3VA3A

Crystal structure of rnase t in complex with a duplex dna product (stem loop dna with 2 nucleotide 3' overhang)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
205
Chain Sequence
b'QLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 58
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3va3A00
2A1SA 1EX4A 1TL3A 3VQ5A 4BDZA 2PYJA 1T7PA 1B92A 1WSFA 4F4KA 3VA0A 1EXQA 5J2PA 2RPIA 3L2UA 1L3VA 4CJ3A 2BDPA 3RRHA 4IFYA 5KTQA 1LW2A 1SKSA 1VSHA 1LAWA 2F96A 4DTOA 3OYLA 3HT3A 4HUGA 3FFIA 1LV5A 4F3TA 4GVMA 1JLBA 3RR7A 1BHLA 1IO2A 4O0IA 3SQ1A 2XY5A 3PX4A 1I3AA 4IG0A 3HPOA 4JRQA 4KHYA 3V1RA 4C8KA 3UIQA 4OVLA 2KW4A 4KAZA 1JKHA 1Y97A 2FBTA 3LP3A 4CFBA 2ETJA 3K5OA 3O3HA 3OY9A 4CCHA 3IAYA 2DFFA 1ZBLA 3OYBA 1SL2A 1HJRA 1J5OA 4J2BA 3V9WA 3LP2A 3RMDA 4N41A 1L3SA 1EP4A 2O4GA 3V9ZA 4CHZA 1C1AA 1L5UA 4OKJA 1HYZA 3VQPA 2X78A 1YTUA 1JLFA 4Z4GA 3NF7A 3RRGA 4CEFA 3DRRA 4CJEA 1Q9YA 4KHNA 4NCGA 4IKFA 2KQ2A 4FM2A 3AO4A 1BIZA 4CHQA 3ITHA 4E7JA 2AJQA 3K5MA 4Z4FA 2JGUA 4ELVA 1RT7A 4QCLA 4JS4A 3WNGA 1IKWA 3V9UA 3VA3A 3AA2A 4CJ4A 5KRSA 2WONA 3LPTA 4DFMA 2OZSA 2NUBA 5J2NA 1QS4A 3U6FA 3V1OA 5I42A 4OGCA 1RT4A 3KLHA 2Z1IA 3JSMA 1WSEA 2HHSA 4NYNA 1BL3A 2F8TA 4CFDA 4M42A 3C94A 4ICLA 1KSPA 1EKEA 1GOCA 2X74A 1NOYA 1WSJA 3L3VA 1MU2A 1WAFA 4M3TA 3ZSRA 5DK5A 1UAXA 4IFVA 4LD0A 3TR8A 4L8RB 3AVGA 2HHWA 3IRXA 1Q8IA 4CHPA 1ZBHA 2G8IA 3QNNA 4I9QA 3EYZA 4FM1A 3LP0A 1FKOA 2FBYA 4MQ3A 4CHYA 2G8UA 2YKMA 3RMAA 4DU4A 1WLJA 3QESA 4KPYA 3ASMA 1LAVA 4DSEA 1SL1A 2OZMA 3ZT4A 1LWEA 2HB5A 3AVLA 3OYKA 5CZ1A 3DLRA 1GOBA 1ASVA 1NKBA 1O1WA 4WE1A 4CFCA 1WAJA 2IGIA 4C8MA 2ZQBA 3TABA 3K5NA 4B9NA 5CYQA 4DG1A 1W9HA 4DF8A 2B4JA 4CJKA 1Z25A 3M8QA 4W5RA 3NH0A 3NCIA 4CEZA 1X9MA 3AV9A 4IBNA 4O4GA 4FJ5A 1VSKA 1CZBA 1VSLA 1VSIA 2ZD1A 1KCFA 4ID1A 4DMNA 3M8PA 4ZTFA 2D0AA 3RR8A 4FJIA 3DLHA 3AVHA 3OYIA 1NKCA 3PO4A 3KTQA 1RDDA 4B8CA 2P1JA 3LALA 1FXXA 1D5AA 1NK8A 4HUFA 3MAQA 3VQ6A 4FM0A 4FJJA 1JLGA 2DY4A 4FLZA 1KVCA 2Y1IA 3MEEA 2VWKA 4W5QA 5SWMA 3QNOA 4M3UA 1U47A 5E41A 4CK3A 1NJZA 1ZBIA 3MECA 4MFBA 3ZSVA 4KO0A 3ZCMA 3V6DA 1NK6A 3G10A 1TAUA 1NJYA 4CERA 3SYZA 3EY1A 4RW6A 2HHQA 4KHSA 5C24A 4AHTA 5JS1A 1LW0A 3NF8A 4JS5A 4B3OA 4Q5VA 5I3UA 2O4IA 5KGXA 4GW6A 1B9FA 4RG8A 5EU7A 3AVMA 4B9MA 4C8LA 4FJGA 2YNHA 3NGIA 3K58A 4M3WA 4FJNA 1RTIA 2YHAA 1TVRA 4O55A 4E3SA 2P5GA 1ITGA 2QXFA 3DOKA 3K59A 3OYDA 3U3YA 3KD1E 1J54A 3RMCA 2QKBA 1TKXA 4DTSA 4H4MA 4B9TA 1RT5A 1W0HA 4LH5A 1TGOA 3SZ2A 4EP5A 4AH9A 3AVIA 1BISA 1BQMA 4DQSA 3TANA 4FJXA 2HHXA 1HQEA 1VSEA 1A5XA 4DFJA 1BGXT 1D9FA 3AO2A 1CLQA 1BIUA 3B6PA 4QAGA 2X6SA 4HCBA 5HROA 1KLNA 1GOAA 1QHTA 2OPSA 1QSYA 2EHGA 3AO5A 3IS9A 2HW3A 3WNEA 3KLEA 4DLEA 1K6YA 4FLXA 3V9XA 1QE1A 3P83D 3KKSA 5HRSA 3S3OA 1U49A 3BDPA 1FK9A 1F21A 3ZSWA 4HVJA 4DS5A 2WOMA 4CJ5A 1RT2A 1S1VA 1U48A 3QERA 1VK0A 3OYAA 1C0TA 3S3NA 4KTQA 4M3YA 1VRUA 1XHXA 4KV8A 4CE9A 1NK4A 3B6OA 4FJ9A 1SV5A 2ATQA 2B5JA 4FZXC 4KHUA 4E0DA 4CJWA 3MXIA 4CECA 1XC9A 4I2PA 4JLHA 5T7BA 2VWJA 3DRSA 1TK8A 5CY4A 2HNZA 2QKKA 3KKRA 4CGDA 1HMVA 3NH2A 3HVTA 3AVCA 4E19A 4K8ZA 4J2DA 2BGGA 4BWJA 1B9DA 1EETA 4DS4A 2KFZA 4CF9A 2QK9A 3HP9A 4Z4HA 4B8AB 4EZ9A 4F8RA 4FLUA 3D45A 3HP6A 2HHTA 4ZTJA 1RILA 3AVNA 1RT6A 1HRHA 4FJLA 2A1RA 1XI1A 4M41A 2G8KA 5CZ2A 4FLYA 3SUOA 3KLGA 1HNVA 4OKEA 1SL0A 4FVMA 4OJRA 4CF2A 1BCOA 1RTDA 5FRMA 4Y1CA 3VQCA 1WSIA 1KTQA 4LSNA 1JL1A 2ITGA 2HNDA 3PX6A 1C6VA 1X9WA 3O4NA 3SQ4A 4PUOA 4CJLA 1RBSA 3L2RA 3LDSA 3D0PA 4Q0BA 4CIFA 1NK0A 1XWLA 4NCBA 1TV6A 4DFPA 1IG9A 3WNFA 1WSGA 3VQDA 4AHUA 3TAMA 4W5NA 3CQ8A 4OGEA 4DF4A 4HTUA 4PA1A 4FZZA 3LWLA 4DQQA 2KZZA 3K57A 3CM6A 3ZSOA 1SKWA 3DOLA 3NBPA 3QINA 3KK2A 4DU3A 3HJFA 3LAKA 3ZSYA 3A2FA 3AA4A 1R0AA 4O44A 3I0SA 3PUFA 1JLQA 4OPKA 4DTXA 2OA8A 1TKDA 4DTPA 3MXMA 1BQNA 5JS2A 1IH7A 4CEBA 4FLWA 1RT3A 1S5JA 2YNFA 4E89A 4W5OA 4CEDA 3O4QA 4CJSA 4CJUA 4DTUA 1Q9XA 3ZSQA 1QSSA 3VQ7A 1RDBA 1JXEA 4ZHRA 4KREA 3LWMA 1U4BA 4CFAA 1REVA 4EP4A 4HUEA 4YFUA 4CF0A 1RBUA 4N5SA 2G8FA 3HVRA 3NAEA 2PY5A 2XHBA 1RT1A 2PYLA 4FK4A 4CF8A 1Z26A 2OPQA 4BWMA 3KK3A 3L8BA 4KHWA 4CGHA 3NGZA 3QEPA 4DSIA 1L3TA 1RDCA 1ZBUA 3MEDA 3KK1A 1JLEA 4CGIA 1KRPA 5D3GA 3OYHA 3U3GA 3M8RA 3RTVA 3E01A 3QEVA 2HHUA 2B6AA 1JL2A 2BE2A 3SV3A 1ASWA 4FYDA 2YNIA 2KFNA 3ZSXA 1JXBA 1CZ9A 2Z1HA 2R7YA 2FC0A 2RN2A 3SPYA 4PWDA 4KI4A 1TAQA 1IKVA 2GV9A 5KRTA 4UQGA 4E1MA 3OS0A 3THVA 1KFSA 3V81A 5HP1A 3DI6A 3ALYA 3C6UA 4AHRA 3PO5A 3QETA 3M8SA 1L3UA 3H08A 3HYFA 3NF9A 4JRPA 3AVAA 2HVIA 3DLKA 3TWHA 3VQBA 1UA1A 3HK2A 4FXDA 1QSLA 3WNHA 1U04A 3C6TA 3CM5A 3HPHA 4CGGA 4Z4CA 4M3XA 4KKOA 3ZT0A 3AVJA 4F3OA 2HHVA 4RW8A 3ZT3A 1ZYQA 4NYFA 2DFHA 3ULDA 5J2MA 3SPZA 3OYNA 3AVBA 4G1QA 3QEXA 1N5YA 4KRFA 3HL8A 3OYJA 2OPRA 3NFAA 2X6NA 3HSTB 4DU1A 2XY6A 2VG6A 3JYTA 4GMJB 4CJRA 2Q3SA 1WNSA 1TKTA 4DTJA 3NH1A 3S9HA 3DLGA 1NOZA 1UOCA 1RTJA 3LANA 4N47A 1S9EA 3PX0A 4FJ7A 2VG7A 1T8EA 2Z1JA 2YKNA 4ID5A 1J9AA 3L2WA 2P51A 3DRPA 3OJSA 1LWCA 3VQQA 3VN5A 4DLGA 4F2SA 3TAQA 4DTRA 4PY5A 1YT3A 3QEWA 2GBZA 1A5VA 5KI6A 4B9SA 4CEEA 1X9SA 1VSDA 3AVFA 3PV8A 4DQPA 2KZMA 1DTTA 4DTMA 3K2PA 4FJMA 1TK0A 4FK2A 5HRPA 1HPZA 1UWBA 3QO9A 2OPPA 4O5BA 2W42A 3NHGA 2DFEA 2Z1GA 2RF2A 1IKXA 4CIGA 3AA5X 3AO3A 4LY7A 1HNIA 2D0CA 4DSFA 1RBRA 5CYMA 2DTUA 1T05A 2XRIA 1IKYA 4I7FA 5HRRA 4B08A 3S3MA 2F8SA 2HNYA 1YTAA 1RNHA 4FLVA 4B9VA 4KB1A 3HO1A 5C42A 4DWIA 4W5TA 3AA3A 3I8DA 3TAEA 3DLEA 4LSLA 4H8KA 4N56A 4KTWA 4F2RA 2KTQA 4FW2A 3HXMA 4QOZB 4CGJA 1FKPA 2YHBA 1C0UA 1KLMA 1HYVA 4CESA 4OLBA 1HYSA 1WSHA 3HM9A 4CHNA 1LWFA 3SQ0A 3OVNA 4RW9A 4Z0UA 3CFPA 4AILC 3RMBA 3VQ4A 4FJHA 1TKZA 2G8WA 4DSJA 4HCCA 1S1TA 3V1QA 2RKIA 2YV0X 4CK2A 4CEOA 3OS2A 3L2VA 2LSNA 3SQ2A 3BGRA 4AHCA 1WN7A 4AHSA 2OYQA 1BI4B 1BCMA 4OPJA 1NJWA 3I0RA 3QIOA 4FCYA 3SV4A 3F9KA 2D5RA 4I9LA 2FBVA 4CK1A 4NCAA 3SJJA 1DLOA 4ELTA 5HRNA 3ZT2A 4RW4A 3VQAA 4CF1A 1ZBFA 4HHTA 1NKEA 3O3FA 1S1XA 1D9DA 4AHVA 3P5JA 3OYMA 5FROA 1DTQA 4Z4EA 3V9SA 3SI6A 4BDPA 2IC3A 4EZ6A 1S1WA 4E7IA 3KIOA 4TSXA 4CEAA 2XY7A 1D8YA 3AVKA 4FK0A 1RBVA 3KLIA 4CIEA 1VSJA 4E7LA 4H4OA 4CEQA 4E7KA 3DLBA 4KHQA 1KVAA 3NGYA 2HVHA 3DM2A 2I5JA 5J2QA 4DQIA 3K5LA 5HLFA 3KLFA 3VQEA 4CJVA 1A5WA 1RTHA 4E7HA 3OJUA 4DSKA 5FDLA 1S1UA 1JLCA 3SUQA 3L3UA 3RWUA 4DTNA 3F73A 4M3RA 4BE1A 2IS3A 3L2QA 4IDKA 5SZTA 3SUNA 4CJFA 5DMRA 1J53A 2XY8A 3QEIA 1TL1A 4OKKA 3LZJA 3C95A 1C1CA 1VRTA 3VQ8A 1CXUA 4M45A 4E1NA 3PY8A 2HMIA 4KFBA 2IOCA 1G15A 4FW1A 1RCHA 3TAGA 1CXQA 3MEGA 1VSFA 4DQRA 3TARA 1KFDA 1NK5A 5KGWA 5FRNA 4R5PA 5J1EA 3VQ9A 3V4IA 3QIPA 3TI0A 5K14A 2VG5A 4DSLA 4B9LA 4OLAA 4BE0A 2G8HA 5C25A 4BE2A 3SCXA 1JLAA 3NF6A 4BACA 4IG3A 1S9GA 3TAPA 2JLEA 4KI6A 3TAFA 2E6LA 1BI4A 4C8OA 4N76A 4K8XA 3KD5E 3HPGA 4CJPA 3LP1A 3SUPA 3SNNA 3EZ5A 1C0MA 4C8NA 4RW7A 1NK9A 4CGFA 1KVBA 3CFRA 1C1BA 3MXJA 2PZSA 3OS1A 1QQCA 4CJTA 3O3GA 5HBMA 3OYFA 4BDYA 1SUQA 2YNGA 1YVUA 2EX3A 4KTZA 3LZIA 3G0ZA 2IDOA 4I2QA 2GUIA 3OYGA 3OYEA 1NJXA 3NDKA 1NK7A 4B9UA 4KB0A 1QTMA 4LH4A 3ZSZA 2E4LA 3ISNC 3LAMA 1S6PA 3QLHA 1N6QA 4Z4IA 2E6MA 3T1AA 4FJKA 3AO1A 3LPUA 1SKRA 4O0JA 1HQUA 3T3FA 4FZYA 3IG1A 2IAJA 4M3ZA 2P5OA 4PQUA 1RBTA 2FBXA 1VSMA 2Y1JA 1TK5A 3ZT1A 2D0BA 1I39A 3CYMA 3CFOA 4CHOA 4XIUA 1S6QA 3NE6A 1XHZA 4ELUA 4YNQA 3OYCA 4J2EA 3CG7A 3KJVA 4FJ8A 3T19A 1T03A 2BANA 1U45A 3DMJA 1X1PA 1UA0A 4FLTA 4Y1DA 4DFKA 2G8VA 4J2AA 1RDAA 1ASUA 3P1GA 4CJQA 3DYAA 2XO7A 2ZE2A
chains in the Genus database with same CATH superfamily
1X9JA 3VQ5A 1T7PA 1VQON 4IJNA 4GKKK 3EE8A 4UY8O 5J2PA 3BZCA 3QICA 1NMDA 3H3NO 1LAWA 2KLAA 3FFIA 4H5VA 1QZ6A 1BHLA 4O0IA 3V1RA 4C8KA 2KW4A 4CFBA 1SL2A 1HJRA 4JKGB 1EP4A 2O4GA 1C1AA 4OKJA 3CC4N 2X78A 1YTUA 1JLFA 4Z4GA 1S3XA 4CEFA 1Q9YA 4CJEA 4KHNA 2KQ2A 3AO4A 4CHQA 4E7JA 4Z4FA 4ELVA 1EO1A 4JS4A 3V9UA 2WONA 3ZX2A 3R8EA 1EQYA 4OGCA 3KLHA 2Z1IA 3Q7CA 2HHSA 2F8TA 4JI2K 2F9WA 5GAGP 3C94A 4B3MK 2O8BA 1HKBA 4HTLA 2A6AA 5ADXA 1EKEA 1WAFA 4M3TA 1UAXA 4JHDB 4Z94A 3CXCM 4CHPA 3QNNA 4JD2A 2H3GX 1FKOA 4MQ3A 5E26A 5AZIB 4CZIA 3R1XA 1SL1A 1YIJN 3VESA 4BR0A 3DLRA 2YHWA 4PHTX 4B1YB 4JKBA 1VQMN 2B4JA 4H0XB 4W5RA 3NCIA 4O4GA 1VSKA 3WT0A 3K9JA 3RR8A 3DLHA 2IVNA 3AVHA 5AQQA 1HLUA 3LALA 1FXXA 4M7XA 4FM0A 4FJJA 2DY4A 4YDUA 3OTOK 3BZKA 4IXCA 3WQTA 5E41A 1U47A 3PIOL 3WUHA 3ZCMA 2QWMA 4CERA 3GOIA 3BP8A 2ITMA 5JS1A 1LW0A 1HNXK 5F2RA 3ZEUB 1B9FA 4RG8A 5AJ3K 4B9MA 4M3WA 1RTIA 2YHAA 3CCUN 4A59A 1ATSA 1ITGA 1Q86O 3LDNA 3GBTA 4WYBA 1J54A 2QKBA 1TKXA 1HUXA 4LH5A 2V7ZA 4IJAA 3C65A 4DQSA 1VSEA 1D9FA 2P9SA 1NGIA 1CLQA 1BIUA 3CCQN 4HCBA 4EHTA 4BRGA 1KLNA 1MA9B 3VEOA 4BRPA 4DLEA 4PUOA 1K6YA 3P83D 4HVJA 1VK0A 3OYAA 3S3NA 4M3YA 4GNIA 4CE9A 3B6OA 4B1UB 1SV5A 4FJ9A 2ATQA 4FZXC 4KHUA 4E0DA 4CJWA 5M1NA 3MXIA 1KXPA 2VQFK 5T7BA 3IKMA 2HNZA 3CCJN 4JI8K 3KKRA 4CGDA 1HMVA 4JKFA 4BWJA 4J8FA 1R59O 4Z4HA 4B8AB 2Q31A 3HP6A 1RILA 1LOTB 2NZTA 3O1WA 4FLYA 1SL0A 3CJ1A 4IOCL 1RTDA 1JL1A 2ITGA 2HNDA 3ZX0A 1P90A 3R3LA 3LDSA 4CIFA 1TV6A 4DFPA 1IG9A 4AHUA 3TAMA 4PA1A 2KZZA 1W7AA 3CM6A 1SKWA 3NBPA 1XNRK 1R0AA 3A2FA 4LFCK 4LF4K 3OA9A 4GY2B 2OA8A 3MXMA 1BQNA 5JS2A 1VQPN 2PFUA 1VHXA 4FLWA 1RT3A 4R79A 4JKGA 4H0OA 2KHOA 3LWMA 4CFAA 4K0KK 4DR3K 4JKAA 3VGKA 4N5SA 3HOSA 2NRWA 3HVRA 1RT1A 2PYLA 4FK4A 1Z26A 2OPQA 1U6ZA 4BWMA 3NGZA 3QEPA 3EKSA 1L3TA 3KK1A 4CBWA 1VQLN 1KRPA 5D3GA 2P9NB 3U3GA 3M8RA 4U7BA 1WBBA 4DCHA 1JL2A 1VQ7N 1JXBA 1CZ9A 5M1PA 3SAHA 5KPRA 2FC0A 2R7YA 3SPYA 3THVA 4BRLA 2F9TA 3DI6A 3R9PA 3M8SA 3MWPA 4JHDA 2HF4A 3HYFA 3AVAA 3GDQA 5CHIA 3VQBA 4DR5K 3HK2A 3WNHA 4CGGA 3FZKA 3HPHA 4Z4CA 3M6GA 4ISEA 4KKOA 2E5LK 2DFHA 1GLCG 4KRFA 2XY6A 4JKDA 3VTIA 4FWMA 1RFQA 3ENBA 3DLGA 3CJCA 1UOCA 4CI6A 1RTJA 3LANA 1S9EA 4L3QA 4FJ7A 4XH1A 1W2BM 1GLFO 2P51A 1LWCA 3VN5A 4BRQA 4DLGA 4PY5A 1A5VA 5KI6A 3L4IA 4DV6K 2KZMA 4DQPA 4PL7A 4DTMA 4O8KA 4A5AA 1TK0A 4FK2A 5C15A 3N4QA 2OPPA 4O5BA 2F4VK 4CIGA 5AQSA 2FXUA 4LY7A 1HNIA 2VQEK 1RBRA 2QWLA 2DTUA 1IKYA 2F8SA 3RVCA 1YTAA 2ZF5O 4KB1A 3HO1A 3GL1A 1YXQA 3AA3A 3I8DA 3DLEA 3J7YP 4H8KA 4H5NA 3ZEUA 2KTQA 4FW2A 5AFUA 3CMAN 4M63C 1FKPA 1C0UA 1KLMA 4CESA 4CW7B 4NB4A 3HM9A 1T6DA 4MLHA 3OVNA 4X66K 3RMBA 1TKZA 3WXJA 4DR1K 3D2EB 3V1QA 2YV0X 1NNEA 3SQ2A 4AHCA 3TSPA 2OYQA 1QQOA 4OPAA 4FCYA 5M1KA 1HPMA 2UXCK 3THXB 4ELTA 3BUZB 4RW4A 3VQAA 3ZT2A 4CF1A 1VQ9N 4AHVA 3P5JA 3AAPA 3V9SA 3SI6A 4BDPA 2IC3A 2OTJN 1QVFM 4MO4A 4FOIA 2XY7A 3KLIA 1VSJA 1ZC6A 4H4OA 3DLBA 4MO5A 2HVHA 2GELA 2I5JA 5J2QA 4DQIA 5HL7L 1GLEG 2A5XA 4CJVA 4E7HA 5FDLA 4FWOA 3CHWA 4DTNA 3F73A 3VGLA 4IDKA 5SZTA 2CGLA 1BA1A 5DMRA 3IUCA 1TL1A 3H45C 3C95A 3O8MA 3SJHA 1VRTA 2QA4N 3FZLA 3GG4A 2GWJA 4KFBA 4FW1A 3ENOA 5KGWA 3MN7A 1NBWA 1VAZA 1X3NA 3QIPA 3TI0A 1Q81O 2VG5A 4OLAA 2OCEA 4BE0A 5C25A 2G8HA 4BE2A 2P9LA 4JNEA 3ZLJA 3EE9A 3QB0A 4GV6A 1MDUB 3C0BA 3O9UA 1OKJA 4C23A 3O9SA 2JLEA 4JI5K 3TAFA 2E6LA 3AARA 4KI6A 3PLAA 1VQKN 4N76A 4K8XA 4NXMK 3HPGA 4C8NA 2E2QA 4AF1A 1C1BA 2ASOA 4AM6A 1SUQA 1YVUA 4KTZA 3G0ZA 2IDOA 2GUIA 1C0GA 5FPDA 1NK7A 4KB0A 4LH4A 3QBXA 3LAMA 1S6PA 1N6QA 4GV3A 4MLEA 3LPUA 3WEEA 2IAJA 2Y1JA 1TK5A 2D0BA 4ELUA 3QFPA 4PKIA 4FJ8A 1U45A 2CGKA 2VWBA 4DFKA 2FSKA 4J2AA 3P1GA 4CJQA 3VQ4A 1TAUA 1TL3A 4JN4A 2YX6A 3B8AX 4WQ5A 1NGCA 5M1FA 2FSJA 2P9NA 3A5MC 2BDPA 4IFYA 3VOVA 4HUGA 4CZJA 4JI6K 3RR7A 3SQ1A 2XY5A 4BR4A 3HPOA 4KHYA 2UUCK 4ISFA 4KAZA 3LP3A 4DKWA 3O3HA 5EXWA 5FRMA 1J6ZA 4BRDA 3OY9A 3T1YK 1J5OA 4DUYK 2Q36A 3V9WA 3V9ZA 1L5UA 1HYZA 3HM8A 3VQPA 4RWTA 3RRGA 2QWOA 4BG8A 1M90O 3DRRA 3LDOA 4NCGA 5HOOA 4DR7K 2ZJRL 2AJQA 4YORA 4DFMA 2OZSA 5J2NA 3S41A 2IVOA 4YOXA 3M5RA 3JAMO 3U6FA 5I42A 2P9UB 1RT4A 3FE1A 4NYNA 1BL3A 4FWKA 2X74A 4ILJA 1Z6RA 3HZ6A 3VF4A 5DK5A 1HX1A 3AVGA 1Q8IA 3SLCA 1Z05A 4CVNE 3EYZA 5IWAK 4FM1A 2FBYA 3LM9A 3RMAA 2ZGYA 4KPYA 1WLJA 4DSEA 3ZT4A 1LWEA 4FJKA 1GOBA 1NKBA 4WE1A 4CFCA 5C2DA 3TABA 3K5NA 1OH7A 2ASPA 4B9NA 5BPLA 5KPTA 1K8KA 1Z25A 4CJKA 3NH0A 4CEZA 3AV9A 4CZKA 2P9SB 4LF6K 4ID1A 1VSIA 1KCFA 3D2EA 2QTDA 1YAGA 3CQXA 3DXKB 3PO4A 2P1JA 4HUFA 3VQ6A 4MDBA 4FLZA 4FPAA 2Y1IA 3MEEA 5SWMA 5BREA 3THXA 4YHHK 1V4TA 3ZSVA 3ZX3A 2PAVA 1N34K 2FF3B 3IDHA 4BR9A 4BRNA 3EY1A 3FR0A 4RW6A 4AHTA 1XQSC 3NF8A 4JS5A 2UU9K 5LL6Z 5I3UA 3BF3A 5KGXA 4GW6A 3VEXA 4C8LA 4FJGA 3K58A 5FPEA 3DOKA 3OYDA 3CJAA 4QS9A 3U3YA 3RMCA 1I94K 5BR8K 1IBKK 1T44A 2UUAK 5AQZA 1C0FA 3SZ2A 4EP5A 3CCLN 4E1JA 2VGNA 1A5XA 3U9ZA 1GOAA 1QHTA 4FWPA 1NLVA 2EHGA 4LFAK 1OH8A 3ATUA 3WNEA 3KLEA 3QEIA 4O8UA 1U49A 3MX2A 1FK9A 3ZSWA 2WOMA 3EEQA 1RT2A 1S1VA 1NGFA 3RSEB 1VRUA 4BRKA 3KWIA 4IO9L 2QI2A 1KC8O 1KD1O 4DQ8A 4CJ7A 5CE3A 3L4QA 2QKKA 4LF7K 4K8ZA 1WB9A 3JS6A 4DS4A 2KFZA 4CF9A 2QK9A 4EZ9A 5LMNK 1ZBSA 3D45A 1Q18A 2HHTA 4ZTJA 5TKWA 4FJLA 2A1RA 5CZ2A 2W41A 3SUOA 1HNVA 4IDHA 4CF2A 5LY3A 2YI1A 3VQCA 1WSIA 3CCMN 3PX6A 1X9WA 3O4NA 4CJLA 1RBSA 2NRTA 4K41A 3CI5A 5C10A 3L2RA 4DR2K 4EAHD 1H1VA 1XWLA 4Q0BA 4NCBA 3EZWA 2JWKA 4W5NA 3DXMA 3CCEN 4FZZA 2HBKA 3ZSOA 1BWFO 2FF6A 3HJFA 3KK2A 4DUZK 4O44A 2D0OA 4I6MB 1IH7A 4W5OA 4CJUA 5AQTA 3ZSQA 4CBUA 2UUBK 4DV0K 1RDBA 4ZHRA 5KPZA 4K42A 4YFUA 3P39A 3ZETB 1HNWK 3NAEA 3CPWM 2PY5A 4CF8A 4YOWA 1BG3A 3J81O 4BG9A 5AR0A 3OYHA 2P9UA 3RTVA 1ASWA 2Z1HA 3OW2M 2DPNA 1TAQA 5KRTA 4UQGA 4IFEA 2I7PA 3V81A 3F5TA 4AHRA 1RDUA 4CD3A 3TWHA 4FXDA 1WOQA 3OHRA 1QSLA 1U04A 3CM5A 3ZT0A 4F3OA 3AVJA 4RW8A 4CZHA 3ZT3A 3U9DA 4X64K 3OYNA 2O8FB 2E8AA 3OYJA 4WFNL 2E2NA 2E20A 2Q3SA 1WNSA 4K43A 3G4SN 2Z1JA 4ID5A 3LDPA 3VQQA 4F2SA 4JV5K 3TAQA 3QEWA 3WXKA 2GBZA 3DXKA 1S22A 3EO3A 3QBWA 1VSDA 2VCPA 1DTTA 4JI0K 1BUPA 1G99A 4FJMA 4IEEA 2Z1GA 2RF2A 3KWGA 5BRFA 3FFKB 3AO3A 2ZJPL 1SZ2A 3KZBA 2O8CB 4I7FA 4B9VA 4W5TA 4LSLA 1X3MA 4KTWA 2CH6A 2YHYA 2O8EA 4QOZB 1HYVA 3E1YA 4X62K 4CHNA 3SQ0A 1OVQA 2NRRA 4B1VA 4Z0UA 4DV7K 3H1QA 4FJHA 4H0TB 2G8WA 4DSJA 2HSTA 2P9KA 2P9LB 4CK2A 4CEOA 3OS2A 1ATRA 1YVNA 3L2VA 2LSNA 1WN7A 5EOYA 5AQYA 3SV4A 4YY3K 2D5RA 2FBVA 4CK1A 4DB3A 3CQYA 5HRNA 5GAEP 1ZBFA 4HHTA 1OVYA 1DTQA 4Z4EA 1NGAA 3JXUA 4FK0A 5C2FA 1K8AO 4CEQA 3WEEB 3NGYA 3RSEA 4PKGA 3T7ZA 3O08A 4DV2K 5HLFA 1A5WA 1RTHA 2VYPA 5H1SQ 3OJUA 3VETA 4M3RA 4BE1A 4A2BA 3UB5A 4IOXA 3L2QA 3SUNA 4CJFA 4LF9K 1ATNA 4K25A 1C1CA 3MMVA 3HBTA 3VERA 4E1NA 3PY8A 4GKJK 4BC4A 2IOCA 4DQRA 1VSFA 1KFDA 4WF9L 4R5PA 5M1QA 3O9TA 5F1XA 2GEMA 5J1EA 5K14A 3TU5A 2QW9A 3SBTA 3P31A 1BI4A 4C8OA 2GX9A 3SNNA 1C0MA 4RW7A 4BRMA 1NK9A 1KVBA 3DJCA 1JCFA 2PYJA 3EL2A 2EX3A 4CZLA 3OYGA 5AQVA 3VTHA 3OYEA 3QFUA 3VENA 3L6QA 4I6MA 3ISNC 5B8HA 3T1AA 1E4GT 4O0JA 4FVUA 1HQUA 4FZYA 2P5OA 3CPEA 1XHZA 3OYCA 3CG7A 3ZETA 1T03A 3DMJA 3H3OB 1RDAA 2XO7A 2ZE2A 2A1SA 1EX4A 4BRCA 1B92A 1WSFA 4F4KA 3VA0A 1EXQA 1NWKA 2RPIA 3L2UA 3VEZA 4CJ3A 4AQYK 4WFBL 5KTQA 1VSHA 4A5BA 2A41A 4FPBA 4BC3A 1LV5A 3HTVA 4F3TA 1IO2A 4JK9A 3D6RA 4CZFA 2O8DB 4IG0A 5AQRA 3UIQA 1JKHA 1Y97A 2FBTA 4CCHA 3IAYA 3LP2A 3RMDA 4N41A 1K8KB 2O8FA 1GLBG 3Q7BA 1HKCA 3NF7A 3CJBA 3D2FA 3O9QA 5E84A 4FM2A 1BIZA 4IKFA 3J7AP 3K5MA 4O5FA 4DV3K 2JGUA 1RDWX 2QEXN 2IVPA 3WNGA 3AA2A 4CJ4A 3LPTA 2NUBA 3VEYA 1BA0A 5CR4A 3EKUA 1JCEA 2WTUA 3ID8A 3THYB 2QWPA 4H5WA 1XMOK 4RTFD 2P9IB 1WSJA 1CZAN 1MU2A 3FZFA 3L3VA 3ZSRA 2YCHA 3TR8A 4BROA 2E2OA 2HHWA 1ZBHA 2G8IA 2HOEA 3QDKA 4I9QA 3C6HA 3LP0A 1JJ2M 3D7EO 2O8CA 2G8UA 3J80O 2YKMA 4HWIA 5KQDA 4DU4A 2OZMA 5BR9A 3DWLA 1WAJA 3L0QA 4Y0WA 5CYQA 5BN9A 4DG1A 1W9HA 4DF8A 3VPZA 3M8QA 1HKGA 1X9MA 3O4WA 4FJ5A 3VF6A 4M42A 1CZBA 1VSLA 3M8PA 4ZTFA 1Y64A 2D0AA 3R6MA 4BRFA 4FJIA 5LJVA 4H03B 4AM7A 1NKCA 3KTQA 4WQ4A 1NK8A 3W0LA 3MAQA 1JLGA 3H6EA 4MDAA 1KVCA 2VWKA 4W5QA 3QNOA 1N8RO 3W3DA 4CK3A 1ZBIA 3MECA 4KO0A 4BREA 1NK6A 4RCHA 1NJYA 4B1ZA 4JYAK 3SYZA 2Q1NA 4KHSA 2BTFA 5C24A 2ASMA 4DR6K 5JMVA 2YHXA 3T69A 1KAZA 2CGJA 1T6CA 3UE5A 3NGIA 4B3TK 4FJNA 2NRZA 4O55A 2QXFA 4BR2A 3UKRA 3NVKA 2AA4A 3E9LA 3BF1A 3CETA 4A61A 1N36K 4FWLA 4A62A 4B9TA 1TGOA 5JICA 4AH9A 1NGEA 1BISA 4FJXA 2HHXA 4DFJA 3MCAB 5AQHA 3DXMB 2X6SA 5HROA 2OPSA 1QSYA 2HW3A 1YJ9N 1QE1A 2NLXA 5HRSA 3S3OA 1JCGA 1F21A 5IT9O 1ESVA 1MWMA 1U48A 1C0TA 4KV8A 3TPQA 1J5EK 2I7NA 4ILGB 4I2PA 4JLHA 2VWJA 5GADP 3DRSA 2JWLA 4ISGA 3IFRA 1M1KO 5TKYA 4JKEA 5LMUK 3NH2A 3HVTA 3AVCA 4E19A 2BGGA 4YOUA 1EETA 3LDQA 1SAZA 5GIPA 3F9MA 5AQKA 3AVNA 1HRHA 1XI1A 4M41A 2G8KA 3ATVA 3E9OA 4OKEA 4FVMA 4NLBA 4OJRA 1BCOA 3HRGA 3KK7A 4Y1CA 3FZMA 4LSNA 1IBLK 1T3VA 1O13A 5ELZA 3QMLA 5AQPA 3D0PA 4FWQA 2ZM6K 1NK0A 5C12A 3WNFA 3VQDA 3CQ8A 4DF4A 1V4SA 1E3MA 1YUWA 3QINA 4DU3A 3LAKA 4YOTA 3ZSYA 5A2QO 3AY9A 2O8DA 3PSFA 3I0SA 4OPKA 1TKDA 2IIRA 4E89A 1YJWN 4CZGA 3O4QA 2FLOA 1Q9XA 4DV1K 3VQ7A 1YHQN 1JXEA 1U4BA 1XC3A 4DR4K 1REVA 4HUEA 4CF0A 2G8FA 5F0XA 3KK3A 3L8BA 3K9KA 4KHWA 4CGHA 1NMNA 1RDCA 1ZBUA 1JLEA 1NGJA 1VQ8N 4BVOA 4JI1K 3ZSXA 2Q0UA 3THYA 3G25A 4KI4A 1KFSA 3CCVN 2P9IA 5GIOA 4QS7A 1GLAG 3H08A 3NF9A 2O8EB 3ULEB 5BPMA 4C1NK 2QWRA 3PSIA 3THWB 3O5BA 3WXLA 1BDGA 2VGMA 1ZYQA 5EY4A 3QEXA 3NFAA 1BU6O 3HSTB 4DU1A 1NGHA 1TYQA 2VG6A 2P9KB 1NGGA 4GMJB 3O6WA 4PL8A 3WQUA 3TTCA 4DTJA 4IWVA 3S9HA 4XEIA 5EVZA 1NOZA 1IBMK 4N47A 4BRHA 1IJJA 3PX0A 1SQKA 4X65K 2YKNA 3CJ7A 3O80A 3DRPA 3OJSA 3CCSN 4DTRA 1YT3A 4BR5A 1SS6A 4NO7A 4CEEA 1X9SA 3AVFA 3PV8A 3TTDA 5HRPA 5M1OA 3QO9A 2W42A 2DFEA 1IKXA 2YJFA 3KHYA 2D0CA 1YF5L 2YJEA 3SBGA 3UKUA 4B08A 3P38A 3CD6N 3A5OC 5C42A 4FO0A 3TAEA 4GVEA 1GLLO 5GAHP 3HXMA 3KVGA 1WSHA 4RW9A 2A42A 3MX5A 3O1BA 2PBDA 2RKIA 2BUPA 4AHSA 1BI4B 1BCMA 2D4WA 1NJWA 3C6AA 3F9KA 4I9LA 3WXMB 5DM7L 4NCAA 2CH5A 3O3FA 3CMEN 3OYMA 5FROA 4EZ6A 1Q7YO 3KIOA 4CEAA 2Q2RA 3AVKA 1RBVA 4B9QA 4CIEA 4LF8K 5GINA 2GWKA 4E7KA 5AQXA 1KVAA 3VGMA 3DM2A 1EWQA 3K5LA 5AQOA 3KLFA 3VQEA 2F7TA 2QXLA 3MN9A 1JLCA 3SUQA 3L3UA 3RWUA 2W6KA 3EN9A 1J53A 2XY8A 4BQLA 4OKKA 1CXUA 3U8XA 3FLCO 1HR0K 1DT9A 2HMIA 1G15A 1RCHA 3MEGA 3CIPA 2Q0RA 3ID6A 2V51B 3V4IA 4DSLA 4B9LA 4CZEA 3MK6A 3SCXA 1DGKN 1JLAA 3NF6A 4BACA 4IG3A 1S9GA 5JVGL 3C7NB 3J8AA 4B1WB 3E66A 4CJPA 3LL3A 3SUPA 3EZ5A 4BR7A 1KAXA 3HSCA 2PZSA 4QS8A 5FPNA 1QQCA 3OYFA 5HBMA 4BDYA 2YNGA 4I2QA 2P9PB 1VQ5N 4B9UA 1QTMA 3ZSZA 4H0PA 3D2FB 2E6MA 1SKRA 3T3FA 3IG1A 1RBTA 3ZT1A 3NE6A 1I39A 4CHOA 3CFOA 1YITN 4XIUA 1S6QA 1QQMA 2BANA 1UA0A 2G8VA 2WFBA 2QWNA 3DYAA 3H1VX 4BDZA 4KH6A 4JI4K 4B1XB 3OBYA 5BRDA 1L3VA 3CC7N 1DKGD 1EWRA 3RRHA 1LW2A 1SKSA 2F96A 4DTOA 1U2VA 3OYLA 3HT3A 2W6LA 1NG9A 5AQFA 4GVMA 1JLBA 4U67L 3PX4A 3T1HK 1I3AA 4JRQA 3ULEA 5I9EB 4DV5K 4OVLA 1VQ6N 3THWA 2ETJA 3K5OA 4LC9B 2DFFA 1ZBLA 3OYBA 4J2BA 4BGBA 3WXIA 1FW6A 4DHYA 4YDUC 1L3SA 1OH5A 4CHZA 4A2AA 4YOYA 5EX5A 1E4FT 3ITHA 1RT7A 4QCLA 3VA3A 1IKWA 1GLDG 5KRSA 1QS4A 3V1OA 3M1FA 3JSMA 2ZGZA 1WSEA 3FZHA 3SAFA 4CFDA 4FL9A 4H0VB 3H46O 1W97L 4ICLA 1KSPA 1GOCA 1NOYA 2UXBK 4KBOA 4LD0A 4IFVA 4L8RB 3K0SA 2D0PA 3IRXA 3ENHA 4DV4K 4CHYA 3UKRB 4YOVA 3QESA 3ASMA 2Q97A 1LAVA 4V19S 4G9ZA 2HB5A 3OYKA 3AVLA 2HHQA 5CZ1A 1ASVA 1O1WA 1WBDA 2IGIA 4FSVA 4C8MA 2ZQBA 4OX9K 5AQMA 2OTLN 2RHKA 1VQ4N 5FLXO 3A8YA 4BVPA 4IBNA 2ZD1A 4DMNA 2NRVA 2W40A 3CF5L 2UYTA 3SK3A 3OYIA 1RDDA 4B8CA 1D5AA 5AQNA 1VQNN 4M3UA 1NJZA 4MFBA 3NVMA 3V6DA 3AGKA 3G10A 1QQNA 3ZYYX 1XMQK 1Q82O 1D4XA 4CD1A 4B3SK 4B3OA 2WC9A 4Q5VA 3F2KA 4FWSA 2O4IA 4XH4A 5EU7A 3AVMA 3E9PA 2YNHA 4LFBK 1TVRA 4E3SA 2P5GA 3K59A 5AZIA 3KD1E 1NM1A 2HBLA 2BH1A 4DTSA 4H4MA 3MWTA 1RT5A 1W0HA 4FOEA 1GLJO 3CERA 3AVIA 5ADXH 4JK7A 3PIPL 3HOTA 1BQMA 1IG8A 3TANA 1HQEA 1NGBA 1BGXT 5BRHA 3AO2A 2E1YA 3B6PA 4QAGA 4H5RA 4KH5A 5C0YA 3AO5A 3IS9A 5KQ8A 4FLXA 3LDLA 3V9XA 3C7NA 4BC2A 3A0IX 3KKSA 3BDPA 5MLCQ 4DS5A 4CJ5A 5AQJA 3QERA 3SAGA 2UXDK 4H5TA 4KTQA 1XHXA 1NK4A 3NMUA 2ZJQL 2P9PA 2B5JA 4IOAL 2A40A 4CECA 1XC9A 2A3ZA 1TK8A 5CY4A 4CBXA 4JAXA 1S72N 4J2DA 2OANA 4NLCA 1B9DA 1XNQK 4IZ9A 3VMFB 3HP9A 4F8RA 3G6EN 2E1ZA 3VEWA 3LM2A 4FLUA 1ZXOA 1QZ5A 1RT6A 1KAYA 3OBWA 3KLGA 2KKZA 4WCEL 3DAWA 2HMPA 1KTQA 3VF2A 1C6VA 1XUPO 3SQ4A 3IMXA 4FWNA 1ILYA 3CCRN 4H0YB 3O9RA 1WSGA 4OGEA 4HTUA 3LWLA 4DQQA 4FWRA 3K57A 3DOLA 3AA4A 5AQIA 4JKCA 1TYQB 3PUFA 4DTXA 1JLQA 2AP1A 5AZJB 4DTPA 1K9MO 5LJWA 4CEBA 1S5JA 2YNFA 1WUAA 2HBMA 4CEDA 4CJSA 1YJNN 1P8ZA 1BOTO 4DTUA 1QSSA 1MWKA 4BRIA 4KREA 4EP4A 1RBUA 4JI7K 3GE1A 2XHBA 3I33A 3I55N 3I56N 4DSIA 3TSUA 4ILHA 3VEVA 3MEDA 4CGIA 3J7ZO 4IEIA 4IO8A 4BQZA 3E01A 3QEVA 2HHUA 2B6AA 2BE2A 3SV3A 4FYDA 2KFNA 2YNIA 1KQSM 2RN2A 4EHUA 3UKUB 4PWDA 1IKVA 2GV9A 3OS0A 4E1MA 2E2PA 5HP1A 3ALYA 3C6UA 3PO5A 4OPHA 3QETA 3SMPA 4B3RK 1L3UA 2E88A 2HHHK 4JRPA 3CC2N 5AQLA 2HVIA 3DLKA 1UA1A 4M3XA 3C6TA 2HHVA 3M3ZA 3I8BA 1N33K 4M7YA 4NYFA 3ULDA 5J2MA 3SPZA 1N5YA 3AVBA 4G1QA 3HL8A 2OPRA 2X6NA 3JYTA 4CJRA 1QVGM 1TKTA 4JI3K 3NH1A 3N4PA 2HF3A 3AAQA 4PKHA 5DM6L 2VG7A 1T8EA 2HBJA 1J9AA 2FSNA 3L2WA 3CJ9A 5BPNA 5JLFA 2RE2A 4B9SA 4BRAA 4OO1J 2O8BB 2GTDA 1NU0A 3K2PA 3DLLL 3HI0A 1HPZA 1UWBA 3NHGA 3AA5X 4JKHA 1TUUA 3TTFA 4JD2B 4DSFA 1N32K 5CYMA 1T05A 2XRIA 5HRRA 3S3MA 2HNYA 4FLVA 1RNHA 4DWIA 4N56A 4F2RA 4NXNK 2WUSA 3BEXA 4CGJA 2YHBA 2ZWHA 4OLBA 1DEJA 1IV0A 1HYSA 3G71N 4WQ4C 4EFHA 3U4LA 4A57A 4BY9C 1OH6A 3AGRA 4GV9A 2GUPA 1LWFA 2D1KA 4LF5K 1LCUA 3CFPA 2J4RA 4AILC 3BY5A 4HCCA 1S1TA 5AQGA 1HNZK 4CZMA 3BGRA 4OPJA 5FPMA 3I0RA 3QIOA 2QWQA 2NRXA 3SJJA 1DLOA 2V52B 1NKEA 1D9DA 1S1XA 1NGDA 3A5NC 3TSQA 1S1WA 4E7IA 4TSXA 1D8YA 4E7LA 4KHQA 3SMSA 5JVHL 3MDQA 4WQ5C 3P4IA 1RGIA 3MCPA 3MN6A 4DSKA 1S1UA 2IS3A 4WFAL 3LZJA 3VQ8A 4M45A 4BC5A 3A5LC 3TAGA 1CXQA 3TARA 5AQWA 1NK5A 4C1NI 5FRNA 3VQ9A 1U2VB 2QM1A 4F9OA 2EWSA 5AQUA 2NNWA 3FGUA 4JK8A 2V7YA 4BGAA 3TAPA 3KD5E 3LP1A 4CGFA 1QHAA 3MN5A 3MXJA 5AFUH 3CFRA 3OS1A 1NJIO 4CJTA 3O3GA 1BO5O 3LZIA 4EIAA 1NJXA 3NDKA 4KH4A 5AZJA 5BN8A 2E4LA 2WBNA 4XH5A 3QLHA 4JEPA 4Z4IA 1K73O 3AO1A 4PQUA 4M3ZA 1HJOA 5JLHA 2FBXA 1VSMA 1FJGK 3CYMA 4J2EA 1TUYA 4YNQA 1YI2N 3KJVA 3T19A 1X1PA 4FLTA 4Y1DA 2NRHA 4KHPK 1ASUA
chains in the Genus database with same CATH topology
2A1SA 1EX4A 1TL3A 3VQ5A 4BDZA 2PYJA 1T7PA 1B92A 1WSFA 4F4KA 3VA0A 1EXQA 5J2PA 2RPIA 3L2UA 1L3VA 4CJ3A 2BDPA 3RRHA 4IFYA 5KTQA 1LW2A 1SKSA 1VSHA 1LAWA 2F96A 4DTOA 3OYLA 3HT3A 4HUGA 3FFIA 1LV5A 4F3TA 4GVMA 1JLBA 3RR7A 1BHLA 1IO2A 4O0IA 3SQ1A 2XY5A 3PX4A 1I3AA 4IG0A 3HPOA 4JRQA 4KHYA 3V1RA 4C8KA 3UIQA 4OVLA 2KW4A 4KAZA 1JKHA 1Y97A 2FBTA 3LP3A 4CFBA 2ETJA 3K5OA 3O3HA 3OY9A 4CCHA 3IAYA 2DFFA 1ZBLA 3OYBA 1SL2A 1HJRA 1J5OA 4J2BA 3V9WA 3LP2A 3RMDA 4N41A 1L3SA 1EP4A 2O4GA 3V9ZA 4CHZA 1C1AA 1L5UA 4OKJA 1HYZA 3VQPA 2X78A 1YTUA 1JLFA 4Z4GA 3NF7A 3RRGA 4CEFA 3DRRA 4CJEA 1Q9YA 4KHNA 4NCGA 4IKFA 2KQ2A 4FM2A 3AO4A 1BIZA 4CHQA 3ITHA 4E7JA 2AJQA 3K5MA 4Z4FA 2JGUA 4ELVA 1RT7A 4QCLA 4JS4A 3WNGA 1IKWA 3V9UA 3VA3A 3AA2A 4CJ4A 5KRSA 2WONA 3LPTA 4DFMA 2OZSA 2NUBA 5J2NA 1QS4A 3U6FA 3V1OA 5I42A 4OGCA 1RT4A 3KLHA 2Z1IA 3JSMA 1WSEA 2HHSA 4NYNA 1BL3A 2F8TA 4CFDA 4M42A 3C94A 4ICLA 1KSPA 1EKEA 1GOCA 2X74A 1NOYA 1WSJA 3L3VA 1MU2A 1WAFA 4M3TA 3ZSRA 5DK5A 1UAXA 4IFVA 4LD0A 3TR8A 4L8RB 3AVGA 2HHWA 3IRXA 1Q8IA 4CHPA 1ZBHA 2G8IA 3QNNA 4I9QA 3EYZA 4FM1A 3LP0A 1FKOA 2FBYA 4MQ3A 4CHYA 2G8UA 2YKMA 3RMAA 4DU4A 1WLJA 3QESA 4KPYA 3ASMA 1LAVA 4DSEA 1SL1A 2OZMA 3ZT4A 1LWEA 2HB5A 3AVLA 3OYKA 5CZ1A 3DLRA 1GOBA 1ASVA 1NKBA 1O1WA 4WE1A 4CFCA 1WAJA 2IGIA 4C8MA 2ZQBA 3TABA 3K5NA 4B9NA 5CYQA 4DG1A 1W9HA 4DF8A 2B4JA 4CJKA 1Z25A 3M8QA 4W5RA 3NH0A 3NCIA 4CEZA 1X9MA 3AV9A 4IBNA 4O4GA 4FJ5A 1VSKA 1CZBA 1VSLA 1VSIA 2ZD1A 1KCFA 4ID1A 4DMNA 3M8PA 4ZTFA 2D0AA 3RR8A 4FJIA 3DLHA 3AVHA 3OYIA 1NKCA 3PO4A 3KTQA 1RDDA 4B8CA 2P1JA 3LALA 1FXXA 1D5AA 1NK8A 4HUFA 3MAQA 3VQ6A 4FM0A 4FJJA 1JLGA 2DY4A 4FLZA 1KVCA 2Y1IA 3MEEA 2VWKA 4W5QA 5SWMA 3QNOA 4M3UA 1U47A 5E41A 4CK3A 1NJZA 1ZBIA 3MECA 4MFBA 3ZSVA 4KO0A 3ZCMA 3V6DA 1NK6A 3G10A 1TAUA 1NJYA 4CERA 3SYZA 3EY1A 4RW6A 2HHQA 4KHSA 5C24A 4AHTA 5JS1A 1LW0A 3NF8A 4JS5A 4B3OA 4Q5VA 5I3UA 2O4IA 5KGXA 4GW6A 1B9FA 4RG8A 5EU7A 3AVMA 4B9MA 4C8LA 4FJGA 2YNHA 3NGIA 3K58A 4M3WA 4FJNA 1RTIA 2YHAA 1TVRA 4O55A 4E3SA 2P5GA 1ITGA 2QXFA 3DOKA 3K59A 3OYDA 3U3YA 3KD1E 1J54A 3RMCA 2QKBA 1TKXA 4DTSA 4H4MA 4B9TA 1RT5A 1W0HA 4LH5A 1TGOA 3SZ2A 4EP5A 4AH9A 3AVIA 1BISA 1BQMA 4DQSA 3TANA 4FJXA 2HHXA 1HQEA 1VSEA 1A5XA 4DFJA 1BGXT 1D9FA 3AO2A 1CLQA 1BIUA 3B6PA 4QAGA 2X6SA 4HCBA 5HROA 1KLNA 1GOAA 1QHTA 2OPSA 1QSYA 2EHGA 3AO5A 3IS9A 2HW3A 3WNEA 3KLEA 4DLEA 1K6YA 4FLXA 3V9XA 1QE1A 3P83D 3KKSA 5HRSA 3S3OA 1U49A 3BDPA 1FK9A 1F21A 3ZSWA 4HVJA 4DS5A 2WOMA 4CJ5A 1RT2A 1S1VA 1U48A 3QERA 1VK0A 3OYAA 1C0TA 3S3NA 4KTQA 4M3YA 1VRUA 1XHXA 4KV8A 4CE9A 1NK4A 3B6OA 4FJ9A 1SV5A 2ATQA 2B5JA 4FZXC 4KHUA 4E0DA 4CJWA 3MXIA 4CECA 1XC9A 4I2PA 4JLHA 5T7BA 2VWJA 3DRSA 1TK8A 5CY4A 2HNZA 2QKKA 3KKRA 4CGDA 1HMVA 3NH2A 3HVTA 3AVCA 4E19A 4K8ZA 4J2DA 2BGGA 4BWJA 1B9DA 1EETA 4DS4A 2KFZA 4CF9A 2QK9A 3HP9A 4Z4HA 4B8AB 4EZ9A 4F8RA 4FLUA 3D45A 3HP6A 2HHTA 4ZTJA 1RILA 3AVNA 1RT6A 1HRHA 4FJLA 2A1RA 1XI1A 4M41A 2G8KA 5CZ2A 4FLYA 3SUOA 3KLGA 1HNVA 4OKEA 1SL0A 4FVMA 4OJRA 4CF2A 1BCOA 1RTDA 5FRMA 4Y1CA 3VQCA 1WSIA 1KTQA 4LSNA 1JL1A 2ITGA 2HNDA 3PX6A 1C6VA 1X9WA 3O4NA 3SQ4A 4PUOA 4CJLA 1RBSA 3L2RA 3LDSA 3D0PA 4Q0BA 4CIFA 1NK0A 1XWLA 4NCBA 1TV6A 4DFPA 1IG9A 3WNFA 1WSGA 3VQDA 4AHUA 3TAMA 4W5NA 3CQ8A 4OGEA 4DF4A 4HTUA 4PA1A 4FZZA 3LWLA 4DQQA 2KZZA 3K57A 3CM6A 3ZSOA 1SKWA 3DOLA 3NBPA 3QINA 3KK2A 4DU3A 3HJFA 3LAKA 3ZSYA 3A2FA 3AA4A 1R0AA 4O44A 3I0SA 3PUFA 1JLQA 4OPKA 4DTXA 2OA8A 1TKDA 4DTPA 3MXMA 1BQNA 5JS2A 1IH7A 4CEBA 4FLWA 1RT3A 1S5JA 2YNFA 4E89A 4W5OA 4CEDA 3O4QA 4CJSA 4CJUA 4DTUA 1Q9XA 3ZSQA 1QSSA 3VQ7A 1RDBA 1JXEA 4ZHRA 4KREA 3LWMA 1U4BA 4CFAA 1REVA 4EP4A 4HUEA 4YFUA 4CF0A 1RBUA 4N5SA 2G8FA 3HVRA 3NAEA 2PY5A 2XHBA 1RT1A 2PYLA 4FK4A 4CF8A 1Z26A 2OPQA 4BWMA 3KK3A 3L8BA 4KHWA 4CGHA 3NGZA 3QEPA 4DSIA 1L3TA 1RDCA 1ZBUA 3MEDA 3KK1A 1JLEA 4CGIA 1KRPA 5D3GA 3OYHA 3U3GA 3M8RA 3RTVA 3E01A 3QEVA 2HHUA 2B6AA 1JL2A 2BE2A 3SV3A 1ASWA 4FYDA 2YNIA 2KFNA 3ZSXA 1JXBA 1CZ9A 2Z1HA 2R7YA 2FC0A 2RN2A 3SPYA 4PWDA 4KI4A 1TAQA 1IKVA 2GV9A 5KRTA 4UQGA 4E1MA 3OS0A 3THVA 1KFSA 3V81A 5HP1A 3DI6A 3ALYA 3C6UA 4AHRA 3PO5A 3QETA 3M8SA 1L3UA 3H08A 3HYFA 3NF9A 4JRPA 3AVAA 2HVIA 3DLKA 3TWHA 3VQBA 1UA1A 3HK2A 4FXDA 1QSLA 3WNHA 1U04A 3C6TA 3CM5A 3HPHA 4CGGA 4Z4CA 4M3XA 4KKOA 3ZT0A 3AVJA 4F3OA 2HHVA 4RW8A 3ZT3A 1ZYQA 4NYFA 2DFHA 3ULDA 5J2MA 3SPZA 3OYNA 3AVBA 4G1QA 3QEXA 1N5YA 4KRFA 3HL8A 3OYJA 2OPRA 3NFAA 2X6NA 3HSTB 4DU1A 2XY6A 2VG6A 3JYTA 4GMJB 4CJRA 2Q3SA 1WNSA 1TKTA 4DTJA 3NH1A 3S9HA 3DLGA 1NOZA 1UOCA 1RTJA 3LANA 4N47A 1S9EA 3PX0A 4FJ7A 2VG7A 1T8EA 2Z1JA 2YKNA 4ID5A 1J9AA 3L2WA 2P51A 3DRPA 3OJSA 1LWCA 3VQQA 3VN5A 4DLGA 4F2SA 3TAQA 4DTRA 4PY5A 1YT3A 3QEWA 2GBZA 1A5VA 5KI6A 4B9SA 4CEEA 1X9SA 1VSDA 3AVFA 3PV8A 4DQPA 2KZMA 1DTTA 4DTMA 3K2PA 4FJMA 1TK0A 4FK2A 5HRPA 1HPZA 1UWBA 3QO9A 2OPPA 4O5BA 2W42A 3NHGA 2DFEA 2Z1GA 2RF2A 1IKXA 4CIGA 3AA5X 3AO3A 4LY7A 1HNIA 2D0CA 4DSFA 1RBRA 5CYMA 2DTUA 1T05A 2XRIA 1IKYA 4I7FA 5HRRA 4B08A 3S3MA 2F8SA 2HNYA 1YTAA 1RNHA 4FLVA 4B9VA 4KB1A 3HO1A 5C42A 4DWIA 4W5TA 3AA3A 3I8DA 3TAEA 3DLEA 4LSLA 4H8KA 4N56A 4KTWA 4F2RA 2KTQA 4FW2A 3HXMA 4QOZB 4CGJA 1FKPA 2YHBA 1C0UA 1KLMA 1HYVA 4CESA 4OLBA 1HYSA 1WSHA 3HM9A 4CHNA 1LWFA 3SQ0A 3OVNA 4RW9A 4Z0UA 3CFPA 4AILC 3RMBA 3VQ4A 4FJHA 1TKZA 2G8WA 4DSJA 4HCCA 1S1TA 3V1QA 2RKIA 2YV0X 4CK2A 4CEOA 3OS2A 3L2VA 2LSNA 3SQ2A 3BGRA 4AHCA 1WN7A 4AHSA 2OYQA 1BI4B 1BCMA 4OPJA 1NJWA 3I0RA 3QIOA 4FCYA 3SV4A 3F9KA 2D5RA 4I9LA 2FBVA 4CK1A 4NCAA 3SJJA 1DLOA 4ELTA 5HRNA 3ZT2A 4RW4A 3VQAA 4CF1A 1ZBFA 4HHTA 1NKEA 3O3FA 1S1XA 1D9DA 4AHVA 3P5JA 3OYMA 5FROA 1DTQA 4Z4EA 3V9SA 3SI6A 4BDPA 2IC3A 4EZ6A 1S1WA 4E7IA 3KIOA 4TSXA 4CEAA 2XY7A 1D8YA 3AVKA 4FK0A 1RBVA 3KLIA 4CIEA 1VSJA 4E7LA 4H4OA 4CEQA 4E7KA 3DLBA 4KHQA 1KVAA 3NGYA 2HVHA 3DM2A 2I5JA 5J2QA 4DQIA 3K5LA 5HLFA 3KLFA 3VQEA 4CJVA 1A5WA 1RTHA 4E7HA 3OJUA 4DSKA 5FDLA 1S1UA 1JLCA 3SUQA 3L3UA 3RWUA 4DTNA 3F73A 4M3RA 4BE1A 2IS3A 3L2QA 4IDKA 5SZTA 3SUNA 4CJFA 5DMRA 1J53A 2XY8A 3QEIA 1TL1A 4OKKA 3LZJA 3C95A 1C1CA 1VRTA 3VQ8A 1CXUA 4M45A 4E1NA 3PY8A 2HMIA 4KFBA 2IOCA 1G15A 4FW1A 1RCHA 3TAGA 1CXQA 3MEGA 1VSFA 4DQRA 3TARA 1KFDA 1NK5A 5KGWA 5FRNA 4R5PA 5J1EA 3VQ9A 3V4IA 3QIPA 3TI0A 5K14A 2VG5A 4DSLA 4B9LA 4OLAA 4BE0A 2G8HA 5C25A 4BE2A 3SCXA 1JLAA 3NF6A 4BACA 4IG3A 1S9GA 3TAPA 2JLEA 4KI6A 3TAFA 2E6LA 1BI4A 4C8OA 4N76A 4K8XA 3KD5E 3HPGA 4CJPA 3LP1A 3SUPA 3SNNA 3EZ5A 1C0MA 4C8NA 4RW7A 1NK9A 4CGFA 1KVBA 3CFRA 1C1BA 3MXJA 2PZSA 3OS1A 1QQCA 4CJTA 3O3GA 5HBMA 3OYFA 4BDYA 1SUQA 2YNGA 1YVUA 2EX3A 4KTZA 3LZIA 3G0ZA 2IDOA 4I2QA 2GUIA 3OYGA 3OYEA 1NJXA 3NDKA 1NK7A 4B9UA 4KB0A 1QTMA 4LH4A 3ZSZA 2E4LA 3ISNC 3LAMA 1S6PA 3QLHA 1N6QA 4Z4IA 2E6MA 3T1AA 4FJKA 3AO1A 3LPUA 1SKRA 4O0JA 1HQUA 3T3FA 4FZYA 3IG1A 2IAJA 4M3ZA 2P5OA 4PQUA 1RBTA 2FBXA 1VSMA 2Y1JA 1TK5A 3ZT1A 2D0BA 1I39A 3CYMA 3CFOA 4CHOA 4XIUA 1S6QA 3NE6A 1XHZA 4ELUA 4YNQA 3OYCA 4J2EA 3CG7A 3KJVA 4FJ8A 3T19A 1T03A 2BANA 1U45A 3DMJA 1X1PA 1UA0A 4FLTA 4Y1DA 4DFKA 2G8VA 4J2AA 1RDAA 1ASUA 3P1GA 4CJQA 3DYAA 2XO7A 2ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1S A;  1EX4 A;  1TL3 A;  3VQ5 A;  4BDZ A;  2PYJ A;  1T7P A;  1B92 A;  1WSF A;  4F4K A;  3VA0 A;  1EXQ A;  5J2P A;  2RPI A;  3L2U A;  1L3V A;  4CJ3 A;  2BDP A;  3RRH A;  4IFY A;  5KTQ A;  1LW2 A;  1SKS A;  1VSH A;  1LAW A;  2F96 A;  4DTO A;  3OYL A;  3HT3 A;  4HUG A;  3FFI A;  1LV5 A;  4F3T A;  4GVM A;  1JLB A;  3RR7 A;  1BHL A;  1IO2 A;  4O0I A;  3SQ1 A;  2XY5 A;  3PX4 A;  1I3A A;  4IG0 A;  3HPO A;  4JRQ A;  4KHY A;  3V1R A;  4C8K A;  3UIQ A;  4OVL A;  2KW4 A;  4KAZ A;  1JKH A;  1Y97 A;  2FBT A;  3LP3 A;  4CFB A;  2ETJ A;  3K5O A;  3O3H A;  3OY9 A;  4CCH A;  3IAY A;  2DFF A;  1ZBL A;  3OYB A;  1SL2 A;  1HJR A;  1J5O A;  4J2B A;  3V9W A;  3LP2 A;  3RMD A;  4N41 A;  1L3S A;  1EP4 A;  2O4G A;  3V9Z A;  4CHZ A;  1C1A A;  1L5U A;  4OKJ A;  1HYZ A;  3VQP A;  2X78 A;  1YTU A;  1JLF A;  4Z4G A;  3NF7 A;  3RRG A;  4CEF A;  3DRR A;  4CJE A;  1Q9Y A;  4KHN A;  4NCG A;  4IKF A;  2KQ2 A;  4FM2 A;  3AO4 A;  1BIZ A;  4CHQ A;  3ITH A;  4E7J A;  2AJQ A;  3K5M A;  4Z4F A;  2JGU A;  4ELV A;  1RT7 A;  4QCL A;  4JS4 A;  3WNG A;  1IKW A;  3V9U A;  3VA3 A;  3AA2 A;  4CJ4 A;  5KRS A;  2WON A;  3LPT A;  4DFM A;  2OZS A;  2NUB A;  5J2N A;  1QS4 A;  3U6F A;  3V1O A;  5I42 A;  4OGC A;  1RT4 A;  3KLH A;  2Z1I A;  3JSM A;  1WSE A;  2HHS A;  4NYN A;  1BL3 A;  2F8T A;  4CFD A;  4M42 A;  3C94 A;  4ICL A;  1KSP A;  1EKE A;  1GOC A;  2X74 A;  1NOY A;  1WSJ A;  3L3V A;  1MU2 A;  1WAF A;  4M3T A;  3ZSR A;  5DK5 A;  1UAX A;  4IFV A;  4LD0 A;  3TR8 A;  4L8R B;  3AVG A;  2HHW A;  3IRX A;  1Q8I A;  4CHP A;  1ZBH A;  2G8I A;  3QNN A;  4I9Q A;  3EYZ A;  4FM1 A;  3LP0 A;  1FKO A;  2FBY A;  4MQ3 A;  4CHY A;  2G8U A;  2YKM A;  3RMA A;  4DU4 A;  1WLJ A;  3QES A;  4KPY A;  3ASM A;  1LAV A;  4DSE A;  1SL1 A;  2OZM A;  3ZT4 A;  1LWE A;  2HB5 A;  3AVL A;  3OYK A;  5CZ1 A;  3DLR A;  1GOB A;  1ASV A;  1NKB A;  1O1W A;  4WE1 A;  4CFC A;  1WAJ A;  2IGI A;  4C8M A;  2ZQB A;  3TAB A;  3K5N A;  4B9N A;  5CYQ A;  4DG1 A;  1W9H A;  4DF8 A;  2B4J A;  4CJK A;  1Z25 A;  3M8Q A;  4W5R A;  3NH0 A;  3NCI A;  4CEZ A;  1X9M A;  3AV9 A;  4IBN A;  4O4G A;  4FJ5 A;  1VSK A;  1CZB A;  1VSL A;  1VSI A;  2ZD1 A;  1KCF A;  4ID1 A;  4DMN A;  3M8P A;  4ZTF A;  2D0A A;  3RR8 A;  4FJI A;  3DLH A;  3AVH A;  3OYI A;  1NKC A;  3PO4 A;  3KTQ A;  1RDD A;  4B8C A;  2P1J A;  3LAL A;  1FXX A;  1D5A A;  1NK8 A;  4HUF A;  3MAQ A;  3VQ6 A;  4FM0 A;  4FJJ A;  1JLG A;  2DY4 A;  4FLZ A;  1KVC A;  2Y1I A;  3MEE A;  2VWK A;  4W5Q A;  5SWM A;  3QNO A;  4M3U A;  1U47 A;  5E41 A;  4CK3 A;  1NJZ A;  1ZBI A;  3MEC A;  4MFB A;  3ZSV A;  4KO0 A;  3ZCM A;  3V6D A;  1NK6 A;  3G10 A;  1TAU A;  1NJY A;  4CER A;  3SYZ A;  3EY1 A;  4RW6 A;  2HHQ A;  4KHS A;  5C24 A;  4AHT A;  5JS1 A;  1LW0 A;  3NF8 A;  4JS5 A;  4B3O A;  4Q5V A;  5I3U A;  2O4I A;  5KGX A;  4GW6 A;  1B9F A;  4RG8 A;  5EU7 A;  3AVM A;  4B9M A;  4C8L A;  4FJG A;  2YNH A;  3NGI A;  3K58 A;  4M3W A;  4FJN A;  1RTI A;  2YHA A;  1TVR A;  4O55 A;  4E3S A;  2P5G A;  1ITG A;  2QXF A;  3DOK A;  3K59 A;  3OYD A;  3U3Y A;  3KD1 E;  1J54 A;  3RMC A;  2QKB A;  1TKX A;  4DTS A;  4H4M A;  4B9T A;  1RT5 A;  1W0H A;  4LH5 A;  1TGO A;  3SZ2 A;  4EP5 A;  4AH9 A;  3AVI A;  1BIS A;  1BQM A;  4DQS A;  3TAN A;  4FJX A;  2HHX A;  1HQE A;  1VSE A;  1A5X A;  4DFJ A;  1BGX T;  1D9F A;  3AO2 A;  1CLQ A;  1BIU A;  3B6P A;  4QAG A;  2X6S A;  4HCB A;  5HRO A;  1KLN A;  1GOA A;  1QHT A;  2OPS A;  1QSY A;  2EHG A;  3AO5 A;  3IS9 A;  2HW3 A;  3WNE A;  3KLE A;  4DLE A;  1K6Y A;  4FLX A;  3V9X A;  1QE1 A;  3P83 D;  3KKS A;  5HRS A;  3S3O A;  1U49 A;  3BDP A;  1FK9 A;  1F21 A;  3ZSW A;  4HVJ A;  4DS5 A;  2WOM A;  4CJ5 A;  1RT2 A;  1S1V A;  1U48 A;  3QER A;  1VK0 A;  3OYA A;  1C0T A;  3S3N A;  4KTQ A;  4M3Y A;  1VRU A;  1XHX A;  4KV8 A;  4CE9 A;  1NK4 A;  3B6O A;  4FJ9 A;  1SV5 A;  2ATQ A;  2B5J A;  4FZX C;  4KHU A;  4E0D A;  4CJW A;  3MXI A;  4CEC A;  1XC9 A;  4I2P A;  4JLH A;  5T7B A;  2VWJ A;  3DRS A;  1TK8 A;  5CY4 A;  2HNZ A;  2QKK A;  3KKR A;  4CGD A;  1HMV A;  3NH2 A;  3HVT A;  3AVC A;  4E19 A;  4K8Z A;  4J2D A;  2BGG A;  4BWJ A;  1B9D A;  1EET A;  4DS4 A;  2KFZ A;  4CF9 A;  2QK9 A;  3HP9 A;  4Z4H A;  4B8A B;  4EZ9 A;  4F8R A;  4FLU A;  3D45 A;  3HP6 A;  2HHT A;  4ZTJ A;  1RIL A;  3AVN A;  1RT6 A;  1HRH A;  4FJL A;  2A1R A;  1XI1 A;  4M41 A;  2G8K A;  5CZ2 A;  4FLY A;  3SUO A;  3KLG A;  1HNV A;  4OKE A;  1SL0 A;  4FVM A;  4OJR A;  4CF2 A;  1BCO A;  1RTD A;  5FRM A;  4Y1C A;  3VQC A;  1WSI A;  1KTQ A;  4LSN A;  1JL1 A;  2ITG A;  2HND A;  3PX6 A;  1C6V A;  1X9W A;  3O4N A;  3SQ4 A;  4PUO A;  4CJL A;  1RBS A;  3L2R A;  3LDS A;  3D0P A;  4Q0B A;  4CIF A;  1NK0 A;  1XWL A;  4NCB A;  1TV6 A;  4DFP A;  1IG9 A;  3WNF A;  1WSG A;  3VQD A;  4AHU A;  3TAM A;  4W5N A;  3CQ8 A;  4OGE A;  4DF4 A;  4HTU A;  4PA1 A;  4FZZ A;  3LWL A;  4DQQ A;  2KZZ A;  3K57 A;  3CM6 A;  3ZSO A;  1SKW A;  3DOL A;  3NBP A;  3QIN A;  3KK2 A;  4DU3 A;  3HJF A;  3LAK A;  3ZSY A;  3A2F A;  3AA4 A;  1R0A A;  4O44 A;  3I0S A;  3PUF A;  1JLQ A;  4OPK A;  4DTX A;  2OA8 A;  1TKD A;  4DTP A;  3MXM A;  1BQN A;  5JS2 A;  1IH7 A;  4CEB A;  4FLW A;  1RT3 A;  1S5J A;  2YNF A;  4E89 A;  4W5O A;  4CED A;  3O4Q A;  4CJS A;  4CJU A;  4DTU A;  1Q9X A;  3ZSQ A;  1QSS A;  3VQ7 A;  1RDB A;  1JXE A;  4ZHR A;  4KRE A;  3LWM A;  1U4B A;  4CFA A;  1REV A;  4EP4 A;  4HUE A;  4YFU A;  4CF0 A;  1RBU A;  4N5S A;  2G8F A;  3HVR A;  3NAE A;  2PY5 A;  2XHB A;  1RT1 A;  2PYL A;  4FK4 A;  4CF8 A;  1Z26 A;  2OPQ A;  4BWM A;  3KK3 A;  3L8B A;  4KHW A;  4CGH A;  3NGZ A;  3QEP A;  4DSI A;  1L3T A;  1RDC A;  1ZBU A;  3MED A;  3KK1 A;  1JLE A;  4CGI A;  1KRP A;  5D3G A;  3OYH A;  3U3G A;  3M8R A;  3RTV A;  3E01 A;  3QEV A;  2HHU A;  2B6A A;  1JL2 A;  2BE2 A;  3SV3 A;  1ASW A;  4FYD A;  2YNI A;  2KFN A;  3ZSX A;  1JXB A;  1CZ9 A;  2Z1H A;  2R7Y A;  2FC0 A;  2RN2 A;  3SPY A;  4PWD A;  4KI4 A;  1TAQ A;  1IKV A;  2GV9 A;  5KRT A;  4UQG A;  4E1M A;  3OS0 A;  3THV A;  1KFS A;  3V81 A;  5HP1 A;  3DI6 A;  3ALY A;  3C6U A;  4AHR A;  3PO5 A;  3QET A;  3M8S A;  1L3U A;  3H08 A;  3HYF A;  3NF9 A;  4JRP A;  3AVA A;  2HVI A;  3DLK A;  3TWH A;  3VQB A;  1UA1 A;  3HK2 A;  4FXD A;  1QSL A;  3WNH A;  1U04 A;  3C6T A;  3CM5 A;  3HPH A;  4CGG A;  4Z4C A;  4M3X A;  4KKO A;  3ZT0 A;  3AVJ A;  4F3O A;  2HHV A;  4RW8 A;  3ZT3 A;  1ZYQ A;  4NYF A;  2DFH A;  3ULD A;  5J2M A;  3SPZ A;  3OYN A;  3AVB A;  4G1Q A;  3QEX A;  1N5Y A;  4KRF A;  3HL8 A;  3OYJ A;  2OPR A;  3NFA A;  2X6N A;  3HST B;  4DU1 A;  2XY6 A;  2VG6 A;  3JYT A;  4GMJ B;  4CJR A;  2Q3S A;  1WNS A;  1TKT A;  4DTJ A;  3NH1 A;  3S9H A;  3DLG A;  1NOZ A;  1UOC A;  1RTJ A;  3LAN A;  4N47 A;  1S9E A;  3PX0 A;  4FJ7 A;  2VG7 A;  1T8E A;  2Z1J A;  2YKN A;  4ID5 A;  1J9A A;  3L2W A;  2P51 A;  3DRP A;  3OJS A;  1LWC A;  3VQQ A;  3VN5 A;  4DLG A;  4F2S A;  3TAQ A;  4DTR A;  4PY5 A;  1YT3 A;  3QEW A;  2GBZ A;  1A5V A;  5KI6 A;  4B9S A;  4CEE A;  1X9S A;  1VSD A;  3AVF A;  3PV8 A;  4DQP A;  2KZM A;  1DTT A;  4DTM A;  3K2P A;  4FJM A;  1TK0 A;  4FK2 A;  5HRP A;  1HPZ A;  1UWB A;  3QO9 A;  2OPP A;  4O5B A;  2W42 A;  3NHG A;  2DFE A;  2Z1G A;  2RF2 A;  1IKX A;  4CIG A;  3AA5 X;  3AO3 A;  4LY7 A;  1HNI A;  2D0C A;  4DSF A;  1RBR A;  5CYM A;  2DTU A;  1T05 A;  2XRI A;  1IKY A;  4I7F A;  5HRR A;  4B08 A;  3S3M A;  2F8S A;  2HNY A;  1YTA A;  1RNH A;  4FLV A;  4B9V A;  4KB1 A;  3HO1 A;  5C42 A;  4DWI A;  4W5T A;  3AA3 A;  3I8D A;  3TAE A;  3DLE A;  4LSL A;  4H8K A;  4N56 A;  4KTW A;  4F2R A;  2KTQ A;  4FW2 A;  3HXM A;  4QOZ B;  4CGJ A;  1FKP A;  2YHB A;  1C0U A;  1KLM A;  1HYV A;  4CES A;  4OLB A;  1HYS A;  1WSH A;  3HM9 A;  4CHN A;  1LWF A;  3SQ0 A;  3OVN A;  4RW9 A;  4Z0U A;  3CFP A;  4AIL C;  3RMB A;  3VQ4 A;  4FJH A;  1TKZ A;  2G8W A;  4DSJ A;  4HCC A;  1S1T A;  3V1Q A;  2RKI A;  2YV0 X;  4CK2 A;  4CEO A;  3OS2 A;  3L2V A;  2LSN A;  3SQ2 A;  3BGR A;  4AHC A;  1WN7 A;  4AHS A;  2OYQ A;  1BI4 B;  1BCM A;  4OPJ A;  1NJW A;  3I0R A;  3QIO A;  4FCY A;  3SV4 A;  3F9K A;  2D5R A;  4I9L A;  2FBV A;  4CK1 A;  4NCA A;  3SJJ A;  1DLO A;  4ELT A;  5HRN A;  3ZT2 A;  4RW4 A;  3VQA A;  4CF1 A;  1ZBF A;  4HHT A;  1NKE A;  3O3F A;  1S1X A;  1D9D A;  4AHV A;  3P5J A;  3OYM A;  5FRO A;  1DTQ A;  4Z4E A;  3V9S A;  3SI6 A;  4BDP A;  2IC3 A;  4EZ6 A;  1S1W A;  4E7I A;  3KIO A;  4TSX A;  4CEA A;  2XY7 A;  1D8Y A;  3AVK A;  4FK0 A;  1RBV A;  3KLI A;  4CIE A;  1VSJ A;  4E7L A;  4H4O A;  4CEQ A;  4E7K A;  3DLB A;  4KHQ A;  1KVA A;  3NGY A;  2HVH A;  3DM2 A;  2I5J A;  5J2Q A;  4DQI A;  3K5L A;  5HLF A;  3KLF A;  3VQE A;  4CJV A;  1A5W A;  1RTH A;  4E7H A;  3OJU A;  4DSK A;  5FDL A;  1S1U A;  1JLC A;  3SUQ A;  3L3U A;  3RWU A;  4DTN A;  3F73 A;  4M3R A;  4BE1 A;  2IS3 A;  3L2Q A;  4IDK A;  5SZT A;  3SUN A;  4CJF A;  5DMR A;  1J53 A;  2XY8 A;  3QEI A;  1TL1 A;  4OKK A;  3LZJ A;  3C95 A;  1C1C A;  1VRT A;  3VQ8 A;  1CXU A;  4M45 A;  4E1N A;  3PY8 A;  2HMI A;  4KFB A;  2IOC A;  1G15 A;  4FW1 A;  1RCH A;  3TAG A;  1CXQ A;  3MEG A;  1VSF A;  4DQR A;  3TAR A;  1KFD A;  1NK5 A;  5KGW A;  5FRN A;  4R5P A;  5J1E A;  3VQ9 A;  3V4I A;  3QIP A;  3TI0 A;  5K14 A;  2VG5 A;  4DSL A;  4B9L A;  4OLA A;  4BE0 A;  2G8H A;  5C25 A;  4BE2 A;  3SCX A;  1JLA A;  3NF6 A;  4BAC A;  4IG3 A;  1S9G A;  3TAP A;  2JLE A;  4KI6 A;  3TAF A;  2E6L A;  1BI4 A;  4C8O A;  4N76 A;  4K8X A;  3KD5 E;  3HPG A;  4CJP A;  3LP1 A;  3SUP A;  3SNN A;  3EZ5 A;  1C0M A;  4C8N A;  4RW7 A;  1NK9 A;  4CGF A;  1KVB A;  3CFR A;  1C1B A;  3MXJ A;  2PZS A;  3OS1 A;  1QQC A;  4CJT A;  3O3G A;  5HBM A;  3OYF A;  4BDY A;  1SUQ A;  2YNG A;  1YVU A;  2EX3 A;  4KTZ A;  3LZI A;  3G0Z A;  2IDO A;  4I2Q A;  2GUI A;  3OYG A;  3OYE A;  1NJX A;  3NDK A;  1NK7 A;  4B9U A;  4KB0 A;  1QTM A;  4LH4 A;  3ZSZ A;  2E4L A;  3ISN C;  3LAM A;  1S6P A;  3QLH A;  1N6Q A;  4Z4I A;  2E6M A;  3T1A A;  4FJK A;  3AO1 A;  3LPU A;  1SKR A;  4O0J A;  1HQU A;  3T3F A;  4FZY A;  3IG1 A;  2IAJ A;  4M3Z A;  2P5O A;  4PQU A;  1RBT A;  2FBX A;  1VSM A;  2Y1J A;  1TK5 A;  3ZT1 A;  2D0B A;  1I39 A;  3CYM A;  3CFO A;  4CHO A;  4XIU A;  1S6Q A;  3NE6 A;  1XHZ A;  4ELU A;  4YNQ A;  3OYC A;  4J2E A;  3CG7 A;  3KJV A;  4FJ8 A;  3T19 A;  1T03 A;  2BAN A;  1U45 A;  3DMJ A;  1X1P A;  1UA0 A;  4FLT A;  4Y1D A;  4DFK A;  2G8V A;  4J2A A;  1RDA A;  1ASU A;  3P1G A;  4CJQ A;  3DYA A;  2XO7 A;  2ZE2 A; 
#chains in the Genus database with same CATH topology
 1X9J A;  3VQ5 A;  1T7P A;  1VQO N;  4IJN A;  4GKK K;  3EE8 A;  4UY8 O;  5J2P A;  3BZC A;  3QIC A;  1NMD A;  3H3N O;  1LAW A;  2KLA A;  3FFI A;  4H5V A;  1QZ6 A;  1BHL A;  4O0I A;  3V1R A;  4C8K A;  2KW4 A;  4CFB A;  1SL2 A;  1HJR A;  4JKG B;  1EP4 A;  2O4G A;  1C1A A;  4OKJ A;  3CC4 N;  2X78 A;  1YTU A;  1JLF A;  4Z4G A;  1S3X A;  4CEF A;  1Q9Y A;  4CJE A;  4KHN A;  2KQ2 A;  3AO4 A;  4CHQ A;  4E7J A;  4Z4F A;  4ELV A;  1EO1 A;  4JS4 A;  3V9U A;  2WON A;  3ZX2 A;  3R8E A;  1EQY A;  4OGC A;  3KLH A;  2Z1I A;  3Q7C A;  2HHS A;  2F8T A;  4JI2 K;  2F9W A;  5GAG P;  3C94 A;  4B3M K;  2O8B A;  1HKB A;  4HTL A;  2A6A A;  5ADX A;  1EKE A;  1WAF A;  4M3T A;  1UAX A;  4JHD B;  4Z94 A;  3CXC M;  4CHP A;  3QNN A;  4JD2 A;  2H3G X;  1FKO A;  4MQ3 A;  5E26 A;  5AZI B;  4CZI A;  3R1X A;  1SL1 A;  1YIJ N;  3VES A;  4BR0 A;  3DLR A;  2YHW A;  4PHT X;  4B1Y B;  4JKB A;  1VQM N;  2B4J A;  4H0X B;  4W5R A;  3NCI A;  4O4G A;  1VSK A;  3WT0 A;  3K9J A;  3RR8 A;  3DLH A;  2IVN A;  3AVH A;  5AQQ A;  1HLU A;  3LAL A;  1FXX A;  4M7X A;  4FM0 A;  4FJJ A;  2DY4 A;  4YDU A;  3OTO K;  3BZK A;  4IXC A;  3WQT A;  5E41 A;  1U47 A;  3PIO L;  3WUH A;  3ZCM A;  2QWM A;  4CER A;  3GOI A;  3BP8 A;  2ITM A;  5JS1 A;  1LW0 A;  1HNX K;  5F2R A;  3ZEU B;  1B9F A;  4RG8 A;  5AJ3 K;  4B9M A;  4M3W A;  1RTI A;  2YHA A;  3CCU N;  4A59 A;  1ATS A;  1ITG A;  1Q86 O;  3LDN A;  3GBT A;  4WYB A;  1J54 A;  2QKB A;  1TKX A;  1HUX A;  4LH5 A;  2V7Z A;  4IJA A;  3C65 A;  4DQS A;  1VSE A;  1D9F A;  2P9S A;  1NGI A;  1CLQ A;  1BIU A;  3CCQ N;  4HCB A;  4EHT A;  4BRG A;  1KLN A;  1MA9 B;  3VEO A;  4BRP A;  4DLE A;  4PUO A;  1K6Y A;  3P83 D;  4HVJ A;  1VK0 A;  3OYA A;  3S3N A;  4M3Y A;  4GNI A;  4CE9 A;  3B6O A;  4B1U B;  1SV5 A;  4FJ9 A;  2ATQ A;  4FZX C;  4KHU A;  4E0D A;  4CJW A;  5M1N A;  3MXI A;  1KXP A;  2VQF K;  5T7B A;  3IKM A;  2HNZ A;  3CCJ N;  4JI8 K;  3KKR A;  4CGD A;  1HMV A;  4JKF A;  4BWJ A;  4J8F A;  1R59 O;  4Z4H A;  4B8A B;  2Q31 A;  3HP6 A;  1RIL A;  1LOT B;  2NZT A;  3O1W A;  4FLY A;  1SL0 A;  3CJ1 A;  4IOC L;  1RTD A;  1JL1 A;  2ITG A;  2HND A;  3ZX0 A;  1P90 A;  3R3L A;  3LDS A;  4CIF A;  1TV6 A;  4DFP A;  1IG9 A;  4AHU A;  3TAM A;  4PA1 A;  2KZZ A;  1W7A A;  3CM6 A;  1SKW A;  3NBP A;  1XNR K;  1R0A A;  3A2F A;  4LFC K;  4LF4 K;  3OA9 A;  4GY2 B;  2OA8 A;  3MXM A;  1BQN A;  5JS2 A;  1VQP N;  2PFU A;  1VHX A;  4FLW A;  1RT3 A;  4R79 A;  4JKG A;  4H0O A;  2KHO A;  3LWM A;  4CFA A;  4K0K K;  4DR3 K;  4JKA A;  3VGK A;  4N5S A;  3HOS A;  2NRW A;  3HVR A;  1RT1 A;  2PYL A;  4FK4 A;  1Z26 A;  2OPQ A;  1U6Z A;  4BWM A;  3NGZ A;  3QEP A;  3EKS A;  1L3T A;  3KK1 A;  4CBW A;  1VQL N;  1KRP A;  5D3G A;  2P9N B;  3U3G A;  3M8R A;  4U7B A;  1WBB A;  4DCH A;  1JL2 A;  1VQ7 N;  1JXB A;  1CZ9 A;  5M1P A;  3SAH A;  5KPR A;  2FC0 A;  2R7Y A;  3SPY A;  3THV A;  4BRL A;  2F9T A;  3DI6 A;  3R9P A;  3M8S A;  3MWP A;  4JHD A;  2HF4 A;  3HYF A;  3AVA A;  3GDQ A;  5CHI A;  3VQB A;  4DR5 K;  3HK2 A;  3WNH A;  4CGG A;  3FZK A;  3HPH A;  4Z4C A;  3M6G A;  4ISE A;  4KKO A;  2E5L K;  2DFH A;  1GLC G;  4KRF A;  2XY6 A;  4JKD A;  3VTI A;  4FWM A;  1RFQ A;  3ENB A;  3DLG A;  3CJC A;  1UOC A;  4CI6 A;  1RTJ A;  3LAN A;  1S9E A;  4L3Q A;  4FJ7 A;  4XH1 A;  1W2B M;  1GLF O;  2P51 A;  1LWC A;  3VN5 A;  4BRQ A;  4DLG A;  4PY5 A;  1A5V A;  5KI6 A;  3L4I A;  4DV6 K;  2KZM A;  4DQP A;  4PL7 A;  4DTM A;  4O8K A;  4A5A A;  1TK0 A;  4FK2 A;  5C15 A;  3N4Q A;  2OPP A;  4O5B A;  2F4V K;  4CIG A;  5AQS A;  2FXU A;  4LY7 A;  1HNI A;  2VQE K;  1RBR A;  2QWL A;  2DTU A;  1IKY A;  2F8S A;  3RVC A;  1YTA A;  2ZF5 O;  4KB1 A;  3HO1 A;  3GL1 A;  1YXQ A;  3AA3 A;  3I8D A;  3DLE A;  3J7Y P;  4H8K A;  4H5N A;  3ZEU A;  2KTQ A;  4FW2 A;  5AFU A;  3CMA N;  4M63 C;  1FKP A;  1C0U A;  1KLM A;  4CES A;  4CW7 B;  4NB4 A;  3HM9 A;  1T6D A;  4MLH A;  3OVN A;  4X66 K;  3RMB A;  1TKZ A;  3WXJ A;  4DR1 K;  3D2E B;  3V1Q A;  2YV0 X;  1NNE A;  3SQ2 A;  4AHC A;  3TSP A;  2OYQ A;  1QQO A;  4OPA A;  4FCY A;  5M1K A;  1HPM A;  2UXC K;  3THX B;  4ELT A;  3BUZ B;  4RW4 A;  3VQA A;  3ZT2 A;  4CF1 A;  1VQ9 N;  4AHV A;  3P5J A;  3AAP A;  3V9S A;  3SI6 A;  4BDP A;  2IC3 A;  2OTJ N;  1QVF M;  4MO4 A;  4FOI A;  2XY7 A;  3KLI A;  1VSJ A;  1ZC6 A;  4H4O A;  3DLB A;  4MO5 A;  2HVH A;  2GEL A;  2I5J A;  5J2Q A;  4DQI A;  5HL7 L;  1GLE G;  2A5X A;  4CJV A;  4E7H A;  5FDL A;  4FWO A;  3CHW A;  4DTN A;  3F73 A;  3VGL A;  4IDK A;  5SZT A;  2CGL A;  1BA1 A;  5DMR A;  3IUC A;  1TL1 A;  3H45 C;  3C95 A;  3O8M A;  3SJH A;  1VRT A;  2QA4 N;  3FZL A;  3GG4 A;  2GWJ A;  4KFB A;  4FW1 A;  3ENO A;  5KGW A;  3MN7 A;  1NBW A;  1VAZ A;  1X3N A;  3QIP A;  3TI0 A;  1Q81 O;  2VG5 A;  4OLA A;  2OCE A;  4BE0 A;  5C25 A;  2G8H A;  4BE2 A;  2P9L A;  4JNE A;  3ZLJ A;  3EE9 A;  3QB0 A;  4GV6 A;  1MDU B;  3C0B A;  3O9U A;  1OKJ A;  4C23 A;  3O9S A;  2JLE A;  4JI5 K;  3TAF A;  2E6L A;  3AAR A;  4KI6 A;  3PLA A;  1VQK N;  4N76 A;  4K8X A;  4NXM K;  3HPG A;  4C8N A;  2E2Q A;  4AF1 A;  1C1B A;  2ASO A;  4AM6 A;  1SUQ A;  1YVU A;  4KTZ A;  3G0Z A;  2IDO A;  2GUI A;  1C0G A;  5FPD A;  1NK7 A;  4KB0 A;  4LH4 A;  3QBX A;  3LAM A;  1S6P A;  1N6Q A;  4GV3 A;  4MLE A;  3LPU A;  3WEE A;  2IAJ A;  2Y1J A;  1TK5 A;  2D0B A;  4ELU A;  3QFP A;  4PKI A;  4FJ8 A;  1U45 A;  2CGK A;  2VWB A;  4DFK A;  2FSK A;  4J2A A;  3P1G A;  4CJQ A;  3VQ4 A;  1TAU A;  1TL3 A;  4JN4 A;  2YX6 A;  3B8A X;  4WQ5 A;  1NGC A;  5M1F A;  2FSJ A;  2P9N A;  3A5M C;  2BDP A;  4IFY A;  3VOV A;  4HUG A;  4CZJ A;  4JI6 K;  3RR7 A;  3SQ1 A;  2XY5 A;  4BR4 A;  3HPO A;  4KHY A;  2UUC K;  4ISF A;  4KAZ A;  3LP3 A;  4DKW A;  3O3H A;  5EXW A;  5FRM A;  1J6Z A;  4BRD A;  3OY9 A;  3T1Y K;  1J5O A;  4DUY K;  2Q36 A;  3V9W A;  3V9Z A;  1L5U A;  1HYZ A;  3HM8 A;  3VQP A;  4RWT A;  3RRG A;  2QWO A;  4BG8 A;  1M90 O;  3DRR A;  3LDO A;  4NCG A;  5HOO A;  4DR7 K;  2ZJR L;  2AJQ A;  4YOR A;  4DFM A;  2OZS A;  5J2N A;  3S41 A;  2IVO A;  4YOX A;  3M5R A;  3JAM O;  3U6F A;  5I42 A;  2P9U B;  1RT4 A;  3FE1 A;  4NYN A;  1BL3 A;  4FWK A;  2X74 A;  4ILJ A;  1Z6R A;  3HZ6 A;  3VF4 A;  5DK5 A;  1HX1 A;  3AVG A;  1Q8I A;  3SLC A;  1Z05 A;  4CVN E;  3EYZ A;  5IWA K;  4FM1 A;  2FBY A;  3LM9 A;  3RMA A;  2ZGY A;  4KPY A;  1WLJ A;  4DSE A;  3ZT4 A;  1LWE A;  4FJK A;  1GOB A;  1NKB A;  4WE1 A;  4CFC A;  5C2D A;  3TAB A;  3K5N A;  1OH7 A;  2ASP A;  4B9N A;  5BPL A;  5KPT A;  1K8K A;  1Z25 A;  4CJK A;  3NH0 A;  4CEZ A;  3AV9 A;  4CZK A;  2P9S B;  4LF6 K;  4ID1 A;  1VSI A;  1KCF A;  3D2E A;  2QTD A;  1YAG A;  3CQX A;  3DXK B;  3PO4 A;  2P1J A;  4HUF A;  3VQ6 A;  4MDB A;  4FLZ A;  4FPA A;  2Y1I A;  3MEE A;  5SWM A;  5BRE A;  3THX A;  4YHH K;  1V4T A;  3ZSV A;  3ZX3 A;  2PAV A;  1N34 K;  2FF3 B;  3IDH A;  4BR9 A;  4BRN A;  3EY1 A;  3FR0 A;  4RW6 A;  4AHT A;  1XQS C;  3NF8 A;  4JS5 A;  2UU9 K;  5LL6 Z;  5I3U A;  3BF3 A;  5KGX A;  4GW6 A;  3VEX A;  4C8L A;  4FJG A;  3K58 A;  5FPE A;  3DOK A;  3OYD A;  3CJA A;  4QS9 A;  3U3Y A;  3RMC A;  1I94 K;  5BR8 K;  1IBK K;  1T44 A;  2UUA K;  5AQZ A;  1C0F A;  3SZ2 A;  4EP5 A;  3CCL N;  4E1J A;  2VGN A;  1A5X A;  3U9Z A;  1GOA A;  1QHT A;  4FWP A;  1NLV A;  2EHG A;  4LFA K;  1OH8 A;  3ATU A;  3WNE A;  3KLE A;  3QEI A;  4O8U A;  1U49 A;  3MX2 A;  1FK9 A;  3ZSW A;  2WOM A;  3EEQ A;  1RT2 A;  1S1V A;  1NGF A;  3RSE B;  1VRU A;  4BRK A;  3KWI A;  4IO9 L;  2QI2 A;  1KC8 O;  1KD1 O;  4DQ8 A;  4CJ7 A;  5CE3 A;  3L4Q A;  2QKK A;  4LF7 K;  4K8Z A;  1WB9 A;  3JS6 A;  4DS4 A;  2KFZ A;  4CF9 A;  2QK9 A;  4EZ9 A;  5LMN K;  1ZBS A;  3D45 A;  1Q18 A;  2HHT A;  4ZTJ A;  5TKW A;  4FJL A;  2A1R A;  5CZ2 A;  2W41 A;  3SUO A;  1HNV A;  4IDH A;  4CF2 A;  5LY3 A;  2YI1 A;  3VQC A;  1WSI A;  3CCM N;  3PX6 A;  1X9W A;  3O4N A;  4CJL A;  1RBS A;  2NRT A;  4K41 A;  3CI5 A;  5C10 A;  3L2R A;  4DR2 K;  4EAH D;  1H1V A;  1XWL A;  4Q0B A;  4NCB A;  3EZW A;  2JWK A;  4W5N A;  3DXM A;  3CCE N;  4FZZ A;  2HBK A;  3ZSO A;  1BWF O;  2FF6 A;  3HJF A;  3KK2 A;  4DUZ K;  4O44 A;  2D0O A;  4I6M B;  1IH7 A;  4W5O A;  4CJU A;  5AQT A;  3ZSQ A;  4CBU A;  2UUB K;  4DV0 K;  1RDB A;  4ZHR A;  5KPZ A;  4K42 A;  4YFU A;  3P39 A;  3ZET B;  1HNW K;  3NAE A;  3CPW M;  2PY5 A;  4CF8 A;  4YOW A;  1BG3 A;  3J81 O;  4BG9 A;  5AR0 A;  3OYH A;  2P9U A;  3RTV A;  1ASW A;  2Z1H A;  3OW2 M;  2DPN A;  1TAQ A;  5KRT A;  4UQG A;  4IFE A;  2I7P A;  3V81 A;  3F5T A;  4AHR A;  1RDU A;  4CD3 A;  3TWH A;  4FXD A;  1WOQ A;  3OHR A;  1QSL A;  1U04 A;  3CM5 A;  3ZT0 A;  4F3O A;  3AVJ A;  4RW8 A;  4CZH A;  3ZT3 A;  3U9D A;  4X64 K;  3OYN A;  2O8F B;  2E8A A;  3OYJ A;  4WFN L;  2E2N A;  2E20 A;  2Q3S A;  1WNS A;  4K43 A;  3G4S N;  2Z1J A;  4ID5 A;  3LDP A;  3VQQ A;  4F2S A;  4JV5 K;  3TAQ A;  3QEW A;  3WXK A;  2GBZ A;  3DXK A;  1S22 A;  3EO3 A;  3QBW A;  1VSD A;  2VCP A;  1DTT A;  4JI0 K;  1BUP A;  1G99 A;  4FJM A;  4IEE A;  2Z1G A;  2RF2 A;  3KWG A;  5BRF A;  3FFK B;  3AO3 A;  2ZJP L;  1SZ2 A;  3KZB A;  2O8C B;  4I7F A;  4B9V A;  4W5T A;  4LSL A;  1X3M A;  4KTW A;  2CH6 A;  2YHY A;  2O8E A;  4QOZ B;  1HYV A;  3E1Y A;  4X62 K;  4CHN A;  3SQ0 A;  1OVQ A;  2NRR A;  4B1V A;  4Z0U A;  4DV7 K;  3H1Q A;  4FJH A;  4H0T B;  2G8W A;  4DSJ A;  2HST A;  2P9K A;  2P9L B;  4CK2 A;  4CEO A;  3OS2 A;  1ATR A;  1YVN A;  3L2V A;  2LSN A;  1WN7 A;  5EOY A;  5AQY A;  3SV4 A;  4YY3 K;  2D5R A;  2FBV A;  4CK1 A;  4DB3 A;  3CQY A;  5HRN A;  5GAE P;  1ZBF A;  4HHT A;  1OVY A;  1DTQ A;  4Z4E A;  1NGA A;  3JXU A;  4FK0 A;  5C2F A;  1K8A O;  4CEQ A;  3WEE B;  3NGY A;  3RSE A;  4PKG A;  3T7Z A;  3O08 A;  4DV2 K;  5HLF A;  1A5W A;  1RTH A;  2VYP A;  5H1S Q;  3OJU A;  3VET A;  4M3R A;  4BE1 A;  4A2B A;  3UB5 A;  4IOX A;  3L2Q A;  3SUN A;  4CJF A;  4LF9 K;  1ATN A;  4K25 A;  1C1C A;  3MMV A;  3HBT A;  3VER A;  4E1N A;  3PY8 A;  4GKJ K;  4BC4 A;  2IOC A;  4DQR A;  1VSF A;  1KFD A;  4WF9 L;  4R5P A;  5M1Q A;  3O9T A;  5F1X A;  2GEM A;  5J1E A;  5K14 A;  3TU5 A;  2QW9 A;  3SBT A;  3P31 A;  1BI4 A;  4C8O A;  2GX9 A;  3SNN A;  1C0M A;  4RW7 A;  4BRM A;  1NK9 A;  1KVB A;  3DJC A;  1JCF A;  2PYJ A;  3EL2 A;  2EX3 A;  4CZL A;  3OYG A;  5AQV A;  3VTH A;  3OYE A;  3QFU A;  3VEN A;  3L6Q A;  4I6M A;  3ISN C;  5B8H A;  3T1A A;  1E4G T;  4O0J A;  4FVU A;  1HQU A;  4FZY A;  2P5O A;  3CPE A;  1XHZ A;  3OYC A;  3CG7 A;  3ZET A;  1T03 A;  3DMJ A;  3H3O B;  1RDA A;  2XO7 A;  2ZE2 A;  2A1S A;  1EX4 A;  4BRC A;  1B92 A;  1WSF A;  4F4K A;  3VA0 A;  1EXQ A;  1NWK A;  2RPI A;  3L2U A;  3VEZ A;  4CJ3 A;  4AQY K;  4WFB L;  5KTQ A;  1VSH A;  4A5B A;  2A41 A;  4FPB A;  4BC3 A;  1LV5 A;  3HTV A;  4F3T A;  1IO2 A;  4JK9 A;  3D6R A;  4CZF A;  2O8D B;  4IG0 A;  5AQR A;  3UIQ A;  1JKH A;  1Y97 A;  2FBT A;  4CCH A;  3IAY A;  3LP2 A;  3RMD A;  4N41 A;  1K8K B;  2O8F A;  1GLB G;  3Q7B A;  1HKC A;  3NF7 A;  3CJB A;  3D2F A;  3O9Q A;  5E84 A;  4FM2 A;  1BIZ A;  4IKF A;  3J7A P;  3K5M A;  4O5F A;  4DV3 K;  2JGU A;  1RDW X;  2QEX N;  2IVP A;  3WNG A;  3AA2 A;  4CJ4 A;  3LPT A;  2NUB A;  3VEY A;  1BA0 A;  5CR4 A;  3EKU A;  1JCE A;  2WTU A;  3ID8 A;  3THY B;  2QWP A;  4H5W A;  1XMO K;  4RTF D;  2P9I B;  1WSJ A;  1CZA N;  1MU2 A;  3FZF A;  3L3V A;  3ZSR A;  2YCH A;  3TR8 A;  4BRO A;  2E2O A;  2HHW A;  1ZBH A;  2G8I A;  2HOE A;  3QDK A;  4I9Q A;  3C6H A;  3LP0 A;  1JJ2 M;  3D7E O;  2O8C A;  2G8U A;  3J80 O;  2YKM A;  4HWI A;  5KQD A;  4DU4 A;  2OZM A;  5BR9 A;  3DWL A;  1WAJ A;  3L0Q A;  4Y0W A;  5CYQ A;  5BN9 A;  4DG1 A;  1W9H A;  4DF8 A;  3VPZ A;  3M8Q A;  1HKG A;  1X9M A;  3O4W A;  4FJ5 A;  3VF6 A;  4M42 A;  1CZB A;  1VSL A;  3M8P A;  4ZTF A;  1Y64 A;  2D0A A;  3R6M A;  4BRF A;  4FJI A;  5LJV A;  4H03 B;  4AM7 A;  1NKC A;  3KTQ A;  4WQ4 A;  1NK8 A;  3W0L A;  3MAQ A;  1JLG A;  3H6E A;  4MDA A;  1KVC A;  2VWK A;  4W5Q A;  3QNO A;  1N8R O;  3W3D A;  4CK3 A;  1ZBI A;  3MEC A;  4KO0 A;  4BRE A;  1NK6 A;  4RCH A;  1NJY A;  4B1Z A;  4JYA K;  3SYZ A;  2Q1N A;  4KHS A;  2BTF A;  5C24 A;  2ASM A;  4DR6 K;  5JMV A;  2YHX A;  3T69 A;  1KAZ A;  2CGJ A;  1T6C A;  3UE5 A;  3NGI A;  4B3T K;  4FJN A;  2NRZ A;  4O55 A;  2QXF A;  4BR2 A;  3UKR A;  3NVK A;  2AA4 A;  3E9L A;  3BF1 A;  3CET A;  4A61 A;  1N36 K;  4FWL A;  4A62 A;  4B9T A;  1TGO A;  5JIC A;  4AH9 A;  1NGE A;  1BIS A;  4FJX A;  2HHX A;  4DFJ A;  3MCA B;  5AQH A;  3DXM B;  2X6S A;  5HRO A;  2OPS A;  1QSY A;  2HW3 A;  1YJ9 N;  1QE1 A;  2NLX A;  5HRS A;  3S3O A;  1JCG A;  1F21 A;  5IT9 O;  1ESV A;  1MWM A;  1U48 A;  1C0T A;  4KV8 A;  3TPQ A;  1J5E K;  2I7N A;  4ILG B;  4I2P A;  4JLH A;  2VWJ A;  5GAD P;  3DRS A;  2JWL A;  4ISG A;  3IFR A;  1M1K O;  5TKY A;  4JKE A;  5LMU K;  3NH2 A;  3HVT A;  3AVC A;  4E19 A;  2BGG A;  4YOU A;  1EET A;  3LDQ A;  1SAZ A;  5GIP A;  3F9M A;  5AQK A;  3AVN A;  1HRH A;  1XI1 A;  4M41 A;  2G8K A;  3ATV A;  3E9O A;  4OKE A;  4FVM A;  4NLB A;  4OJR A;  1BCO A;  3HRG A;  3KK7 A;  4Y1C A;  3FZM A;  4LSN A;  1IBL K;  1T3V A;  1O13 A;  5ELZ A;  3QML A;  5AQP A;  3D0P A;  4FWQ A;  2ZM6 K;  1NK0 A;  5C12 A;  3WNF A;  3VQD A;  3CQ8 A;  4DF4 A;  1V4S A;  1E3M A;  1YUW A;  3QIN A;  4DU3 A;  3LAK A;  4YOT A;  3ZSY A;  5A2Q O;  3AY9 A;  2O8D A;  3PSF A;  3I0S A;  4OPK A;  1TKD A;  2IIR A;  4E89 A;  1YJW N;  4CZG A;  3O4Q A;  2FLO A;  1Q9X A;  4DV1 K;  3VQ7 A;  1YHQ N;  1JXE A;  1U4B A;  1XC3 A;  4DR4 K;  1REV A;  4HUE A;  4CF0 A;  2G8F A;  5F0X A;  3KK3 A;  3L8B A;  3K9K A;  4KHW A;  4CGH A;  1NMN A;  1RDC A;  1ZBU A;  1JLE A;  1NGJ A;  1VQ8 N;  4BVO A;  4JI1 K;  3ZSX A;  2Q0U A;  3THY A;  3G25 A;  4KI4 A;  1KFS A;  3CCV N;  2P9I A;  5GIO A;  4QS7 A;  1GLA G;  3H08 A;  3NF9 A;  2O8E B;  3ULE B;  5BPM A;  4C1N K;  2QWR A;  3PSI A;  3THW B;  3O5B A;  3WXL A;  1BDG A;  2VGM A;  1ZYQ A;  5EY4 A;  3QEX A;  3NFA A;  1BU6 O;  3HST B;  4DU1 A;  1NGH A;  1TYQ A;  2VG6 A;  2P9K B;  1NGG A;  4GMJ B;  3O6W A;  4PL8 A;  3WQU A;  3TTC A;  4DTJ A;  4IWV A;  3S9H A;  4XEI A;  5EVZ A;  1NOZ A;  1IBM K;  4N47 A;  4BRH A;  1IJJ A;  3PX0 A;  1SQK A;  4X65 K;  2YKN A;  3CJ7 A;  3O80 A;  3DRP A;  3OJS A;  3CCS N;  4DTR A;  1YT3 A;  4BR5 A;  1SS6 A;  4NO7 A;  4CEE A;  1X9S A;  3AVF A;  3PV8 A;  3TTD A;  5HRP A;  5M1O A;  3QO9 A;  2W42 A;  2DFE A;  1IKX A;  2YJF A;  3KHY A;  2D0C A;  1YF5 L;  2YJE A;  3SBG A;  3UKU A;  4B08 A;  3P38 A;  3CD6 N;  3A5O C;  5C42 A;  4FO0 A;  3TAE A;  4GVE A;  1GLL O;  5GAH P;  3HXM A;  3KVG A;  1WSH A;  4RW9 A;  2A42 A;  3MX5 A;  3O1B A;  2PBD A;  2RKI A;  2BUP A;  4AHS A;  1BI4 B;  1BCM A;  2D4W A;  1NJW A;  3C6A A;  3F9K A;  4I9L A;  3WXM B;  5DM7 L;  4NCA A;  2CH5 A;  3O3F A;  3CME N;  3OYM A;  5FRO A;  4EZ6 A;  1Q7Y O;  3KIO A;  4CEA A;  2Q2R A;  3AVK A;  1RBV A;  4B9Q A;  4CIE A;  4LF8 K;  5GIN A;  2GWK A;  4E7K A;  5AQX A;  1KVA A;  3VGM A;  3DM2 A;  1EWQ A;  3K5L A;  5AQO A;  3KLF A;  3VQE A;  2F7T A;  2QXL A;  3MN9 A;  1JLC A;  3SUQ A;  3L3U A;  3RWU A;  2W6K A;  3EN9 A;  1J53 A;  2XY8 A;  4BQL A;  4OKK A;  1CXU A;  3U8X A;  3FLC O;  1HR0 K;  1DT9 A;  2HMI A;  1G15 A;  1RCH A;  3MEG A;  3CIP A;  2Q0R A;  3ID6 A;  2V51 B;  3V4I A;  4DSL A;  4B9L A;  4CZE A;  3MK6 A;  3SCX A;  1DGK N;  1JLA A;  3NF6 A;  4BAC A;  4IG3 A;  1S9G A;  5JVG L;  3C7N B;  3J8A A;  4B1W B;  3E66 A;  4CJP A;  3LL3 A;  3SUP A;  3EZ5 A;  4BR7 A;  1KAX A;  3HSC A;  2PZS A;  4QS8 A;  5FPN A;  1QQC A;  3OYF A;  5HBM A;  4BDY A;  2YNG A;  4I2Q A;  2P9P B;  1VQ5 N;  4B9U A;  1QTM A;  3ZSZ A;  4H0P A;  3D2F B;  2E6M A;  1SKR A;  3T3F A;  3IG1 A;  1RBT A;  3ZT1 A;  3NE6 A;  1I39 A;  4CHO A;  3CFO A;  1YIT N;  4XIU A;  1S6Q A;  1QQM A;  2BAN A;  1UA0 A;  2G8V A;  2WFB A;  2QWN A;  3DYA A;  3H1V X;  4BDZ A;  4KH6 A;  4JI4 K;  4B1X B;  3OBY A;  5BRD A;  1L3V A;  3CC7 N;  1DKG D;  1EWR A;  3RRH A;  1LW2 A;  1SKS A;  2F96 A;  4DTO A;  1U2V A;  3OYL A;  3HT3 A;  2W6L A;  1NG9 A;  5AQF A;  4GVM A;  1JLB A;  4U67 L;  3PX4 A;  3T1H K;  1I3A A;  4JRQ A;  3ULE A;  5I9E B;  4DV5 K;  4OVL A;  1VQ6 N;  3THW A;  2ETJ A;  3K5O A;  4LC9 B;  2DFF A;  1ZBL A;  3OYB A;  4J2B A;  4BGB A;  3WXI A;  1FW6 A;  4DHY A;  4YDU C;  1L3S A;  1OH5 A;  4CHZ A;  4A2A A;  4YOY A;  5EX5 A;  1E4F T;  3ITH A;  1RT7 A;  4QCL A;  3VA3 A;  1IKW A;  1GLD G;  5KRS A;  1QS4 A;  3V1O A;  3M1F A;  3JSM A;  2ZGZ A;  1WSE A;  3FZH A;  3SAF A;  4CFD A;  4FL9 A;  4H0V B;  3H46 O;  1W97 L;  4ICL A;  1KSP A;  1GOC A;  1NOY A;  2UXB K;  4KBO A;  4LD0 A;  4IFV A;  4L8R B;  3K0S A;  2D0P A;  3IRX A;  3ENH A;  4DV4 K;  4CHY A;  3UKR B;  4YOV A;  3QES A;  3ASM A;  2Q97 A;  1LAV A;  4V19 S;  4G9Z A;  2HB5 A;  3OYK A;  3AVL A;  2HHQ A;  5CZ1 A;  1ASV A;  1O1W A;  1WBD A;  2IGI A;  4FSV A;  4C8M A;  2ZQB A;  4OX9 K;  5AQM A;  2OTL N;  2RHK A;  1VQ4 N;  5FLX O;  3A8Y A;  4BVP A;  4IBN A;  2ZD1 A;  4DMN A;  2NRV A;  2W40 A;  3CF5 L;  2UYT A;  3SK3 A;  3OYI A;  1RDD A;  4B8C A;  1D5A A;  5AQN A;  1VQN N;  4M3U A;  1NJZ A;  4MFB A;  3NVM A;  3V6D A;  3AGK A;  3G10 A;  1QQN A;  3ZYY X;  1XMQ K;  1Q82 O;  1D4X A;  4CD1 A;  4B3S K;  4B3O A;  2WC9 A;  4Q5V A;  3F2K A;  4FWS A;  2O4I A;  4XH4 A;  5EU7 A;  3AVM A;  3E9P A;  2YNH A;  4LFB K;  1TVR A;  4E3S A;  2P5G A;  3K59 A;  5AZI A;  3KD1 E;  1NM1 A;  2HBL A;  2BH1 A;  4DTS A;  4H4M A;  3MWT A;  1RT5 A;  1W0H A;  4FOE A;  1GLJ O;  3CER A;  3AVI A;  5ADX H;  4JK7 A;  3PIP L;  3HOT A;  1BQM A;  1IG8 A;  3TAN A;  1HQE A;  1NGB A;  1BGX T;  5BRH A;  3AO2 A;  2E1Y A;  3B6P A;  4QAG A;  4H5R A;  4KH5 A;  5C0Y A;  3AO5 A;  3IS9 A;  5KQ8 A;  4FLX A;  3LDL A;  3V9X A;  3C7N A;  4BC2 A;  3A0I X;  3KKS A;  3BDP A;  5MLC Q;  4DS5 A;  4CJ5 A;  5AQJ A;  3QER A;  3SAG A;  2UXD K;  4H5T A;  4KTQ A;  1XHX A;  1NK4 A;  3NMU A;  2ZJQ L;  2P9P A;  2B5J A;  4IOA L;  2A40 A;  4CEC A;  1XC9 A;  2A3Z A;  1TK8 A;  5CY4 A;  4CBX A;  4JAX A;  1S72 N;  4J2D A;  2OAN A;  4NLC A;  1B9D A;  1XNQ K;  4IZ9 A;  3VMF B;  3HP9 A;  4F8R A;  3G6E N;  2E1Z A;  3VEW A;  3LM2 A;  4FLU A;  1ZXO A;  1QZ5 A;  1RT6 A;  1KAY A;  3OBW A;  3KLG A;  2KKZ A;  4WCE L;  3DAW A;  2HMP A;  1KTQ A;  3VF2 A;  1C6V A;  1XUP O;  3SQ4 A;  3IMX A;  4FWN A;  1ILY A;  3CCR N;  4H0Y B;  3O9R A;  1WSG A;  4OGE A;  4HTU A;  3LWL A;  4DQQ A;  4FWR A;  3K57 A;  3DOL A;  3AA4 A;  5AQI A;  4JKC A;  1TYQ B;  3PUF A;  4DTX A;  1JLQ A;  2AP1 A;  5AZJ B;  4DTP A;  1K9M O;  5LJW A;  4CEB A;  1S5J A;  2YNF A;  1WUA A;  2HBM A;  4CED A;  4CJS A;  1YJN N;  1P8Z A;  1BOT O;  4DTU A;  1QSS A;  1MWK A;  4BRI A;  4KRE A;  4EP4 A;  1RBU A;  4JI7 K;  3GE1 A;  2XHB A;  3I33 A;  3I55 N;  3I56 N;  4DSI A;  3TSU A;  4ILH A;  3VEV A;  3MED A;  4CGI A;  3J7Z O;  4IEI A;  4IO8 A;  4BQZ A;  3E01 A;  3QEV A;  2HHU A;  2B6A A;  2BE2 A;  3SV3 A;  4FYD A;  2KFN A;  2YNI A;  1KQS M;  2RN2 A;  4EHU A;  3UKU B;  4PWD A;  1IKV A;  2GV9 A;  3OS0 A;  4E1M A;  2E2P A;  5HP1 A;  3ALY A;  3C6U A;  3PO5 A;  4OPH A;  3QET A;  3SMP A;  4B3R K;  1L3U A;  2E88 A;  2HHH K;  4JRP A;  3CC2 N;  5AQL A;  2HVI A;  3DLK A;  1UA1 A;  4M3X A;  3C6T A;  2HHV A;  3M3Z A;  3I8B A;  1N33 K;  4M7Y A;  4NYF A;  3ULD A;  5J2M A;  3SPZ A;  1N5Y A;  3AVB A;  4G1Q A;  3HL8 A;  2OPR A;  2X6N A;  3JYT A;  4CJR A;  1QVG M;  1TKT A;  4JI3 K;  3NH1 A;  3N4P A;  2HF3 A;  3AAQ A;  4PKH A;  5DM6 L;  2VG7 A;  1T8E A;  2HBJ A;  1J9A A;  2FSN A;  3L2W A;  3CJ9 A;  5BPN A;  5JLF A;  2RE2 A;  4B9S A;  4BRA A;  4OO1 J;  2O8B B;  2GTD A;  1NU0 A;  3K2P A;  3DLL L;  3HI0 A;  1HPZ A;  1UWB A;  3NHG A;  3AA5 X;  4JKH A;  1TUU A;  3TTF A;  4JD2 B;  4DSF A;  1N32 K;  5CYM A;  1T05 A;  2XRI A;  5HRR A;  3S3M A;  2HNY A;  4FLV A;  1RNH A;  4DWI A;  4N56 A;  4F2R A;  4NXN K;  2WUS A;  3BEX A;  4CGJ A;  2YHB A;  2ZWH A;  4OLB A;  1DEJ A;  1IV0 A;  1HYS A;  3G71 N;  4WQ4 C;  4EFH A;  3U4L A;  4A57 A;  4BY9 C;  1OH6 A;  3AGR A;  4GV9 A;  2GUP A;  1LWF A;  2D1K A;  4LF5 K;  1LCU A;  3CFP A;  2J4R A;  4AIL C;  3BY5 A;  4HCC A;  1S1T A;  5AQG A;  1HNZ K;  4CZM A;  3BGR A;  4OPJ A;  5FPM A;  3I0R A;  3QIO A;  2QWQ A;  2NRX A;  3SJJ A;  1DLO A;  2V52 B;  1NKE A;  1D9D A;  1S1X A;  1NGD A;  3A5N C;  3TSQ A;  1S1W A;  4E7I A;  4TSX A;  1D8Y A;  4E7L A;  4KHQ A;  3SMS A;  5JVH L;  3MDQ A;  4WQ5 C;  3P4I A;  1RGI A;  3MCP A;  3MN6 A;  4DSK A;  1S1U A;  2IS3 A;  4WFA L;  3LZJ A;  3VQ8 A;  4M45 A;  4BC5 A;  3A5L C;  3TAG A;  1CXQ A;  3TAR A;  5AQW A;  1NK5 A;  4C1N I;  5FRN A;  3VQ9 A;  1U2V B;  2QM1 A;  4F9O A;  2EWS A;  5AQU A;  2NNW A;  3FGU A;  4JK8 A;  2V7Y A;  4BGA A;  3TAP A;  3KD5 E;  3LP1 A;  4CGF A;  1QHA A;  3MN5 A;  3MXJ A;  5AFU H;  3CFR A;  3OS1 A;  1NJI O;  4CJT A;  3O3G A;  1BO5 O;  3LZI A;  4EIA A;  1NJX A;  3NDK A;  4KH4 A;  5AZJ A;  5BN8 A;  2E4L A;  2WBN A;  4XH5 A;  3QLH A;  4JEP A;  4Z4I A;  1K73 O;  3AO1 A;  4PQU A;  4M3Z A;  1HJO A;  5JLH A;  2FBX A;  1VSM A;  1FJG K;  3CYM A;  4J2E A;  1TUY A;  4YNQ A;  1YI2 N;  3KJV A;  3T19 A;  1X1P A;  4FLT A;  4Y1D A;  2NRH A;  4KHP K;  1ASU A; 
#chains in the Genus database with same CATH homology
 2A1S A;  1EX4 A;  1TL3 A;  3VQ5 A;  4BDZ A;  2PYJ A;  1T7P A;  1B92 A;  1WSF A;  4F4K A;  3VA0 A;  1EXQ A;  5J2P A;  2RPI A;  3L2U A;  1L3V A;  4CJ3 A;  2BDP A;  3RRH A;  4IFY A;  5KTQ A;  1LW2 A;  1SKS A;  1VSH A;  1LAW A;  2F96 A;  4DTO A;  3OYL A;  3HT3 A;  4HUG A;  3FFI A;  1LV5 A;  4F3T A;  4GVM A;  1JLB A;  3RR7 A;  1BHL A;  1IO2 A;  4O0I A;  3SQ1 A;  2XY5 A;  3PX4 A;  1I3A A;  4IG0 A;  3HPO A;  4JRQ A;  4KHY A;  3V1R A;  4C8K A;  3UIQ A;  4OVL A;  2KW4 A;  4KAZ A;  1JKH A;  1Y97 A;  2FBT A;  3LP3 A;  4CFB A;  2ETJ A;  3K5O A;  3O3H A;  3OY9 A;  4CCH A;  3IAY A;  2DFF A;  1ZBL A;  3OYB A;  1SL2 A;  1HJR A;  1J5O A;  4J2B A;  3V9W A;  3LP2 A;  3RMD A;  4N41 A;  1L3S A;  1EP4 A;  2O4G A;  3V9Z A;  4CHZ A;  1C1A A;  1L5U A;  4OKJ A;  1HYZ A;  3VQP A;  2X78 A;  1YTU A;  1JLF A;  4Z4G A;  3NF7 A;  3RRG A;  4CEF A;  3DRR A;  4CJE A;  1Q9Y A;  4KHN A;  4NCG A;  4IKF A;  2KQ2 A;  4FM2 A;  3AO4 A;  1BIZ A;  4CHQ A;  3ITH A;  4E7J A;  2AJQ A;  3K5M A;  4Z4F A;  2JGU A;  4ELV A;  1RT7 A;  4QCL A;  4JS4 A;  3WNG A;  1IKW A;  3V9U A;  3VA3 A;  3AA2 A;  4CJ4 A;  5KRS A;  2WON A;  3LPT A;  4DFM A;  2OZS A;  2NUB A;  5J2N A;  1QS4 A;  3U6F A;  3V1O A;  5I42 A;  4OGC A;  1RT4 A;  3KLH A;  2Z1I A;  3JSM A;  1WSE A;  2HHS A;  4NYN A;  1BL3 A;  2F8T A;  4CFD A;  4M42 A;  3C94 A;  4ICL A;  1KSP A;  1EKE A;  1GOC A;  2X74 A;  1NOY A;  1WSJ A;  3L3V A;  1MU2 A;  1WAF A;  4M3T A;  3ZSR A;  5DK5 A;  1UAX A;  4IFV A;  4LD0 A;  3TR8 A;  4L8R B;  3AVG A;  2HHW A;  3IRX A;  1Q8I A;  4CHP A;  1ZBH A;  2G8I A;  3QNN A;  4I9Q A;  3EYZ A;  4FM1 A;  3LP0 A;  1FKO A;  2FBY A;  4MQ3 A;  4CHY A;  2G8U A;  2YKM A;  3RMA A;  4DU4 A;  1WLJ A;  3QES A;  4KPY A;  3ASM A;  1LAV A;  4DSE A;  1SL1 A;  2OZM A;  3ZT4 A;  1LWE A;  2HB5 A;  3AVL A;  3OYK A;  5CZ1 A;  3DLR A;  1GOB A;  1ASV A;  1NKB A;  1O1W A;  4WE1 A;  4CFC A;  1WAJ A;  2IGI A;  4C8M A;  2ZQB A;  3TAB A;  3K5N A;  4B9N A;  5CYQ A;  4DG1 A;  1W9H A;  4DF8 A;  2B4J A;  4CJK A;  1Z25 A;  3M8Q A;  4W5R A;  3NH0 A;  3NCI A;  4CEZ A;  1X9M A;  3AV9 A;  4IBN A;  4O4G A;  4FJ5 A;  1VSK A;  1CZB A;  1VSL A;  1VSI A;  2ZD1 A;  1KCF A;  4ID1 A;  4DMN A;  3M8P A;  4ZTF A;  2D0A A;  3RR8 A;  4FJI A;  3DLH A;  3AVH A;  3OYI A;  1NKC A;  3PO4 A;  3KTQ A;  1RDD A;  4B8C A;  2P1J A;  3LAL A;  1FXX A;  1D5A A;  1NK8 A;  4HUF A;  3MAQ A;  3VQ6 A;  4FM0 A;  4FJJ A;  1JLG A;  2DY4 A;  4FLZ A;  1KVC A;  2Y1I A;  3MEE A;  2VWK A;  4W5Q A;  5SWM A;  3QNO A;  4M3U A;  1U47 A;  5E41 A;  4CK3 A;  1NJZ A;  1ZBI A;  3MEC A;  4MFB A;  3ZSV A;  4KO0 A;  3ZCM A;  3V6D A;  1NK6 A;  3G10 A;  1TAU A;  1NJY A;  4CER A;  3SYZ A;  3EY1 A;  4RW6 A;  2HHQ A;  4KHS A;  5C24 A;  4AHT A;  5JS1 A;  1LW0 A;  3NF8 A;  4JS5 A;  4B3O A;  4Q5V A;  5I3U A;  2O4I A;  5KGX A;  4GW6 A;  1B9F A;  4RG8 A;  5EU7 A;  3AVM A;  4B9M A;  4C8L A;  4FJG A;  2YNH A;  3NGI A;  3K58 A;  4M3W A;  4FJN A;  1RTI A;  2YHA A;  1TVR A;  4O55 A;  4E3S A;  2P5G A;  1ITG A;  2QXF A;  3DOK A;  3K59 A;  3OYD A;  3U3Y A;  3KD1 E;  1J54 A;  3RMC A;  2QKB A;  1TKX A;  4DTS A;  4H4M A;  4B9T A;  1RT5 A;  1W0H A;  4LH5 A;  1TGO A;  3SZ2 A;  4EP5 A;  4AH9 A;  3AVI A;  1BIS A;  1BQM A;  4DQS A;  3TAN A;  4FJX A;  2HHX A;  1HQE A;  1VSE A;  1A5X A;  4DFJ A;  1BGX T;  1D9F A;  3AO2 A;  1CLQ A;  1BIU A;  3B6P A;  4QAG A;  2X6S A;  4HCB A;  5HRO A;  1KLN A;  1GOA A;  1QHT A;  2OPS A;  1QSY A;  2EHG A;  3AO5 A;  3IS9 A;  2HW3 A;  3WNE A;  3KLE A;  4DLE A;  1K6Y A;  4FLX A;  3V9X A;  1QE1 A;  3P83 D;  3KKS A;  5HRS A;  3S3O A;  1U49 A;  3BDP A;  1FK9 A;  1F21 A;  3ZSW A;  4HVJ A;  4DS5 A;  2WOM A;  4CJ5 A;  1RT2 A;  1S1V A;  1U48 A;  3QER A;  1VK0 A;  3OYA A;  1C0T A;  3S3N A;  4KTQ A;  4M3Y A;  1VRU A;  1XHX A;  4KV8 A;  4CE9 A;  1NK4 A;  3B6O A;  4FJ9 A;  1SV5 A;  2ATQ A;  2B5J A;  4FZX C;  4KHU A;  4E0D A;  4CJW A;  3MXI A;  4CEC A;  1XC9 A;  4I2P A;  4JLH A;  5T7B A;  2VWJ A;  3DRS A;  1TK8 A;  5CY4 A;  2HNZ A;  2QKK A;  3KKR A;  4CGD A;  1HMV A;  3NH2 A;  3HVT A;  3AVC A;  4E19 A;  4K8Z A;  4J2D A;  2BGG A;  4BWJ A;  1B9D A;  1EET A;  4DS4 A;  2KFZ A;  4CF9 A;  2QK9 A;  3HP9 A;  4Z4H A;  4B8A B;  4EZ9 A;  4F8R A;  4FLU A;  3D45 A;  3HP6 A;  2HHT A;  4ZTJ A;  1RIL A;  3AVN A;  1RT6 A;  1HRH A;  4FJL A;  2A1R A;  1XI1 A;  4M41 A;  2G8K A;  5CZ2 A;  4FLY A;  3SUO A;  3KLG A;  1HNV A;  4OKE A;  1SL0 A;  4FVM A;  4OJR A;  4CF2 A;  1BCO A;  1RTD A;  5FRM A;  4Y1C A;  3VQC A;  1WSI A;  1KTQ A;  4LSN A;  1JL1 A;  2ITG A;  2HND A;  3PX6 A;  1C6V A;  1X9W A;  3O4N A;  3SQ4 A;  4PUO A;  4CJL A;  1RBS A;  3L2R A;  3LDS A;  3D0P A;  4Q0B A;  4CIF A;  1NK0 A;  1XWL A;  4NCB A;  1TV6 A;  4DFP A;  1IG9 A;  3WNF A;  1WSG A;  3VQD A;  4AHU A;  3TAM A;  4W5N A;  3CQ8 A;  4OGE A;  4DF4 A;  4HTU A;  4PA1 A;  4FZZ A;  3LWL A;  4DQQ A;  2KZZ A;  3K57 A;  3CM6 A;  3ZSO A;  1SKW A;  3DOL A;  3NBP A;  3QIN A;  3KK2 A;  4DU3 A;  3HJF A;  3LAK A;  3ZSY A;  3A2F A;  3AA4 A;  1R0A A;  4O44 A;  3I0S A;  3PUF A;  1JLQ A;  4OPK A;  4DTX A;  2OA8 A;  1TKD A;  4DTP A;  3MXM A;  1BQN A;  5JS2 A;  1IH7 A;  4CEB A;  4FLW A;  1RT3 A;  1S5J A;  2YNF A;  4E89 A;  4W5O A;  4CED A;  3O4Q A;  4CJS A;  4CJU A;  4DTU A;  1Q9X A;  3ZSQ A;  1QSS A;  3VQ7 A;  1RDB A;  1JXE A;  4ZHR A;  4KRE A;  3LWM A;  1U4B A;  4CFA A;  1REV A;  4EP4 A;  4HUE A;  4YFU A;  4CF0 A;  1RBU A;  4N5S A;  2G8F A;  3HVR A;  3NAE A;  2PY5 A;  2XHB A;  1RT1 A;  2PYL A;  4FK4 A;  4CF8 A;  1Z26 A;  2OPQ A;  4BWM A;  3KK3 A;  3L8B A;  4KHW A;  4CGH A;  3NGZ A;  3QEP A;  4DSI A;  1L3T A;  1RDC A;  1ZBU A;  3MED A;  3KK1 A;  1JLE A;  4CGI A;  1KRP A;  5D3G A;  3OYH A;  3U3G A;  3M8R A;  3RTV A;  3E01 A;  3QEV A;  2HHU A;  2B6A A;  1JL2 A;  2BE2 A;  3SV3 A;  1ASW A;  4FYD A;  2YNI A;  2KFN A;  3ZSX A;  1JXB A;  1CZ9 A;  2Z1H A;  2R7Y A;  2FC0 A;  2RN2 A;  3SPY A;  4PWD A;  4KI4 A;  1TAQ A;  1IKV A;  2GV9 A;  5KRT A;  4UQG A;  4E1M A;  3OS0 A;  3THV A;  1KFS A;  3V81 A;  5HP1 A;  3DI6 A;  3ALY A;  3C6U A;  4AHR A;  3PO5 A;  3QET A;  3M8S A;  1L3U A;  3H08 A;  3HYF A;  3NF9 A;  4JRP A;  3AVA A;  2HVI A;  3DLK A;  3TWH A;  3VQB A;  1UA1 A;  3HK2 A;  4FXD A;  1QSL A;  3WNH A;  1U04 A;  3C6T A;  3CM5 A;  3HPH A;  4CGG A;  4Z4C A;  4M3X A;  4KKO A;  3ZT0 A;  3AVJ A;  4F3O A;  2HHV A;  4RW8 A;  3ZT3 A;  1ZYQ A;  4NYF A;  2DFH A;  3ULD A;  5J2M A;  3SPZ A;  3OYN A;  3AVB A;  4G1Q A;  3QEX A;  1N5Y A;  4KRF A;  3HL8 A;  3OYJ A;  2OPR A;  3NFA A;  2X6N A;  3HST B;  4DU1 A;  2XY6 A;  2VG6 A;  3JYT A;  4GMJ B;  4CJR A;  2Q3S A;  1WNS A;  1TKT A;  4DTJ A;  3NH1 A;  3S9H A;  3DLG A;  1NOZ A;  1UOC A;  1RTJ A;  3LAN A;  4N47 A;  1S9E A;  3PX0 A;  4FJ7 A;  2VG7 A;  1T8E A;  2Z1J A;  2YKN A;  4ID5 A;  1J9A A;  3L2W A;  2P51 A;  3DRP A;  3OJS A;  1LWC A;  3VQQ A;  3VN5 A;  4DLG A;  4F2S A;  3TAQ A;  4DTR A;  4PY5 A;  1YT3 A;  3QEW A;  2GBZ A;  1A5V A;  5KI6 A;  4B9S A;  4CEE A;  1X9S A;  1VSD A;  3AVF A;  3PV8 A;  4DQP A;  2KZM A;  1DTT A;  4DTM A;  3K2P A;  4FJM A;  1TK0 A;  4FK2 A;  5HRP A;  1HPZ A;  1UWB A;  3QO9 A;  2OPP A;  4O5B A;  2W42 A;  3NHG A;  2DFE A;  2Z1G A;  2RF2 A;  1IKX A;  4CIG A;  3AA5 X;  3AO3 A;  4LY7 A;  1HNI A;  2D0C A;  4DSF A;  1RBR A;  5CYM A;  2DTU A;  1T05 A;  2XRI A;  1IKY A;  4I7F A;  5HRR A;  4B08 A;  3S3M A;  2F8S A;  2HNY A;  1YTA A;  1RNH A;  4FLV A;  4B9V A;  4KB1 A;  3HO1 A;  5C42 A;  4DWI A;  4W5T A;  3AA3 A;  3I8D A;  3TAE A;  3DLE A;  4LSL A;  4H8K A;  4N56 A;  4KTW A;  4F2R A;  2KTQ A;  4FW2 A;  3HXM A;  4QOZ B;  4CGJ A;  1FKP A;  2YHB A;  1C0U A;  1KLM A;  1HYV A;  4CES A;  4OLB A;  1HYS A;  1WSH A;  3HM9 A;  4CHN A;  1LWF A;  3SQ0 A;  3OVN A;  4RW9 A;  4Z0U A;  3CFP A;  4AIL C;  3RMB A;  3VQ4 A;  4FJH A;  1TKZ A;  2G8W A;  4DSJ A;  4HCC A;  1S1T A;  3V1Q A;  2RKI A;  2YV0 X;  4CK2 A;  4CEO A;  3OS2 A;  3L2V A;  2LSN A;  3SQ2 A;  3BGR A;  4AHC A;  1WN7 A;  4AHS A;  2OYQ A;  1BI4 B;  1BCM A;  4OPJ A;  1NJW A;  3I0R A;  3QIO A;  4FCY A;  3SV4 A;  3F9K A;  2D5R A;  4I9L A;  2FBV A;  4CK1 A;  4NCA A;  3SJJ A;  1DLO A;  4ELT A;  5HRN A;  3ZT2 A;  4RW4 A;  3VQA A;  4CF1 A;  1ZBF A;  4HHT A;  1NKE A;  3O3F A;  1S1X A;  1D9D A;  4AHV A;  3P5J A;  3OYM A;  5FRO A;  1DTQ A;  4Z4E A;  3V9S A;  3SI6 A;  4BDP A;  2IC3 A;  4EZ6 A;  1S1W A;  4E7I A;  3KIO A;  4TSX A;  4CEA A;  2XY7 A;  1D8Y A;  3AVK A;  4FK0 A;  1RBV A;  3KLI A;  4CIE A;  1VSJ A;  4E7L A;  4H4O A;  4CEQ A;  4E7K A;  3DLB A;  4KHQ A;  1KVA A;  3NGY A;  2HVH A;  3DM2 A;  2I5J A;  5J2Q A;  4DQI A;  3K5L A;  5HLF A;  3KLF A;  3VQE A;  4CJV A;  1A5W A;  1RTH A;  4E7H A;  3OJU A;  4DSK A;  5FDL A;  1S1U A;  1JLC A;  3SUQ A;  3L3U A;  3RWU A;  4DTN A;  3F73 A;  4M3R A;  4BE1 A;  2IS3 A;  3L2Q A;  4IDK A;  5SZT A;  3SUN A;  4CJF A;  5DMR A;  1J53 A;  2XY8 A;  3QEI A;  1TL1 A;  4OKK A;  3LZJ A;  3C95 A;  1C1C A;  1VRT A;  3VQ8 A;  1CXU A;  4M45 A;  4E1N A;  3PY8 A;  2HMI A;  4KFB A;  2IOC A;  1G15 A;  4FW1 A;  1RCH A;  3TAG A;  1CXQ A;  3MEG A;  1VSF A;  4DQR A;  3TAR A;  1KFD A;  1NK5 A;  5KGW A;  5FRN A;  4R5P A;  5J1E A;  3VQ9 A;  3V4I A;  3QIP A;  3TI0 A;  5K14 A;  2VG5 A;  4DSL A;  4B9L A;  4OLA A;  4BE0 A;  2G8H A;  5C25 A;  4BE2 A;  3SCX A;  1JLA A;  3NF6 A;  4BAC A;  4IG3 A;  1S9G A;  3TAP A;  2JLE A;  4KI6 A;  3TAF A;  2E6L A;  1BI4 A;  4C8O A;  4N76 A;  4K8X A;  3KD5 E;  3HPG A;  4CJP A;  3LP1 A;  3SUP A;  3SNN A;  3EZ5 A;  1C0M A;  4C8N A;  4RW7 A;  1NK9 A;  4CGF A;  1KVB A;  3CFR A;  1C1B A;  3MXJ A;  2PZS A;  3OS1 A;  1QQC A;  4CJT A;  3O3G A;  5HBM A;  3OYF A;  4BDY A;  1SUQ A;  2YNG A;  1YVU A;  2EX3 A;  4KTZ A;  3LZI A;  3G0Z A;  2IDO A;  4I2Q A;  2GUI A;  3OYG A;  3OYE A;  1NJX A;  3NDK A;  1NK7 A;  4B9U A;  4KB0 A;  1QTM A;  4LH4 A;  3ZSZ A;  2E4L A;  3ISN C;  3LAM A;  1S6P A;  3QLH A;  1N6Q A;  4Z4I A;  2E6M A;  3T1A A;  4FJK A;  3AO1 A;  3LPU A;  1SKR A;  4O0J A;  1HQU A;  3T3F A;  4FZY A;  3IG1 A;  2IAJ A;  4M3Z A;  2P5O A;  4PQU A;  1RBT A;  2FBX A;  1VSM A;  2Y1J A;  1TK5 A;  3ZT1 A;  2D0B A;  1I39 A;  3CYM A;  3CFO A;  4CHO A;  4XIU A;  1S6Q A;  3NE6 A;  1XHZ A;  4ELU A;  4YNQ A;  3OYC A;  4J2E A;  3CG7 A;  3KJV A;  4FJ8 A;  3T19 A;  1T03 A;  2BAN A;  1U45 A;  3DMJ A;  1X1P A;  1UA0 A;  4FLT A;  4Y1D A;  4DFK A;  2G8V A;  4J2A A;  1RDA A;  1ASU A;  3P1G A;  4CJQ A;  3DYA A;  2XO7 A;  2ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...