QI2A 3CG7A 4KI6A 2O8FA 4LF7K 3D2FA 4GY2B 1A5VA 1GLDG 3EE9A 3K0SA 3VQDA 1QVGM 5AQXA 2FBTA 3AARA 1RTJA 4B3SK 4KBOA 3WNGA 2G8HA 3CCRN 3Q7CA 3EN9A 2ZF5O 4BY9C 3O3HA 4QS8A 3OYMA 2ZGZA 1U2VB 4NYFA 1NMDA 1K8KA 3NVMA 4BR9A 4L8RB 4UQGA 4E7JA 3OYIA 4FWNA 3VQBA 1SL2A 2ZQBA 3WXKA 3SPYA 2HHUA 2P9IB 3JYTA 3LDQA 3NF6A 1JLQA 2YNGA 3LP2A 2P9LA 3O9QA 4B8AB 2A1RA 3SAFA 5J2MA 1LW2A 4H5NA 4HUFA 3KLEA 3P1GA 1JLAA 1NJXA 2OTLN 2D0CA 3KLFA 2KFZA 1OKJA 5H1SQ 1ESVA 3QLHA 5BR8K 3HRGA 4JKBA 4I6MA 1T6CA 3KK7A 4BVPA 1JLEA 5DK5A 2YHYA 4I2QA 3VQQA 1HMVA 1XMQK 3WXJA 4DUZK 3H3OB 2CH5A 3ULDA 4OPJA 4DTUA 4X65K 3OW2M 3ZETB 4E7KA 3DI6A 2QEXN 4LFCK 2P9PB 4KO0A 2Y1IA 4M3RA 4MFBA 3TAQA 1S22A 5ADXA 4JNEA 1VQ7N 1NGFA 4DV2K 4OGCA 1NJZA 2BGGA 1NGBA 2OANA 2Q0RA 4M7XA 3MMVA 4CIFA 3DOLA 1GLLO 3CETA 4FJ5A 4QS7A 2E20A 4JKCA 4NXNK 3FFIA 4BRQA 3MWPA 2QWQA 1J53A 3SYZA 3HPOA 1XWLA 2XY7A 4B1WB 1HNWK 1JCFA 4M7YA 5JS2A 3DLKA 1BI4B 3D7EO 4DKWA 1VQPN 2EWSA 3QO9A 3VQ4A 5TKWA 3DLBA 1KTQA 4WYBA 4OKJA 1NKBA 1NLVA 1O13A 2GWJA 2E6LA 4IO9L 2YHXA 1YVNA 2O8EB 4PKHA 1JLCA 1A5XA 3AO3A 3JSMA 1CLQA 3NGZA 1KVAA 1Z25A 3QEVA 1EP4A 5FPDA 4BGAA 1N34K 2YHWA 3V9SA 4CGJA 2HVHA 3THYB 2KHOA 1L3SA 1SKSA 4BGBA 1KVBA 2QWLA 4YOWA 4OLBA 1GLEG 3V6DA 2HNYA 4BRDA 2GELA 3IG1A 3VQ6A 3CJ1A 3P39A 2YKNA 3L2WA 1MDUB 1JL1A 3SBGA 3MXMA 3I0RA 4CK3A 2X6SA 5FRNA 5J2NA 3IDHA 4YNQA 4FJHA 1RDDA 4CGDA 4H0VB 3K5NA 4BRFA 4JS4A 3HP9A 4FJNA 4FJ9A 1KXPA 2RN2A 2QWMA 3CC7N 4FWLA 3SQ4A 4H4OA 2NRWA 5BREA 3VENA 2D0BA 3CFPA 1WBDA 2WONA 5GAGP 1FKPA 3THXA 5J2QA 2HBMA 4LSLA 3VQEA 4DR5K 2XY5A 2HMIA 1YT3A 2P9KB 4WE1A 4IDKA 3DYAA 2X74A 1VRTA 4C8LA 5AQSA 4DR2K 1SS6A 3D6RA 4CGIA 1T05A 4J8FA 1P90A 1K8AO 4J2AA 5AQOA 3NGIA 1U48A 3ZT0A 3EO3A 1RFQA 2OPRA 1SUQA 2AP1A 3C6UA 3IUCA 5CYMA 2DFFA 1T7PA 3DLRA 2E4LA 4BE2A 1BQNA 1S3XA 3FZFA 3SLCA 3U3GA 2QWPA 3GL1A 4DV3K 4DU3A 1BDGA 4M45A 2CGKA 1CZBA 1DKGD 3SAGA 4BG9A 1RTIA 3PY8A 1EX4A 3HM9A 1C0FA 4FWMA 1X9SA 3BEXA 1N32K 5HRNA 5JS1A 3N4PA 4O0IA 1M90O 2NRTA 3LL3A 3M5RA 3LDPA 3AVFA 4CJFA 5KPRA 3K57A 4FM2A 3RSEA 1T03A 1OVQA 4JHDA 4KRFA 1QSSA 2FBYA 4BRKA 3G71N 4ID5A 1EWRA 5LY3A 3DXMB 1RTDA 3L3VA 2HHWA 2OZSA 5AQFA 4W5RA 4Z4CA 2I7PA 3CFOA 1EO1A 3SBTA 1GLBG 4OLAA 4DR1K 3ULEA 3BDPA 4O5BA 4ELVA 3ALYA 3ZSOA 1JJ2M 5M1QA 4FWKA 3KLHA 3CJBA 5GINA 3ZT1A 5EU7A 1SAZA 1GLJO 1RT3A 4A59A 3NMUA 4JKGB 1G99A 1EXQA 1RNHA 1NGGA 3ZSVA 5I3UA 1V4SA 5CE3A 4FZZA 2PY5A 1VSHA 4IDHA 3FFKB 1VQ4N 1TKTA 2HF4A 2JLEA 2VCPA 4BQZA 1IO2A 4FW1A 4YOVA 3RMAA 3AVNA 2YNFA 2E8AA 1QHAA 4PKGA 1WB9A 4CD1A 3A0IX 1TAQA 4FOEA 3L4QA 3NF7A 5JMVA 3A5MC 1KLNA 3BF1A 3ISNC 4LF5K 4FLYA 1TK5A 3H45C 1RT7A 1LOTB 4FJXA 4DMNA 3SUPA 4JD2B 1JXBA 1LAVA 4BC2A 2HW3A 4DTRA 4N41A 2V7YA 4F9OA 3A2FA 2DPNA 2Z1JA 4HTLA 3O5BA 3VERA 4CEZA 3CM6A 4DR6K 4CEQA 3WQUA 4FLXA 4CERA 5HLFA 4I9LA 3C7NB 4NCGA 3PX6A 4X62K 4H0YB 4B1UB 3JS6A 3WXLA 3I33A 3OYGA 1KD1O 4LC9B 4KPYA 1HYSA 3NDKA 3ZT4A 1RDWX 5KTQA 2E6MA 5AZJB 4H5TA 1TUUA 4JI0K 1IBKK 4K25A 2H3GX 2ASOA 2QXLA 5AZIA 5LL6Z 4N56A 2QK9A 4FVUA 4B9QA 3AGRA 3BP8A 3GG4A 4KHYA 3JXUA 2NRHA 3CQYA 1IJJA 1CZAN 2OPPA 4ILGB 3VGMA 3RVCA 2ZE2A 2VWJA 4CJ4A 4XEIA 4BVOA 4HCBA 1SQKA 3K9KA 4CJLA 1JKHA 2ITMA 1IG9A 2GUIA 1WLJA 1XHXA 4BR2A 3AVHA 4IFVA 5EOYA 1NM1A 2A1SA 2G8UA 4CF2A 3MDQA 3CD6N 3R8EA 2OYQA 1ZXOA 4B3RK 5IWAK 3MECA 3LDOA 2QTDA 5C15A 1W97L 3VEWA 2YV0X 2UYTA 4E1NA 4DTXA 3O6WA 3KVGA 4IJNA 3O9SA 2Q2RA 1LW0A 2ZM6K 1L3TA 5CR4A 1UWBA 3O80A 3AVCA 3THVA 1S1XA 1L5UA 3ZSRA 3CCQN 3L2QA 1C1CA 1IV0A 4AH9A 1TGOA 3QEWA 5SZTA 4DS4A 3TPQA 5KGWA 4FJGA 2HBKA 3D2EA 4PA1A 5FPEA 4GV3A 4OJRA 3VTIA 4MLEA 3VEVA 2UXCK 2YKMA 4BWJA 1E4FT 5K14A 3RMBA 1Q18A 3LP0A 1ATRA 2O8BA 1T6DA 1GLAG 2KLAA 1ZBHA 4PUOA 2GUPA 1NK9A 1NMNA 3KD1E 1RCHA 4RW7A 4XH4A 4IOXA 3ATUA 1KAYA 4NO7A 4OVLA 3L2RA 3AO4A 2KZMA 4KTQA 1ATSA 5AR0A 2BH1A 4FJ8A 3PLAA 4B9NA 2D4WA 5ELZA 4AM7A 2O8DA 2E2PA 3M8PA 3PX0A 3RTVA 5GADP 3DM2A 4ICLA 2G8WA 3AVAA 2XRIA 3AAPA 4HTUA 4W5QA 1QQMA 1SKWA 4CI6A 3RRGA 3G4SN 5AQPA 2O8CB 3EZ5A 4Y1DA 4NLBA 2RE2A 4FK0A 3T1AA 1S1TA 1ASWA 2GEMA 4CJVA 4JKAA 4AF1A 4FPBA 4BG8A 4EP4A 2IIRA 5EX5A 3E9OA 2VGNA 1T44A 3LP1A 3TU5A 3CJCA 3KHYA 2P51A 5AQMA 3GOIA 1TK8A 2QM1A 3UKRA 2QKKA 1I94K 3I0SA 4KH6A 1KFDA 2P9NB 2IVNA 2FLOA 4BDZA 3MWTA 4OPHA 4C8OA 1YAGA 3P83D 1YTUA 4EP5A 4BDYA 3MN6A 3THWA 3R3LA 2YHBA 4LFBK 1NGCA 2PZSA 3HT3A 4B9LA 4IKFA 3QFPA 5HOOA 4B3OA 4JI4K 1VSMA 4FPAA 1P8ZA 2O4GA 4JLHA 3ZT2A 2WC9A 3VOVA 4CF9A 3J7ZO 1J5EK 5BRHA 5I9EB 1TKXA 3PUFA 2HHVA 4B1XB 2BTFA 3T3FA 1NNEA 3N4QA 3U3YA 4OPKA 5CYQA 2PFUA 3DMJA 2UUAK 3NHGA 3HTVA 4EHTA 3OY9A 4DTMA 1N36K 3OA9A 1VSLA 4M3XA 4CJEA 4FJMA 1U2VA 4N47A 4DQ8A 2DFHA 5EY4A 3A5LC 3AAQA 1VQMN 3LDSA 3LAKA 4FLVA 2HVIA 5FPMA 5KI6A 3M6GA 4E7LA 5FDLA 3HOSA 2P9IA 2NNWA 3ZCMA 5AQZA 4JRQA 1VQ5N 1HJOA 3NAEA 5J2PA 4E3SA 1U47A 1NGEA 1HYVA 1VQ8N 3EKUA 1TL3A 4IG3A 2HHXA 3WT0A 1RT6A 2VG7A 1F21A 1Q7YO 3E66A 4NCAA 4EAHD 1VQ6N 1LWFA 2Z1HA 2NRVA 3KWGA 2YJFA 4F4KA 4CF0A 3CQXA 1BO5O 3NFAA 2PYJA 3FZLA 1NGIA 4O8KA 2FF6A 3WQTA 4CBUA 1S6QA 1RDCA 5AJ3K 3ZETA 4BRPA 2P9PA 4JEPA 1VQLN 4OX9K 3CPWM 3VEXA 4HVJA 1HKCA 3W3DA 5AFUA 4M3YA 2FXUA 1YVUA 1ZYQA 3AA4A 4FSVA 2IAJA 2HNZA 3EKSA 3MN7A 3AA5X 5JLHA 2CH6A 1VQNN 3ZEUB 1BG3A 3S41A 1NGAA 1VSFA 4BRNA 2BUPA 1BI4A 4H4MA 3KTQA 4KB0A 2QWNA 4BRCA 3OBWA 4M3UA 3AO1A 3M8QA 3NH0A 3IFRA 3CCVN 3MX2A 4DSEA 3ZYYX 4BR7A 3K2PA 4JI6K 4O5FA 4CZEA 2DY4A 1G15A 2KZZA 2O8EA 2XO7A 5E84A 1HKBA 3MEEA 1XMOK 3O4WA 4DFMA 3HYFA 2HBJA 1RGIA 4JI5K 4DR3K 5FRMA 3ID6A 3VA3A 3UIQA 4NB4A 4CZKA 3THYA 3HI0A 3SCXA 4LF9K 4CJSA 3HZ6A 4GKJK 4WQ5A 2F9TA 3L3UA 4JKEA 1WSIA 1I3AA 1BL3A 4C1NK 2V51B 4K42A 1HYZA 4BREA 4ID1A 2ITGA 1BUPA 2D0AA 1GLCG 3VTHA 1A5WA 3ID8A 4QCLA 3NE6A 5DM6L 5EVZA 1NWKA 4MDAA 4GMJB 3CCMN 1VQON 4PQUA 4DTPA 3VGLA 1WSGA 3LALA 5E41A 1KSPA 1ZC6A 4RW8A 3UB5A 1NJWA 1X9MA 1GOCA 1KLMA 2NLXA 4PKIA 4YY3K 3OS1A 2CGJA 3W0LA 3LZIA 1S9GA 5I42A 4FZXC 3F9KA 4LD0A 2P9KA 4FWRA 3I56N 2AJQA 3ATVA 1YTAA 3OYCA 3MXIA 4CE9A 4DU4A 1JXEA 2PBDA 3EE8A 4DF8A 3PX4A 4CHQA 1WSEA 4B9SA 3OYAA 5BPNA 3OYEA 4KTZA 2RHKA 4H0XB 1VQ9N 2QKBA 2E1ZA 3UKUB 1Y64A 1BA0A 2FBVA 3KK2A 3IS9A 3NH1A 1Q86O 2J4RA 5BN8A 2O4IA 4FW2A 2KW4A 2V52B 3PV8A 4EHUA 3DOKA 3KD5E 4CFDA 4FJJA 4AHTA 2X6NA 3B6OA 4YDUA 1NK5A 4JI8K 4FWSA 2OCEA 3T7ZA 2ZJQL 4KAZA 3S3NA 3T19A 2ASMA 4E0DA 4A5AA 2G8VA 1NK7A 4CCHA 4KHPK 2JWLA 2HSTA 4E7HA 1X9JA 2ASPA 1QSLA 1KCFA 1E3MA 1DTTA 2Q1NA 3OYBA 1W0HA 3NH2A 3HSTB 3AA2A 3CMEN 2IDOA 5BR9A 4L3QA 4DCHA 4DV5K 3DXMA 1BIZA 4B3MK 1DEJA 2UU9K 3M8SA 4Z4EA 2RKIA 4DQPA 1BHLA 3WXIA 1C6VA 1SZ2A 2P1JA 4DQRA 3AY9A 4WCEL 3OYLA 2YJEA 1GOBA 4J2DA 4JKGA 3R9PA 3EL2A 4WFBL 5HROA 5HRSA 1Q8IA 2W6LA 1RT2A 3KK1A 3E1YA 3K5OA 4FZYA 3V9XA 3SI6A 3R6MA 1MU2A 3ENBA 5M1FA 5BN9A 4U67L 4JN4A 4BRGA 3J80O 1LAWA 3CM5A 3HK2A 1KRPA 3DRSA 1HNVA 1RBTA 3CCUN 3IAYA 1D9FA 1Y97A 3HPGA 4FO0A 1ZBLA 4NYNA 3QIOA 3A5NC 4JD2A 3AVBA 4LH4A 3CFRA 4F8RA 2A6AA 5EXWA 3WNFA 2FSJA 1QZ6A 3TTDA 4DV4K 2E5LK 3H1QA 3SPZA 2GWKA 1UA0A 2E1YA 3C7NA 2E2NA 1TKDA 4A61A 1FXXA 1N5YA 4IJAA 4FJ7A 2D5RA 3QETA 2HOEA 2EHGA 1RT1A 1DLOA 3QFUA 5AZJA 4CW7B 4KV8A 5J1EA 4CZIA 3AV9A 4YOUA 1RBUA 3OHRA 4YOXA 4M63C 3DLHA 3SK3A 5LMUK 2HF3A 4JI3K 4JKDA 4Z4HA 2NZTA 5IT9O 1EETA 2I7NA 4CECA 3OS0A 2F96A 2DTUA 4FM0A 2X78A 4CJ5A 3P4IA 1RDUA 4GW6A 4CZHA 2Q36A 4CHZA 3QERA 4ELTA 4B9VA 3Q7BA 4ISGA 4DTJA 4UY8O 3TAGA 4EIAA 2KFNA 1NK0A 1BA1A 3KWIA 1WSFA 3O1WA 1IKVA 2P5OA
chains in the Genus database with same CATH topology
4B9MA 3SNNA 3V1RA 4L8RB 4KHQA 4Z4IA 4EP4A 4UQGA 4E7JA 1RDAA 4FZYA 3QNNA 4DU1A 3OYIA 4KREA 3VQBA 1SL2A 1WN7A 2ZQBA 5HBMA 3SPYA 3LP1A 4EZ9A 3O3GA 4FJKA 1VSEA 4FVMA 2G8IA 1CXQA 2HHUA 3JYTA 1EKEA 2P51A 3NF6A 1JLQA 4R5PA 2YNGA 3O3FA 3LP2A 4LH5A 4B8AB 2A1RA 2QKKA 1TK8A 5J2MA 2OPSA 1ZBFA 1LW2A 3I0SA 5HRPA 3VN5A 4HUFA 3TR8A 1KFDA 4BDZA 3KLEA 3P1GA 1JLAA 1NJXA 2D0CA 4C8KA 3KLFA 1U49A 2KFZA 5SWMA 3QLHA 4C8OA 1RILA 3P83D 1YTUA 4EP5A 4BDYA 4Q5VA 4F3TA 4HUEA 4CJQA 1JLEA 4RW9A 5DK5A 3RRHA 2LSNA 1U45A 3EY1A 3KKSA 2YHBA 4I2QA 3VQQA 3OYJA 2PZSA 3HT3A 1HMVA 4B9LA 4DF4A 4IKFA 1TVRA 3TANA 3F73A 3ULDA 5DMRA 3BGRA 4OPJA 4DTUA 4FJIA 4B3OA 1VSMA 3ITHA 1HQUA 4KI4A 4E7KA 1W9HA 3DI6A 1X9WA 3E01A 4KO0A 2Y1IA 2O4GA 4JLHA 4M3RA 3DRPA 3ZT2A 4CF9A 3RMCA 4CJ3A 4MFBA 5CZ2A 4DG1A 4DFJA 3B6PA 3TAQA 5C24A 3K5LA 1TL1A 4FCYA 1QQCA 4OKKA 1TKXA 2Z1GA 1RBVA 1VSIA 3LANA 3PUFA 4E1MA 4BE0A 4DS5A 3ZSYA 2HHVA 3ZSXA 1NJZA 2BGGA 4OGCA 4CEFA 3T3FA 2W42A 1XI1A 4CIFA 2YNIA 3DOLA 3KIOA 3U3YA 4OPKA 4E7IA 5CYQA 4CF8A 4CFAA 3QNOA 1J5OA 4FJ5A 3DMJA 1L3UA 3NHGA 3FFIA 4CHOA 1IKWA 4J2BA 3OY9A 4DTMA 1J53A 3C95A 3HPOA 3SYZA 3AO2A 4AHSA 2OPQA 1XWLA 3LWLA 2XY7A 1VSLA 4M3XA 3MAQA 4I7FA 4CJEA 4FJMA 5JS2A 3OYKA 4N47A 1S1UA 3DLKA 1BI4B 1SKRA 2DFHA 4CFCA 1VK0A 3QO9A 3OS2A 3VQ4A 1L3VA 2B6AA 3DLBA 1RBRA 3MXJA 3LDSA 3LAKA 1KTQA 4FLVA 2HVIA 5KI6A 4E7LA 4CEOA 4OKJA 5FDLA 4OKEA 4CJWA 1NKBA 1ZBUA 3KLGA 1FK9A 3VQCA 3ZCMA 2E6LA 4JRQA 1B92A 3NAEA 5J2PA 4E3SA 3NF8A 1U47A 1HYVA 1TL3A 1U04A 3HXMA 1CXUA 4IG3A 2HHXA 3RWUA 1JLCA 1A5XA 3AO3A 1RBSA 1RT6A 2VG7A 3ZT3A 3JSMA 4FXDA 1F21A 1CLQA 3NGZA 4NCAA 1LWFA 1KVAA 1HNIA 2Z1HA 1Z25A 3QEVA 1ASUA 1EP4A 4CF0A 4F4KA 4DQSA 2F8TA 1TKZA 3EYZA 4AHCA 3V9SA 3WNHA 3NFAA 2HNDA 3QIPA 4DSFA 4CGJA 1FKOA 4Z0UA 4CJRA 2PYJA 2HVHA 3TWHA 5KRTA 1L3SA 1SKSA 3V9UA 1KVBA 4CK1A 4M3TA 3D45A 4OLBA 1S6QA 1S5JA 1TV6A 4IBNA 1RDCA 3QEIA 1NOYA 3P5JA 1IKYA 2HNYA 3V6DA 4OGEA 1KVCA 1K6YA 1WAJA 1LWCA 3IG1A 3VQ6A 1I39A 1T8EA 4KKOA 2YKNA 3L2WA 1BCOA 4W5NA 5D3GA 1JL1A 3MXMA 3I0RA 4HVJA 2X6SA 1JL2A 4IG0A 4CK3A 2R7YA 3SQ2A 5FRNA 5J2NA 4M3YA 5HP1A 3ZSQA 4YNQA 4FJHA 1RDDA 1YVUA 4CGDA 1ZYQA 1NK8A 2G8KA 1B9FA 3AA4A 3K5NA 4JS4A 1VSJA 3HP9A 2ETJA 2IAJA 4LSNA 2PYLA 4FJNA 4FJ9A 2HNZA 2RN2A 4ZHRA 3OJSA 3AA5X 3SQ4A 4H4OA 1LV5A 1N6QA 3V1QA 4RW6A 5CY4A 3QINA 1VSFA 4MQ3A 4CHPA 4M3WA 2D0BA 3CFPA 1BI4A 2WONA 4KHWA 1FKPA 3MEDA 1BQMA 4O44A 4H4MA 1Q9XA 3KTQA 3V9WA 5J2QA 4LSLA 4FLTA 2HB5A 4Y1CA 1S9EA 3VQEA 4KB0A 2XY5A 4K8ZA 1REVA 1HQEA 4N5SA 2HMIA 1YT3A 3SV3A 1SL0A 4M3UA 3OYFA 3ZSZA 4WE1A 3AO1A 4IDKA 3M8QA 3NH0A 4H8KA 4DTNA 4DSLA 3DYAA 2X74A 3ZSWA 4DSEA 4DFKA 3QEXA 1VRTA 4I9QA 4C8LA 3TAPA 4G1QA 3K2PA 2Y1JA 1B9DA 3AVLA 2DY4A 1G15A 3HPHA 2KZZA 3SQ0A 4CEBA 4CGIA 3RR7A 2IGIA 2XO7A 1T05A 3VQ8A 2NUBA 3NBPA 3MEEA 4J2AA 2IC3A 3NGIA 4DFMA 1U48A 3HYFA 4BWMA 3ZT0A 2G8FA 2OPRA 1SUQA 4CFBA 3C6UA 5KGXA 5CYMA 1R0AA 3VQ5A 2DFFA 5FRMA 3S9HA 3VA3A 1T7PA 3UIQA 3DLRA 2E4LA 2JGUA 4BE2A 1BQNA 4B8CA 4CF1A 3SCXA 3HO1A 3U3GA 3QESA 3TAMA 1HPZA 4CJSA 1C1AA 5KRSA 3V81A 1VSDA 2B5JA 3SJJA 4DU3A 4M45A 1CZBA 4M41A 4FYDA 3L3UA 1RTIA 3K58A 3PY8A 1EX4A 1WSIA 1I3AA 1BL3A 2FC0A 5T7BA 3HM9A 4PY5A 2YHAA 1HYZA 1X9SA 4W5TA 3AVIA 3OYHA 5HRNA 3RMDA 4QOZB 4ID1A 4O0IA 5JS1A 2ITGA 2HHSA 2D0AA 4DTOA 1U4BA 4CIEA 3AVFA 4CJFA 3K57A 4RG8A 3VA0A 4CJKA 2WOMA 1A5WA 4FM2A 1T03A 4QCLA 2KQ2A 4KRFA 3MEGA 3NE6A 5FROA 3TAFA 4FM1A 4C8MA 1WNSA 2FBYA 1QSSA 2XHBA 2Q3SA 4GMJB 4ID5A 4O4GA 3WNEA 4DTPA 2F8SA 4PQUA 1WSGA 3LALA 1SV5A 4GVMA 3SUNA 2QXFA 5E41A 2Z1IA 3O4QA 1C1BA 3L3VA 4CJTA 1RTDA 2HHWA 4HUGA 2OZSA 4ELUA 3KLIA 1KSPA 4W5RA 4Z4CA 4W5OA 1RDBA 1S1WA 3CFOA 3IRXA 4RW8A 1KLMA 1GOCA 1NJWA 3OS1A 1X9MA 1D8YA 4KHSA 4OLAA 3LZIA 4DTSA 3BDPA 1S9GA 5I42A 3TI0A 4O5BA 4FZXC 4ELVA 1RTHA 3F9KA 4LD0A 3ALYA 3ZSOA 1QHTA 1C0UA 3KLHA 1IH7A 1ITGA 1Q9YA 2AJQA 3ZT1A 5EU7A 3LPUA 1YTAA 1RT3A 3OYCA 1BCMA 1S1VA 3MXIA 4DQIA 4CE9A 4DU4A 1JXEA 4FLWA 4J2EA 2XY8A 1EXQA 3DRRA 3OJUA 1RNHA 4DF8A 3PX4A 3ZSVA 1TK0A 4CHQA 1WSEA 4B9SA 4DSKA 4CHNA 3OYAA 3VQPA 3PO5A 3VQ7A 5I3UA 1UAXA 3HP6A 3OYEA 4KTZA 2OZMA 3RR8A 4FZZA 2PY5A 1VSHA 2QKBA 3HJFA 1Z26A 1TKTA 1C0MA 2JLEA 2P5GA 3CQ8A 2IS3A 2FBVA 3KK2A 1IO2A 3IS9A 4FW1A 3RMAA 3NH1A 3M8RA 3AVNA 3V9ZA 2YNFA 3VQ9A 4CESA 2ZD1A 3O4NA 4FW2A 2O4IA 2KW4A 4AHVA 1TAQA 3PV8A 1NOZA 4Q0BA 3DOKA 3KD5E 3NF7A 4QAGA 4CFDA 2HHTA 2B4JA 4FJJA 1KLNA 3ISNC 4AHTA 4DFPA 1NJYA 4FLYA 2X6NA 3B6OA 1TK5A 3HVTA 1NK5A 1RT7A 3NCIA 4KTWA 4DLGA 4FJXA 1ASVA 4DMNA 3SUPA 1JXBA 3DLGA 4KAZA 3S3NA 1BIUA 1LAVA 3T19A 4E0DA 2HW3A 4DTRA 4N41A 2G8VA 4F2RA 1WAFA 5C42A 3OYNA 3A2FA 3HL8A 1NK7A 3LPTA 4CCHA 2Z1JA 1KFSA 4CEZA 3CM6A 1ZBIA 2KTQA 2GBZA 4CEQA 3AA3A 4E7HA 3KK3A 3G0ZA 1QSLA 4FLXA 1KCFA 4CERA 5C25A 5HLFA 4ZTJA 1DTTA 4I9LA 2BANA 3AVKA 3SZ2A 2HHQA 4NCGA 4KB1A 3I8DA 3PX6A 3OYBA 1BGXT 1W0HA 3NH2A 3HSTB 3AA2A 4RW4A 2IDOA 3OYGA 4FLUA 3HVRA 4LY7A 4DLEA 3LP3A 4KPYA 1HYSA 3NDKA 3ZT4A 1BIZA 2E6MA 5KTQA 3TARA 1HRHA 2RPIA 4F3OA 3OYDA 4C8NA 1TAUA 3U6FA 3SUQA 2IOCA 4BE1A 3C6TA 3M8SA 4M42A 4Z4EA 4N76A 3SUOA 1NK4A 3SQ1A 3L8BA 3LAMA 3AVMA 2RKIA 4DSJA 4KHNA 4N56A 4DQPA 2QK9A 1BHLA 5CZ1A 1C6VA 3V4IA 4KHYA 2BE2A 2P1JA 4DQRA 4TSXA 4Z4GA 2YNHA 2OPPA 3KJVA 1UOCA 3OYLA 4JRPA 1S6PA 1GOBA 1RT5A 4O55A 4J2DA 4K8XA 2ZE2A 2VWJA 4KHUA 2I5JA 5HROA 1WSHA 4CJ4A 5HRSA 1Q8IA 4B9TA 4HCBA 1UA1A 1RT2A 4CJLA 1JKHA 3KK1A 3QEPA 1IG9A 2GUIA 1WLJA 1XHXA 3K5OA 3AVHA 3V9XA 3SI6A 4AHRA 3ASMA 1MU2A 4IFVA 4BACA 4FK2A 3AVGA 5HRRA 3SV4A 4XIUA 2BDPA 1D9DA 2A1SA 2FBXA 4CJPA 3DLEA 1LAWA 3CM5A 2G8UA 3HK2A 4CEDA 4CF2A 1NKCA 1KRPA 2XY6A 1BISA 3DRSA 4HCCA 1JLGA 1HNVA 4AILC 2OYQA 1RBTA 3CYMA 1QS4A 3MECA 3PO4A 3IAYA 1D9FA 1Y97A 3L2VA 4DQQA 3HPGA 1ZBLA 2YV0X 4NYNA 3QIOA 4E1NA 3AVJA 4DTXA 4F2SA 1D5AA 1QTMA 3AVBA 4CEEA 4LH4A 3CFRA 3L2UA 4F8RA 1LW0A 3G10A 3D0PA 3LZJA 1L3TA 3LWMA 1VRUA 1X1PA 1UWBA 4E89A 1XHZA 1SL1A 3H08A 3TABA 1NKEA 4EZ6A 1WSJA 3AO5A 1QE1A 3AVCA 4O0JA 3WNFA 3THVA 4FK4A 1S1XA 4E19A 2VWKA 4CJUA 3ZSRA 3SPZA 3S3MA 1L5UA 4M3ZA 1UA0A 2GV9A 4B08A 3L2QA 1C1CA 4AH9A 1TGOA 4CK2A 3QEWA 5SZTA 3K59A 4DS4A 5KGWA 1TKDA 4CGHA 4JS5A 1FXXA 4BDPA 4FJGA 1N5YA 4PA1A 4PWDA 2DFEA 2EX3A 2VG6A 2D5RA 4OJRA 3QETA 4FJ7A 4Z4FA 1NK6A 1JLBA 3S3OA 1IKXA 1QSYA 1RT4A 1O1WA 2EHGA 2YKMA 1RT1A 1DLOA 4BWJA 3K5MA 4CGFA 5K14A 4CHYA 3LP0A 3RMBA 1HJRA 3KKRA 4B9UA 3NGYA 4KV8A 5J1EA 1ZBHA 2RF2A 4PUOA 3AV9A 4CGGA 1GOAA 4ZTFA 1DTQA 1RCHA 4RW7A 1NK9A 3KD1E 1LWEA 1RBUA 3DLHA 4DSIA 4OVLA 4FJLA 3L2RA 3AO4A 2ATQA 2KZMA 1XC9A 4AHUA 4KTQA 1VSKA 4Z4HA 1EETA 4FJ8A 4CECA 4HHTA 4B9NA 2OA8A 3V1OA 4FLZA 4NCBA 1CZ9A 2VG5A 2F96A 3OS0A 3M8PA 3PX0A 4FM0A 3RTVA 2X78A 4CJ5A 2DTUA 3DM2A 1J9AA 4ICLA 2G8WA 3AVAA 4GW6A 1JLFA 2XRIA 4IFYA 3OVNA 4HTUA 3CG7A 4W5QA 4DWIA 4KI6A 1SKWA 1C0TA 4CHZA 3QERA 3RRGA 4B9VA 4ELTA 4DTJA 1A5VA 3NF9A 3VQDA 3EZ5A 4Y1DA 3TAGA 2FBTA 4CIGA 1RTJA 3VQAA 1NK0A 3T1AA 4FK0A 2KFNA 3WNGA 4CEAA 2G8HA 4I2PA 4YFUA 1WSFA 1S1TA 3TAEA 1ASWA 4KFBA 1IKVA 2P5OA 4CJVA 3O3HA 3OYMA 3C94A 1J54A 4NYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9M A;  3SNN A;  3V1R A;  4L8R B;  4KHQ A;  4Z4I A;  4EP4 A;  4UQG A;  4E7J A;  1RDA A;  4FZY A;  3QNN A;  4DU1 A;  3OYI A;  4KRE A;  3VQB A;  1SL2 A;  1WN7 A;  2ZQB A;  5HBM A;  3SPY A;  3LP1 A;  4EZ9 A;  3O3G A;  4FJK A;  1VSE A;  4FVM A;  2G8I A;  1CXQ A;  2HHU A;  3JYT A;  1EKE A;  2P51 A;  3NF6 A;  1JLQ A;  4R5P A;  2YNG A;  3O3F A;  3LP2 A;  4LH5 A;  4B8A B;  2A1R A;  2QKK A;  1TK8 A;  5J2M A;  2OPS A;  1ZBF A;  1LW2 A;  3I0S A;  5HRP A;  3VN5 A;  4HUF A;  3TR8 A;  1KFD A;  4BDZ A;  3KLE A;  3P1G A;  1JLA A;  1NJX A;  2D0C A;  4C8K A;  3KLF A;  1U49 A;  2KFZ A;  5SWM A;  3QLH A;  4C8O A;  1RIL A;  3P83 D;  1YTU A;  4EP5 A;  4BDY A;  4Q5V A;  4F3T A;  4HUE A;  4CJQ A;  1JLE A;  4RW9 A;  5DK5 A;  3RRH A;  2LSN A;  1U45 A;  3EY1 A;  3KKS A;  2YHB A;  4I2Q A;  3VQQ A;  3OYJ A;  2PZS A;  3HT3 A;  1HMV A;  4B9L A;  4DF4 A;  4IKF A;  1TVR A;  3TAN A;  3F73 A;  3ULD A;  5DMR A;  3BGR A;  4OPJ A;  4DTU A;  4FJI A;  4B3O A;  1VSM A;  3ITH A;  1HQU A;  4KI4 A;  4E7K A;  1W9H A;  3DI6 A;  1X9W A;  3E01 A;  4KO0 A;  2Y1I A;  2O4G A;  4JLH A;  4M3R A;  3DRP A;  3ZT2 A;  4CF9 A;  3RMC A;  4CJ3 A;  4MFB A;  5CZ2 A;  4DG1 A;  4DFJ A;  3B6P A;  3TAQ A;  5C24 A;  3K5L A;  1TL1 A;  4FCY A;  1QQC A;  4OKK A;  1TKX A;  2Z1G A;  1RBV A;  1VSI A;  3LAN A;  3PUF A;  4E1M A;  4BE0 A;  4DS5 A;  3ZSY A;  2HHV A;  3ZSX A;  1NJZ A;  2BGG A;  4OGC A;  4CEF A;  3T3F A;  2W42 A;  1XI1 A;  4CIF A;  2YNI A;  3DOL A;  3KIO A;  3U3Y A;  4OPK A;  4E7I A;  5CYQ A;  4CF8 A;  4CFA A;  3QNO A;  1J5O A;  4FJ5 A;  3DMJ A;  1L3U A;  3NHG A;  3FFI A;  4CHO A;  1IKW A;  4J2B A;  3OY9 A;  4DTM A;  1J53 A;  3C95 A;  3HPO A;  3SYZ A;  3AO2 A;  4AHS A;  2OPQ A;  1XWL A;  3LWL A;  2XY7 A;  1VSL A;  4M3X A;  3MAQ A;  4I7F A;  4CJE A;  4FJM A;  5JS2 A;  3OYK A;  4N47 A;  1S1U A;  3DLK A;  1BI4 B;  1SKR A;  2DFH A;  4CFC A;  1VK0 A;  3QO9 A;  3OS2 A;  3VQ4 A;  1L3V A;  2B6A A;  3DLB A;  1RBR A;  3MXJ A;  3LDS A;  3LAK A;  1KTQ A;  4FLV A;  2HVI A;  5KI6 A;  4E7L A;  4CEO A;  4OKJ A;  5FDL A;  4OKE A;  4CJW A;  1NKB A;  1ZBU A;  3KLG A;  1FK9 A;  3VQC A;  3ZCM A;  2E6L A;  4JRQ A;  1B92 A;  3NAE A;  5J2P A;  4E3S A;  3NF8 A;  1U47 A;  1HYV A;  1TL3 A;  1U04 A;  3HXM A;  1CXU A;  4IG3 A;  2HHX A;  3RWU A;  1JLC A;  1A5X A;  3AO3 A;  1RBS A;  1RT6 A;  2VG7 A;  3ZT3 A;  3JSM A;  4FXD A;  1F21 A;  1CLQ A;  3NGZ A;  4NCA A;  1LWF A;  1KVA A;  1HNI A;  2Z1H A;  1Z25 A;  3QEV A;  1ASU A;  1EP4 A;  4CF0 A;  4F4K A;  4DQS A;  2F8T A;  1TKZ A;  3EYZ A;  4AHC A;  3V9S A;  3WNH A;  3NFA A;  2HND A;  3QIP A;  4DSF A;  4CGJ A;  1FKO A;  4Z0U A;  4CJR A;  2PYJ A;  2HVH A;  3TWH A;  5KRT A;  1L3S A;  1SKS A;  3V9U A;  1KVB A;  4CK1 A;  4M3T A;  3D45 A;  4OLB A;  1S6Q A;  1S5J A;  1TV6 A;  4IBN A;  1RDC A;  3QEI A;  1NOY A;  3P5J A;  1IKY A;  2HNY A;  3V6D A;  4OGE A;  1KVC A;  1K6Y A;  1WAJ A;  1LWC A;  3IG1 A;  3VQ6 A;  1I39 A;  1T8E A;  4KKO A;  2YKN A;  3L2W A;  1BCO A;  4W5N A;  5D3G A;  1JL1 A;  3MXM A;  3I0R A;  4HVJ A;  2X6S A;  1JL2 A;  4IG0 A;  4CK3 A;  2R7Y A;  3SQ2 A;  5FRN A;  5J2N A;  4M3Y A;  5HP1 A;  3ZSQ A;  4YNQ A;  4FJH A;  1RDD A;  1YVU A;  4CGD A;  1ZYQ A;  1NK8 A;  2G8K A;  1B9F A;  3AA4 A;  3K5N A;  4JS4 A;  1VSJ A;  3HP9 A;  2ETJ A;  2IAJ A;  4LSN A;  2PYL A;  4FJN A;  4FJ9 A;  2HNZ A;  2RN2 A;  4ZHR A;  3OJS A;  3AA5 X;  3SQ4 A;  4H4O A;  1LV5 A;  1N6Q A;  3V1Q A;  4RW6 A;  5CY4 A;  3QIN A;  1VSF A;  4MQ3 A;  4CHP A;  4M3W A;  2D0B A;  3CFP A;  1BI4 A;  2WON A;  4KHW A;  1FKP A;  3MED A;  1BQM A;  4O44 A;  4H4M A;  1Q9X A;  3KTQ A;  3V9W A;  5J2Q A;  4LSL A;  4FLT A;  2HB5 A;  4Y1C A;  1S9E A;  3VQE A;  4KB0 A;  2XY5 A;  4K8Z A;  1REV A;  1HQE A;  4N5S A;  2HMI A;  1YT3 A;  3SV3 A;  1SL0 A;  4M3U A;  3OYF A;  3ZSZ A;  4WE1 A;  3AO1 A;  4IDK A;  3M8Q A;  3NH0 A;  4H8K A;  4DTN A;  4DSL A;  3DYA A;  2X74 A;  3ZSW A;  4DSE A;  4DFK A;  3QEX A;  1VRT A;  4I9Q A;  4C8L A;  3TAP A;  4G1Q A;  3K2P A;  2Y1J A;  1B9D A;  3AVL A;  2DY4 A;  1G15 A;  3HPH A;  2KZZ A;  3SQ0 A;  4CEB A;  4CGI A;  3RR7 A;  2IGI A;  2XO7 A;  1T05 A;  3VQ8 A;  2NUB A;  3NBP A;  3MEE A;  4J2A A;  2IC3 A;  3NGI A;  4DFM A;  1U48 A;  3HYF A;  4BWM A;  3ZT0 A;  2G8F A;  2OPR A;  1SUQ A;  4CFB A;  3C6U A;  5KGX A;  5CYM A;  1R0A A;  3VQ5 A;  2DFF A;  5FRM A;  3S9H A;  3VA3 A;  1T7P A;  3UIQ A;  3DLR A;  2E4L A;  2JGU A;  4BE2 A;  1BQN A;  4B8C A;  4CF1 A;  3SCX A;  3HO1 A;  3U3G A;  3QES A;  3TAM A;  1HPZ A;  4CJS A;  1C1A A;  5KRS A;  3V81 A;  1VSD A;  2B5J A;  3SJJ A;  4DU3 A;  4M45 A;  1CZB A;  4M41 A;  4FYD A;  3L3U A;  1RTI A;  3K58 A;  3PY8 A;  1EX4 A;  1WSI A;  1I3A A;  1BL3 A;  2FC0 A;  5T7B A;  3HM9 A;  4PY5 A;  2YHA A;  1HYZ A;  1X9S A;  4W5T A;  3AVI A;  3OYH A;  5HRN A;  3RMD A;  4QOZ B;  4ID1 A;  4O0I A;  5JS1 A;  2ITG A;  2HHS A;  2D0A A;  4DTO A;  1U4B A;  4CIE A;  3AVF A;  4CJF A;  3K57 A;  4RG8 A;  3VA0 A;  4CJK A;  2WOM A;  1A5W A;  4FM2 A;  1T03 A;  4QCL A;  2KQ2 A;  4KRF A;  3MEG A;  3NE6 A;  5FRO A;  3TAF A;  4FM1 A;  4C8M A;  1WNS A;  2FBY A;  1QSS A;  2XHB A;  2Q3S A;  4GMJ B;  4ID5 A;  4O4G A;  3WNE A;  4DTP A;  2F8S A;  4PQU A;  1WSG A;  3LAL A;  1SV5 A;  4GVM A;  3SUN A;  2QXF A;  5E41 A;  2Z1I A;  3O4Q A;  1C1B A;  3L3V A;  4CJT A;  1RTD A;  2HHW A;  4HUG A;  2OZS A;  4ELU A;  3KLI A;  1KSP A;  4W5R A;  4Z4C A;  4W5O A;  1RDB A;  1S1W A;  3CFO A;  3IRX A;  4RW8 A;  1KLM A;  1GOC A;  1NJW A;  3OS1 A;  1X9M A;  1D8Y A;  4KHS A;  4OLA A;  3LZI A;  4DTS A;  3BDP A;  1S9G A;  5I42 A;  3TI0 A;  4O5B A;  4FZX C;  4ELV A;  1RTH A;  3F9K A;  4LD0 A;  3ALY A;  3ZSO A;  1QHT A;  1C0U A;  3KLH A;  1IH7 A;  1ITG A;  1Q9Y A;  2AJQ A;  3ZT1 A;  5EU7 A;  3LPU A;  1YTA A;  1RT3 A;  3OYC A;  1BCM A;  1S1V A;  3MXI A;  4DQI A;  4CE9 A;  4DU4 A;  1JXE A;  4FLW A;  4J2E A;  2XY8 A;  1EXQ A;  3DRR A;  3OJU A;  1RNH A;  4DF8 A;  3PX4 A;  3ZSV A;  1TK0 A;  4CHQ A;  1WSE A;  4B9S A;  4DSK A;  4CHN A;  3OYA A;  3VQP A;  3PO5 A;  3VQ7 A;  5I3U A;  1UAX A;  3HP6 A;  3OYE A;  4KTZ A;  2OZM A;  3RR8 A;  4FZZ A;  2PY5 A;  1VSH A;  2QKB A;  3HJF A;  1Z26 A;  1TKT A;  1C0M A;  2JLE A;  2P5G A;  3CQ8 A;  2IS3 A;  2FBV A;  3KK2 A;  1IO2 A;  3IS9 A;  4FW1 A;  3RMA A;  3NH1 A;  3M8R A;  3AVN A;  3V9Z A;  2YNF A;  3VQ9 A;  4CES A;  2ZD1 A;  3O4N A;  4FW2 A;  2O4I A;  2KW4 A;  4AHV A;  1TAQ A;  3PV8 A;  1NOZ A;  4Q0B A;  3DOK A;  3KD5 E;  3NF7 A;  4QAG A;  4CFD A;  2HHT A;  2B4J A;  4FJJ A;  1KLN A;  3ISN C;  4AHT A;  4DFP A;  1NJY A;  4FLY A;  2X6N A;  3B6O A;  1TK5 A;  3HVT A;  1NK5 A;  1RT7 A;  3NCI A;  4KTW A;  4DLG A;  4FJX A;  1ASV A;  4DMN A;  3SUP A;  1JXB A;  3DLG A;  4KAZ A;  3S3N A;  1BIU A;  1LAV A;  3T19 A;  4E0D A;  2HW3 A;  4DTR A;  4N41 A;  2G8V A;  4F2R A;  1WAF A;  5C42 A;  3OYN A;  3A2F A;  3HL8 A;  1NK7 A;  3LPT A;  4CCH A;  2Z1J A;  1KFS A;  4CEZ A;  3CM6 A;  1ZBI A;  2KTQ A;  2GBZ A;  4CEQ A;  3AA3 A;  4E7H A;  3KK3 A;  3G0Z A;  1QSL A;  4FLX A;  1KCF A;  4CER A;  5C25 A;  5HLF A;  4ZTJ A;  1DTT A;  4I9L A;  2BAN A;  3AVK A;  3SZ2 A;  2HHQ A;  4NCG A;  4KB1 A;  3I8D A;  3PX6 A;  3OYB A;  1BGX T;  1W0H A;  3NH2 A;  3HST B;  3AA2 A;  4RW4 A;  2IDO A;  3OYG A;  4FLU A;  3HVR A;  4LY7 A;  4DLE A;  3LP3 A;  4KPY A;  1HYS A;  3NDK A;  3ZT4 A;  1BIZ A;  2E6M A;  5KTQ A;  3TAR A;  1HRH A;  2RPI A;  4F3O A;  3OYD A;  4C8N A;  1TAU A;  3U6F A;  3SUQ A;  2IOC A;  4BE1 A;  3C6T A;  3M8S A;  4M42 A;  4Z4E A;  4N76 A;  3SUO A;  1NK4 A;  3SQ1 A;  3L8B A;  3LAM A;  3AVM A;  2RKI A;  4DSJ A;  4KHN A;  4N56 A;  4DQP A;  2QK9 A;  1BHL A;  5CZ1 A;  1C6V A;  3V4I A;  4KHY A;  2BE2 A;  2P1J A;  4DQR A;  4TSX A;  4Z4G A;  2YNH A;  2OPP A;  3KJV A;  1UOC A;  3OYL A;  4JRP A;  1S6P A;  1GOB A;  1RT5 A;  4O55 A;  4J2D A;  4K8X A;  2ZE2 A;  2VWJ A;  4KHU A;  2I5J A;  5HRO A;  1WSH A;  4CJ4 A;  5HRS A;  1Q8I A;  4B9T A;  4HCB A;  1UA1 A;  1RT2 A;  4CJL A;  1JKH A;  3KK1 A;  3QEP A;  1IG9 A;  2GUI A;  1WLJ A;  1XHX A;  3K5O A;  3AVH A;  3V9X A;  3SI6 A;  4AHR A;  3ASM A;  1MU2 A;  4IFV A;  4BAC A;  4FK2 A;  3AVG A;  5HRR A;  3SV4 A;  4XIU A;  2BDP A;  1D9D A;  2A1S A;  2FBX A;  4CJP A;  3DLE A;  1LAW A;  3CM5 A;  2G8U A;  3HK2 A;  4CED A;  4CF2 A;  1NKC A;  1KRP A;  2XY6 A;  1BIS A;  3DRS A;  4HCC A;  1JLG A;  1HNV A;  4AIL C;  2OYQ A;  1RBT A;  3CYM A;  1QS4 A;  3MEC A;  3PO4 A;  3IAY A;  1D9F A;  1Y97 A;  3L2V A;  4DQQ A;  3HPG A;  1ZBL A;  2YV0 X;  4NYN A;  3QIO A;  4E1N A;  3AVJ A;  4DTX A;  4F2S A;  1D5A A;  1QTM A;  3AVB A;  4CEE A;  4LH4 A;  3CFR A;  3L2U A;  4F8R A;  1LW0 A;  3G10 A;  3D0P A;  3LZJ A;  1L3T A;  3LWM A;  1VRU A;  1X1P A;  1UWB A;  4E89 A;  1XHZ A;  1SL1 A;  3H08 A;  3TAB A;  1NKE A;  4EZ6 A;  1WSJ A;  3AO5 A;  1QE1 A;  3AVC A;  4O0J A;  3WNF A;  3THV A;  4FK4 A;  1S1X A;  4E19 A;  2VWK A;  4CJU A;  3ZSR A;  3SPZ A;  3S3M A;  1L5U A;  4M3Z A;  1UA0 A;  2GV9 A;  4B08 A;  3L2Q A;  1C1C A;  4AH9 A;  1TGO A;  4CK2 A;  3QEW A;  5SZT A;  3K59 A;  4DS4 A;  5KGW A;  1TKD A;  4CGH A;  4JS5 A;  1FXX A;  4BDP A;  4FJG A;  1N5Y A;  4PA1 A;  4PWD A;  2DFE A;  2EX3 A;  2VG6 A;  2D5R A;  4OJR A;  3QET A;  4FJ7 A;  4Z4F A;  1NK6 A;  1JLB A;  3S3O A;  1IKX A;  1QSY A;  1RT4 A;  1O1W A;  2EHG A;  2YKM A;  1RT1 A;  1DLO A;  4BWJ A;  3K5M A;  4CGF A;  5K14 A;  4CHY A;  3LP0 A;  3RMB A;  1HJR A;  3KKR A;  4B9U A;  3NGY A;  4KV8 A;  5J1E A;  1ZBH A;  2RF2 A;  4PUO A;  3AV9 A;  4CGG A;  1GOA A;  4ZTF A;  1DTQ A;  1RCH A;  4RW7 A;  1NK9 A;  3KD1 E;  1LWE A;  1RBU A;  3DLH A;  4DSI A;  4OVL A;  4FJL A;  3L2R A;  3AO4 A;  2ATQ A;  2KZM A;  1XC9 A;  4AHU A;  4KTQ A;  1VSK A;  4Z4H A;  1EET A;  4FJ8 A;  4CEC A;  4HHT A;  4B9N A;  2OA8 A;  3V1O A;  4FLZ A;  4NCB A;  1CZ9 A;  2VG5 A;  2F96 A;  3OS0 A;  3M8P A;  3PX0 A;  4FM0 A;  3RTV A;  2X78 A;  4CJ5 A;  2DTU A;  3DM2 A;  1J9A A;  4ICL A;  2G8W A;  3AVA A;  4GW6 A;  1JLF A;  2XRI A;  4IFY A;  3OVN A;  4HTU A;  3CG7 A;  4W5Q A;  4DWI A;  4KI6 A;  1SKW A;  1C0T A;  4CHZ A;  3QER A;  3RRG A;  4B9V A;  4ELT A;  4DTJ A;  1A5V A;  3NF9 A;  3VQD A;  3EZ5 A;  4Y1D A;  3TAG A;  2FBT A;  4CIG A;  1RTJ A;  3VQA A;  1NK0 A;  3T1A A;  4FK0 A;  2KFN A;  3WNG A;  4CEA A;  2G8H A;  4I2P A;  4YFU A;  1WSF A;  1S1T A;  3TAE A;  1ASW A;  4KFB A;  1IKV A;  2P5O A;  4CJV A;  3O3H A;  3OYM A;  3C94 A;  1J54 A;  4NYF A; 
#chains in the Genus database with same CATH topology
 5JVH L;  4B9M A;  3SNN A;  3V1R A;  4JI2 K;  3QNN A;  1MA9 B;  1QZ5 A;  4A2A A;  4EZ9 A;  4FJK A;  2G8I A;  1CXQ A;  1EKE A;  4R5P A;  4LH5 A;  3CXC M;  3VN5 A;  3TR8 A;  1YJW N;  4LF4 K;  3O9R A;  4C8K A;  1R59 O;  5SWM A;  1FJG K;  3WXM B;  4K43 A;  4Q5V A;  4QS9 A;  4F3T A;  4HUE A;  2E88 A;  3RRH A;  5AQG A;  3CCL N;  3EY1 A;  1D4X A;  4CD3 A;  1XC3 A;  4B1Y B;  4WQ5 C;  1TVR A;  3TAN A;  3F73 A;  5DMR A;  4IOC L;  3U9Z A;  5C12 A;  4KI4 A;  3E01 A;  2A40 A;  3RMC A;  5CZ2 A;  4DG1 A;  2D0P A;  2NRR A;  1TL1 A;  4OKK A;  2Z1G A;  1RBV A;  3CHW A;  4IOA L;  3LAN A;  2ZJR L;  3ZSX A;  3SMP A;  1ILY A;  2W42 A;  5KQD A;  4B1V A;  4X64 K;  4CZL A;  5ADX H;  4MDB A;  2YNI A;  1J5O A;  2O8C A;  4E7I A;  4CF8 A;  3QNO A;  4OPA A;  1L3U A;  3U4L A;  1VQK N;  4J2B A;  3C95 A;  3AO2 A;  4AHS A;  2OPQ A;  3LWL A;  2WTU A;  3F2K A;  3MAQ A;  4I7F A;  3OYK A;  1Q82 O;  2ZJP L;  4WF9 L;  4CFC A;  4FL9 A;  2B6A A;  1RBR A;  1NGH A;  5AQW A;  3TTF A;  2HBL A;  2NRX A;  3VF4 A;  4CJW A;  3DJC A;  1ZBU A;  1GLF O;  3PSF A;  3VQC A;  4RTF D;  3I55 N;  1NU0 A;  2P9N A;  1CXU A;  2AA4 A;  5M1P A;  3FLC O;  1T3V A;  4H0T B;  3JAM O;  1KC8 O;  1RBS A;  2YX6 A;  4FXD A;  1OH7 A;  4B3T K;  1HNI A;  3G25 A;  2F8T A;  3VMF B;  4DQS A;  4DB3 A;  3EYZ A;  4IEI A;  5AQI A;  3T69 A;  4AHC A;  2HND A;  4DSF A;  4Z0U A;  4CJR A;  4DV6 K;  3TWH A;  4YDU C;  2VQF K;  3DLL L;  3V9U A;  4CK1 A;  4M3T A;  1TYQ B;  3D45 A;  2HMP A;  1TV6 A;  4JKH A;  3QEI A;  1NOY A;  1IKY A;  3C6A A;  4OGE A;  1KVC A;  3GE1 A;  1I39 A;  4E1J A;  1T8E A;  4KKO A;  1BCO A;  3CJA A;  1JL2 A;  4IG0 A;  3SQ2 A;  3HM8 A;  2W6K A;  5HP1 A;  4LF8 K;  5M1K A;  3CJ7 A;  2HHH K;  1NK8 A;  2G8K A;  1B9F A;  4K0K K;  1EQY A;  3VF2 A;  2ETJ A;  4LSN A;  2PYL A;  4CBW A;  1XNR K;  3FE1 A;  3OJS A;  3EZW A;  4Y0W A;  3ZX3 A;  5F2R A;  3V1Q A;  3O9T A;  3SJH A;  4RW6 A;  5AQV A;  2P9U B;  1JCE A;  3M3Z A;  4BR5 A;  5TKY A;  4CHP A;  1TUY A;  4O44 A;  1Q9X A;  3V9W A;  4FLT A;  4Y1C A;  1S9E A;  4K8Z A;  5C2D A;  4DV7 K;  1SL0 A;  3OYF A;  2GX9 A;  1BU6 O;  4BRA A;  4MO5 A;  3ZSW A;  2A41 A;  3QEX A;  1OVY A;  3BY5 A;  4G1Q A;  1B9D A;  3AVL A;  4DV1 K;  4DR7 K;  2QA4 N;  4AQY K;  4JI7 K;  3U9D A;  2W41 A;  2JWK A;  5AQR A;  3RR7 A;  2IGI A;  3IMX A;  2IC3 A;  1BOT O;  4DHY A;  3P38 A;  4BWM A;  1KQS M;  4O8U A;  3VF6 A;  1R0A A;  3VQ5 A;  3S9H A;  4A57 A;  2JGU A;  4B8C A;  4CF1 A;  3HO1 A;  2WBN A;  3QES A;  1HPZ A;  3V81 A;  1VSD A;  3SJJ A;  5M1N A;  4M41 A;  1Z05 A;  4C23 A;  3K58 A;  5AQN A;  2FC0 A;  5T7B A;  4CZM A;  3ENH A;  4W5T A;  3AVI A;  1WOQ A;  4GV6 A;  1HNZ K;  2ZWH A;  4DTO A;  4JK7 A;  4RG8 A;  3WEE B;  4CJK A;  2WOM A;  5AQT A;  3MEG A;  3FZM A;  4BC3 A;  5FRO A;  3TAF A;  4FM1 A;  4C8M A;  1K9M O;  2XHB A;  2Q3S A;  3WNE A;  5GIO A;  5LJW A;  2QXF A;  3ZEU A;  2Z1I A;  1C1B A;  4CJT A;  4HUG A;  4ELU A;  3KLI A;  4ILH A;  1IG8 A;  3CC2 N;  4KHS A;  3TSP A;  5GIP A;  3TI0 A;  1RTH A;  3CPE A;  1QHT A;  1DGK N;  4H5R A;  4JKF A;  1IH7 A;  2A3Z A;  1OH5 A;  1C0G A;  3IKM A;  2VQE K;  4FLW A;  4OO1 J;  5AQY A;  3VEY A;  1YJ9 N;  4WQ4 A;  1UAX A;  3LDL A;  5AQU A;  4G9Z A;  4FWO A;  4XH5 A;  3HJF A;  1Z26 A;  3A8Y A;  2VYP A;  3FZK A;  1XNQ K;  2CGL A;  3CQ8 A;  2P9S B;  2UUC K;  3M8R A;  3V9Z A;  3GDQ A;  3VQ9 A;  4CES A;  2ZD1 A;  4BRO A;  3O4N A;  3ZX0 A;  4Q0B A;  1NOZ A;  5AQK A;  2HHT A;  1W2B M;  3T1Y K;  4DFP A;  3J8A A;  4V19 S;  1WBB A;  4F2R A;  5C42 A;  2V7Z A;  5LMN K;  4DV0 K;  1ZBI A;  2KTQ A;  2GBZ A;  3AA3 A;  3ZLJ A;  3KK3 A;  3G0Z A;  5C25 A;  4ZTJ A;  4BRL A;  3SZ2 A;  3CCE N;  4H0O A;  4XH1 A;  3I8D A;  4KB1 A;  4FLU A;  2NRZ A;  2QW9 A;  3HVR A;  4DLE A;  3DXK B;  2RPI A;  4F3O A;  1M1K O;  3OYD A;  1TAU A;  3U6F A;  3SUQ A;  4M42 A;  3QDK A;  4N76 A;  3SUO A;  3LAM A;  3MN9 A;  5CZ1 A;  4R79 A;  3V4I A;  2BE2 A;  2YNH A;  1J6Z A;  4JRP A;  5CHI A;  1X3N A;  3HSC A;  4K8X A;  1LCU A;  3J81 O;  1BWF O;  4B9T A;  1W7A A;  1UA1 A;  3QEP A;  4BQL A;  4FK2 A;  4BAC A;  3AVG A;  2O8F B;  3UKU A;  2BDP A;  1D9D A;  3D2F B;  3DLE A;  4CED A;  2F7T A;  1BIS A;  3VEO A;  3CYM A;  3PO4 A;  2VGM A;  4A5B A;  4CZF A;  4DQQ A;  3OTO K;  1K8K B;  3AVJ A;  4KH5 A;  3FZH A;  4GV9 A;  1QTM A;  1JCG A;  4CEE A;  3SAH A;  3L2U A;  1VHX A;  3G10 A;  2W40 A;  2KKZ A;  3D0P A;  3LZJ A;  1VRU A;  1X1P A;  4EZ6 A;  4E89 A;  1XHZ A;  3H08 A;  4X66 K;  3PIO L;  5BPL A;  1QE1 A;  4A2B A;  4WFA L;  4FK4 A;  4DR4 K;  2P9L B;  2VWK A;  3S3M A;  2GV9 A;  5GAH P;  4CGH A;  1HPM A;  1YXQ A;  2EX3 A;  2VG6 A;  3QBX A;  3C65 A;  4Z4F A;  5FLX O;  4I6M B;  3S3O A;  1QSY A;  4AM6 A;  1O1W A;  4PL7 A;  2FSN A;  3K5M A;  4CGF A;  4CHY A;  1QQO A;  3NGY A;  4GNI A;  2RF2 A;  2VWB A;  1DTQ A;  4DSI A;  2D0O A;  4FJL A;  3QIC A;  4MLH A;  1DT9 A;  5BRF A;  2OA8 A;  3V1O A;  3CIP A;  3K9J A;  2VG5 A;  5F0X A;  1J9A A;  2IVO A;  3HBT A;  1JLF A;  3FGU A;  3LM9 A;  1C0T A;  1YUW A;  3NF9 A;  3MK6 A;  4CIG A;  3VQA A;  1XUP O;  4CEA A;  4I2P A;  4YFU A;  4GVE A;  3TAE A;  4KFB A;  3C94 A;  1J54 A;  3H3N O;  4B1Z A;  4KHQ A;  4Z4I A;  1HUX A;  4PL8 A;  1RDA A;  1NJI O;  4DU1 A;  4KRE A;  1WN7 A;  1YF5 L;  5HBM A;  1U6Z A;  1Z6R A;  1V4T A;  3O3G A;  1VSE A;  4FVM A;  3O08 A;  3TTC A;  3O3F A;  3AGK A;  2OPS A;  1ZBF A;  3TSQ A;  5HRP A;  3MCP A;  3L6Q A;  3KZB A;  1U49 A;  5GAE P;  3H46 O;  4ISE A;  1RIL A;  4CJ7 A;  4CJQ A;  4RW9 A;  3A5O C;  2LSN A;  1U45 A;  3KKS A;  3OYJ A;  4FOI A;  4DF4 A;  3BGR A;  4FJI A;  4DUY K;  3ITH A;  1HQU A;  1W9H A;  3DAW A;  3BZK A;  1X9W A;  4H5V A;  3DRP A;  2E2O A;  4CJ3 A;  2F9W A;  4DFJ A;  3B6P A;  2IVP A;  5C24 A;  3K5L A;  4FCY A;  1QQC A;  2ZGY A;  5KPT A;  1VSI A;  2A5X A;  3MN5 A;  4E1M A;  4BE0 A;  1HKG A;  4DS5 A;  2OTJ N;  3ZSY A;  1QQN A;  4BC4 A;  3OBY A;  4CEF A;  1XI1 A;  3CCS N;  1HLU A;  4IO8 A;  1XQS C;  3KIO A;  1N33 K;  4CFA A;  1K73 O;  5HL7 L;  3DWL A;  4CHO A;  1IKW A;  1IBM K;  5JVG L;  1S1U A;  3THX B;  1SKR A;  1VK0 A;  3OS2 A;  1L3V A;  3MXJ A;  3J7Y P;  4JK9 A;  4CEO A;  3VEZ A;  4H5W A;  4JV5 K;  4OKE A;  3KLG A;  1FK9 A;  3WUH A;  1B92 A;  3BUZ B;  4WQ4 C;  3NF8 A;  3O8M A;  1U04 A;  3HXM A;  1WUA A;  3RWU A;  4LF6 K;  3ZT3 A;  1ASU A;  4RCH A;  1TKZ A;  3WNH A;  3CI5 A;  3QIP A;  3H1V X;  1FKO A;  5KRT A;  3B8A X;  3J7A P;  4CBX A;  1S5J A;  4IBN A;  1YIJ N;  3VGK A;  3P5J A;  2Q97 A;  4BC5 A;  1K6Y A;  1WAJ A;  1LWC A;  4Z94 A;  3O1B A;  2WFB A;  3M1F A;  4W5N A;  3F9M A;  5D3G A;  4CVN E;  3L4I A;  2R7Y A;  3UE5 A;  3ZSQ A;  1ATN A;  3F5T A;  4BR4 A;  5AFU H;  4LFA K;  1VSJ A;  4H0P A;  5M1O A;  2PAV A;  1Q81 O;  3RSE B;  1HR0 K;  4ZHR A;  4JHD B;  1NBW A;  1LV5 A;  1N6Q A;  2F4V K;  5CY4 A;  5C2F A;  3QIN A;  4IXC A;  4MQ3 A;  4M3W A;  5JLF A;  5BRD A;  4KHW A;  3MED A;  3CF5 L;  1BQM A;  3ULE B;  2HB5 A;  3BF3 A;  4JK8 A;  1REV A;  1HQE A;  4PHT X;  4JAX A;  4N5S A;  3SV3 A;  3ZSZ A;  4C1N I;  4JI1 K;  4H8K A;  4DTN A;  4BRH A;  4DSL A;  4DFK A;  4I9Q A;  3TAP A;  3I8B A;  2Y1J A;  3GBT A;  4JYA K;  4IEE A;  3HPH A;  2UXB K;  3SQ0 A;  4CEB A;  4CZJ A;  3VQ8 A;  2NUB A;  3NBP A;  4GKK K;  5A2Q O;  2UXD K;  1QVF M;  4CFB A;  3CJ9 A;  3E9P A;  5KGX A;  1TYQ A;  2Q0U A;  3TAM A;  5KRS A;  1C1A A;  2B5J A;  1YHQ N;  3LM2 A;  3EEQ A;  5BPM A;  4FYD A;  3U8X A;  2A42 A;  3MCA B;  5AQJ A;  4PY5 A;  2YHA A;  4IWV A;  4YOR A;  4U7B A;  5FPN A;  3OYH A;  4QOZ B;  3RMD A;  1MWK A;  4WFN L;  1H1V A;  2HHS A;  1U4B A;  4CIE A;  1IBL K;  4EFH A;  5C0Y A;  3VA0 A;  1YJN N;  3CC4 N;  2FF3 B;  2KQ2 A;  1WNS A;  2F8S A;  4O4G A;  4A62 A;  4GVM A;  1SV5 A;  3SUN A;  2P9U A;  3O4Q A;  3CER A;  4ISF A;  1RDB A;  1S1W A;  3IRX A;  4W5O A;  1D8Y A;  4YHH K;  3CCJ N;  2E2Q A;  4DTS A;  5AZI B;  3R1X A;  1C0U A;  4KH4 A;  1N8R O;  1ITG A;  1Q9Y A;  3LPU A;  1BCM A;  1S1V A;  4DQI A;  4J2E A;  2XY8 A;  3DRR A;  3OJU A;  5MLC Q;  1TK0 A;  5LJV A;  4DSK A;  4CHN A;  3PO5 A;  3VQP A;  3VQ7 A;  3HP6 A;  2OZM A;  3RR8 A;  4K41 A;  3BZC A;  3O9U A;  1C0M A;  3E9L A;  2P5G A;  2IS3 A;  4HWI A;  1X3M A;  3CMA N;  2D1K A;  4AHV A;  1E4G T;  4QAG A;  2B4J A;  1NJY A;  1S72 N;  3HOT A;  3HVT A;  4IFE A;  3NCI A;  4KTW A;  4DLG A;  1ASV A;  3DLG A;  1BIU A;  1NGD A;  1WAF A;  3OYN A;  3HL8 A;  5JIC A;  3LPT A;  4ILJ A;  1KFS A;  5AQL A;  5AQH A;  1NGJ A;  4NXM K;  2BAN A;  1EWQ A;  3AVK A;  3C6H A;  3WEE A;  2HHQ A;  5KQ8 A;  1BGX T;  3D2E B;  4RW4 A;  3LDN A;  4RWT A;  1OH8 A;  1MWM A;  2YCH A;  4LY7 A;  1YI2 N;  3LP3 A;  4BR0 A;  3TAR A;  3MX5 A;  1YIT N;  1HRH A;  4C8N A;  2O8B B;  2IOC A;  4BE1 A;  3C6T A;  1NK4 A;  3SQ1 A;  3L8B A;  1KAX A;  3AVM A;  4DSJ A;  4KHN A;  5AQQ A;  3PSI A;  3TSU A;  4TSX A;  4Z4G A;  3KJV A;  3QBW A;  1UOC A;  3VET A;  2UUB K;  1S6P A;  1RT5 A;  4O55 A;  2GTD A;  4IZ9 A;  4KHU A;  2I5J A;  1WSH A;  4BRM A;  3QB0 A;  2O8D B;  4H03 B;  4BRI A;  2G8F A;  4YOT A;  1NG9 A;  4AHR A;  2QWO A;  3ASM A;  5C10 A;  1OH6 A;  3FR0 A;  1HNX K;  5HRR A;  3SV4 A;  4XIU A;  2FBX A;  5F1X A;  4CJP A;  1HX1 A;  2YI1 A;  3VPZ A;  1NKC A;  2P9S A;  3ZX2 A;  2XY6 A;  4HCC A;  3P31 A;  3QML A;  1JLG A;  4AIL C;  5DM7 L;  1QS4 A;  3ENO A;  3L2V A;  3H6E A;  4F2S A;  1D5A A;  3L0Q A;  2QWR A;  4FWQ A;  4CZG A;  4FWP A;  3LWM A;  4YOY A;  1SL1 A;  1NKE A;  3TAB A;  1WSJ A;  3AO5 A;  4O0J A;  4E19 A;  1KAZ A;  4CJU A;  5E26 A;  3UKR B;  4M3Z A;  5KPZ A;  4B08 A;  4CK2 A;  3VES A;  3K59 A;  5B8H A;  3C0B A;  4JS5 A;  4BDP A;  4PWD A;  2DFE A;  1NK6 A;  1JLB A;  1IKX A;  1RT4 A;  3DXK A;  2WUS A;  3NVK A;  3THW B;  1HJR A;  1VAZ A;  3KKR A;  2FSK A;  4B9U A;  1ZBS A;  3PIP L;  3T1H K;  4CGG A;  1GOA A;  4ZTF A;  3SMS A;  1LWE A;  4MO4 A;  2ATQ A;  1XC9 A;  1FW6 A;  4AHU A;  1VSK A;  3G6E N;  4HHT A;  4FLZ A;  4NCB A;  1CZ9 A;  4NLC A;  2Q31 A;  4IFY A;  3OVN A;  4DWI A;  2QI2 A;  3CG7 A;  4KI6 A;  2O8F A;  4LF7 K;  3D2F A;  4GY2 B;  1A5V A;  1GLD G;  3EE9 A;  3K0S A;  3VQD A;  1QVG M;  5AQX A;  2FBT A;  3AAR A;  1RTJ A;  4B3S K;  4KBO A;  3WNG A;  2G8H A;  3CCR N;  3Q7C A;  3EN9 A;  2ZF5 O;  4BY9 C;  3O3H A;  4QS8 A;  3OYM A;  2ZGZ A;  1U2V B;  4NYF A;  1NMD A;  1K8K A;  3NVM A;  4BR9 A;  4L8R B;  4UQG A;  4E7J A;  3OYI A;  4FWN A;  3VQB A;  1SL2 A;  2ZQB A;  3WXK A;  3SPY A;  2HHU A;  2P9I B;  3JYT A;  3LDQ A;  3NF6 A;  1JLQ A;  2YNG A;  3LP2 A;  2P9L A;  3O9Q A;  4B8A B;  2A1R A;  3SAF A;  5J2M A;  1LW2 A;  4H5N A;  4HUF A;  3KLE A;  3P1G A;  1JLA A;  1NJX A;  2OTL N;  2D0C A;  3KLF A;  2KFZ A;  1OKJ A;  5H1S Q;  1ESV A;  3QLH A;  5BR8 K;  3HRG A;  4JKB A;  4I6M A;  1T6C A;  3KK7 A;  4BVP A;  1JLE A;  5DK5 A;  2YHY A;  4I2Q A;  3VQQ A;  1HMV A;  1XMQ K;  3WXJ A;  4DUZ K;  3H3O B;  2CH5 A;  3ULD A;  4OPJ A;  4DTU A;  4X65 K;  3OW2 M;  3ZET B;  4E7K A;  3DI6 A;  2QEX N;  4LFC K;  2P9P B;  4KO0 A;  2Y1I A;  4M3R A;  4MFB A;  3TAQ A;  1S22 A;  5ADX A;  4JNE A;  1VQ7 N;  1NGF A;  4DV2 K;  4OGC A;  1NJZ A;  2BGG A;  1NGB A;  2OAN A;  2Q0R A;  4M7X A;  3MMV A;  4CIF A;  3DOL A;  1GLL O;  3CET A;  4FJ5 A;  4QS7 A;  2E20 A;  4JKC A;  4NXN K;  3FFI A;  4BRQ A;  3MWP A;  2QWQ A;  1J53 A;  3SYZ A;  3HPO A;  1XWL A;  2XY7 A;  4B1W B;  1HNW K;  1JCF A;  4M7Y A;  5JS2 A;  3DLK A;  1BI4 B;  3D7E O;  4DKW A;  1VQP N;  2EWS A;  3QO9 A;  3VQ4 A;  5TKW A;  3DLB A;  1KTQ A;  4WYB A;  4OKJ A;  1NKB A;  1NLV A;  1O13 A;  2GWJ A;  2E6L A;  4IO9 L;  2YHX A;  1YVN A;  2O8E B;  4PKH A;  1JLC A;  1A5X A;  3AO3 A;  3JSM A;  1CLQ A;  3NGZ A;  1KVA A;  1Z25 A;  3QEV A;  1EP4 A;  5FPD A;  4BGA A;  1N34 K;  2YHW A;  3V9S A;  4CGJ A;  2HVH A;  3THY B;  2KHO A;  1L3S A;  1SKS A;  4BGB A;  1KVB A;  2QWL A;  4YOW A;  4OLB A;  1GLE G;  3V6D A;  2HNY A;  4BRD A;  2GEL A;  3IG1 A;  3VQ6 A;  3CJ1 A;  3P39 A;  2YKN A;  3L2W A;  1MDU B;  1JL1 A;  3SBG A;  3MXM A;  3I0R A;  4CK3 A;  2X6S A;  5FRN A;  5J2N A;  3IDH A;  4YNQ A;  4FJH A;  1RDD A;  4CGD A;  4H0V B;  3K5N A;  4BRF A;  4JS4 A;  3HP9 A;  4FJN A;  4FJ9 A;  1KXP A;  2RN2 A;  2QWM A;  3CC7 N;  4FWL A;  3SQ4 A;  4H4O A;  2NRW A;  5BRE A;  3VEN A;  2D0B A;  3CFP A;  1WBD A;  2WON A;  5GAG P;  1FKP A;  3THX A;  5J2Q A;  2HBM A;  4LSL A;  3VQE A;  4DR5 K;  2XY5 A;  2HMI A;  1YT3 A;  2P9K B;  4WE1 A;  4IDK A;  3DYA A;  2X74 A;  1VRT A;  4C8L A;  5AQS A;  4DR2 K;  1SS6 A;  3D6R A;  4CGI A;  1T05 A;  4J8F A;  1P90 A;  1K8A O;  4J2A A;  5AQO A;  3NGI A;  1U48 A;  3ZT0 A;  3EO3 A;  1RFQ A;  2OPR A;  1SUQ A;  2AP1 A;  3C6U A;  3IUC A;  5CYM A;  2DFF A;  1T7P A;  3DLR A;  2E4L A;  4BE2 A;  1BQN A;  1S3X A;  3FZF A;  3SLC A;  3U3G A;  2QWP A;  3GL1 A;  4DV3 K;  4DU3 A;  1BDG A;  4M45 A;  2CGK A;  1CZB A;  1DKG D;  3SAG A;  4BG9 A;  1RTI A;  3PY8 A;  1EX4 A;  3HM9 A;  1C0F A;  4FWM A;  1X9S A;  3BEX A;  1N32 K;  5HRN A;  5JS1 A;  3N4P A;  4O0I A;  1M90 O;  2NRT A;  3LL3 A;  3M5R A;  3LDP A;  3AVF A;  4CJF A;  5KPR A;  3K57 A;  4FM2 A;  3RSE A;  1T03 A;  1OVQ A;  4JHD A;  4KRF A;  1QSS A;  2FBY A;  4BRK A;  3G71 N;  4ID5 A;  1EWR A;  5LY3 A;  3DXM B;  1RTD A;  3L3V A;  2HHW A;  2OZS A;  5AQF A;  4W5R A;  4Z4C A;  2I7P A;  3CFO A;  1EO1 A;  3SBT A;  1GLB G;  4OLA A;  4DR1 K;  3ULE A;  3BDP A;  4O5B A;  4ELV A;  3ALY A;  3ZSO A;  1JJ2 M;  5M1Q A;  4FWK A;  3KLH A;  3CJB A;  5GIN A;  3ZT1 A;  5EU7 A;  1SAZ A;  1GLJ O;  1RT3 A;  4A59 A;  3NMU A;  4JKG B;  1G99 A;  1EXQ A;  1RNH A;  1NGG A;  3ZSV A;  5I3U A;  1V4S A;  5CE3 A;  4FZZ A;  2PY5 A;  1VSH A;  4IDH A;  3FFK B;  1VQ4 N;  1TKT A;  2HF4 A;  2JLE A;  2VCP A;  4BQZ A;  1IO2 A;  4FW1 A;  4YOV A;  3RMA A;  3AVN A;  2YNF A;  2E8A A;  1QHA A;  4PKG A;  1WB9 A;  4CD1 A;  3A0I X;  1TAQ A;  4FOE A;  3L4Q A;  3NF7 A;  5JMV A;  3A5M C;  1KLN A;  3BF1 A;  3ISN C;  4LF5 K;  4FLY A;  1TK5 A;  3H45 C;  1RT7 A;  1LOT B;  4FJX A;  4DMN A;  3SUP A;  4JD2 B;  1JXB A;  1LAV A;  4BC2 A;  2HW3 A;  4DTR A;  4N41 A;  2V7Y A;  4F9O A;  3A2F A;  2DPN A;  2Z1J A;  4HTL A;  3O5B A;  3VER A;  4CEZ A;  3CM6 A;  4DR6 K;  4CEQ A;  3WQU A;  4FLX A;  4CER A;  5HLF A;  4I9L A;  3C7N B;  4NCG A;  3PX6 A;  4X62 K;  4H0Y B;  4B1U B;  3JS6 A;  3WXL A;  3I33 A;  3OYG A;  1KD1 O;  4LC9 B;  4KPY A;  1HYS A;  3NDK A;  3ZT4 A;  1RDW X;  5KTQ A;  2E6M A;  5AZJ B;  4H5T A;  1TUU A;  4JI0 K;  1IBK K;  4K25 A;  2H3G X;  2ASO A;  2QXL A;  5AZI A;  5LL6 Z;  4N56 A;  2QK9 A;  4FVU A;  4B9Q A;  3AGR A;  3BP8 A;  3GG4 A;  4KHY A;  3JXU A;  2NRH A;  3CQY A;  1IJJ A;  1CZA N;  2OPP A;  4ILG B;  3VGM A;  3RVC A;  2ZE2 A;  2VWJ A;  4CJ4 A;  4XEI A;  4BVO A;  4HCB A;  1SQK A;  3K9K A;  4CJL A;  1JKH A;  2ITM A;  1IG9 A;  2GUI A;  1WLJ A;  1XHX A;  4BR2 A;  3AVH A;  4IFV A;  5EOY A;  1NM1 A;  2A1S A;  2G8U A;  4CF2 A;  3MDQ A;  3CD6 N;  3R8E A;  2OYQ A;  1ZXO A;  4B3R K;  5IWA K;  3MEC A;  3LDO A;  2QTD A;  5C15 A;  1W97 L;  3VEW A;  2YV0 X;  2UYT A;  4E1N A;  4DTX A;  3O6W A;  3KVG A;  4IJN A;  3O9S A;  2Q2R A;  1LW0 A;  2ZM6 K;  1L3T A;  5CR4 A;  1UWB A;  3O80 A;  3AVC A;  3THV A;  1S1X A;  1L5U A;  3ZSR A;  3CCQ N;  3L2Q A;  1C1C A;  1IV0 A;  4AH9 A;  1TGO A;  3QEW A;  5SZT A;  4DS4 A;  3TPQ A;  5KGW A;  4FJG A;  2HBK A;  3D2E A;  4PA1 A;  5FPE A;  4GV3 A;  4OJR A;  3VTI A;  4MLE A;  3VEV A;  2UXC K;  2YKM A;  4BWJ A;  1E4F T;  5K14 A;  3RMB A;  1Q18 A;  3LP0 A;  1ATR A;  2O8B A;  1T6D A;  1GLA G;  2KLA A;  1ZBH A;  4PUO A;  2GUP A;  1NK9 A;  1NMN A;  3KD1 E;  1RCH A;  4RW7 A;  4XH4 A;  4IOX A;  3ATU A;  1KAY A;  4NO7 A;  4OVL A;  3L2R A;  3AO4 A;  2KZM A;  4KTQ A;  1ATS A;  5AR0 A;  2BH1 A;  4FJ8 A;  3PLA A;  4B9N A;  2D4W A;  5ELZ A;  4AM7 A;  2O8D A;  2E2P A;  3M8P A;  3PX0 A;  3RTV A;  5GAD P;  3DM2 A;  4ICL A;  2G8W A;  3AVA A;  2XRI A;  3AAP A;  4HTU A;  4W5Q A;  1QQM A;  1SKW A;  4CI6 A;  3RRG A;  3G4S N;  5AQP A;  2O8C B;  3EZ5 A;  4Y1D A;  4NLB A;  2RE2 A;  4FK0 A;  3T1A A;  1S1T A;  1ASW A;  2GEM A;  4CJV A;  4JKA A;  4AF1 A;  4FPB A;  4BG8 A;  4EP4 A;  2IIR A;  5EX5 A;  3E9O A;  2VGN A;  1T44 A;  3LP1 A;  3TU5 A;  3CJC A;  3KHY A;  2P51 A;  5AQM A;  3GOI A;  1TK8 A;  2QM1 A;  3UKR A;  2QKK A;  1I94 K;  3I0S A;  4KH6 A;  1KFD A;  2P9N B;  2IVN A;  2FLO A;  4BDZ A;  3MWT A;  4OPH A;  4C8O A;  1YAG A;  3P83 D;  1YTU A;  4EP5 A;  4BDY A;  3MN6 A;  3THW A;  3R3L A;  2YHB A;  4LFB K;  1NGC A;  2PZS A;  3HT3 A;  4B9L A;  4IKF A;  3QFP A;  5HOO A;  4B3O A;  4JI4 K;  1VSM A;  4FPA A;  1P8Z A;  2O4G A;  4JLH A;  3ZT2 A;  2WC9 A;  3VOV A;  4CF9 A;  3J7Z O;  1J5E K;  5BRH A;  5I9E B;  1TKX A;  3PUF A;  2HHV A;  4B1X B;  2BTF A;  3T3F A;  1NNE A;  3N4Q A;  3U3Y A;  4OPK A;  5CYQ A;  2PFU A;  3DMJ A;  2UUA K;  3NHG A;  3HTV A;  4EHT A;  3OY9 A;  4DTM A;  1N36 K;  3OA9 A;  1VSL A;  4M3X A;  4CJE A;  4FJM A;  1U2V A;  4N47 A;  4DQ8 A;  2DFH A;  5EY4 A;  3A5L C;  3AAQ A;  1VQM N;  3LDS A;  3LAK A;  4FLV A;  2HVI A;  5FPM A;  5KI6 A;  3M6G A;  4E7L A;  5FDL A;  3HOS A;  2P9I A;  2NNW A;  3ZCM A;  5AQZ A;  4JRQ A;  1VQ5 N;  1HJO A;  3NAE A;  5J2P A;  4E3S A;  1U47 A;  1NGE A;  1HYV A;  1VQ8 N;  3EKU A;  1TL3 A;  4IG3 A;  2HHX A;  3WT0 A;  1RT6 A;  2VG7 A;  1F21 A;  1Q7Y O;  3E66 A;  4NCA A;  4EAH D;  1VQ6 N;  1LWF A;  2Z1H A;  2NRV A;  3KWG A;  2YJF A;  4F4K A;  4CF0 A;  3CQX A;  1BO5 O;  3NFA A;  2PYJ A;  3FZL A;  1NGI A;  4O8K A;  2FF6 A;  3WQT A;  4CBU A;  1S6Q A;  1RDC A;  5AJ3 K;  3ZET A;  4BRP A;  2P9P A;  4JEP A;  1VQL N;  4OX9 K;  3CPW M;  3VEX A;  4HVJ A;  1HKC A;  3W3D A;  5AFU A;  4M3Y A;  2FXU A;  1YVU A;  1ZYQ A;  3AA4 A;  4FSV A;  2IAJ A;  2HNZ A;  3EKS A;  3MN7 A;  3AA5 X;  5JLH A;  2CH6 A;  1VQN N;  3ZEU B;  1BG3 A;  3S41 A;  1NGA A;  1VSF A;  4BRN A;  2BUP A;  1BI4 A;  4H4M A;  3KTQ A;  4KB0 A;  2QWN A;  4BRC A;  3OBW A;  4M3U A;  3AO1 A;  3M8Q A;  3NH0 A;  3IFR A;  3CCV N;  3MX2 A;  4DSE A;  3ZYY X;  4BR7 A;  3K2P A;  4JI6 K;  4O5F A;  4CZE A;  2DY4 A;  1G15 A;  2KZZ A;  2O8E A;  2XO7 A;  5E84 A;  1HKB A;  3MEE A;  1XMO K;  3O4W A;  4DFM A;  3HYF A;  2HBJ A;  1RGI A;  4JI5 K;  4DR3 K;  5FRM A;  3ID6 A;  3VA3 A;  3UIQ A;  4NB4 A;  4CZK A;  3THY A;  3HI0 A;  3SCX A;  4LF9 K;  4CJS A;  3HZ6 A;  4GKJ K;  4WQ5 A;  2F9T A;  3L3U A;  4JKE A;  1WSI A;  1I3A A;  1BL3 A;  4C1N K;  2V51 B;  4K42 A;  1HYZ A;  4BRE A;  4ID1 A;  2ITG A;  1BUP A;  2D0A A;  1GLC G;  3VTH A;  1A5W A;  3ID8 A;  4QCL A;  3NE6 A;  5DM6 L;  5EVZ A;  1NWK A;  4MDA A;  4GMJ B;  3CCM N;  1VQO N;  4PQU A;  4DTP A;  3VGL A;  1WSG A;  3LAL A;  5E41 A;  1KSP A;  1ZC6 A;  4RW8 A;  3UB5 A;  1NJW A;  1X9M A;  1GOC A;  1KLM A;  2NLX A;  4PKI A;  4YY3 K;  3OS1 A;  2CGJ A;  3W0L A;  3LZI A;  1S9G A;  5I42 A;  4FZX C;  3F9K A;  4LD0 A;  2P9K A;  4FWR A;  3I56 N;  2AJQ A;  3ATV A;  1YTA A;  3OYC A;  3MXI A;  4CE9 A;  4DU4 A;  1JXE A;  2PBD A;  3EE8 A;  4DF8 A;  3PX4 A;  4CHQ A;  1WSE A;  4B9S A;  3OYA A;  5BPN A;  3OYE A;  4KTZ A;  2RHK A;  4H0X B;  1VQ9 N;  2QKB A;  2E1Z A;  3UKU B;  1Y64 A;  1BA0 A;  2FBV A;  3KK2 A;  3IS9 A;  3NH1 A;  1Q86 O;  2J4R A;  5BN8 A;  2O4I A;  4FW2 A;  2KW4 A;  2V52 B;  3PV8 A;  4EHU A;  3DOK A;  3KD5 E;  4CFD A;  4FJJ A;  4AHT A;  2X6N A;  3B6O A;  4YDU A;  1NK5 A;  4JI8 K;  4FWS A;  2OCE A;  3T7Z A;  2ZJQ L;  4KAZ A;  3S3N A;  3T19 A;  2ASM A;  4E0D A;  4A5A A;  2G8V A;  1NK7 A;  4CCH A;  4KHP K;  2JWL A;  2HST A;  4E7H A;  1X9J A;  2ASP A;  1QSL A;  1KCF A;  1E3M A;  1DTT A;  2Q1N A;  3OYB A;  1W0H A;  3NH2 A;  3HST B;  3AA2 A;  3CME N;  2IDO A;  5BR9 A;  4L3Q A;  4DCH A;  4DV5 K;  3DXM A;  1BIZ A;  4B3M K;  1DEJ A;  2UU9 K;  3M8S A;  4Z4E A;  2RKI A;  4DQP A;  1BHL A;  3WXI A;  1C6V A;  1SZ2 A;  2P1J A;  4DQR A;  3AY9 A;  4WCE L;  3OYL A;  2YJE A;  1GOB A;  4J2D A;  4JKG A;  3R9P A;  3EL2 A;  4WFB L;  5HRO A;  5HRS A;  1Q8I A;  2W6L A;  1RT2 A;  3KK1 A;  3E1Y A;  3K5O A;  4FZY A;  3V9X A;  3SI6 A;  3R6M A;  1MU2 A;  3ENB A;  5M1F A;  5BN9 A;  4U67 L;  4JN4 A;  4BRG A;  3J80 O;  1LAW A;  3CM5 A;  3HK2 A;  1KRP A;  3DRS A;  1HNV A;  1RBT A;  3CCU N;  3IAY A;  1D9F A;  1Y97 A;  3HPG A;  4FO0 A;  1ZBL A;  4NYN A;  3QIO A;  3A5N C;  4JD2 A;  3AVB A;  4LH4 A;  3CFR A;  4F8R A;  2A6A A;  5EXW A;  3WNF A;  2FSJ A;  1QZ6 A;  3TTD A;  4DV4 K;  2E5L K;  3H1Q A;  3SPZ A;  2GWK A;  1UA0 A;  2E1Y A;  3C7N A;  2E2N A;  1TKD A;  4A61 A;  1FXX A;  1N5Y A;  4IJA A;  4FJ7 A;  2D5R A;  3QET A;  2HOE A;  2EHG A;  1RT1 A;  1DLO A;  3QFU A;  5AZJ A;  4CW7 B;  4KV8 A;  5J1E A;  4CZI A;  3AV9 A;  4YOU A;  1RBU A;  3OHR A;  4YOX A;  4M63 C;  3DLH A;  3SK3 A;  5LMU K;  2HF3 A;  4JI3 K;  4JKD A;  4Z4H A;  2NZT A;  5IT9 O;  1EET A;  2I7N A;  4CEC A;  3OS0 A;  2F96 A;  2DTU A;  4FM0 A;  2X78 A;  4CJ5 A;  3P4I A;  1RDU A;  4GW6 A;  4CZH A;  2Q36 A;  4CHZ A;  3QER A;  4ELT A;  4B9V A;  3Q7B A;  4ISG A;  4DTJ A;  4UY8 O;  3TAG A;  4EIA A;  2KFN A;  1NK0 A;  1BA1 A;  3KWI A;  1WSF A;  3O1W A;  1IKV A;  2P5O A; 
#chains in the Genus database with same CATH homology
 4B9M A;  3SNN A;  3V1R A;  4L8R B;  4KHQ A;  4Z4I A;  4EP4 A;  4UQG A;  4E7J A;  1RDA A;  4FZY A;  3QNN A;  4DU1 A;  3OYI A;  4KRE A;  3VQB A;  1SL2 A;  1WN7 A;  2ZQB A;  5HBM A;  3SPY A;  3LP1 A;  4EZ9 A;  3O3G A;  4FJK A;  1VSE A;  4FVM A;  2G8I A;  1CXQ A;  2HHU A;  3JYT A;  1EKE A;  2P51 A;  3NF6 A;  1JLQ A;  4R5P A;  2YNG A;  3O3F A;  3LP2 A;  4LH5 A;  4B8A B;  2A1R A;  2QKK A;  1TK8 A;  5J2M A;  2OPS A;  1ZBF A;  1LW2 A;  3I0S A;  5HRP A;  3VN5 A;  4HUF A;  3TR8 A;  1KFD A;  4BDZ A;  3KLE A;  3P1G A;  1JLA A;  1NJX A;  2D0C A;  4C8K A;  3KLF A;  1U49 A;  2KFZ A;  5SWM A;  3QLH A;  4C8O A;  1RIL A;  3P83 D;  1YTU A;  4EP5 A;  4BDY A;  4Q5V A;  4F3T A;  4HUE A;  4CJQ A;  1JLE A;  4RW9 A;  5DK5 A;  3RRH A;  2LSN A;  1U45 A;  3EY1 A;  3KKS A;  2YHB A;  4I2Q A;  3VQQ A;  3OYJ A;  2PZS A;  3HT3 A;  1HMV A;  4B9L A;  4DF4 A;  4IKF A;  1TVR A;  3TAN A;  3F73 A;  3ULD A;  5DMR A;  3BGR A;  4OPJ A;  4DTU A;  4FJI A;  4B3O A;  1VSM A;  3ITH A;  1HQU A;  4KI4 A;  4E7K A;  1W9H A;  3DI6 A;  1X9W A;  3E01 A;  4KO0 A;  2Y1I A;  2O4G A;  4JLH A;  4M3R A;  3DRP A;  3ZT2 A;  4CF9 A;  3RMC A;  4CJ3 A;  4MFB A;  5CZ2 A;  4DG1 A;  4DFJ A;  3B6P A;  3TAQ A;  5C24 A;  3K5L A;  1TL1 A;  4FCY A;  1QQC A;  4OKK A;  1TKX A;  2Z1G A;  1RBV A;  1VSI A;  3LAN A;  3PUF A;  4E1M A;  4BE0 A;  4DS5 A;  3ZSY A;  2HHV A;  3ZSX A;  1NJZ A;  2BGG A;  4OGC A;  4CEF A;  3T3F A;  2W42 A;  1XI1 A;  4CIF A;  2YNI A;  3DOL A;  3KIO A;  3U3Y A;  4OPK A;  4E7I A;  5CYQ A;  4CF8 A;  4CFA A;  3QNO A;  1J5O A;  4FJ5 A;  3DMJ A;  1L3U A;  3NHG A;  3FFI A;  4CHO A;  1IKW A;  4J2B A;  3OY9 A;  4DTM A;  1J53 A;  3C95 A;  3HPO A;  3SYZ A;  3AO2 A;  4AHS A;  2OPQ A;  1XWL A;  3LWL A;  2XY7 A;  1VSL A;  4M3X A;  3MAQ A;  4I7F A;  4CJE A;  4FJM A;  5JS2 A;  3OYK A;  4N47 A;  1S1U A;  3DLK A;  1BI4 B;  1SKR A;  2DFH A;  4CFC A;  1VK0 A;  3QO9 A;  3OS2 A;  3VQ4 A;  1L3V A;  2B6A A;  3DLB A;  1RBR A;  3MXJ A;  3LDS A;  3LAK A;  1KTQ A;  4FLV A;  2HVI A;  5KI6 A;  4E7L A;  4CEO A;  4OKJ A;  5FDL A;  4OKE A;  4CJW A;  1NKB A;  1ZBU A;  3KLG A;  1FK9 A;  3VQC A;  3ZCM A;  2E6L A;  4JRQ A;  1B92 A;  3NAE A;  5J2P A;  4E3S A;  3NF8 A;  1U47 A;  1HYV A;  1TL3 A;  1U04 A;  3HXM A;  1CXU A;  4IG3 A;  2HHX A;  3RWU A;  1JLC A;  1A5X A;  3AO3 A;  1RBS A;  1RT6 A;  2VG7 A;  3ZT3 A;  3JSM A;  4FXD A;  1F21 A;  1CLQ A;  3NGZ A;  4NCA A;  1LWF A;  1KVA A;  1HNI A;  2Z1H A;  1Z25 A;  3QEV A;  1ASU A;  1EP4 A;  4CF0 A;  4F4K A;  4DQS A;  2F8T A;  1TKZ A;  3EYZ A;  4AHC A;  3V9S A;  3WNH A;  3NFA A;  2HND A;  3QIP A;  4DSF A;  4CGJ A;  1FKO A;  4Z0U A;  4CJR A;  2PYJ A;  2HVH A;  3TWH A;  5KRT A;  1L3S A;  1SKS A;  3V9U A;  1KVB A;  4CK1 A;  4M3T A;  3D45 A;  4OLB A;  1S6Q A;  1S5J A;  1TV6 A;  4IBN A;  1RDC A;  3QEI A;  1NOY A;  3P5J A;  1IKY A;  2HNY A;  3V6D A;  4OGE A;  1KVC A;  1K6Y A;  1WAJ A;  1LWC A;  3IG1 A;  3VQ6 A;  1I39 A;  1T8E A;  4KKO A;  2YKN A;  3L2W A;  1BCO A;  4W5N A;  5D3G A;  1JL1 A;  3MXM A;  3I0R A;  4HVJ A;  2X6S A;  1JL2 A;  4IG0 A;  4CK3 A;  2R7Y A;  3SQ2 A;  5FRN A;  5J2N A;  4M3Y A;  5HP1 A;  3ZSQ A;  4YNQ A;  4FJH A;  1RDD A;  1YVU A;  4CGD A;  1ZYQ A;  1NK8 A;  2G8K A;  1B9F A;  3AA4 A;  3K5N A;  4JS4 A;  1VSJ A;  3HP9 A;  2ETJ A;  2IAJ A;  4LSN A;  2PYL A;  4FJN A;  4FJ9 A;  2HNZ A;  2RN2 A;  4ZHR A;  3OJS A;  3AA5 X;  3SQ4 A;  4H4O A;  1LV5 A;  1N6Q A;  3V1Q A;  4RW6 A;  5CY4 A;  3QIN A;  1VSF A;  4MQ3 A;  4CHP A;  4M3W A;  2D0B A;  3CFP A;  1BI4 A;  2WON A;  4KHW A;  1FKP A;  3MED A;  1BQM A;  4O44 A;  4H4M A;  1Q9X A;  3KTQ A;  3V9W A;  5J2Q A;  4LSL A;  4FLT A;  2HB5 A;  4Y1C A;  1S9E A;  3VQE A;  4KB0 A;  2XY5 A;  4K8Z A;  1REV A;  1HQE A;  4N5S A;  2HMI A;  1YT3 A;  3SV3 A;  1SL0 A;  4M3U A;  3OYF A;  3ZSZ A;  4WE1 A;  3AO1 A;  4IDK A;  3M8Q A;  3NH0 A;  4H8K A;  4DTN A;  4DSL A;  3DYA A;  2X74 A;  3ZSW A;  4DSE A;  4DFK A;  3QEX A;  1VRT A;  4I9Q A;  4C8L A;  3TAP A;  4G1Q A;  3K2P A;  2Y1J A;  1B9D A;  3AVL A;  2DY4 A;  1G15 A;  3HPH A;  2KZZ A;  3SQ0 A;  4CEB A;  4CGI A;  3RR7 A;  2IGI A;  2XO7 A;  1T05 A;  3VQ8 A;  2NUB A;  3NBP A;  3MEE A;  4J2A A;  2IC3 A;  3NGI A;  4DFM A;  1U48 A;  3HYF A;  4BWM A;  3ZT0 A;  2G8F A;  2OPR A;  1SUQ A;  4CFB A;  3C6U A;  5KGX A;  5CYM A;  1R0A A;  3VQ5 A;  2DFF A;  5FRM A;  3S9H A;  3VA3 A;  1T7P A;  3UIQ A;  3DLR A;  2E4L A;  2JGU A;  4BE2 A;  1BQN A;  4B8C A;  4CF1 A;  3SCX A;  3HO1 A;  3U3G A;  3QES A;  3TAM A;  1HPZ A;  4CJS A;  1C1A A;  5KRS A;  3V81 A;  1VSD A;  2B5J A;  3SJJ A;  4DU3 A;  4M45 A;  1CZB A;  4M41 A;  4FYD A;  3L3U A;  1RTI A;  3K58 A;  3PY8 A;  1EX4 A;  1WSI A;  1I3A A;  1BL3 A;  2FC0 A;  5T7B A;  3HM9 A;  4PY5 A;  2YHA A;  1HYZ A;  1X9S A;  4W5T A;  3AVI A;  3OYH A;  5HRN A;  3RMD A;  4QOZ B;  4ID1 A;  4O0I A;  5JS1 A;  2ITG A;  2HHS A;  2D0A A;  4DTO A;  1U4B A;  4CIE A;  3AVF A;  4CJF A;  3K57 A;  4RG8 A;  3VA0 A;  4CJK A;  2WOM A;  1A5W A;  4FM2 A;  1T03 A;  4QCL A;  2KQ2 A;  4KRF A;  3MEG A;  3NE6 A;  5FRO A;  3TAF A;  4FM1 A;  4C8M A;  1WNS A;  2FBY A;  1QSS A;  2XHB A;  2Q3S A;  4GMJ B;  4ID5 A;  4O4G A;  3WNE A;  4DTP A;  2F8S A;  4PQU A;  1WSG A;  3LAL A;  1SV5 A;  4GVM A;  3SUN A;  2QXF A;  5E41 A;  2Z1I A;  3O4Q A;  1C1B A;  3L3V A;  4CJT A;  1RTD A;  2HHW A;  4HUG A;  2OZS A;  4ELU A;  3KLI A;  1KSP A;  4W5R A;  4Z4C A;  4W5O A;  1RDB A;  1S1W A;  3CFO A;  3IRX A;  4RW8 A;  1KLM A;  1GOC A;  1NJW A;  3OS1 A;  1X9M A;  1D8Y A;  4KHS A;  4OLA A;  3LZI A;  4DTS A;  3BDP A;  1S9G A;  5I42 A;  3TI0 A;  4O5B A;  4FZX C;  4ELV A;  1RTH A;  3F9K A;  4LD0 A;  3ALY A;  3ZSO A;  1QHT A;  1C0U A;  3KLH A;  1IH7 A;  1ITG A;  1Q9Y A;  2AJQ A;  3ZT1 A;  5EU7 A;  3LPU A;  1YTA A;  1RT3 A;  3OYC A;  1BCM A;  1S1V A;  3MXI A;  4DQI A;  4CE9 A;  4DU4 A;  1JXE A;  4FLW A;  4J2E A;  2XY8 A;  1EXQ A;  3DRR A;  3OJU A;  1RNH A;  4DF8 A;  3PX4 A;  3ZSV A;  1TK0 A;  4CHQ A;  1WSE A;  4B9S A;  4DSK A;  4CHN A;  3OYA A;  3VQP A;  3PO5 A;  3VQ7 A;  5I3U A;  1UAX A;  3HP6 A;  3OYE A;  4KTZ A;  2OZM A;  3RR8 A;  4FZZ A;  2PY5 A;  1VSH A;  2QKB A;  3HJF A;  1Z26 A;  1TKT A;  1C0M A;  2JLE A;  2P5G A;  3CQ8 A;  2IS3 A;  2FBV A;  3KK2 A;  1IO2 A;  3IS9 A;  4FW1 A;  3RMA A;  3NH1 A;  3M8R A;  3AVN A;  3V9Z A;  2YNF A;  3VQ9 A;  4CES A;  2ZD1 A;  3O4N A;  4FW2 A;  2O4I A;  2KW4 A;  4AHV A;  1TAQ A;  3PV8 A;  1NOZ A;  4Q0B A;  3DOK A;  3KD5 E;  3NF7 A;  4QAG A;  4CFD A;  2HHT A;  2B4J A;  4FJJ A;  1KLN A;  3ISN C;  4AHT A;  4DFP A;  1NJY A;  4FLY A;  2X6N A;  3B6O A;  1TK5 A;  3HVT A;  1NK5 A;  1RT7 A;  3NCI A;  4KTW A;  4DLG A;  4FJX A;  1ASV A;  4DMN A;  3SUP A;  1JXB A;  3DLG A;  4KAZ A;  3S3N A;  1BIU A;  1LAV A;  3T19 A;  4E0D A;  2HW3 A;  4DTR A;  4N41 A;  2G8V A;  4F2R A;  1WAF A;  5C42 A;  3OYN A;  3A2F A;  3HL8 A;  1NK7 A;  3LPT A;  4CCH A;  2Z1J A;  1KFS A;  4CEZ A;  3CM6 A;  1ZBI A;  2KTQ A;  2GBZ A;  4CEQ A;  3AA3 A;  4E7H A;  3KK3 A;  3G0Z A;  1QSL A;  4FLX A;  1KCF A;  4CER A;  5C25 A;  5HLF A;  4ZTJ A;  1DTT A;  4I9L A;  2BAN A;  3AVK A;  3SZ2 A;  2HHQ A;  4NCG A;  4KB1 A;  3I8D A;  3PX6 A;  3OYB A;  1BGX T;  1W0H A;  3NH2 A;  3HST B;  3AA2 A;  4RW4 A;  2IDO A;  3OYG A;  4FLU A;  3HVR A;  4LY7 A;  4DLE A;  3LP3 A;  4KPY A;  1HYS A;  3NDK A;  3ZT4 A;  1BIZ A;  2E6M A;  5KTQ A;  3TAR A;  1HRH A;  2RPI A;  4F3O A;  3OYD A;  4C8N A;  1TAU A;  3U6F A;  3SUQ A;  2IOC A;  4BE1 A;  3C6T A;  3M8S A;  4M42 A;  4Z4E A;  4N76 A;  3SUO A;  1NK4 A;  3SQ1 A;  3L8B A;  3LAM A;  3AVM A;  2RKI A;  4DSJ A;  4KHN A;  4N56 A;  4DQP A;  2QK9 A;  1BHL A;  5CZ1 A;  1C6V A;  3V4I A;  4KHY A;  2BE2 A;  2P1J A;  4DQR A;  4TSX A;  4Z4G A;  2YNH A;  2OPP A;  3KJV A;  1UOC A;  3OYL A;  4JRP A;  1S6P A;  1GOB A;  1RT5 A;  4O55 A;  4J2D A;  4K8X A;  2ZE2 A;  2VWJ A;  4KHU A;  2I5J A;  5HRO A;  1WSH A;  4CJ4 A;  5HRS A;  1Q8I A;  4B9T A;  4HCB A;  1UA1 A;  1RT2 A;  4CJL A;  1JKH A;  3KK1 A;  3QEP A;  1IG9 A;  2GUI A;  1WLJ A;  1XHX A;  3K5O A;  3AVH A;  3V9X A;  3SI6 A;  4AHR A;  3ASM A;  1MU2 A;  4IFV A;  4BAC A;  4FK2 A;  3AVG A;  5HRR A;  3SV4 A;  4XIU A;  2BDP A;  1D9D A;  2A1S A;  2FBX A;  4CJP A;  3DLE A;  1LAW A;  3CM5 A;  2G8U A;  3HK2 A;  4CED A;  4CF2 A;  1NKC A;  1KRP A;  2XY6 A;  1BIS A;  3DRS A;  4HCC A;  1JLG A;  1HNV A;  4AIL C;  2OYQ A;  1RBT A;  3CYM A;  1QS4 A;  3MEC A;  3PO4 A;  3IAY A;  1D9F A;  1Y97 A;  3L2V A;  4DQQ A;  3HPG A;  1ZBL A;  2YV0 X;  4NYN A;  3QIO A;  4E1N A;  3AVJ A;  4DTX A;  4F2S A;  1D5A A;  1QTM A;  3AVB A;  4CEE A;  4LH4 A;  3CFR A;  3L2U A;  4F8R A;  1LW0 A;  3G10 A;  3D0P A;  3LZJ A;  1L3T A;  3LWM A;  1VRU A;  1X1P A;  1UWB A;  4E89 A;  1XHZ A;  1SL1 A;  3H08 A;  3TAB A;  1NKE A;  4EZ6 A;  1WSJ A;  3AO5 A;  1QE1 A;  3AVC A;  4O0J A;  3WNF A;  3THV A;  4FK4 A;  1S1X A;  4E19 A;  2VWK A;  4CJU A;  3ZSR A;  3SPZ A;  3S3M A;  1L5U A;  4M3Z A;  1UA0 A;  2GV9 A;  4B08 A;  3L2Q A;  1C1C A;  4AH9 A;  1TGO A;  4CK2 A;  3QEW A;  5SZT A;  3K59 A;  4DS4 A;  5KGW A;  1TKD A;  4CGH A;  4JS5 A;  1FXX A;  4BDP A;  4FJG A;  1N5Y A;  4PA1 A;  4PWD A;  2DFE A;  2EX3 A;  2VG6 A;  2D5R A;  4OJR A;  3QET A;  4FJ7 A;  4Z4F A;  1NK6 A;  1JLB A;  3S3O A;  1IKX A;  1QSY A;  1RT4 A;  1O1W A;  2EHG A;  2YKM A;  1RT1 A;  1DLO A;  4BWJ A;  3K5M A;  4CGF A;  5K14 A;  4CHY A;  3LP0 A;  3RMB A;  1HJR A;  3KKR A;  4B9U A;  3NGY A;  4KV8 A;  5J1E A;  1ZBH A;  2RF2 A;  4PUO A;  3AV9 A;  4CGG A;  1GOA A;  4ZTF A;  1DTQ A;  1RCH A;  4RW7 A;  1NK9 A;  3KD1 E;  1LWE A;  1RBU A;  3DLH A;  4DSI A;  4OVL A;  4FJL A;  3L2R A;  3AO4 A;  2ATQ A;  2KZM A;  1XC9 A;  4AHU A;  4KTQ A;  1VSK A;  4Z4H A;  1EET A;  4FJ8 A;  4CEC A;  4HHT A;  4B9N A;  2OA8 A;  3V1O A;  4FLZ A;  4NCB A;  1CZ9 A;  2VG5 A;  2F96 A;  3OS0 A;  3M8P A;  3PX0 A;  4FM0 A;  3RTV A;  2X78 A;  4CJ5 A;  2DTU A;  3DM2 A;  1J9A A;  4ICL A;  2G8W A;  3AVA A;  4GW6 A;  1JLF A;  2XRI A;  4IFY A;  3OVN A;  4HTU A;  3CG7 A;  4W5Q A;  4DWI A;  4KI6 A;  1SKW A;  1C0T A;  4CHZ A;  3QER A;  3RRG A;  4B9V A;  4ELT A;  4DTJ A;  1A5V A;  3NF9 A;  3VQD A;  3EZ5 A;  4Y1D A;  3TAG A;  2FBT A;  4CIG A;  1RTJ A;  3VQA A;  1NK0 A;  3T1A A;  4FK0 A;  2KFN A;  3WNG A;  4CEA A;  2G8H A;  4I2P A;  4YFU A;  1WSF A;  1S1T A;  3TAE A;  1ASW A;  4KFB A;  1IKV A;  2P5O A;  4CJV A;  3O3H A;  3OYM A;  3C94 A;  1J54 A;  4NYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...