3VAQA

Adenosine kinase from schistosoma mansoni in complex with adenosine
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
345
structure length
345
Chain Sequence
DLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAACDLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGDAFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Putative adenosine kinase
total genus 124
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 3vaqA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3vaqA01
5CM5A 3RQHA 4E69A 3HICA 3GO7A 5CGEA 4YL5A 2QHPA 3H74A 1U2XA 3MBHA 3IN1A 3VASA 3GO6A 4XF6A 2HQQA 2PKMA 3KEUA 3B3LA 4C5MA 3B1RA 1JXHA 3B1QA 4K8PA 2R3EA 2A9YA 3IE7A 5B6AA 3RTGA 1UB0A 2V78A 3RTEA 3Q92A 1EKKA 3CQDA 3RS9A 3RSGA 3RTAA 1LIOA 1RFTA 3RU2A 3RY7A 4B8SA 2VARA 2ABSA 4KADA 2PKNA 3EWMA 1YHJA 4LC4A 4B8RA 4DU5A 5C3ZA 5F11A 3RQ5A 5EYNA 1L2LA 4X8FA 2JG1A 5TRWA 3RRJA 4UBEA 3RQ6A 5BYDA 4K9CA 4C5NA 1TZ3A 2YXTA 1JXIA 3K5WA 1V1AA 3RTDA 1GQTA 3GBUA 2F02A 2AJRA 3H49A 3RRFA 3FHXA 1YGJA 3LHXA 3N1CA 1V1SA 3DRWA 3LJSA 3Q1YA 4KANA 3RS8A 3IH0A 3NM3A 3I3YA 4PVVA 5BYFA 3NBVA 3K9EA 3RSQA 3RT9A 3RQ2A 3RQ8A 3UMOA 4E8YA 5BYEA 3NC9A 3NBWA 4EBUA 4LBGA 3RTCA 4XCKA 1LHPA 1TD2A 1UA4A 1LIKA 1RFUA 3RPZA 3NL5A 2XTBA 2I5BA 2C49A 4KALA 2HW1A 2AB8A 3NC2A 4JKSA 4KBEA 3UBOA 1DGMA 3NCAA 3DZVA 2I6AA 1BX4A 3LOOA 2PKFA 4XF7A 4KAHA 2I6BA 2AJPA 4E8ZA 1VK4A 4O1LA 2R3BA 3NM1A 5F0ZA 3HYOA 1EKQA 3B1PA 2DDMA 3JULA 1KYHA 3RQQA 4YWRA 1LIJA 2C4EA 4XDAA 2DDOA 1ESJA 1GC5A 1RK2A 1RKAA 1TZ6A 2F7KA 2HLZA 3RPHA 3RU3A 2RBCA 3BF5A 4EN4A 2DDWA 2NWHA 3UMPA 5EY7A 5C3YA 3RO4A 5C41A 5C40A 3W4SA 4E3AA 3BGKA 3QA2A 4E84A 3KD6A 4GM6A 4S1MA 2AFBA 2JGVA 4K8CA 2ABQA 4N09A 3UQ6A 3IQ0A 2Q5RA 1LIIA 4E8WA 4LBXA 3QAIA 1V19A 4K9IA 1RKSA 3RTBA 4EOHA 1VI9A 1C3QA 5CGAA 4O1GA 1RFVA 2A9ZA 2AA0A 3ZS7A 3UQEA 3KTNA 4C5LA 2AWDA 3NL2A 4C5KA 3OTXA 3KZHA 3B1OA 4S1IB 3RSSA 3UQDA 4K8KA 3HPDA 4EUMA 4JKUA 2YXUA 5BYCA 3B1NA 3NL6A 3IBQA 4S1IA 4C5JA 3PZSA 3VAQA 5COJA 4N08A 1TYYA 3IKHA 2AX3A 2DCNA 4K8TA 3RQXA 3RT7A 4LCAA 3UQ9A 3FHYA 1WYEA 2FV7A 4DC3A 3LKIA 3PL2A 1ESQA 1V1BA 1VM7A 2PKKA 3NL3A 4JJPA 3RM5A 3MBJA 3RSFA 5TQIA 4S1HA 1LHRA 4U7XA 1YGKA 4K93A 3RRBA 1RKDA 2QCVA 4WJMA 3RREA 2JG5A
chains in the Genus database with same CATH superfamily
5CM5A 2XJAA 3RQHA 3HICA 4E69A 3QCZA 3GO7A 3ZM5A 4YL5A 5CGEA 2QHPA 3H74A 1U2XA 3MBHA 3IN1A 3VASA 3GO6A 4XF6A 2HQQA 2PKMA 3KEUA 3B3LA 1P31A 3N2AA 3B1RA 1JXHA 3B1QA 4K8PA 5BYEA 2R3EA 2A9YA 3IE7A 2WJPA 4CVMA 1JBWA 2Y68A 3RTGA 2Y1OA 5B6AA 1UB0A 5BYFA 2V78A 3RTEA 3Q92A 1EKKA 3CQDA 3RS9A 3RSGA 3RTAA 1LIOA 1GQYA 1RFTA 3RU2A 3RY7A 4B8SA 1E0DA 2VARA 4E8YA 4UAGA 2ABSA 4C12A 2F00A 4KADA 4B8RA 2PKNA 1YHJA 3EWMA 4LC4A 4DU5A 5C3ZA 5F11A 3RQ5A 5EYNA 1L2LA 4X8FA 2XPCA 1EEHA 2JG1A 2VOSA 5TRWA 3RRJA 5A5EA 2AM2A 4UBEA 3RQ6A 5BYDA 4K9CA 4C5NA 1TZ3A 2YXTA 1JXIA 3K5WA 1V1AA 3RTDA 1GQTA 3GBUA 1FGSA 2AJRA 2F02A 2GCBA 2VORA 1YGJA 3FHXA 3H49A 3DRWA 1V1SA 3LHXA 3LJSA 3N1CA 3Q1YA 4KANA 3RS8A 3IH0A 3NM3A 3I3YA 4PVVA 4CVKA 3NBVA 3K9EA 3HN7A 3RSQA 3RQ2A 3RQ8A 3RT9A 2Y67A 3UMOA 3NC9A 3NBWA 4C5MA 4LBGA 3RTCA 1O5ZA 1GG4A 4XCKA 4EBUA 1LHPA 2Y66A 1TD2A 1W78A 1UA4A 5A5FA 2GC5A 1E8CA 1RFUA 1LIKA 3RPZA 3NL5A 2XTBA 2I5BA 2C49A 4KALA 2HW1A 2AB8A 3NC2A 4JKSA 4KBEA 3UBOA 1DGMA 2JFFA 3NCAA 3DZVA 2I6AA 1BX4A 3LOOA 2PKFA 4XF7A 4KAHA 2I6BA 2AJPA 4E8ZA 2JFGA 1VK4A 3EAGA 4O1LA 2R3BA 3NM1A 5F0ZA 2X5OA 1EKQA 1P3DA 2DDMA 3B1PA 3HYOA 2UAGA 1KYHA 3JULA 3RQQA 3LK7A 4YWRA 1LIJA 2C4EA 4C13A 4XDAA 2DDOA 3RRFA 1ESJA 1GC5A 1RK2A 1RKAA 1TZ6A 2F7KA 2HLZA 4QDIA 3RPHA 3RU3A 2RBCA 3BF5A 4EN4A 2VTEA 1W7KA 3ZL8A 2DDWA 2NWHA 3UMPA 5EY7A 5C3YA 3RO4A 5C41A 5C40A 3W4SA 4E3AA 4HV4A 3BGKA 3QA2A 4E84A 3KD6A 4GM6A 4S1MA 2AFBA 2JGVA 3HJ6A 4K8CA 3ZM6A 2ABQA 4BUCA 4N09A 2UUPA 3UQ6A 3IQ0A 2Q5RA 1LIIA 4E8WA 1J6UA 4LBXA 3QAIA 1V19A 4K9IA 1RKSA 3RTBA 4EOHA 1VI9A 1C3QA 2VTDA 4O1GA 5CGAA 3NRSA 1RFVA 2A9ZA 2AA0A 3ZS7A 3UQEA 3KTNA 1UAGA 4C5LA 2AWDA 3NL2A 4C5KA 2JFHA 3OTXA 3KZHA 3B1OA 4S1IB 3RSSA 4CVLA 3UQDA 2WTZA 4K8KA 3HPDA 4EUMA 3PYZA 4QF5A 4JKUA 2GCAA 2YXUA 5BYCA 3B1NA 3NL6A 3IBQA 4S1IA 4C5JA 3PZSA 1JBVA 3VAQA 5COJA 4N08A 3UAGA 2AM1A 1TYYA 3IKHA 2AX3A 2DCNA 4K8TA 1GQQA 3RQXA 4LCAA 3UQ9A 3RT7A 3FHYA 1WYEA 2FV7A 4DC3A 3LKIA 3PL2A 1ESQA 1V1BA 1VM7A 2PKKA 3NL3A 4JJPA 3RM5A 3MBJA 3RSFA 2GC6A 4BUBA 5TQIA 4S1HA 2UUOA 1LHRA 4U7XA 1YGKA 4ZIYA 4K93A 3RRBA 1RKDA 2QCVA 4WJMA 3RREA 2JG5A
chains in the Genus database with same CATH topology
5CM5A 3RQHA 4E69A 3HICA 3GO7A 5CGEA 4YL5A 2QHPA 3H74A 1U2XA 3MBHA 3IN1A 3VASA 3GO6A 4XF6A 2HQQA 2PKMA 3KEUA 3B3LA 4C5MA 3B1RA 1JXHA 3B1QA 4K8PA 2R3EA 2A9YA 3IE7A 5B6AA 3RTGA 1UB0A 2V78A 3RTEA 3Q92A 1EKKA 3CQDA 3RS9A 3RSGA 3RTAA 1LIOA 1RFTA 3RU2A 3RY7A 4B8SA 2VARA 2ABSA 4KADA 4B8RA 2PKNA 1YHJA 3EWMA 4LC4A 4DU5A 5C3ZA 5F11A 3RQ5A 5EYNA 1L2LA 4X8FA 2JG1A 5TRWA 3RRJA 4UBEA 3RQ6A 5BYDA 4K9CA 4C5NA 1TZ3A 2YXTA 1JXIA 3K5WA 1V1AA 3RTDA 1GQTA 3GBUA 2F02A 2AJRA 3H49A 3RRFA 3FHXA 1YGJA 3LHXA 3N1CA 3DRWA 1V1SA 3LJSA 3Q1YA 4KANA 3RS8A 3IH0A 3NM3A 3I3YA 4PVVA 5BYFA 3NBVA 3K9EA 3RSQA 3RT9A 3RQ2A 3RQ8A 3UMOA 4E8YA 5BYEA 3NC9A 3NBWA 4EBUA 4LBGA 3RTCA 4XCKA 1LHPA 1TD2A 1UA4A 1LIKA 1RFUA 3RPZA 3NL5A 2XTBA 2I5BA 2C49A 4KALA 2HW1A 2AB8A 3NC2A 4JKSA 4KBEA 3UBOA 1DGMA 3NCAA 3DZVA 2I6AA 1BX4A 3LOOA 2PKFA 4XF7A 4KAHA 2I6BA 2AJPA 4E8ZA 1VK4A 4O1LA 2R3BA 3NM1A 5F0ZA 3HYOA 1EKQA 3B1PA 2DDMA 3JULA 1KYHA 3RQQA 4YWRA 1LIJA 2C4EA 4XDAA 2DDOA 1ESJA 1GC5A 1RK2A 1RKAA 1TZ6A 2F7KA 2HLZA 3RPHA 3RU3A 2RBCA 3BF5A 4EN4A 2DDWA 2NWHA 3UMPA 5EY7A 5C3YA 3RO4A 5C41A 5C40A 3W4SA 4E3AA 3BGKA 3QA2A 4E84A 3KD6A 4GM6A 4S1MA 2AFBA 2JGVA 3HJ6A 4K8CA 2ABQA 4N09A 3UQ6A 3IQ0A 2Q5RA 1LIIA 4E8WA 4LBXA 3QAIA 1V19A 4K9IA 1RKSA 3RTBA 4EOHA 1VI9A 1C3QA 5CGAA 4O1GA 1RFVA 2A9ZA 2AA0A 3ZS7A 3UQEA 3KTNA 4C5LA 2AWDA 3NL2A 4C5KA 3OTXA 3KZHA 3B1OA 4S1IB 3RSSA 3UQDA 4K8KA 3HPDA 4EUMA 4JKUA 2YXUA 5BYCA 3B1NA 3NL6A 3IBQA 4S1IA 4C5JA 3PZSA 3VAQA 5COJA 4N08A 1TYYA 3IKHA 2AX3A 2DCNA 4K8TA 3RQXA 3RT7A 4LCAA 3UQ9A 3FHYA 1WYEA 2FV7A 4DC3A 3LKIA 3PL2A 1ESQA 1V1BA 1VM7A 2PKKA 3NL3A 4JJPA 3RM5A 3MBJA 3RSFA 5TQIA 4S1HA 1LHRA 4U7XA 1YGKA 4K93A 3RRBA 1RKDA 2QCVA 4WJMA 3RREA 2JG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM5 A;  3RQH A;  4E69 A;  3HIC A;  3GO7 A;  5CGE A;  4YL5 A;  2QHP A;  3H74 A;  1U2X A;  3MBH A;  3IN1 A;  3VAS A;  3GO6 A;  4XF6 A;  2HQQ A;  2PKM A;  3KEU A;  3B3L A;  4C5M A;  3B1R A;  1JXH A;  3B1Q A;  4K8P A;  2R3E A;  2A9Y A;  3IE7 A;  5B6A A;  3RTG A;  1UB0 A;  2V78 A;  3RTE A;  3Q92 A;  1EKK A;  3CQD A;  3RS9 A;  3RSG A;  3RTA A;  1LIO A;  1RFT A;  3RU2 A;  3RY7 A;  4B8S A;  2VAR A;  2ABS A;  4KAD A;  2PKN A;  3EWM A;  1YHJ A;  4LC4 A;  4B8R A;  4DU5 A;  5C3Z A;  5F11 A;  3RQ5 A;  5EYN A;  1L2L A;  4X8F A;  2JG1 A;  5TRW A;  3RRJ A;  4UBE A;  3RQ6 A;  5BYD A;  4K9C A;  4C5N A;  1TZ3 A;  2YXT A;  1JXI A;  3K5W A;  1V1A A;  3RTD A;  1GQT A;  3GBU A;  2F02 A;  2AJR A;  3H49 A;  3RRF A;  3FHX A;  1YGJ A;  3LHX A;  3N1C A;  1V1S A;  3DRW A;  3LJS A;  3Q1Y A;  4KAN A;  3RS8 A;  3IH0 A;  3NM3 A;  3I3Y A;  4PVV A;  5BYF A;  3NBV A;  3K9E A;  3RSQ A;  3RT9 A;  3RQ2 A;  3RQ8 A;  3UMO A;  4E8Y A;  5BYE A;  3NC9 A;  3NBW A;  4EBU A;  4LBG A;  3RTC A;  4XCK A;  1LHP A;  1TD2 A;  1UA4 A;  1LIK A;  1RFU A;  3RPZ A;  3NL5 A;  2XTB A;  2I5B A;  2C49 A;  4KAL A;  2HW1 A;  2AB8 A;  3NC2 A;  4JKS A;  4KBE A;  3UBO A;  1DGM A;  3NCA A;  3DZV A;  2I6A A;  1BX4 A;  3LOO A;  2PKF A;  4XF7 A;  4KAH A;  2I6B A;  2AJP A;  4E8Z A;  1VK4 A;  4O1L A;  2R3B A;  3NM1 A;  5F0Z A;  3HYO A;  1EKQ A;  3B1P A;  2DDM A;  3JUL A;  1KYH A;  3RQQ A;  4YWR A;  1LIJ A;  2C4E A;  4XDA A;  2DDO A;  1ESJ A;  1GC5 A;  1RK2 A;  1RKA A;  1TZ6 A;  2F7K A;  2HLZ A;  3RPH A;  3RU3 A;  2RBC A;  3BF5 A;  4EN4 A;  2DDW A;  2NWH A;  3UMP A;  5EY7 A;  5C3Y A;  3RO4 A;  5C41 A;  5C40 A;  3W4S A;  4E3A A;  3BGK A;  3QA2 A;  4E84 A;  3KD6 A;  4GM6 A;  4S1M A;  2AFB A;  2JGV A;  4K8C A;  2ABQ A;  4N09 A;  3UQ6 A;  3IQ0 A;  2Q5R A;  1LII A;  4E8W A;  4LBX A;  3QAI A;  1V19 A;  4K9I A;  1RKS A;  3RTB A;  4EOH A;  1VI9 A;  1C3Q A;  5CGA A;  4O1G A;  1RFV A;  2A9Z A;  2AA0 A;  3ZS7 A;  3UQE A;  3KTN A;  4C5L A;  2AWD A;  3NL2 A;  4C5K A;  3OTX A;  3KZH A;  3B1O A;  4S1I B;  3RSS A;  3UQD A;  4K8K A;  3HPD A;  4EUM A;  4JKU A;  2YXU A;  5BYC A;  3B1N A;  3NL6 A;  3IBQ A;  4S1I A;  4C5J A;  3PZS A;  3VAQ A;  5COJ A;  4N08 A;  1TYY A;  3IKH A;  2AX3 A;  2DCN A;  4K8T A;  3RQX A;  3RT7 A;  4LCA A;  3UQ9 A;  3FHY A;  1WYE A;  2FV7 A;  4DC3 A;  3LKI A;  3PL2 A;  1ESQ A;  1V1B A;  1VM7 A;  2PKK A;  3NL3 A;  4JJP A;  3RM5 A;  3MBJ A;  3RSF A;  5TQI A;  4S1H A;  1LHR A;  4U7X A;  1YGK A;  4K93 A;  3RRB A;  1RKD A;  2QCV A;  4WJM A;  3RRE A;  2JG5 A; 
#chains in the Genus database with same CATH topology
 5CM5 A;  2XJA A;  3RQH A;  3HIC A;  4E69 A;  3QCZ A;  3GO7 A;  3ZM5 A;  4YL5 A;  5CGE A;  2QHP A;  3H74 A;  1U2X A;  3MBH A;  3IN1 A;  3VAS A;  3GO6 A;  4XF6 A;  2HQQ A;  2PKM A;  3KEU A;  3B3L A;  1P31 A;  3N2A A;  3B1R A;  1JXH A;  3B1Q A;  4K8P A;  5BYE A;  2R3E A;  2A9Y A;  3IE7 A;  2WJP A;  4CVM A;  1JBW A;  2Y68 A;  3RTG A;  2Y1O A;  5B6A A;  1UB0 A;  5BYF A;  2V78 A;  3RTE A;  3Q92 A;  1EKK A;  3CQD A;  3RS9 A;  3RSG A;  3RTA A;  1LIO A;  1GQY A;  1RFT A;  3RU2 A;  3RY7 A;  4B8S A;  1E0D A;  2VAR A;  4E8Y A;  4UAG A;  2ABS A;  4C12 A;  2F00 A;  4KAD A;  4B8R A;  2PKN A;  1YHJ A;  3EWM A;  4LC4 A;  4DU5 A;  5C3Z A;  5F11 A;  3RQ5 A;  5EYN A;  1L2L A;  4X8F A;  2XPC A;  1EEH A;  2JG1 A;  2VOS A;  5TRW A;  3RRJ A;  5A5E A;  2AM2 A;  4UBE A;  3RQ6 A;  5BYD A;  4K9C A;  4C5N A;  1TZ3 A;  2YXT A;  1JXI A;  3K5W A;  1V1A A;  3RTD A;  1GQT A;  3GBU A;  1FGS A;  2AJR A;  2F02 A;  2GCB A;  2VOR A;  1YGJ A;  3FHX A;  3H49 A;  3DRW A;  1V1S A;  3LHX A;  3LJS A;  3N1C A;  3Q1Y A;  4KAN A;  3RS8 A;  3IH0 A;  3NM3 A;  3I3Y A;  4PVV A;  4CVK A;  3NBV A;  3K9E A;  3HN7 A;  3RSQ A;  3RQ2 A;  3RQ8 A;  3RT9 A;  2Y67 A;  3UMO A;  3NC9 A;  3NBW A;  4C5M A;  4LBG A;  3RTC A;  1O5Z A;  1GG4 A;  4XCK A;  4EBU A;  1LHP A;  2Y66 A;  1TD2 A;  1W78 A;  1UA4 A;  5A5F A;  2GC5 A;  1E8C A;  1RFU A;  1LIK A;  3RPZ A;  3NL5 A;  2XTB A;  2I5B A;  2C49 A;  4KAL A;  2HW1 A;  2AB8 A;  3NC2 A;  4JKS A;  4KBE A;  3UBO A;  1DGM A;  2JFF A;  3NCA A;  3DZV A;  2I6A A;  1BX4 A;  3LOO A;  2PKF A;  4XF7 A;  4KAH A;  2I6B A;  2AJP A;  4E8Z A;  2JFG A;  1VK4 A;  3EAG A;  4O1L A;  2R3B A;  3NM1 A;  5F0Z A;  2X5O A;  1EKQ A;  1P3D A;  2DDM A;  3B1P A;  3HYO A;  2UAG A;  1KYH A;  3JUL A;  3RQQ A;  3LK7 A;  4YWR A;  1LIJ A;  2C4E A;  4C13 A;  4XDA A;  2DDO A;  3RRF A;  1ESJ A;  1GC5 A;  1RK2 A;  1RKA A;  1TZ6 A;  2F7K A;  2HLZ A;  4QDI A;  3RPH A;  3RU3 A;  2RBC A;  3BF5 A;  4EN4 A;  2VTE A;  1W7K A;  3ZL8 A;  2DDW A;  2NWH A;  3UMP A;  5EY7 A;  5C3Y A;  3RO4 A;  5C41 A;  5C40 A;  3W4S A;  4E3A A;  4HV4 A;  3BGK A;  3QA2 A;  4E84 A;  3KD6 A;  4GM6 A;  4S1M A;  2AFB A;  2JGV A;  3HJ6 A;  4K8C A;  3ZM6 A;  2ABQ A;  4BUC A;  4N09 A;  2UUP A;  3UQ6 A;  3IQ0 A;  2Q5R A;  1LII A;  4E8W A;  1J6U A;  4LBX A;  3QAI A;  1V19 A;  4K9I A;  1RKS A;  3RTB A;  4EOH A;  1VI9 A;  1C3Q A;  2VTD A;  4O1G A;  5CGA A;  3NRS A;  1RFV A;  2A9Z A;  2AA0 A;  3ZS7 A;  3UQE A;  3KTN A;  1UAG A;  4C5L A;  2AWD A;  3NL2 A;  4C5K A;  2JFH A;  3OTX A;  3KZH A;  3B1O A;  4S1I B;  3RSS A;  4CVL A;  3UQD A;  2WTZ A;  4K8K A;  3HPD A;  4EUM A;  3PYZ A;  4QF5 A;  4JKU A;  2GCA A;  2YXU A;  5BYC A;  3B1N A;  3NL6 A;  3IBQ A;  4S1I A;  4C5J A;  3PZS A;  1JBV A;  3VAQ A;  5COJ A;  4N08 A;  3UAG A;  2AM1 A;  1TYY A;  3IKH A;  2AX3 A;  2DCN A;  4K8T A;  1GQQ A;  3RQX A;  4LCA A;  3UQ9 A;  3RT7 A;  3FHY A;  1WYE A;  2FV7 A;  4DC3 A;  3LKI A;  3PL2 A;  1ESQ A;  1V1B A;  1VM7 A;  2PKK A;  3NL3 A;  4JJP A;  3RM5 A;  3MBJ A;  3RSF A;  2GC6 A;  4BUB A;  5TQI A;  4S1H A;  2UUO A;  1LHR A;  4U7X A;  1YGK A;  4ZIY A;  4K93 A;  3RRB A;  1RKD A;  2QCV A;  4WJM A;  3RRE A;  2JG5 A; 
#chains in the Genus database with same CATH homology
 5CM5 A;  3RQH A;  4E69 A;  3HIC A;  3GO7 A;  5CGE A;  4YL5 A;  2QHP A;  3H74 A;  1U2X A;  3MBH A;  3IN1 A;  3VAS A;  3GO6 A;  4XF6 A;  2HQQ A;  2PKM A;  3KEU A;  3B3L A;  4C5M A;  3B1R A;  1JXH A;  3B1Q A;  4K8P A;  2R3E A;  2A9Y A;  3IE7 A;  5B6A A;  3RTG A;  1UB0 A;  2V78 A;  3RTE A;  3Q92 A;  1EKK A;  3CQD A;  3RS9 A;  3RSG A;  3RTA A;  1LIO A;  1RFT A;  3RU2 A;  3RY7 A;  4B8S A;  2VAR A;  2ABS A;  4KAD A;  4B8R A;  2PKN A;  1YHJ A;  3EWM A;  4LC4 A;  4DU5 A;  5C3Z A;  5F11 A;  3RQ5 A;  5EYN A;  1L2L A;  4X8F A;  2JG1 A;  5TRW A;  3RRJ A;  4UBE A;  3RQ6 A;  5BYD A;  4K9C A;  4C5N A;  1TZ3 A;  2YXT A;  1JXI A;  3K5W A;  1V1A A;  3RTD A;  1GQT A;  3GBU A;  2F02 A;  2AJR A;  3H49 A;  3RRF A;  3FHX A;  1YGJ A;  3LHX A;  3N1C A;  3DRW A;  1V1S A;  3LJS A;  3Q1Y A;  4KAN A;  3RS8 A;  3IH0 A;  3NM3 A;  3I3Y A;  4PVV A;  5BYF A;  3NBV A;  3K9E A;  3RSQ A;  3RT9 A;  3RQ2 A;  3RQ8 A;  3UMO A;  4E8Y A;  5BYE A;  3NC9 A;  3NBW A;  4EBU A;  4LBG A;  3RTC A;  4XCK A;  1LHP A;  1TD2 A;  1UA4 A;  1LIK A;  1RFU A;  3RPZ A;  3NL5 A;  2XTB A;  2I5B A;  2C49 A;  4KAL A;  2HW1 A;  2AB8 A;  3NC2 A;  4JKS A;  4KBE A;  3UBO A;  1DGM A;  3NCA A;  3DZV A;  2I6A A;  1BX4 A;  3LOO A;  2PKF A;  4XF7 A;  4KAH A;  2I6B A;  2AJP A;  4E8Z A;  1VK4 A;  4O1L A;  2R3B A;  3NM1 A;  5F0Z A;  3HYO A;  1EKQ A;  3B1P A;  2DDM A;  3JUL A;  1KYH A;  3RQQ A;  4YWR A;  1LIJ A;  2C4E A;  4XDA A;  2DDO A;  1ESJ A;  1GC5 A;  1RK2 A;  1RKA A;  1TZ6 A;  2F7K A;  2HLZ A;  3RPH A;  3RU3 A;  2RBC A;  3BF5 A;  4EN4 A;  2DDW A;  2NWH A;  3UMP A;  5EY7 A;  5C3Y A;  3RO4 A;  5C41 A;  5C40 A;  3W4S A;  4E3A A;  3BGK A;  3QA2 A;  4E84 A;  3KD6 A;  4GM6 A;  4S1M A;  2AFB A;  2JGV A;  3HJ6 A;  4K8C A;  2ABQ A;  4N09 A;  3UQ6 A;  3IQ0 A;  2Q5R A;  1LII A;  4E8W A;  4LBX A;  3QAI A;  1V19 A;  4K9I A;  1RKS A;  3RTB A;  4EOH A;  1VI9 A;  1C3Q A;  5CGA A;  4O1G A;  1RFV A;  2A9Z A;  2AA0 A;  3ZS7 A;  3UQE A;  3KTN A;  4C5L A;  2AWD A;  3NL2 A;  4C5K A;  3OTX A;  3KZH A;  3B1O A;  4S1I B;  3RSS A;  3UQD A;  4K8K A;  3HPD A;  4EUM A;  4JKU A;  2YXU A;  5BYC A;  3B1N A;  3NL6 A;  3IBQ A;  4S1I A;  4C5J A;  3PZS A;  3VAQ A;  5COJ A;  4N08 A;  1TYY A;  3IKH A;  2AX3 A;  2DCN A;  4K8T A;  3RQX A;  3RT7 A;  4LCA A;  3UQ9 A;  3FHY A;  1WYE A;  2FV7 A;  4DC3 A;  3LKI A;  3PL2 A;  1ESQ A;  1V1B A;  1VM7 A;  2PKK A;  3NL3 A;  4JJP A;  3RM5 A;  3MBJ A;  3RSF A;  5TQI A;  4S1H A;  1LHR A;  4U7X A;  1YGK A;  4K93 A;  3RRB A;  1RKD A;  2QCV A;  4WJM A;  3RRE A;  2JG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...