3VAMA

Structure of u2af65 variant with bru5c2 dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 44
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vamA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vamA02
3CCJS 2N82B 3SXLA 4OZ1A 3MOJB 1YJ9S 1N54B 3BO3A 2MZJA 3NNHA 1VQ4S 1R8HA 3VAHA 1VQKS 1A7GE 2E5HA 1QM9A 4IUFA 2CQGA 2WBRA 3CTRA 5LJ3Y 2DNNA 3VF0B 1FT8A 1UP1A 2A3JA 2UP1A 1HD1A 3U1LA 2JX2A 2RQCA 2CQPA 3FEYB 2CQHA 5LSOA 2DGQA 3EGZA 3PIOQ 1WELA 1X4FA 2LXUA 2MSSA 1ZZNA 2DIUA 4WFBQ 2DH9A 3THTA 3VAJA 2N3LA 5JVHQ 1YIJS 2SXLA 3TYTA 4YUDA 1H2VZ 4CH0S 3FEXB 3P49B 2EK1A 4LMZA 2YTCA 4LJMA 2RNEA 1YITS 2M9KA 2DK2A 1QVFR 2LA4A 2L9WA 2YH1A 1DRZA 3P3DA 3SDEB 1NU4A 4WKRA 2CQIA 2M7SA 1WHVA 1X5OA 3P6YC 5GVQA 1RK8A 5MLCV 3UCUP 3MI7X 1YHQS 3G8TA 3TP2A 5FJ4A 5IFMA 4CQ1A 1YJNS 2MZTA 1U1LA 2LYVA 1U1KA 4YOEA 2DGSA 1U1NA 2DHGA 2CPIA 5BJRA 3JB9k 1JJ4A 1M1KT 1U1RA 3H2UB 5ITHA 4U67Q 2DGOA 3CCSS 2X1BA 1NJIT 2DNPA 1VC6A 2DNQA 1H6KX 2MZRA 2RS8A 2QFJA 4TU7A 3NNCA 2NZ4A 2ZJPQ 3Q2TC 1JJHA 4WFNQ 2JVOA 2XS7A 2DGVA 2XNRA 2AYGA 5GADU 5JVGQ 2Q79A 1D9AA 2L41A 2OJ3A 4WF9Q 1VQLS 3H2VE 1U6FA 1WF0A 1VQ6S 2KXHA 1WWHA 1NO8A 3DLLQ 1X4HA 2B0GA 5GMKa 2L08A 5CXTA 2DH8A 1UW4A 2MKJA 2DISA 2OSRA 1PO6A 3P5TL 1JMTA 1DZ5A 4C4WA 2CPHA 3ZZYA 1W2BR 3D2WA 2LCWA 3UD3P 5DDQC 3CXCR 5IM0B 2MQLA 4OZ0A 2MQPA 3UCZP 1X4CA 2G4BA 1VQNS 2OSQA 2CQ1A 3R1HA 5CA5A 3CMES 3L3CA 1Q7YT 4LIRA 2CJKA 2VOOA 4WFAQ 5LSLA 2PEHA 3MURP 3CCUS 3BEGB 2CQ3A 3BO4A 2XS5A 3S8SA 3G6ES 3IWNC 1FJCA 1X5SA 2M2BA 3B4DA 1WF1A 1M90T 2KYXA 4TU8A 3S7RA 3G96A 3UCGA 2GHPA 3NS6A 1M5VC 3BO2A 1CVJA 2DNGA 2RS2A 4CIOA 2DNKA 2M70A 3R27A 1VQ5S 2MB0B 4EGLA 2KG1A 2K8GA 2OIHA 3G8SA 3I56S 2EK6A 4FXVA 3NS5A 2MKKA 2X1GA 2VOPA 1WI6A 1VBXA 2DO0A 1OPIA 1BY9A 2RVJA 2DGXA 2D9PA 2DNYA 3CCLS 2LEBA 2CQCA 2ADCA 2F3JA 2MJUA 2HVZA 3OW2R 2QA4S 1X4EA 3DXBA 1YJWS 2CQDA 5DDPC 2MGZB 2YKAA 2HGMA 4C7QA 1Q82T 2J8AA 1SJ4P 1WF2A 2XS2A 4FXWA 2MQNA 2ZJQQ 2DO4A 2CQ0A 1QVGR 3TO8A 5DETA 5GAGU 3IRWP 2CQBA 2FC9A 2MZQA 1VQMS 2MPUA 2FHOB 4IO9Q 2LECA 2ZJRQ 2AYBA 3BS9A 3J7ZT 1WEYA 2MSTA 3V4MA 2LA6A 1VQ7S 2KXFA 1X4GA 2KVIA 2M0GB 3VAMA 1U1MA 2AYEA 5CYJA 2J0QD 2DH7A 2V94A 3VAKA 1VBZA 1Q81T 3CCES 2FC8A 1KOOA 1FHTA 3B4MA 2JVRA 2MHNA 3SDEA 4BS2A 2DNZA 4A8XA 3J7YU 1YWXA 1H2TZ 3HHNB 3R1LA 3LQVA 3ZZZA 2EVZA 2MKSA 5GAHU 4Z2XA 4W92B 2JRSA 4YB1P 1R8PA 2MJNA 1G2EA 1FO1A 4UQTA 3MUTP 2KXNB 1U2FA 1X5PA 2KHCA 2X1AA 2OTJS 2LEAA 1RKJA 2M8HA 2HGNA 3G9CA 1SJFA 2CPZA 2FPHX 3G71S 2KRRA 2RRAA 1XN9A 1H2UX 4QU7A 2ADBA 1VBYA 1IQTA 4J5OA 3CC7S 3VALA 1WI8A 3CF5Q 2MQQA 4Y00A 2HGLA 2MKIA 1DHMA 2MGZA 2CPYA 2YWKA 1OIAA 2HZCA 2PE8A 3N9UC 2KI2A 2J76E 2KM8C 3MUVP 3MDFA 1U6BA 3MD1A 2DNRA 3G4SS 2M88A 3CCMS 1N88A 2CPJA 3NNAA 2DIVA 2DITA 3CUNA 2U1AA 2E5GA 2VODA 1WEZA 2LQ5A 2DGTA 1UAWA 4F25A 1S72S 1AUDA 2D3OR 1X4BA 2DGWA 2KU7A 2MQOA 4V19X 1UFWA 4W90B 4TLQA 5DDOC 2DHXA 1YTYA 1VQ8S 2CQ4A 2DNLA 1HL6A 2MY7A 2U2FA 1M5OC 2FY1A 2K3KA 2KT5A 2MZ1A 5EN1A 3VAIA 2BZ2A 4PR6A 3MD3A 1WHXA 4WIIA 5LJ5Y 4WCEQ 2AD9A 1WTBA 1WG1A 1YI2S 5D78A 2HYIB 4PRFA 1X4AA 5D77A 3U1MA 3CCQS 3UE2A 1D8ZA 2RQ4A 1X0FA 2F9DA 4P6QA 5DDRC 2CQ2A 3VAGA 2M52A 1U1PA 1Q86T 1U1QA 1WG4A 3UD4P 3CPWR 2NLWA 3CMAS 1ZZFA 2JWNA 2RRBA 3Q2SC 2KFYA 5LXRA 1WEXA 4TU9A 3THPA 3MXHP 4IOAQ 2KG0A 4ED5A 1S79A 3CCRS 3RW6A 2MMYA 4QPTA 2XNQA 2MQMA 5IQQA 2I2YA 3EX7B 4F26A 4RU2A 2CPXA 2OTLS 3LPYA 4QQBA 3RW7A 2MYFA 5H1SV 1P1TA 1M5PC 2E5IA 2LXIA 4ERDA 1FNXH 5HL7Q 2QEXS 1L3KA 3HI9A 5LXYA 4M5DB 1KC8T 2N3OA 2DHSA 3US5A 3CULA 3NMRA 4QU6A 3S6EA 1WHWA 1O0PA 4ZKAA 4IOCQ 1WG5A 4CH1A 2CPDA 1KOHA 1FJEB 3CCVS 5DM7Q 2N7CA 2MXYA 1M5KC 2LMIA 2KRBA 2D9OA 3CD6S 2KM8B 1F9FA 3CC2S 2KH9A 3EGNA 1N8RT 2RT3A 2DNOA 1PGZA 2YH0A 2BOPA 2XSFA 2M8DB 4UY8T 2DNMA 2CPEA 1X5TA 2ERRA 1HA1A 2MZSA 1K9MT 1A9NB 2XB2D 1U1OA 1DBDA 3UWTA 2RUGA 1URNA 2VONA 1HD0A 2DHAA 1KQSR 1VQ9S 1OO0B 3ULHA 2DGUA 1B7FA 1VQPS 2G1DA 2X1FA 3VAFA 1JJ2R 5HO4A 2DB1A 1KD1T 1FXLA 3CC4S 1VC0A 2E44A 4C0OC 2AYMA 3I55S 2E5JA 1P27B 2KN4A 2GO9A 1VQOS 1SJQA 2RU3A 1ZH5A 3K0JA 1OWXA 1SJRA 3SMZA 4PKDB 2J0SD 2CPFA 2M4MA 4Y0FA 2F9JA 2LKZA 1SJ3P 3S01A 1FJ7A 5GAEU 5IM0A 2MKHA 3MUMP 1X4DA 2MKCA 1K8AT 2I38A 2G0CA 1N52B 2MY8A 5DM6Q 3PIPQ 1K73T 1WHYA 2DNHA 1SXLA 4F02A 1VC5A 2O3DA
chains in the Genus database with same CATH superfamily
3CJKA 1SJ1A 2ILZA 1XNRF 1FD8A 5BYSA 1EJ7L 1WOSA 3NAHA 4MAKA 4FVCA 2ZFHA 1YJ9S 2J0XA 3JSMA 2GMHA 1FRIA 1GXLA 1RWVB 4J9PA 4ILLA 3D0GE 2HRUA 3ISNC 1AB8A 3LPEA 4Q45A 1QDUB 3M8PB 1D8YA 2VQFJ 2CG8A 1QM9A 2E5HA 2VH7A 2WBRA 3M9OB 4DN9A 4NMXA 3UN5A 2DNNA 1PKUA 4DL4A 1LWEB 2AZ1A 2R7XA 3R9LA 2UP1A 4JV2A 4OI1A 2I1RA 4DOZA 2Q6BA 1N5SA 5CCLA 5GAGI 2JX2A 4LF6F 2BQUA 1HPZA 1RT3B 2CQHA 5HK4A 1T05B 1WELA 1UJ5A 3ZTPA 5KFXA 4NPOA 2FHJD 2G9OA 3HKWA 5DRKA 2PI4A 4QWEA 1S1TB 5E3RA 4CH7A 2R7TA 4ZA1A 5DLGA 4ID8A 5HLFA 2R9LA 4K8RA 4WFBQ 1AXQA 4DFPA 3RB4A 3KDOA 2ZH3A 3GR1A 4PZVA 3W9JA 1BQNA 1IUJA 1YBTA 2OPRB 2NXNA 4AUKA 1UJ6A 2XWXA 1G3OA 3ISND 4CH0S 3GV7B 2W9AA 3GFXA 4ZOSA 4ES2A 4M94A 4USKA 3SSSA 4LJMA 2RNEA 4ZVOB 5A76A 3W9IA 4JI3J 4F4KA 2HFNA 3MECA 4GVLA 1C0UB 4ZN1A 2M9KA 3QIPA 2DK2A 3MEGB 5THWA 3P3DA 4URGA 5E3AA 1NU4A 4KT0C 3ADAC 4K7QA 4K4UA 3MR5A 2V4RA 4PYDA 2CQIA 4YN3B 4LFCJ 2GAHC 5ETRA 4F4WA 3BBFA 4P71A 4WE1A 1NK7A 2UUCF 3VVTA 3GLJA 5CCMA 1SQFA 4BLGA 2D74B 2AJ0A 4ZP7A 2LQJA 3BGLA 4NYPA 2XLKA 3G8TA 4LVNP 2QV6A 4O23A 3B6BA 3W3SA 4WZMA 1NLKL 4KGXB 3NCPA 3H2LA 3HD2A 4P7TA 2MZTA 4DQPA 3OTEA 1U1KA 2OHDA 3MOZA 3AODA 2DT9A 1B4SA 4BWMA 2V68A 2KHDA 2MQ8A 4LRBA 4J9OA 4NCBA 3G6XA 1NK6A 5ITHA 1ZTTA 2DGOA 2HAIA 3QT6A 1SC6A 4Y28C 3M30A 1RWXB 3MR2A 3TJ9A 4RW9B 8ATCB 1I5OB 5JUMA 1NKCA 3IO1A 2DPJA 1H6KX 2RS8A 2ZNZA 3V4IB 2ZBQA 1E6YA 1NBEB 3PJ9A 1NDPA 3TUJC 4BC7A 2QLXA 1TL3A 1OSDA 4DR5J 4LFBJ 2DGVA 2GV1A 3BF4A 1T9UA 4O3QA 2HQ3A 4B08A 2D69A 2D3UA 2POKA 2AYGA 2BR0A 5B0EA 1RT1A 5T7LB 4C8LA 1TQLA 3DOKA 4ZN3A 4L74A 4JI6J 1VQLS 5IC4B 1U6FA 2UXBJ 4ZVHA 4GO7X 5HAOA 4JOUA 3KK3A 2ZEJA 3MEEB 3OR1A 4PUOA 1JKHA 1H98A 2DKOB 2FZCB 2HSEB 3ET6A 5CZXA 3QBCA 3AY0A 1N5QA 4W4MA 1N33J 5J2MA 5HLFB 1RT2B 3B82A 1S1WB 4GMKA 2FHMA 5GMKa 2OFGX 5B0CA 3FCHA 6FD1A 3OHAA 3DRXA 1QUVA 4CO3A 1UW4A 3PJWA 2Y1LB 2MKJA 2DISA 3IXQA 4CLTA 1AYEA 4UQGA 2FVPA 4JI1J 3P5TL 3HZGA 4O3NA 4EK2A 1SKSA 2QC3A 4P2FA 4ILMA 4OYMA 1F5BA 1WUUA 1HPZB 4ECZA 3D2WA 2LCWA 3UD3P 3DRSB 3NG8A 4LF1A 3GPAA 2GQQA 3W7BA 5KFPA 4OHYA 3Q8PB 2OELA 2R42A 3MECB 2FLLA 1GTHA 2OPSB 3PRBA 3FDSA 4ZVEA 1U2RA 3NY0A 3TUIC 4RO0A 1LFWA 1CJTA 2MQPA 2F7VA 5AJ3J 2OPPB 2DCLA 1X4CA 2HNZB 3CJSA 3EXYA 3O3LA 1LKZA 1YGYA 1HWJA 2B43A 2PDAA 2ZE2A 3MEDA 5AXLA 4ED0A 4U9RA 3CMES 2DJWA 1TR0A 3DYAB 4OZ2A 4HACA 4LIRA 1RT7B 5DZ6A 3TVKA 2ROGA 1TAUA 2C3MA 1H7XA 1HW9A 2I8EA 3CCUS 3BEGB 1L3VA 1S10A 4WTYA 2GS8A 4JV0A 4EFAC 3J81U 3BO4A 1TK5A 3BSCA 3LOUA 3G6ES 1FJCA 1HQUA 4DR1J 4L76A 4G1QB 3DHXA 2C2EA 3D9BA 5FLXY 2LU1A 4RUHA 2QMXA 3MM7B 3GIJA 4X62J 5AXMA 3ZNJ1 2ZHBA 1EIYB 3QGIA 3NS6A 2GVDB 4B3MJ 2CVIA 1RZMA 4J37A 4HT5A 1DQ8A 2ROPA 2VZ9A 4ES3A 2BE9B 3KJNB 2DNGA 3M6WA 4J90A 3GB0A 5C42B 4X4SA 1CVJA 3TARA 4ZP6A 2GIRA 1IWGA 4DMZA 1T9XA 3KDNA 3R27A 2IVFB 4M5NA 4K0KF 5K9FA 3SSQA 4LSNB 1WC3A 2I0XA 1T9VA 1FFSB 3DLKB 2Q66A 1NM2A 2IM3A 2X1GA 2OKQA 1LWXA 3TW0A 4IDKB 2RVJA 2H3EB 2CNLB 2I6WA 3OVBA 3EDRB 4EWTA 3AJDA 5ETNA 3UQSA 4ZPBA 2N4CA 4CLWA 2IDLA 2VFTA 2CQCA 1CC8A 4IG3B 3LP0A 4K59A 2HVZA 3UVJB 2VJUA 2BUNA 2E5LJ 1RTHA 2DXFA 1JXEA 3CDAA 4FKYA 2H5IB 2PMWA 5F8MA 2CQDA 3M1VB 4DS4A 2YKAA 2HGMA 1JLGB 3DDIA 3NP5A 4KGKA 4MKYA 2KFZA 5KFNA 4X4UA 1IXKA 3H5XA 5G0RA 4DJBA 1URRA 1D09B 4K5SA 2XMKA 2IVYA 3W9HA 2FLPA 1RAGB 2BBEA 3KJQB 2FC9A 2MPUA 2B56A 2FHOB 2OD4A 4OYZA 4IO9Q 2LECA 1HNWF 3RB6A 3NEKA 2AX1A 1WEYA 3H0PA 3V4MA 3KUHA 5FIIA 1VRTA 5KFTA 4OJ1A 1X4GA 3LGHA 2KVIA 1VJQA 3VAMA 2WK4A 2Z58B 3PG9A 5KG5A 4DV7J 2ZWOA 4DLEA 4KH0B 3H5YA 4V1Ak 3H20A 1ITPA 2RUSA 5G4DA 4ZPDA 4USTA 3H5UA 4XPCA 5GMEA 5H9FJ 3IGVA 3DFEA 2XSJA 2V94A 3TAQA 4RKUC 5F0WA 2B4UA 4ZCLA 4OLPA 1IVZA 2HQDA 4ZLLA 1F9HA 1RA6A 2GQCA 3D3BJ 4C3LA 3PVXA 2DR9A 2BANB 3QT8A 3J7YU 1PC5A 1YWXA 3GG0A 2XCPA 3GV5B 2UXBF 2P9EA 3CDUA 4LREA 1HHTP 3SFUA 2ASJA 1F60B 4U96A 2C2KB 2AJFE 2MKSA 4FBTA 4LR9A 4RR5A 5KFKA 1F1BB 1JLFB 4FYVB 5LMNF 1RABB 1G2EA 5K14B 3FGVA 1V3RA 1U2FA 4PUOB 1APSA 2HMIB 3K5NA 2M5YA 1ZOTA 4ZVPB 3CJQA 2BM1A 4DV6J 4CTAA 2KKHA 3PYEA 2V2ZA 3ILIA 1S9FA 1TK8A 4CNZA 3RRGA 4R25A 1JNRB 4IH5A 3RRKA 5GAEI 3OR2A 1O8BA 2CPZA 3MPUB 4CT8A 2KRRA 3G71S 1XN9A 1H2UX 2RRAA 2IA6A 1VBYA 4QU7A 5SZTA 5G0RB 4ZVSB 5HQ8A 2O67A 2VASA 1WI8A 2H48B 3ZFVA 2C2OB 2MQQA 3AJ2A 1GK8A 2YNIB 2CJYB 2XY7A 3M32B 3M8QB 2MGZA 5HATA 2CPYA 2EEYA 3SQOP 2KL8A 2PE8A 2KI2A 1FKPB 1NUEA 3T41A 1TP7A 4P52A 1AFJA 2FGCA 3RAMA 2OEKA 4LRFA 4C0BA 3MUVP 4NLQA 1RTDA 1HHQA 3HVTB 3JQJA 4LSLB 1CJUB 4DSJA 4DV1F 2COLA 3HSJA 1P1LA 3CNQP 3CCMS 3KLIB 1N88A 4QWAA 2X51A 4Q43A 5FDLB 1HQEB 4M8LA 3CDWA 2OEJA 5DQIA 3DGVA 1QTNB 2AJ4A 4DPYA 1S9EB 3D6FB 3CUNA 3CJKB 2LQ5A 1XNRJ 2XEXA 2WVDA 1H38A 5F0UA 4OZ5A 4F25A 2LP4A 4ZCIA 4C11A 1PC4A 3IS9B 3H25A 2QA4G 4ECSA 1S72S 3PR4A 3IBWA 2N7YA 4KYZA 1T3OA 1R0BG 1S1UB 2WCXA 2YWGA 2KB2A 2YWFA 3AB2B 1LW0A 3C15B 4FDFA 1W2IA 3VQTA 2D7SA 2DGWA 3OFFA 1RTJB 4NYZA 4X4PA 1IBMJ 2GGPA 4W90B 3IS9A 5DDOC 1YTYA 2GIFA 1F2GA 4NA1A 1JLEA 4DEZA 2JLEA 1HBNA 2J6SA 3PKYA 3N6MA 1YG0A 3Q86A 1Y5IB 4B3RJ 5EN1A 2R8KA 4G1IA 3D0HE 2XYHB 1HIYA 2BZ2A 5KFLA 3MD3A 4ZDNA 3DDKA 2P2CB 2G0IA 4NLYA 2R7RA 5LJ5Y 5KG2A 3BYPA 3NCQA 3HJVA 1JLAA 3MEEA 3R5AA 3TUPA 3BSNA 1JLCA 3AXKA 1J5OA 2IM0A 2HYIB 2E9ZA 5D4OA 1DURA 2OPPA 1GFWB 1SUQB 2BYCA 3MTJA 5CH7B 5KFYA 2QLBB 1HNVB 3BDEA 2RQ4A 3CWJA 4O4GA 3OTDA 2OGUA 1U1PA 4AYBD 2JLGA 5F8JA 2LU2A 2BJ9A 3PYFA 3JYTB 2W01A 1WG4A 1EETB 3I9ZA 1SKUB 2YWEA 4I7FA 4EBDA 4H54A 1FI4A 4OI4A 4DFKA 5IT4A 3UD4P 1OY8A 2GMLA 3L9ZA 4I2QA 2IBKA 1Z2LA 3I5AA 1UWBB 3Q2SC 3QJLA 1TL4A 5I42B 1GT8A 2VA3A 2G1HA 3MXHP 2L48A 2VDIA 3BSAA 2XZDB 2BV3A 1S9GB 3KLEB 5DG7A 3OSPA 3BN4A 3BBBA 2NZCA 3Q0AA 3GMGA 3I9V9 4LUBA 5L9NA 4UY85 1L3SA 4RWWA 3FZBA 3IBCB 2OI2A 3JQKA 2AZ3A 1RADB 4F26A 3R2CJ 3KK3B 4WZQA 1IBLF 2OTLS 1G4CA 1XR7A 2VPXB 4ZPTR 4U7UK 2YWHA 4WIQA 4MFBA 4X84A 3OUYA 2W9CA 1VGYA 1LV5A 1PYSB 1R8BA 2XZTB 1T9YA 2DXDA 3OPKA 2FIUA 2HVDA 3A3OB 3EICA 3M2RB 1YZ7A 2AP6A 2PN6A 3IG1A 2QLJB 2AW0A 2BJ7A 2QEXS 2YX7A 4E8UA 1RWWB 4M5DB 1S5ZA 2DBBA 5M2UA 4CLZA 2N3OA 1KC8T 1S0OA 1UWBA 1KONA 3KLHB 2HWIA 2ZM6J 1YRUA 2DHSA 3US5A 3IG1B 1RJJA 3NGDA 5KFZA 4K4YA 1CJKA 5H9EJ 1DY3A 3UR0A 3KUGA 1PYOB 1NJWA 1Z1ZA 2WRMA 2AT1B 3EXCX 4J9QA 1PAEX 4DV6F 2FJVA 3WDOA 2Y9HA 2RMLA 2CPDA 1EQ0A 1Q79A 3AB4B 3PO4A 4K2JA 2Z8QA 1IN0A 5IS2A 1HBUA 1QJHA 4IDKA 1BQNB 2W2NP 1NXIA 4NXMJ 2KM8B 1TKZB 1KFDA 1CBKA 1B70B 3A8JA 5B0BA 2YY3A 4NI2A 2BW7A 3JXOA 2GAGC 4M5GA 1VCTA 1PJ6A 1NKBA 2ZKUA 3CD7A 1IJFB 1WORA 3SV3A 2BJ3A 2YH0A 2WW8A 2XG8A 2XSFA 4I6YA 3U02A 2IAJA 5C25A 1IBMF 3F41A 3JSYA 5K8OA 2PGCA 3W5XA 1HA1A 3AOAA 4IO1A 3MEGA 2OPQA 2MLZA 3GR0A 3I96A 2XB2D 2O01C 3I82A 1X0PA 2DY9A 1MW7A 2XMMA 4ZVFA 1LWEA 1H73A 3TI0A 4A8MP 4P2XA 2DGUA 2X7IA 4NEZA 3GJQB 4NMLA 3AH6A 5B0AA 1RUSA 4DV2J 4DL7A 4B9MA 3VAFA 1JJ2R 5HO4A 1TVRA 4N8OA 1CJVA 1XMBA 3LWLA 4TY8A 4LF8F 2E44A 4YS2A 1LFPA 3W2WB 1NSKL 1ZPWX 2V2QA 4IFVB 1U0SA 2VU5A 5D4PA 1IR0A 2EBEA 3PXGa 4OYIA 1KQFB 3M8SA 1K0VA 1ZH5A 1NDKA 1CJUA 2LQ9A 1FXDA 1U0HB 1HARA 3D66A 2JOQA 3JSRA 4UOGA 4ZCKA 3PW2A 1U49A 3SMZA 1KTQA 1UMJA 1Y00A 2GGPB 2M4MA 3QAEA 4B02A 2F9JA 1RKIA 3X3UA 2LKZA 4N5SA 5IT9U 2NYIA 2AHOB 3AQOA 1HNXF 1WNEA 1BE4A 4UOCA 1RCOB 2AEJA 3M8QA 3MUMP 4A8YA 3T5LA 1RWUA 2PT0A 1X4DA 2ZITA 3OFGA 1ZA2B 2D3O1 3P45B 1S12A 3HHLB 3U27A 4FZVA 1MMNA 1RE1B 4GRSA 1LQ9A 3IFEA 1E6VB 4RPFA 4ZK7M 1N4LA 2GVZB 2ZWPA 2EFVA 5DM6Q 3PIPQ 1RTHB 5CYMB 3KHHA 3V6DB 1RISA 1WHYA 2DNHA 4DUYF 2FD2A 1SXLA 3CJ0A 1HI0P 3GSIA 5F9LA 2O3DA 1SL0A 4F02A 3CCJS 3QNWB 1Y10A 2W2MP 3SXLA 3QT7A 1NHVA 1RCXB 3MOJB 4ED6A 4USVA 2HMIA 3U7JA 4FVMA 5A6PA 4A4JA 3NNHA 2CZVC 4MK7A 3T1YF 1VQ4S 1BQMA 4MKVA 1R8HA 3CIMA 5KFOA 5IWAJ 3AFGA 1FE0A 1PBUA 4PPDA 3OXFA 4ZP8A 3SI8A 1ZETA 4ELUA 3A3PB 2WONB 3FCVA 1C1CA 3J7AN 2NS1B 3IWXA 2CQGA 2B4VA 3CTRA 4NLPA 4QPXA 3CJ5A 1XMQJ 1UP1A 4WWSA 2BANA 2A3JA 4NLSA 1WDTA 2XO6A 4AQYF 3HHLA 1SH3A 3BZQA 1SI9A 1AZSB 1UKUA 3CB4A 3IGNA 2RQCA 2CQPA 2CZ4A 2HFOA 1CULB 1UETA 5D0RA 5HBMA 1Y5LB 1H3DA 1JQGA 4H4OB 5LSOA 5HP1A 1UZDA 4B3OB 1X4FA 2YNHB 3T6JA 3A8KA 2GJ2A 1FXRA 4EI2A 3A3NB 4X4VA 3NGKA 1NNDA 1REVB 4CO5A 2V4QA 2CNNB 4IRDA 2QLFB 1XWLA 3THTA 5DGAA 3OBIA 2N3LA 1NAQA 4QIWD 4A8QA 5JVHQ 3UI3A 1P6TA 5BXIA 1FK9B 4B3TF 3I0SA 2EK1A 5AXNA 4YP3A 4LMZA 1FNMA 1CJVB 1S6PB 2YTCA 1U47A 2YKOA 1X7VA 3BH6B 4AL6A 1RTIA 3C6UA 1YITS 2QL5B 3GQCA 2UUWA 2Y0SD 3OL6A 4KKOA 2GC8A 4ZJLA 1QVFR 2HHHJ 3Q23A 3E3XA 3D54A 3DKDA 2LQBA 2OAUA 1WJ9A 3LANA 3SDEB 1DTTB 4EO8A 2XMVA 2NR0A 3QFWA 5KFVA 6AT1B 2IJNA 3GJTB 1WHVA 3K5OA 3UPFA 3LP0B 3R6GB 2MLYA 2R2SA 1XR6A 3O44A 1X9WA 1RK8A 3G82A 3M6XA 4X65F 2GQ2A 4CWBA 3OUYB 4LRAA 3K89A 1YHQS 2OH2A 5L1LA 5FJ4A 2XMAA 1HQEA 5IFMA 3PX6A 4C98A 5KT7A 3HO1A 4CQ1A 1EARA 1Q53A 1RWOB 1SC1B 2ZNYA 4F7VA 2JEFA 3RR7A 4OZNA 3P8BB 1U1NA 1LW2B 1SQEA 2CPIA 5ETKA 2C3UA 4DWIA 3JTOA 3JB9k 1NPKA 1JJ4A 1S48A 3QFHA 1WC0A 3RB3A 2FVSA 2ZUAA 2WB4A 3IWLA 3MTKA 4L73A 2X1BA 4R8UA 1NJIT 3MEKA 2DNPA 4NZ0A 1S7HA 3LH2S 2G2OA 4NA3A 4WU2A 1VC6A 1CJKB 2Y8WA 2ZDOA 2QFJA 1JLGA 4DQSA 3HFVA 3KK1B 2ZUGA 1SH0A 3M32A 2VQFF 2KT2A 2HS0A 2ZJPQ 3PV8A 3NNCA 2ZD1A 3Q2TC 4HKQA 1S1XB 3O8WA 4WFNQ 4L6V3 2A1BA 4LF8J 4DZDA 1UVKA 4ECWA 1RHUB 2CADA 2DR8A 1Y3JA 5ETVA 2XNRA 3SYZA 2DPIA 5GADU 5JVGQ 2BRKA 2Q79A 4CCHA 2L41A 2PMZD 2C42A 5DO2A 3RAQA 1NK4A 3F73A 2P6SA 4YHHF 2HLUA 1VQ6S 4L72B 1UFKA 4LF5F 1WWHA 1NO8A 2XGQA 4DQIA 3DRPB 2W9CB 2V5HG 1VRTB 1X4HA 3DLKA 4HACB 1FDDA 5HI7A 3UDVA 5HMYA 4KC5A 1X9SA 2UXCJ 1S59A 2HRYA 2ZBCA 4DL3A 3O6QA 4OYXA 2IMWP 2OD6A 4AQYJ 3QJPA 2OFHX 2V6AA 2XHWA 3HCXA 5CXTA 1RT3A 3GP9A 1PO6A 1U6ZA 2F65A 1R0AA 3IA0A 4PG5A 3WC2A 3CW2C 1TKXA 3FSIA 4JI8J 2XI2A 4JYAF 4C4WA 3EUNA 3ZZYA 4ED3A 1W2BR 5EWEA 3D68A 2XWYA 1D9DA 3CMQA 2I9SA 5DDQC 3LP1A 4ANDA 5C7PA 1FKOA 4XPEA 2VQEJ 2A6OA 2QO3A 3M8WA 5A2QU 3FSXA 4X4OA 4N7TA 1W26A 4OZ0A 5KFWA 3OL7A 1NK5A 2VC1A 2BQRA 4P75A 2KZZA 2Y0BB 3TZXA 5DG9A 1KKHA 2OSQA 1VRUA 4JBCA 2H54B 2F63A 5M2RA 3HM9A 1I94F 1J2VA 2HZVA 2C28A 2QA1A 2CJKA 1REGX 3IC1A 4KFBB 4NL5A 4ZVTB 4MIAA 4Z7YA 1U02A 4BBYA 2IRXA 4N56A 1JLAB 4GKJJ 1N6QB 4FNHA 1B0TA 2CQ3A 2ZE2B 3OXGA 3CDEA 3G8QA 3ILLA 5A8WA 1BWVA 3HHDA 3J7A1 3TJ8A 1DTQA 1O6XA 3ETOA 3MR7A 5ADZA 2ZZNA 1R27B 3M2VB 3NBPA 4CO4A 2YKPA 1IKYB 1RDRA 3PFEA 5A8KA 2M2BA 4BWJA 3UDLA 4H4OA 3TEGA 3S7RA 2QT7A 3CJTA 3MZIA 3NKYA 3G96A 3KHLA 1FRHA 4QWCA 4DSLA 3IR5B 1UZHA 1FF2A 3LP1B 2RDJA 4DQRA 4B3RF 5AXKA 2BM0A 3TRGA 1HWKA 1RWNB 3GFHA 3JYTA 1XERA 1QLNA 3FUYA 4X62F 3C14A 4DR2J 4EGLA 2XLIA 5IT0A 2KG1A 2E7XA 4C11B 2OIHA 2KYZA 3PEJA 5KG7A 3I56S 5D3GA 4IRKA 3MFIA 4I2PA 4PPZA 3NS5A 1DARA 4O44B 4TQRA 3RG6A 2MKKA 1WI6A 3L95X 1TL1B 1VBXA 4B9TA 2VA2A 1JLQB 2K06A 2RF2B 4KO0B 2B4PA 2W8KA 1KP6A 4J9RA 2E5LF 2QSFA 4WPAA 4RNFA 1HFEL 2FZGB 4OL8A 2DGXA 4IFYA 1CS4B 4CM0A 3R3TA 3PW7A 2V9WA 1OQ3A 2LEBA 2R2UA 1S6UA 4NOHA 3MPVA 5E41A 1FRMA 1WC6A 5J2PA 4A47A 2HWHA 4WE1B 3UNGC 5K20B 3OW2R 2FY8A 1N5YB 1AUSL 1FKOB 1Q7LB 2HNDB 3DXBA 2XMJA 5BR8J 3C8YA 3SCIE 4I4BA 4ZPVR 4C7QA 2HVIA 3EVOA 4CLUA 3FKBA 2UUTA 2ZD1B 3HULA 1LW0B 1QE1A 2ACYA 2J8AA 2J5AA 2J8SA 1MN7A 2HQGA 2IBOA 3C15A 3ICLA 4A8SA 1IR2A 4JI0F 2XS2A 3QIPB 4FXWA 3GSDA 3TX0A 2ZJQQ 2E1MC 1QVGR 5IOLA 3TO8A 4CYUB 2HHHF 4Y2IA 3BKFA 4DCPB 1PIEA 3BH7B 2Z30B 5E5NA 3CT9A 1OY6A 3DRYA 3IR7B 2EKNA 4F67A 2RHSB 4LFAJ 5EUHA 2AYBA 1ACMB 4IFVA 4TVAB 2BOAA 2BACA 2MSTA 4RW8A 2LA6A 2IVMA 1XNQJ 4O4RA 1Y7PA 2CWKA 2FGOA 1EAYC 4XK8C 1K0TA 1U1MA 2UU9F 1ZAWA 1EB0A 3KG4A 3GJRB 2AYEA 1RTDB 2DEJA 3LAKA 3FEZA 1LK7A 3UDEA 2IC3A 2ZVSA 1PBAA 1S6QB 2B5JA 3UD5A 4C3KA 1TFWA 4ZPCA 3T1YJ 1WC4A 4WTOB 3VAKA 3QO9A 4Y2KA 2PIIA 3M2UB 5IC6B 4DPWA 4NRUA 1AW0A 2ZKTA 4USHA 3SCLE 1FHTA 3B4MA 2IY5B 3E01A 3M1VA 5KOWA 2MHNA 4WP8A 2YNIA 2JEIA 3TQEA 5DG8A 2E1CA 1NZ8A 1N56A 3MPWA 4BS2A 5EWGA 1TUVA 4RUAA 4A8XA 4IRCA 1Q5YA 2BJEA 3LQVA 5ETTA 5ETSA 3WIVA 2GJIA 4EU0A 3V4IA 3R1LA 2HHQA 3W2VA 2JDJA 3IBFB 5J2PB 2BE2B 4M5IA 4KR0B 2DHHA 4JI5J 2PFDA 1XBWA 5L46A 3IMQJ 3PEHA 3QT5A 2JRSA 1N36J 4LF9J 1P9QC 3P5BP 1M1GA 1UEUA 1HMVB 2D1CA 2MTLA 2KHCA 2LXFA 1VDHA 2KJVA 1TUGB 1GMWD 4HDHA 2GZOA 2LEAA 2HAFA 1JLFA 3HHLC 1YJVA 2BE7D 2EBGA 3D5MA 3FQLA 4OI6A 4K4WA 2B8QA 2BW2A 2FYXA 2FPHX 2HZAA 2QA2A 3Q8QB 1YLXA 3LWMA 1XJWB 2JHEA 2CUYA 4MH8A 4N47A 1CPZA 3CC7S 3TZZA 3VALA 3BQ1A 1Y3KA 1LEOA 1SC4B 2J7WA 4HDGA 4FP9A 5I3UB 4C9DA 3KLHA 3UO0A 2P8IA 4LF2A 4FF2A 2FHKA 1XTZA 2IFXA 3CJ3A 4U8VA 3DRRB 1HWUA 2HZCA 3N9UC 5DQGA 4LRCA 5BYRA 4YDXA 3L7UA 1F0XA 5CYQA 4YHHJ 2C2DA 3QQCD 2CRLA 2XGPA 4B9LA 1BLUA 1U6BA 3R97A 4O4GB 3AAWB 4ALZA 3DC2A 1C4AA 4UTGA 2IDEA 1BHNA 4OI3A 3DM2A 2UZAA 2MDAA 3G4SS 1IBCB 1PILA 4PXDA 2IMOA 4OHVA 2M88A 4J9NA 2RF2A 3Q8SB 4F4XA 1NK0A 3PYDA 1G1XA 2CPJA 1PSDA 2P9CA 5GAHI 1PYTA 2Z2YB 4NLWA 4X65J 3T19A 4HI1A 1ROFA 2PA3A 4DV1J 2IM2A 2PSZA 2U1AA 3NRBA 1WEZA 2AIRB 4M63A 4HHUA 4OJHA 2DGTA 3TX8A 5C24B 2XY6A 1UAWA 3R7BB 1B0VA 3FVYA 4KV8B 3KJVB 1FEHA 1SC3B 1Q16B 4NA2A 2DD8S 1S57A 2QIFA 5HANA 3WX4A 2EXUA 4NXMF 2VQEF 4ID5A 4DV7F 1V5VA 3P96A 4CLKA 4Z7CA 1RWKB 2VIHA 1G7CB 4LSZB 1X4BA 4PQAA 4OMFG 1SV5B 5C2GA 3SQGB 2DHXA 2WBMA 1UWAA 3JTPA 3OD2A 5A8KB 2MY7A 2FY1A 1MMDA 3D7SB 4RLEA 2VG5A 4KHPF 5ETLA 4QR0A 3NS7B 1FCAA 1MLAA 2MZ1A 2RRNA 4NRTA 2HBZB 4J91A 2XMUA 1S97A 2C2NA 3QPIA 3CGIA 3DLEA 2JSXA 4K50A 1UA0A 2DRBA 1WHXA 2YX1A 5MAOA 4WCEQ 1WTBA 3OT9A 2Q1LA 3KLFB 2YKQA 4KRWA 1HR0J 1YI2S 2EW9A 1TMMA 3F44A 4KQZA 2ZH7A 3LF0A 5A0YA 4ZHRA 4PRFA 3PX0A 2HIQA 2ZHOA 5KG4A 1RBOB 2AKWB 5IV4A 2B6AB 4DR3F 4ECVA 2CVEA 2GVZA 3D1OA 3DLJA 3ENVA 4RNNA 1D8ZA 2RE1A 1B3TA 2FVQA 2GMJA 1RAHB 2CQ2A 1TL3B 1CJTB 4P6QA 5DZ7A 1HNZF 1T05A 1Y9OA 1QD1A 5LT5A 4M95A 2NLWA 1T7PA 3R2DJ 3G86A 3I87A 2H5JB 1S1UA 2W7OA 5DLFA 4ATNA 1BQXA 4TU9A 4IH7A 2B9XA 3AD9C 1LNQA 3THPA 3H7HB 4IOAQ 4ED5A 3KUEA 1MWYA 1S79A 4HTIA 1D0EA 2E9TA 4FYDA 2UUCJ 1IKWA 2V2KA 4CZCA 3K59A 2MMYA 3AA9A 2XNQA 4QPTA 5DS7A 5IQQA 2HK3A 3CJRA 3UW1A 5J2QB 2V4JA 5KT4A 5K8PA 3LPYA 3RR8A 2L9NA 2W2PP 1HBUB 4DU8A 1TVRB 2C3OA 5E2QA 3BBCA 3KOAA 4U8YA 2UV8G 1PCAA 2MYFA 4P9SA 4ANEA 5H1SV 1P1TA 5K8MA 2IRYA 1YBAA 2VFUA 4HEA9 1RI7A 3T1HF 4ERDA 4EYHB 4J9VA 4L3KA 4URQU 1KQKA 1JX4A 3N6NA 4KGVB 5LXYA 2L9DA 4JI7F 1U8SA 3OL9A 3ZC4A 4DX7A 3QRPA 3PTWA 2KZMA 3DRRA 2J0WA 1HBMB 3PFOA 5D0HA 1I3OB 2K1RB 4C8OA 4JI3F 4HHJA 3CULA 3NMRA 3BM7A 5A8RB 5E0OA 4B9VA 3FQKA 4YB6A 4QWBA 1N5YA 1O0PA 2BJ1A 5LL6d 3SCKE 4ZKAA 4IOCQ 1RLDA 3HSZA 1ZS6A 1YJ7A 1FWPA 4Q7AA 2HBYB 4PXCA 4CTAB 4FF3A 2B6AA 1KOHA 2W4PA 5D6GA 3V6JA 3HJFA 2HW3A 4UZBA 1S1VA 3Q8UA 5DM7Q 4DR4J 1OS5A 1GX6A 2MXYA 1M5KC 3PKMA 4KHPJ 1RHRB 2V34A 5F8NA 2HKEA 4B9UA 4KO0A 3K2YA 3KNAA 4LF4F 1C4CA 5GMDA 4DV0F 1J5EF 3CD6S 4ANCA 1F9FA 3CCZA 2X3DA 3ZXWA 4OZLA 5F8GA 1OYEA 2RT3A 1QAXA 4DL0C 3GZ7A 3Q83A 2H4YB 3M6VA 5D0GA 4C0OC 2DNMA 4AT1B 2FJEB 2LVWA 4TYBA 1NPPA 1WSRA 2QZ8A 3EM1A 2CA9A 3GCWP 4DR2F 5HN0A 3C3LA 5A8RA 1K9MT 2CFXA 4A48A 1A9NB 3AD8C 1S0NA 1S99A 1DBDA 2VONA 1URNA 4OZJA 2DHAA 3ILJA 1XMQF 3RTVA 1SVDA 4Q2MA 7AT1B 2J6UA 3ULHA 3QRRA 3KXDA 3AT1B 2G1DA 2VPZB 1T9TA 3EGVA 5K8NA 3MMBA 1KVKA 1PJ5A 1V3SA 2N4DA 4CO2A 2V67A 1RWPB 3GU0A 3J7YI 1FXLA 1VC0A 4OHXA 3R7SB 4ECUA 1IKXB 2KTQA 4YB5A 1IBKJ 3I55S 5C2CA 2ABYA 4MYUA 2EFNA 4RW4A 4X4QA 5BR8F 1Q8IA 2ZBRA 3R5JB 2DVIA 2RU3A 5JJBA 1ZA1B 4I56A 4FN5A 5D0EA 2ACMA 2W24A 2Z56B 3EZ5A 4K4SA 4DUZF 4YFUA 2J0SD 1HI1A 2CPFA 1UEKA 3UN2A 5JMNA 4WP9A 1E6VA 3K57A 3ILOA 2GJFA 3S01A 4Q44A 1FJ7A 3FFIA 5U47A 3VZIA 3VV2B 4PWDB 1VK3A 1NB2A 2Q43A 2XS5A 2MKCA 1U4BA 2V8PA 4M5MA 1S0MA 2I38A 1N52B 3W5ZA 3KHRA 4E0DA 3UVJA 3LA0A 2Y3YA 5KFCA 4RW7A 1WDDA 4X66J 1SUQA 2XHCA 4WK3A 4X4RA 1K73T 4EO6A 1FX4A 4ECTA 1N0UA 4ZPAA 1MWZA 3HVAA 4GO5X 1VC5A 2G13A 3KNGA 4ED8A 4JV5F 4IG0B 4LFCF 1S9EA 2OPRA 2N82B 1RXOB 2HG4A 3L7PA 4U7CA 3NAIA 1HMVA 4C48A 1SIWB 1N54B 4LR8A 3VVUA 3BO3A 4P7VA 3MMAA 3C6TB 3E2EA 2ZBPA 2A0FB 3DCAA 4ITSA 4E2FB 1VQKS 4LF5J 2CKWA 1RGVA 2B7BB 3QGPA 4WFXA 1NSQA 4DFMA 2Z2LA 3RYLA 5KFJA 3KLGB 1XR5A 2OP5A 3JQMA 3VF0B 1SKRA 4DR5F 4OYPA 1D3WA 3DHWC 5KFBA 1M1HA 5KG3A 3BPDA 3ELHA 2QMUB 1I1GA 1TKXB 3K17A 5E3QA 3HFKA 5T41A 3SQGA 3JAMY 1XEZA 2ZOMA 1UPMB 3DLHA 4C8MA 3FEYB 9RUBA 2HQCA 2DGQA 3EGZA 2IJRA 4RJVA 3PIOQ 3BN7A 2V63A 1FJGJ 5D4LA 4PEOA 3UFCX 5C25B 1SH2A 2QL7B 1S6QA 3M8PA 2LXUA 3VCDA 3UNYA 1AT1B 2DRAA 2G2ZA 2W7AA 3BB5A 3QSIA 3PW0A 1ZZNA 1RT2A 1YJUA 2DIUA 1TU0B 5KOXA 3VGUA 4IYQA 2DR7A 4RW8B 3TVZA 2SXLA 1EKRA 3TYTA 3BR9A 3PX4A 2JEJA 4KJIA 1W7WA 2IM1A 3P49B 1MMLA 2RKIB 1RHMB 2ZOFA 1YDLA 4X4NA 2AU0A 4RBTA 2AGPA 1EKSA 5T7LA 3RBEA 4KB7A 1JK9B 1RHKB 3I4HX 3M6UA 2KFNA 4I64A 4KBIA 3TZYA 4P2MA 3PRVA 2I5JB 3DRSA 3KHGA 1K1SA 2HQIA 3BGUA 5I3PA 2LA4A 2YH1A 2IA0A 3HHLD 4X66F 2ZBIA 2HBRB 3TA2A 5J2NA 2GO8A 1LWCA 1NCLA 3DLLQ 2B3TB 2WVCA 3IAS9 4XDCA 1T03A 4WKRA 1BC6A 1B99A 2CNOB 3F56A 5E3PA 2HNYB 2V2VA 2GA7A 3DOMB 2M7SA 5H9FK 2Y1RI 2W2QP 2R7OA 3P6YC 3WQPA 4EBEA 4PXBA 3QSYB 4AFFA 3UCUP 2EKYA 4TKTA 1SIZA 2VBZA 2ZH4A 4UUXA 2ZH2A 4LT6A 1H74A 1M0SA 1NHKL 4WKYA 1TL5A 3U1NA 4MKBA 4J9KA 4OHWA 1U1LA 1FRKA 2LYVA 2XI3A 3CD5A 1OJ4A 1C0TA 2G2YA 2FJXA 4DPOA 5HQLA 4CLFA 1GNKA 2XYGB 3FSYA 1Q1KA 1Q0NA 3LTOA 1U1RA 2K7KA 4AXJA 3CCSS 1B0PA 4DR7J 5L1KA 4H4KA 5HP1B 5L8RC 1VIXA 2DNQA 1KEKA 2MZRA 5F9NA 4GVBB 3MM5B 3BQ0A 1T03B 4KKOB 5I3UA 2K1RA 1RT4B 4CLSA 2R4FA 3HLUA 4F4YA 1XMOF 5D4NA 1JJHA 3AOCA 2JVOA 2VUGA 1EETA 4I7FB 5H9EK 2XS7A 3IRXB 4B3SF 3M2RA 3CJ4A 3PW5A 1B64A 2EG1A 4I0WA 4DZ6A 3O5TB 2W7PA 1UVJA 2A2CA 2OJ3A 2J9DA 3AHPA 2CZ9A 3C16A 3LAMA 2K7JA 3HHEA 4FBUA 1WF0A 2WTFA 4USMA 2E7VA 4KFBA 1R8AA 4HI2A 4ETZA 4OV1A 1A6LA 3SEOA 1KHWA 1NDCA 4ECRA 3C46A 1N32F 4JYAJ 1RQ0A 3MR3A 4FXDA 5HJYA 4OLOA 1F9EB 3NOGA 1U26A 3VGSA 2B51A 3WBZA 3MAAA 3TAMA 1XNQF 2DH8A 4WBFA 3I5BA 3BGRB 5CZVA 1CULA 1Q8KA 2FDNA 3MCOA 3MGJA 2C22A 1QAIA 4ELVA 2E66A 5KFHA 2Y1JA 1JMTA 1H0HB 1WKJA 2CPHA 4PXEA 3M05A 3W62A 7FD1A 4DV4J 2APOA 1BXNA 4OZ3A 1RTJA 2QJ3A 3W5YA 1MNEA 2H51B 3MMCA 5IM0B 1RU1A 2WOMB 3CXCR 4J9SA 5KAKA 1ZYQA 1YX2A 1VIOA 4IG3A 3FK4A 1R7IA 3QAUA 3UCZP 2DYAA 2G4BA 4G1QA 2MLXA 2ZC4A 1VQNS 4XO0A 4N8NA 3DU6A 1RHJB 1NH8A 1Q95G 2YQ0A 5SUHA 5JXSA 3W65A 5HROB 3CCWA 3BKTA 4U6PA 5L9XA 3L3CA 4X2BA 2V4JB 3QLHA 1KLMB 3KK2A 2PEHA 4RBUA 4QR1A 2NUHA 3DNCA 3TA1A 4DSKA 1BMQB 5LMUJ 1OYDA 1ZM4A 3MM8B 2QLWA 3S1TA 4F4ZA 3S8SA 2X3GA 2PD1A 3T5KA 3HVTA 2HURA 2LQ8A 2AV5A 2D3ZA 2RQKA 4H4MA 5KG6A 3OVSA 1X5SA 3B4DA 1HBOB 4DX6A 3POTB 4TU8A 3MPYA 4K4VA 2YBVA 2J9CA 3UCGA 1RB0A 4TN2A 3FBBA 3VZHA 3PDNA 3LALA 2O66A 5KT2A 1R8CA 1S4FA 2ATCB 4QWDA 2RS2A 4UOFA 3POTA 2M70A 5ETOA 1FE4A 3LP2A 4DN0A 1VQ5S 2MB0B 1V9OA 4B3MF 1NH7A 2W4CA 3MHYA 3NWRA 4DUTA 1Y4ZB 4UT4A 2K8GA 3TA0A 2EK6A 2QYCA 1CS4A 5KFMA 2UXCF 1Y11A 1UCNA 1YVFA 1QUPA 2NSCA 2RH3A 1WC1A 2VDHA 4GKKF 2B4OA 1KLMA 2V69A 2FZKB 1RACB 5A0YB 5KT3A 2DO0A 3KK2B 3KMQA 2VOPA 2HHUA 2ILYA 4G6VB 1OPIA 1CSJA 4OX8A 4O3PA 2BDPA 3HK2A 1BY9A 1KDNA 2W8LA 4DR7F 3PO5A 2CNKB 4N41A 3HMJG 2VFSA 3VWSA 1VJWA 2IPOB 3W2VB 2D9PA 1OQ6A 3DOKB 4P2SA 5F3TA 3CCLS 5J1PA 2BKOA 1XMOJ 1HI8A 4LIWA 4Y2AA 1FKPA 3D6HB 3KWMA 2VG6B 1X4EA 4P74A 5L38A 5ETPA 1DLOB 1NK9A 1N36F 3AJ1A 1YJWS 1KWMA 1P9YA 3W60A 2MGZB 4JB8B 3NMAA 1Q82T 3MAQA 3CJ8A 1F3FA 2BKPA 4RNOA 4DF4A 3G87A 1SJ4P 4DSFA 2DO4A 2FJAB 4M5DA 4UOHA 2P5VA 2AEFA 1H7WA 1MROA 2HHWA 4OYAA 4TXSA 2CQBA 5C24A 4NWBA 3SFGA 4Y2CA 1RYRA 3ITHB 2BQ3A 1QSYA 4OX6A 2UU9J 2ZJRQ 5CQGA 3BS9A 4HL9A 1IKXA 3NLCA 3T1HJ 1HYSA 1ZPVA 1NHUA 2KXFA 2ZC3A 3AXMA 2YVSA 1YJRA 1CG2A 1U24A 3HX9A 3Q8YA 4HHHA 3DM2B 4UZCA 4YQWA 4DUYJ 5KFQA 3J81Y 4ZITA 1S1VB 1I94J 4KAIA 1IKVB 4W98A 4EUVA 4NLGA 1QAYA 5CYJA 3PR5B 4QZVB 2FLOA 2J6TA 3H90A 2DH7A 3T3FA 3ZZPA 4AL7A 1VBZA 1DQAA 1WTFA 3UN3A 1UVIA 1VI7A 2JVRA 1UFLA 4WFZA 2PO4A 1RP5A 1UPPA 3K8WA 4HVZA 5DGBA 4PG8A 2VC0A 1IM4A 1H2TZ 2B7CB 2O1PA 2Z2ZA 3ZZZA 3HHNB 3ENQA 3RBZA 2BMBA 3ZTOA 4B3SJ 3OTBA 4LBPA 3I0SB 4ICLA 4ZPWR 1WACA 2B5JB 3ZZOA 1JWWA 1NJXA 4ZS6A 1YQHA 4A8OA 1BQMB 1R8PA 2MJNA 1RHQB 2MHEA 2VBYA 2B8PA 1LW2A 3A13A 2E1RA 4XTTA 2H1YA 3R5DA 1TKZA 3MUTP 1GMUA 1X5PA 1Y5NB 3FBFA 4O44A 4DPTA 3OVAA 3N79A 2J9EA 1REVA 2W1BA 5HVHA 4DR1F 1KRPA 2UVVA 4LQ3A 3CVKA 2YKMB 4Q2LA 4CLPA 1RKJA 2HGNA 2OLWA 2JL9A 1WOPA 2R8JA 3G9CA 2YQ3A 3CDBA 3Q24A 1QAJA 2OEMA 2BVZA 4IH6A 3GIRA 4M5KA 2XC9A 1FKAF 2W4DA 1KR4A 2VD3A 4LF4J 5HBMB 1UJ4A 4DI6A 1AA1B 4CYUA 4Y00A 3OXLA 3DU5A 2LDIA 3W61A 3DLBA 4BHQA 4PQUB 1NMEB 3VTIA 2GFFA 4DL6A 2HQFA 1CC7A 2R7VA 2HHXA 1DHMA 3E8OA 4C8ZA 1LK5A 2W25A 2GHWA 2R8GA 3HSDA 4GC6A 2UVWA 2VG6A 4UW2A 1KLNA 3AOBA 3EJMA 1C1CB 4FS1A 4R8UB 3RBDA 2R3VA 2ZM6F 3I31A 2KM8C 3GYGA 2R7UA 3C2PA 2Y1IA 2AGQA 1N6QA 4DCOB 5HQMA 4HLBA 7FDRA 2HIYA 3NGUA 5K5MA 4HYKA 3QJJA 2HFZA 3MPDA 3ZNUA 5GADI 2VFRA 2R7WA 1VRUB 1UVMA 3NNAA 5IXUA 2DIVA 2F8HA 2NPFA 2Q6CA 1IKWB 3RGIA 3GYXB 2DITA 1GEHA 3W63A 1HNWJ 4IG0A 4PG6A 2R2TA 4KPYA 2JFDA 5KTQA 4X64F 2DRDA 4C8YA 3H98A 5LOQA 3GFZA 3R5CA 1K44A 4NLXA 4C3MA 5B0FA 5KFRA 1PG5B 1RT5B 4YDDB 3J80U 5L1JA 3T6BA 1AUDA 5KG1A 1WD6A 2V0NA 4Y34A 1SQGA 2KDOA 4R5PB 2C2MB 2UUBF 1VHIA 2ZH8A 2KU7A 2K3IA 2MQOA 4V19X 1Q4RA 1UFWA 2WSCC 4HH0A 2F4FA 1GAOA 4I2QB 2YQ1A 4TLQA 3NL0A 2C3PA 1VQ8S 3C19A 2CQ4A 2U2FA 1HL6A 4USWA 1U7LA 2GX8A 1RTIB 1N0VC 1VQYA 3C6UB 4ID5B 5IQ6A 3TAPA 3L09A 2BRLA 4CO1A 4K4XA 2UXDF 1LOUA 4NI2B 4F8RA 3SSRA 2PC6A 2WVEA 3GWCA 4ZLNA 5T14A 1KVIA 2Z57B 3ETMA 1IJEB 5FDLA 2FJDB 2R8HA 1RT7A 2FTRA 4N77A 4DX5A 2XM3A 4FS2A 1I6JA 2FLNA 4I67A 3DOLA 4WXOA 3TUZC 3K5LA 4NLOA 5K14A 1Q78A 1FFWB 3FNNA 1X4AA 2VJVA 4DG1A 4QYZK 1T95A 1IQTA 5D77A 4Q8FA 3CCQS 3UE2A 3QIDA 4H4KC 4D3HA 3HZEA 1FD2A 2OPSA 2RJZA 4J9MA 1X0FA 2UVRA 1JLBB 2F9DA 3TNVA 3VAGA 2M52A 4QW8A 3BDPA 4LFBF 5E7OB 4I6AA 1U1QA 4IUFA 2YNFB 3P4UB 2CDQA 3JS9A 4WFYA 3CPWR 4Q0BB 2PMHA 3FFIB 4YB7A 3CMAS 1ZZFA 2JWNA 2RRBA 1S6OA 2QGFB 1WEXA 2IIHA 3T9NA 2D41A 3ZTQA 2UUAJ 3K58A 2KG0A 3HSGA 5F8HA 4RW6B 3GFYA 4NLVA 3RW6A 1DTQB 1IBKF 4QIVA 2VG7B 3ENAA 3ET6B 2NQPA 2B9YA 2I2YA 3EX7B 4R0EA 3I4PA 1OMSA 4RU2A 2CPXA 1FESA 1DFDA 5AT1B 4QQBA 2ZH5A 3MMBB 2F5GA 2NYHA 5F3ZA 3N6LA 1FTRA 5J1NA 1IQZA 3ITHA 2B9WA 5KFSA 2VPYB 5IZHA 4MYTA 2LXIA 3EPGA 1KFSA 3PZPA 4QCLA 1FNXH 4LVOP 5CD4A 1A0OB 3DDNA 2J7KA 3GG1A 2DEIA 2EG2A 1DTTA 2AJ2A 3HI9A 2E1AA 4DSEA 1EQMA 3EWGA 4DQQA 3ZZUA 3MM5A 1VOMA 2NPIA 4MKAA 2A2DA 4FYYB 4DSIA 4JI4F 1KVJA 2OPQB 5EGYA 5LMNJ 1KS2A 2QRRA 3S6EA 4BDPA 1RAEB 4RL1A 2FHJA 1U25A 1J27A 4LF6J 3LGMA 1HNVA 4I68A 1C0TB 4IQXA 2HS4A 2XULA 3HT3A 4JI4J 2O5DA 1B7YB 1XIQA 4DG1B 3PACA 4KHRA 1O5JA 2ALYB 3IM8A 4DPXA 2N7CA 3CCVS 1FJEB 5HMWA 1FWLA 2E7WA 3W2WA 3CIZA 3AQPA 5J2QA 5J1EB 1SL1A 3HT0A 1CQNA 1FRJA 2EWHA 2ASLA 3BQ2A 2KH9A 3CC2S 3K8VA 3EGNA 1N8RT 3UDCA 1TKDA 4EZ9A 2HHSA 4F3QA 3EDQB 5E3CA 3K7RA 2UV8A 2E29A 3MM9B 1PGZA 3SCJE 4B9SA 2VBXA 1AZSA 5LSRA 3I0RB 4OYOA 2DTJA 2OMLA 3PHEA 3D67A 4PAAA 5EDWA 4YR0A 2ERRA 2WSFC 1CEZA 5IT9Y 4F50A 4KH1B 1LWFA 1HQ2A 2J7UA 3FMWA 3TZWA 1RT6B 2R2RA 2A10A 2HVEA 2HHTA 1HHSA 4GKKJ 3TQ1A 3EVMA 4DHVA 1PAUB 4ZJQA 1KQSR 2WONA 4P73A 1OO0B 1VQ9S 4C8KA 3HFZB 3M8YA 3M8RA 4OX7A 1MG7A 2ZVIA 3MCNA 3R8YA 2RQMA 4MIWA 5HMZA 3KLGA 1EZZB 2CDRB 4NLRA 1D1UA 2NXJA 2AJ1A 5D15A 5KT6A 2DB1A 3OJUA 1KD1T 1S6PA 3H42A 4XIUA 3CC4S 1N32J 3J7Z5 2CXEA 4IFYB 3N5BA 4YMEA 5ETQA 3JSMB 1KHVA 3FZ2A 3EE3A 1S4EA 3ISZA 3QLHB 4OV6A 2AYMA 2PEBA 3WHIA 2E5JA 3KLIA 2F8MA 3WIUA 1P27B 3PRDA 2KN4A 2GO9A 4OYWA 5CAAA 1VQOS 1UVLA 4LSNA 3GCXP 2HLTA 1H72C 3O1LA 1OWXA 3R5GA 1SJRA 5D3GB 1Q5VA 1JXLA 3PY8A 2P6TA 2HS3A 3N28A 4Y0FA 1RTZA 1TELA 1SJ3P 2AMCB 2ROEA 1UL3A 2P9GA 3EZOA 2AF6A 2G0JA 1TV6B 2MKHA 1NRKA 5IM0A 5GAEU 5AJ3F 4X64J 3C66A 4HH1A 2Z2MA 4RX6A 3H5SA 1BUXA 2G0CA 3HDSA 3OLBA 2CYYA 1DAXA 4DX8H 4NYOA 2MY8A 1U0HA 3OJSA 1V3ZA 4IQMA 3QATA 4NZ6A 1DLOA 2CG4A 1TZ0A 1J5EJ 1TAQA 1N5VA 3AD7C 4QJVA 1MSWD 2YPZA 3BGFA 1S49A 1JNZB 3VHQA 5A8WB 4OZ1A 4LR7A 1XC9A 2EFQA 2YKNA 3A1YG 2NCKL 2HK2A 2MZJA 3CO9A 4I2PB 4CDIA 3VAHA 1GXUA 1T02A 2DY1A 3OFHA 2XMTA 4OX9J 4JI2F 2OO4A 4JV5J 3H4BA 3BGOP 1A7GE 2AEMA 4RW6A 1N48A 4DFJA 1RAIB 2DXEA 5CYMA 3V6DA 5EX0A 5LJ3Y 1RT6A 1NK8A 1RAOA 1TL7A 1FT8A 5KT5A 4DR3J 4P72A 3TWZA 1HBNB 2RIJA 4Q8EA 3U1LA 1HD1A 4F2SA 4XDDA 2GW8A 2IAJB 5LM7E 5CD4H 2W9BB 1Y0HA 4JI6F 2AWZA 3OL8A 1TL7B 2BKNA 3CE8A 2HEKA 4EEYA 4DU7A 1IKYA 2VICA 1U8WA 4F36A 2KJWA 3FRYA 3DLGA 3QWUA 2UVUA 4YR2A 2MSSA 3CEDA 4HT7A 4RW4B 1FDAA 4ZIVA 4NEYA 2A6MA 2JH3A 4AXIA 3OTCA 4F3MA 3OR1B 4ZVGA 3VR1A 2DH9A 1ELOA 4JP8A 3VAJA 4HR2A 3LGNA 1YIJS 1HWIA 1NDLA 3N01A 2EI5A 1H2VZ 4CLYA 5DJBA 4NLDA 3FEXB 4YUDA 2CJAA 2WZ1A 3GIIA 2ASYA 3DYAA 3RU0A 3HVRA 1TFYA 1SBRA 1R0CB 2NREA 3MR6A 3NWGA 1S76D 5FD1A 3D3CJ 4O3OA 1YRTA 2DR5A 1ZAXA 4BC9A 3RRHA 2PI5A 3DOMA 3JTNA 3GONA 4KIAA 4YY3F 2UUAF 2L9WA 1FNOA 1MU2A 4WXWA 4MJKA 1S1XA 1X31C 1UTAA 3EMTA 1DRZA 4TNOA 3OFEA 4A46A 3MM6A 2RHQB 5F41A 4E98A 3KK1A 4LBHA 1NB7A 1ICEB 1MWQA 4F0HA 4ELTA 3PYGA 4ZJOA 2QN6B 4LBIA 4ED7A 3TANA 2HHVA 1KN6A 3TR5A 4O3SA 1VQPS 2ZH9A 1X5OA 1LXJA 1SPBP 2QL9B 5GVQA 1T8EA 3BGRA 1UVNA 1BWEA 1YSJA 4MFBB 4DXLA 5MLCV 2VFVA 1BGXT 3Q89A 3MI7X 1F2HA 5CABA 4JI0J 1HYSB 4NXNJ 4M5LA 2FJWA 3DRPA 3E51A 3TP2A 4K0KJ 5HSPA 1T94A 2EC0A 5DQHA 1VBKA 2Z0GA 1EP4B 2Q3PA 4IOBA 3T9ZA 1YJNS 4YEAA 1L3TA 8AT1B 4PG4A 4DL2A 3PW4A 2DGSA 2NZ4A 2B9EA 4YOEA 2DHGA 2IYIA 4G1PA 4ZVUB 1GX5A 5BJRA 3HVWA 4AD6A 1M1KT 5EHHA 1VLOA 1JJCB 4I69A 3W66A 4F04B 2D3OR 1HKAA 3H2UB 3G82B 3KG0A 4USIA 4U67Q 4LF7J 4DF8A 3GIKA 2JEGA 3A8EA 3BR8A 2XO7A 1FERA 3SIPB 2V8DA 5C42A 1WOOA 5KG0A 4DV2F 1U45A 3W8PA 5D8HB 2E1PA 1YBUA 3JAMU 2RU9A 4TU7A 1QE1B 4KHMA 3TEHB 1ZM2A 2ATLA 4ZLJA 2KO1A 1CQMA 2BEFA 1EHWA 2YNGB 4C6AA 4IR1A 3MM7A 1JXVA 1OY9A 2IC3B 5AE1A 1HLWA 2MKYA 3BYRA 2BX6A 5FLXU 4H4MB 2XSJB 4PCQA 3KKFA 4B17A 1K1QA 3KG1A 3MMJA 1D9AA 4WF9Q 1VQSA 4B3TJ 1RAFB 3KYLA 2ZOGA 3WC0A 5J1EA 3H2VE 2VBWA 1YRXA 2KXHA 4EMDA 4QW9A 4F4AA 2C1EB 2L3MA 4MTPA 2YXLA 2XTJP 4USUA 4DR6J 1FDBA 3IR6B 4ES1A 1AFIA 1NPRA 1CLFA 1S1TA 2V9KA 1RLCL 4ZP9A 2B0GA 4DV3F 4F3OA 1GMVA 4ENOA 4ICLB 3HPOA 3TOQA 1JLEB 2L08A 4OFZA 2VHGA 4NLTA 3Q22A 4RW7B 2GIQA 4F0MA 4ZCMA 2OSRA 2BJDA 3TVYA 4TY9A 1DZ5A 4UF4A 5HVFA 4R5PA 1TKTB 2WSEC 4Y3CA 3WZ0A 3D0IE 1RT5A 1VFJA 5RUBA 1C1BA 1FRXA 1U2CA 2MQLA 3D6MB 4YY3J 1VRQC 2I5JA 2AGOA 1W25A 2VKZG 4TYAA 5F8IA 1IM6A 2CQ1A 3R1HA 4O0IA 1SB6A 5CA5A 4FF4A 4YR3A 1V6HA 4ZMMA 1Q7YT 1JKHB 2BABA 2VOOA 3FRZA 2F1FA 4DBQA 4K4TA 2IYGA 2QYGA 3UR3C 4WFAQ 2F8EX 5LSLA 3MURP 1RSCA 1GXTA 3DOLB 3LO3A 4LQ9A 2RB7A 3DLEB 4LSLA 5BYQA 3RZAA 3NXZA 4DR4F 1BD6A 3IWNC 2FUG9 3GTYX 2V8VA 2YNHA 3VGVA 3KLEA 5C5JA 1TTHB 4U7UD 1WF1A 1M90T 2QMWA 3IP0A 2KYXA 3EVWA 3IRXA 1T9WA 1SV5A 4DR6F 4NCAA 2XCAA 2GHPA 4CP5A 2LLZA 3OV7A 4R0JA 1M5VC 4Q0BA 2HPUA 3DMJB 1WKLA 1G6BA 1JIHA 4OI0A 2HBQB 2HVHA 1FA0A 4CIOA 1I51B 1YJTA 2DNKA 4TLRA 1VS3A 2EFGA 4LF9F 1VYAA 3A4TA 3M30B 3KMSA 5EX3A 2H9ZA 3RJMB 5J2MB 4KTQA 1HR0F 2UUBJ 2OTJS 4FKXA 1UEVA 1HBOA 4CO0A 3VQSA 3G8SA 3THVA 2FVCA 1F5AA 3D1QA 4FXVA 1V5IB 2FQQB 4OJGA 2ZHAA 2K2PA 4DPUA 4ER8A 4X4TA 2CJQA 3MWBA 2XZWA 4Y65A 5L39A 2QE5A 4WYWA 5KFIA 4OQJA 2A18A 2FB0A 4EZ6A 2IRUA 2DNYA 1FWKA 2BXJA 4PWWA 4USJC 2BE2A 1DJ0A 2ADCA 2F3JA 2MJUA 1NZAA 2LFVA 2QA4S 3DI6B 1DQ9A 4Z37A 1C1BB 2R7QA 4LRDA 1R6VA 5KFGA 1SL2A 5DDPC 2AX0A 1E6YB 2XQCA 4FYXB 2ZZMA 2C3YA 3LUYA 2JJ4D 4GC7A 1IWAA 3Q8VA 2OMOA 1LWFB 4CNYA 1QTMA 3E01B 1WF2A 2VB6A 3QGGA 3ZO7A 3PCOB 2MQNA 2RILA 2QX0A 3I32A 2V50A 2CQ0A 4PWDA 4LFAF 1C0UA 4C8NA 5DETA 2GNKA 4Y2MA 1HQUB 3MM9A 5GAGU 4PWUA 5E33A 4Q5VA 3CCTA 3M9NB 3IRWP 2QG9B 3QZ8A 4WU3A 3V6HA 1VQMS 2MZQA 4RNMA 1WSVA 3QRQA 4NX9A 4QIGA 1VR6A 2XBPA 3FC9A 3J7ZT 4DV3J 4CM2A 4KY3A 3QZ7A 3OSNA 1VQ7S 1GMWA 2LEPA 2M0GB 4IR9A 4S0MA 4JI7J 1KSPA 2IHR1 5KFFA 1ZM9A 3MEDB 1MROB 2OUGA 5I4MA 2WVFA 4NCGB 2J0QD 3WX8A 2Y8YA 1IBLJ 2XLJA 1EX8A 1RT1B 3M9MB 4KGZB 4MMOA 1R31A 3L7OA 1Q81T 2ASDA 3KLVA 3CCES 3NOCA 2FC8A 2QTWA 2JZ5A 2H4WB 1KOOA 3AA8A 2NXCA 1QSLA 1B7FA 3MM6B 2J9DE 4KPCA 3SDEA 1D9FA 1KNZA 1NJZA 4PQUA 2UXDJ 1ZAVA 1K47A 2DNZA 2ALZA 2H5EA 3MCSA 4OYBA 2JC1A 1HWLA 2VL1A 4GVBA 1XQIA 4F0KA 5I3QA 3GE9A 2EVZA 1FRLA 3EYZA 2NSBA 1S1WA 5GAHU 4CT9A 3H4DA 4RUBA 1SKWA 4Z2XA 4DV0J 3RAXA 1FVQA 2HFVA 4DV5F 4WP3A 4W92B 4YB1P 3OTOF 3MMAB 1N33F 1FO1A 2BA9A 3FBCA 1Z4UA 4UQTA 4K2XA 4ZHRB 2KXNB 2CJBA 2YX4A 2AQ4A 4JI2J 3M7VA 4OI2A 5A2QY 2X1AA 3R7NB 1T0TV 3Q8RB 1S77D 1FFGB 1TL1A 1VK8A 1T3NA 4U95A 1HNZJ 5CHCB 1RBLA 3EPIA 3OTOJ 3V81B 2M8HA 3ZTRA 2CAJA 1SJFA 4O3RA 3FMBA 2M3DA 4JV1A 2ADBA 1R6YA 3QWPA 1KTVA 1X8DA 4J5OA 4L3NA 2FVRA 2F4VJ 2PFFB 1S9GA 1M5HA 3M4XA 3W64A 3HXMA 3FCWA 3CF5Q 2GVDA 2HGLA 2MKIA 1PJ7A 4QBUA 4I1TA 3B78A 4L75A 1MU2B 3PJXA 5I42A 4J7CA 2W9BA 9ATCB 1RAJA 1TUWA 4QIEA 4ECXA 1HBMA 2YWKA 1OIAA 2QFIA 4ECQA 1IR1A 4D3GA 3ZZTA 5B7WA 3G6VA 4QR2A 2J76E 5L1IA 4DV4F 4FF1A 2E9RX 2HWTA 2R7SA 3MM8A 4WK1A 3MDFA 1JLBA 3MD1A 1O51A 2ZDPA 2RDDA 3M2VA 3NBPB 4FPRA 3D28A 3SBMA 2R8IA 2DNRA 1RYSA 1F3VA 2EC2A 2NXUA 4MT1A 3T1AA 3B8HA 1JLQA 2XY5A 4ZLPA 3D6TB 2H65B 1JLCB 3QYYA 4MIBA 1J5OB 1NSPA 2CWXA 3KFWX 3RBXA 4EBCA 3CSKA 2VG7A 2HNZA 1VHFA 2E5GA 2FJBB 4C2MA 4NLUA 2VODA 3HHKA 4JI8F 8RUCA 4DL5A 1LXNA 2VG5B 3D1HA 4FYWB 5HMXA 2HHPA 3C14B 3M8ZA 3RB0A 3CJ2A 1U09A 1JB0C 5B0DA 4ECYA 3FBEA 5LMUF 3W8GA 3LP2B 1VMBA 3G6YA 4NZ7A 3TJAA 4KGMA 2YNFA 3NGTA 3J81j 3A8IA 1TMJA 3EZUA 1GTEA 3G2XA 1Q8BA 4DV5J 1RWMB 2LDYA 1TK0A 2DNLA 3BPSP 1M5OC 2K3KA 2KT5A 2CJXB 3IM9A 3VGTA 3VAIA 2GHVC 4OJ3A 2WVBA 4PR6A 1F6TA 3V81A 4WIIA 4PG7A 1R89A 2JC0A 2AD9A 1WG1A 3I6PA 5B08A 2ZH1A 3C6TA 5M2PA 3N4WA 1NKEA 4FNIA 5EWFA 4LF7F 4QYZJ 4PYAA 5D78A 3OHBA 1N5TA 2NXEA 4ETXA 3QGHA 4M5HA 4TY8B 2CJ9A 3JSBA 2HFUA 3CD0A 3U1MA 1NEEA 5CYQB 4N76A 2XYPB 1OSCA 2WHOA 3BKUA 3IAM9 3NGRA 4RZRA 1S0VA 4AL5A 5DDRC 1Q86T 1M5SA 1VISA 4Y6IA 3T5HA 5IWAF 2YNGA 1N34J 3PM9A 1TKTA 3N5FA 1TV6A 3B54A 4ED2A 3QMQA 4K5RA 2W2OP 5LXRA 4OHZA 2KFYA 1SCJB 1X60A 4ED1A 3KJFB 2DR6A 2BJ8A 4CRJA 3X1LB 4G65A 4A8KA 5F8LA 1VLYA 3CCRS 4EYIB 2VF3A 4OIXA 1Q8LA 4NCGA 1MN9A 4MK8A 4KV8A 3KJVA 1HW8A 3MAHA 4AE5A 3BJYA 1FX2A 4MK9A 2MQMA 2Z4PA 3LW5C 4RWXA 2RD5C 5AE3A 3H8YA 3BSOA 4G3IA 2VKRA 1WC5A 5AE2A 1EP4A 3W1YC 3HF5A 4QOTA 4ZVRB 4TQSA 5HROA 3GIMA 3SV4A 2YWWA 4JI1F 3RW7A 4M1KA 4RBVA 3DGPB 5KFUA 4RUCA 3V6KA 1M5PC 2E5IA 1T11A 3V2UC 2F40A 5HL7Q 3RUBL 1Z2ZA 3PNIA 1L3KA 3OLAA 2WOMA 1FEEA 3MMCB 4OX9F 1YK9A 3SZ2A 1L5UA 1ZBTA 2WW4A 2XMWA 3I0RA 3M2UA 1GH8A 1RT4A 3QO9B 1ULRA 3N0VA 3NGSA 4XAKA 1RBAA 4JUZA 2WB1D 4QU6A 1U48A 1HNIB 1WHWA 3MAAB 3TAMB 2RSQA 2V8HA 3DI6A 3MCMA 3OR2B 1FDNA 1YKWA 1WG5A 1AROP 3ZZ0A 2C2ZB 4FPIA 3ENWA 4CH1A 2AJQA 2YKMA 4C97A 3BV8A 1FVSA 3K5MA 4F2RA 1RU2A 3IN5A 3ZZRA 2LMIA 2KRBA 2WAQD 3GV8B 1ZTWA 1X9MA 1OPZA 2D9OA 2IJFA 1YZ6A 4JI5F 1S7IA 2KVQE 4GKJF 3C16B 4J9UE 2PA8D 6FDRA 4CLLA 1KBRA 2EFOA 5B09A 3R5BA 4ED4A 2DNOA 4M5JA 3ONQA 2BOPA 1C2PA 4UY8T 1L3UA 2DCUB 2M8DB 5HVGA 4B3OA 3H59A 3H40A 2QSWA 3J80Y 3V5RA 2CPEA 1X5TA 2ZZTA 4UUWA 3DXSX 2MZSA 4IKAA 2NUUG 3DMJA 2JFKA 2JNJA 3DN9A 3T5JA 5KFAA 1U1OA 2VPWB 2HNDA 2HRTA 3CO0P 2RUGA 5J2NB 3UWTA 1HD0A 3OQ2A 4HTJA 4RW9A 4CI0B 2F4VF 1P8GA 5ETMA 4DCJB 3D4JA 1F5CA 2EPIA 3O2IA 3A12A 1XK8A 2MEWA 1IKVA 2X1FA 1QY7A 1FK9A 1GQEA 3GJSB 5B0GA 3GILA 1FTCA 3FJ2A 3HD1A 2ZH6A 2EFPA 2GCFA 3KTQA 1FJGF 1RAAB 3DGPA 3HP6A 3KLFA 4BCAA 4A8WA 1KQGB 2RAQA 2RKIA 3NCRA 4P10A 1QSSA 3R6LB 4PABA 2YKNB 3L4BC 3I5CA 3MFHA 2HFSA 4NXNF 1SJQA 1HNXJ 3EGWB 3K0JA 4A8FA 3DLGB 1R43A 1N34F 3F0NA 4K4ZA 1NSAA 4PKDB 4DLGA 1NJYA 2CIMA 2JLFA 2HNYA 3K5PA 5HJXA 4DDFA 2V8GA 4I6WA 1HNIA 4KE5A 4KSEB 4ILRA 4NE9C 4URSA 5IV3A 4QYRA 1LWCB 1UA1A 1RA7A 4RNHA 4WYLA 5KFDA 4DUZJ 5A6WA 4O0NA 4NASA 5KFEA 3HKZD 4RU9A 1K8AT 3ZTSA 4QIFA 1UW9A 1R0AB 4V19J 1ZM3A 3BREA 4B9NA 3GYNA 3MF5A 4DS5A 4ZIWA 2KT3A 2C2RA 1R3NA 1WKKA 4WJBA 4ZVQB 4C0HA 2VV5A 4J9LA 3BO2A 2RDIA 3PHTA 2YPYA
chains in the Genus database with same CATH topology
3CJKA 1SJ1A 2ILZA 1XNRF 1FD8A 5BYSA 3NAHA 4MAKA 4FVCA 2ZFHA 1YJ9S 2J0XA 3JSMA 2GMHA 1FRIA 1GXLA 4ILLA 4J9PA 3D0GE 2HRUA 3ISNC 4Q45A 3M8PB 2E5HA 1QM9A 2VH7A 3M9OB 2WBRA 4DN9A 2DNNA 4DL4A 1LWEB 2R7XA 2UP1A 4JV2A 4OI1A 2I1RA 4DOZA 2Q6BA 1N5SA 5CCLA 5GAGI 2JX2A 4LF6F 2BQUA 1HPZA 1RT3B 2CQHA 1T05B 1WELA 1UJ5A 5KFXA 4NPOA 2FHJD 2G9OA 3HKWA 5DRKA 2PI4A 4QWEA 1S1TB 5E3RA 4CH7A 2R7TA 4ZA1A 5DLGA 4ID8A 5HLFA 2R9LA 4WFBQ 1AXQA 4DFPA 3RB4A 2ZH3A 3GR1A 1BQNA 1IUJA 2OPRB 4AUKA 3GV7B 1UJ6A 2XWXA 1G3OA 3ISND 4CH0S 2W9AA 3GFXA 4ZOSA 4ES2A 4M94A 3SSSA 4LJMA 2RNEA 4F4KA 2HFNA 3MECA 1C0UB 2M9KA 3QIPA 2DK2A 3MEGB 5THWA 3P3DA 4URGA 5E3AA 1NU4A 4KT0C 4K4UA 3MR5A 2V4RA 2CQIA 4F4WA 4WE1A 1NK7A 5CCMA 2D74B 2AJ0A 4ZP7A 2LQJA 3BGLA 4NYPA 2XLKA 3G8TA 4LVNP 2QV6A 4O23A 3W3SA 4WZMA 3NCPA 3H2LA 4P7TA 2MZTA 4DQPA 3OTEA 1U1KA 3MOZA 2DT9A 4BWMA 2KHDA 4J9OA 4NCBA 3G6XA 1NK6A 5ITHA 1ZTTA 2DGOA 2HAIA 4Y28C 1SC6A 3MR2A 3M30A 4RW9B 5JUMA 1NKCA 3IO1A 2DPJA 1H6KX 2RS8A 2ZNZA 3V4IB 1E6YA 3TUJC 4BC7A 2QLXA 1TL3A 1OSDA 2DGVA 2GV1A 3BF4A 4O3QA 2HQ3A 4B08A 2D3UA 2POKA 2AYGA 2BR0A 5B0EA 1RT1A 5T7LB 4C8LA 1TQLA 3DOKA 1VQLS 1U6FA 4ZVHA 4GO7X 4JOUA 3KK3A 3MEEB 3OR1A 4PUOA 1JKHA 1H98A 5CZXA 3AY0A 1N5QA 5J2MA 5HLFB 1RT2B 3B82A 1S1WB 4GMKA 2FHMA 5GMKa 2OFGX 5B0CA 3FCHA 6FD1A 3OHAA 3DRXA 1QUVA 4CO3A 1UW4A 3PJWA 2MKJA 2DISA 3IXQA 4UQGA 2FVPA 3P5TL 3HZGA 4O3NA 1SKSA 4ILMA 4ECZA 1F5BA 1HPZB 3D2WA 2LCWA 3UD3P 3DRSB 3NG8A 2GQQA 3W7BA 5KFPA 4OHYA 3Q8PB 3MECB 2FLLA 1GTHA 2OPSB 3PRBA 3FDSA 4ZVEA 1U2RA 3TUIC 2MQPA 1LFWA 3H5YA 2F7VA 2OPPB 2DCLA 1X4CA 2HNZB 3EXYA 3O3LA 5HI7A 1LKZA 1YGYA 1HWJA 2B43A 2PDAA 2ZE2A 3MEDA 5AXLA 4ED0A 4U9RA 3CMES 2DJWA 1TR0A 3DYAB 4LIRA 1RT7B 3TVKA 2ROGA 2C3MA 1H7XA 1HW9A 2I8EA 3CCUS 3BEGB 1L3VA 1S10A 4WTYA 4JV0A 4EFAC 3BO4A 1TK5A 3BSCA 3LOUA 3G6ES 1FJCA 1HQUA 4G1QB 3DHXA 2C2EA 5FLXY 2LU1A 4RUHA 2QMXA 3MM7B 3GIJA 5AXMA 2ZHBA 3QGIA 3NS6A 2CVIA 4J37A 4HT5A 1DQ8A 2ROPA 2VZ9A 4ES3A 1CVJA 3M6WA 2DNGA 5C42B 4X4SA 3GB0A 3TARA 4ZP6A 2GIRA 4DMZA 3R27A 2IVFB 4K0KF 5K9FA 3SSQA 4LSNB 2I0XA 3DLKB 2Q66A 2IM3A 2X1GA 2OKQA 3TW0A 4IDKB 2RVJA 3OVBA 4EWTA 3UQSA 4ZPBA 2N4CA 4IG3B 2VFTA 2CQCA 1CC8A 4K59A 3LP0A 2HVZA 2BUNA 3CDAA 1RTHA 1JXEA 5F8MA 4DS4A 2CQDA 3M1VB 2YKAA 2HGMA 1JLGB 4KGKA 3NP5A 4MKYA 2KFZA 5KFNA 4X4UA 1IXKA 3H5XA 5G0RA 4DJBA 1URRA 4K5SA 2XMKA 2IVYA 2FLPA 2BBEA 2FC9A 2MPUA 2B56A 2FHOB 2OD4A 4IO9Q 2LECA 1HNWF 3RB6A 2AX1A 1WEYA 3V4MA 5KFTA 5FIIA 1VRTA 4OJ1A 1X4GA 2KVIA 3VAMA 2WK4A 5KG5A 4DLEA 3H20A 5G4DA 4ZPDA 3H5UA 4XPCA 5H9FJ 3IGVA 3DFEA 2XSJA 2V94A 3TAQA 4RKUC 5F0WA 2B4UA 4ZCLA 4OLPA 1RA6A 2GQCA 4C3LA 3PVXA 2DR9A 2BANB 3J7YU 1PC5A 1YWXA 3GG0A 2XCPA 3GV5B 2UXBF 2P9EA 3CDUA 1HHTP 3SFUA 2ASJA 1F60B 2AJFE 2MKSA 4FBTA 5KFKA 1JLFB 5LMNF 1G2EA 5K14B 3FGVA 1V3RA 1U2FA 1APSA 2HMIB 3K5NA 2M5YA 1ZOTA 2BM1A 4CTAA 2KKHA 1S9FA 1TK8A 4CNZA 3RRGA 4R25A 1JNRB 4IH5A 3RRKA 5GAEI 3OR2A 1O8BA 2CPZA 4CT8A 3G71S 2KRRA 2RRAA 1XN9A 1H2UX 2IA6A 4QU7A 1VBYA 1IQTA 5SZTA 5G0RB 5HQ8A 2O67A 2VASA 1WI8A 2MQQA 3ZFVA 3AJ2A 2YNIB 2XY7A 3M32B 3M8QB 2MGZA 2CPYA 2PE8A 2KI2A 1FKPB 1TP7A 1AFJA 2FGCA 3RAMA 3MUVP 4C0BA 1RTDA 4NLQA 3HVTB 4LSLB 4DSJA 4DV1F 2COLA 1P1LA 3CCMS 3KLIB 1N88A 4QWAA 2X51A 4Q43A 5FDLB 1HQEB 4M8LA 3CDWA 5DQIA 2AJ4A 3CUNA 1S9EB 3CJKB 2LQ5A 2XEXA 1H38A 5F0UA 4OZ5A 4F25A 4ZCIA 4C11A 1PC4A 3IS9B 3H25A 2QA4G 4ECSA 1S72S 3PR4A 3IBWA 2N7YA 1T3OA 3AB2B 1S1UB 2WCXA 2YWGA 2KB2A 2YWFA 2D3OR 1LW0A 3VQTA 4O3RA 1W2IA 1GH8A 2D7SA 2DGWA 3OFFA 1RTJB 4NYZA 4X4PA 2GGPA 4W90B 3IS9A 5DDOC 1YTYA 1F2GA 4NA1A 1JLEA 4DEZA 2JLEA 1HBNA 2J6SA 3PKYA 3N6MA 1YG0A 1Y5IB 5EN1A 2R8KA 4G1IA 3D0HE 2BZ2A 5KFLA 3MD3A 4ZDNA 3DDKA 4NLYA 2R7RA 5LJ5Y 5KG2A 3NCQA 1JLAA 3MEEA 3R5AA 3BSNA 1JLCA 1J5OA 2HYIB 2IM0A 2E9ZA 5D4OA 1DURA 2OPPA 1SUQB 2BYCA 3MTJA 5CH7B 5KFYA 1HNVB 3BDEA 3CWJA 2RQ4A 4O4GA 3OTDA 1U1PA 4AYBD 2JLGA 5F8JA 2LU2A 3JYTB 1WG4A 1EETB 3I9ZA 2YWEA 4I7FA 4EBDA 4ECUA 4H54A 4OI4A 4DFKA 3UD4P 5IT4A 2GMLA 4I2QA 2IBKA 1Z2LA 3I5AA 1UWBB 3Q2SC 3QJLA 1TL4A 5I42B 1GT8A 2VA3A 3MXHP 2L48A 3BSAA 2BV3A 1S9GB 3KLEB 5DG7A 3OSPA 3BN4A 3Q0AA 3GMGA 3I9V9 4LUBA 5L9NA 4UY85 1L3SA 4RWWA 3FZBA 4F26A 3KK3B 4WZQA 1IBLF 2OTLS 4ZPTR 1XR7A 2VPXB 4U7UK 3OUYA 2YWHA 2W9CA 4MFBA 4X84A 1VGYA 1LV5A 1R8BA 3OPKA 2FIUA 3M2RB 2AP6A 2PN6A 3IG1A 2AW0A 2QEXS 2YX7A 4E8UA 4M5DB 5M2UA 2DBBA 1KC8T 2N3OA 1S0OA 1UWBA 1KONA 3KLHB 2HWIA 1YRUA 2DHSA 3US5A 3IG1B 1RJJA 3NGDA 5KFZA 4K4YA 5H9EJ 3UR0A 1NJWA 1Z1ZA 2WRMA 3EXCX 4J9QA 4DV6F 2FJVA 3WDOA 2RMLA 2CPDA 1Q79A 3AB4B 3PO4A 2Z8QA 1IN0A 5IS2A 1HBUA 1QJHA 4IDKA 1BQNB 2KM8B 1TKZB 1KFDA 5B0BA 2YY3A 1NKBA 2ZKUA 3CD7A 1IJFB 3SV3A 3PX6A