3VAQA

Adenosine kinase from schistosoma mansoni in complex with adenosine
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
345
structure length
345
Chain Sequence
DLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAACDLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGDAFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Putative adenosine kinase
total genus 124
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 3vaqA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3vaqA01
4K9CA 2AWDA 4KALA 3UBOA 1YHJA 3IH0A 1V1AA 2PKMA 4XF6A 3RREA 3IN1A 3NL6A 4EOHA 2C49A 2DDOA 3IE7A 2ABQA 3N1CA 4S1IB 2AB8A 3RT7A 1UA4A 3RY7A 2C4EA 3RPZA 4N08A 3UMPA 2DDMA 4C5LA 4LBXA 4XCKA 3RTEA 4DU5A 4E69A 2JG5A 4EUMA 5B6AA 3RSSA 3NCAA 1YGKA 4E8ZA 4C5MA 2I6AA 5F11A 4E8WA 3KEUA 2HW1A 2A9YA 4XDAA 3FHXA 3HYOA 3IBQA 4KAHA 1LHRA 1VI9A 3GO7A 3PL2A 3RQ2A 3RSGA 2HLZA 3MBHA 5C41A 4LC4A 5F0ZA 3RS8A 3BF5A 4U7XA 2I5BA 2QHPA 2ABSA 2VARA 3HPDA 2FV7A 3Q92A 3QA2A 5CM5A 4WJMA 3LOOA 3RQ8A 4B8RA 1RFTA 2AJRA 1JXIA 3Q1YA 3RT9A 2XTBA 4JKUA 1L2LA 3NM1A 3KZHA 3I3YA 4O1LA 3B1PA 3B3LA 4B8SA 3RQXA 2YXTA 3NL2A 3LKIA 5EYNA 4K8KA 4YWRA 1WYEA 3PZSA 3OTXA 1EKQA 3HICA 4JKSA 4C5NA 5BYDA 1LIOA 1V19A 3RU3A 3IKHA 2PKKA 5BYFA 3ZS7A 1RKDA 2AFBA 4S1HA 2QCVA 4K8TA 4E3AA 5BYEA 3EWMA 3IQ0A 3RS9A 3NBVA 4K8PA 3JULA 3RTAA 3RU2A 4E84A 1LHPA 3RM5A 2F02A 4UBEA 1JXHA 3RQQA 4DC3A 4K9IA 2F7KA 5BYCA 1ESJA 1YGJA 2I6BA 5C40A 3W4SA 4KADA 3RPHA 4X8FA 3NC9A 1DGMA 3VAQA 2RBCA 3FHYA 3BGKA 5EY7A 3UMOA 3KTNA 2DCNA 3RQHA 4EN4A 4GM6A 2PKFA 3RTCA 1ESQA 1GQTA 1EKKA 3RRBA 3RQ5A 2V78A 3RTDA 3RSQA 2NWHA 2JGVA 3B1RA 2YXUA 3RO4A 1V1BA 1U2XA 3B1QA 4K8CA 4C5JA 3CQDA 4N09A 1RKSA 3UQ9A 2R3EA 3KD6A 4LBGA 4E8YA 1LIKA 3RRJA 3VASA 1RKAA 4KANA 5C3ZA 2PKNA 3NL3A 4KBEA 1LIIA 2R3BA 5TRWA 1GC5A 3H74A 3NM3A 4S1IA 1TZ6A 3K5WA 3GO6A 3RTBA 1TZ3A 2DDWA 3NC2A 3NL5A 2Q5RA 3H49A 3RRFA 2A9ZA 3DRWA 3RQ6A 1RK2A 5C3YA 3RTGA 4XF7A 3MBJA 5TQIA 3NBWA 2AJPA 3B1NA 1VM7A 3UQ6A 2AX3A 3B1OA 1RFUA 4YL5A 1TD2A 3UQDA 1C3QA 4K93A 1KYHA 2JG1A 4O1GA 4S1MA 5CGAA 1V1SA 4PVVA 5COJA 3GBUA 4C5KA 5CGEA 3LHXA 1LIJA 2HQQA 1BX4A 4JJPA 3K9EA 1TYYA 3UQEA 1UB0A 1VK4A 3RSFA 2AA0A 1RFVA 3LJSA 4LCAA 3DZVA 3QAIA 4EBUA
chains in the Genus database with same CATH superfamily
2GC6A 2VOSA 2AWDA 4K9CA 4KALA 1GQYA 3N2AA 1YHJA 3IH0A 1V1AA 2PKMA 3PYZA 3QCZA 1W78A 4XF6A 3RREA 3IN1A 3NL6A 4EOHA 2C49A 2DDOA 3IE7A 2ABQA 3N1CA 4S1IB 2AB8A 2AM2A 1UA4A 3RT7A 3RY7A 2C4EA 3LK7A 3RPZA 4N08A 3UMPA 2DDMA 4C5LA 4LBXA 4XCKA 3RTEA 4DU5A 4E69A 3HN7A 3ZL8A 2JG5A 4EUMA 5B6AA 3RSSA 3NCAA 1J6UA 1YGKA 4E8ZA 4C5MA 2I6AA 2WTZA 2VORA 4E8WA 5F11A 2XJAA 3EAGA 3KEUA 2HW1A 2A9YA 4XDAA 3FHXA 3HYOA 3IBQA 4KAHA 1LHRA 1VI9A 3GO7A 3PL2A 3RQ2A 3RSGA 2HLZA 3MBHA 3ZM5A 4LC4A 5C41A 3RS8A 1EEHA 3BF5A 4U7XA 2I5BA 2QHPA 2ABSA 2VARA 3HPDA 2FV7A 3Q92A 3QA2A 5CM5A 4WJMA 3LOOA 3RQ8A 4B8RA 4CVMA 1RFTA 2AJRA 1JXIA 3Q1YA 3RT9A 1P3DA 2XTBA 1JBWA 4JKUA 3UBOA 5A5FA 1L2LA 3NM1A 3KZHA 3I3YA 4O1LA 3B1PA 3B3LA 4B8SA 3RQXA 4BUBA 2YXTA 2X5OA 3NL2A 3LKIA 5EYNA 4K8KA 2UUPA 4YWRA 1WYEA 3PZSA 3OTXA 1EKQA 3HICA 4JKSA 4C5NA 5BYDA 1GQQA 4C12A 1LIOA 1V19A 1E0DA 3IKHA 2PKKA 3RU3A 3ZS7A 1RKDA 2AFBA 2VTDA 2QCVA 4K8TA 4S1HA 4E3AA 5BYFA 3EWMA 3IQ0A 3RS9A 3NBVA 4QF5A 4K8PA 3JULA 3RTAA 3RU2A 4E84A 1LHPA 1P31A 2GCBA 3RM5A 2F02A 4UBEA 1JXHA 3RQQA 4DC3A 4K9IA 2F7KA 5A5EA 1ESJA 5BYCA 1YGJA 2I6BA 2Y68A 5C40A 3W4SA 1W7KA 2Y1OA 4KADA 4QDIA 4X8FA 3RPHA 3NC9A 1DGMA 3VAQA 2RBCA 2UAGA 3BGKA 3FHYA 5EY7A 3UMOA 2XPCA 2DCNA 3KTNA 3RQHA 4EN4A 4GM6A 2PKFA 3RTCA 1ESQA 2GCAA 1GQTA 1EKKA 3RRBA 3RQ5A 2V78A 3RTDA 3RSQA 5F0ZA 2NWHA 2JGVA 3B1RA 2YXUA 3RO4A 1V1BA 1U2XA 2Y66A 3B1QA 4HV4A 4K8CA 4C5JA 3CQDA 4N09A 1RKSA 3UQ9A 2R3EA 2JFGA 3KD6A 4LBGA 4E8YA 1LIKA 1GG4A 2AM1A 3RRJA 3VASA 1RKAA 4KANA 5C3ZA 2PKNA 3NRSA 3NL3A 4KBEA 1LIIA 2R3BA 5TRWA 1GC5A 2VTEA 3H74A 3NM3A 4S1IA 1TZ6A 3K5WA 3GO6A 5BYEA 3RTBA 1TZ3A 2DDWA 2JFHA 3NC2A 3NL5A 2Q5RA 3H49A 4CVLA 3RRFA 2A9ZA 3DRWA 3RQ6A 1RK2A 5C3YA 3RTGA 4XF7A 3MBJA 5TQIA 3NBWA 2AJPA 3HJ6A 3B1NA 3ZM6A 1VM7A 3UQ6A 2AX3A 3B1OA 1RFUA 4YL5A 1TD2A 3UQDA 1C3QA 4K93A 1KYHA 2JG1A 4O1GA 2UUOA 4S1MA 1V1SA 5CGAA 4PVVA 5COJA 1E8CA 3GBUA 4UAGA 4C5KA 4CVKA 5CGEA 1FGSA 4C13A 2GC5A 3LHXA 1LIJA 2HQQA 1BX4A 2F00A 2JFFA 4JJPA 1UAGA 1O5ZA 3K9EA 1TYYA 2WJPA 3UQEA 1UB0A 1VK4A 4ZIYA 3UAGA 4BUCA 3RSFA 2AA0A 1RFVA 3LJSA 4LCAA 3DZVA 3QAIA 1JBVA 2Y67A 4EBUA
chains in the Genus database with same CATH topology
4K9CA 2AWDA 4KALA 3UBOA 1YHJA 3IH0A 1V1AA 2PKMA 4XF6A 3RREA 3IN1A 3NL6A 4EOHA 2C49A 2DDOA 3IE7A 2ABQA 3N1CA 4S1IB 2AB8A 3RT7A 1UA4A 3RY7A 2C4EA 3RPZA 4N08A 3UMPA 2DDMA 4C5LA 4LBXA 4XCKA 3RTEA 4DU5A 4E69A 2JG5A 4EUMA 5B6AA 3RSSA 3NCAA 1YGKA 4E8ZA 4C5MA 2I6AA 5F11A 4E8WA 3KEUA 2HW1A 2A9YA 4XDAA 3FHXA 3HYOA 3IBQA 4KAHA 1LHRA 1VI9A 3GO7A 3PL2A 3RQ2A 3RSGA 2HLZA 3MBHA 5C41A 4LC4A 5F0ZA 3RS8A 3BF5A 4U7XA 2I5BA 2QHPA 2ABSA 2VARA 3HPDA 2FV7A 3Q92A 3QA2A 5CM5A 4WJMA 3LOOA 3RQ8A 4B8RA 1RFTA 2AJRA 1JXIA 3Q1YA 3RT9A 2XTBA 4JKUA 1L2LA 3NM1A 3KZHA 3I3YA 4O1LA 3B1PA 3B3LA 4B8SA 3RQXA 2YXTA 3NL2A 3LKIA 5EYNA 4K8KA 4YWRA 1WYEA 3PZSA 3OTXA 1EKQA 3HICA 4JKSA 4C5NA 5BYDA 1LIOA 1V19A 3RU3A 3IKHA 2PKKA 5BYFA 3ZS7A 1RKDA 2AFBA 4S1HA 2QCVA 4K8TA 4E3AA 5BYEA 3EWMA 3IQ0A 3RS9A 3NBVA 4K8PA 3JULA 3RTAA 3RU2A 4E84A 1LHPA 3RM5A 2F02A 4UBEA 1JXHA 3RQQA 4DC3A 4K9IA 2F7KA 5BYCA 1ESJA 1YGJA 2I6BA 5C40A 3W4SA 4KADA 3RPHA 4X8FA 3NC9A 1DGMA 3VAQA 2RBCA 3FHYA 3BGKA 5EY7A 3UMOA 3KTNA 2DCNA 3RQHA 4EN4A 4GM6A 2PKFA 3RTCA 1ESQA 1GQTA 1EKKA 3RRBA 3RQ5A 2V78A 3RTDA 3RSQA 2NWHA 2JGVA 3B1RA 2YXUA 3RO4A 1V1BA 1U2XA 3B1QA 4K8CA 4C5JA 3CQDA 4N09A 1RKSA 3UQ9A 2R3EA 3KD6A 4LBGA 4E8YA 1LIKA 3RRJA 3VASA 1RKAA 4KANA 5C3ZA 2PKNA 3NL3A 4KBEA 1LIIA 2R3BA 5TRWA 1GC5A 3H74A 3NM3A 4S1IA 1TZ6A 3K5WA 3GO6A 3RTBA 1TZ3A 2DDWA 3NC2A 3NL5A 2Q5RA 3H49A 3RRFA 2A9ZA 3DRWA 3RQ6A 1RK2A 5C3YA 3RTGA 4XF7A 3MBJA 5TQIA 3NBWA 2AJPA 3HJ6A 3B1NA 1VM7A 3UQ6A 2AX3A 3B1OA 1RFUA 4YL5A 1TD2A 3UQDA 1C3QA 4K93A 1KYHA 2JG1A 4O1GA 4S1MA 5CGAA 1V1SA 4PVVA 5COJA 3GBUA 4C5KA 5CGEA 3LHXA 1LIJA 2HQQA 1BX4A 4JJPA 3K9EA 1TYYA 3UQEA 1UB0A 1VK4A 3RSFA 2AA0A 1RFVA 3LJSA 4LCAA 3DZVA 3QAIA 4EBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K9C A;  2AWD A;  4KAL A;  3UBO A;  1YHJ A;  3IH0 A;  1V1A A;  2PKM A;  4XF6 A;  3RRE A;  3IN1 A;  3NL6 A;  4EOH A;  2C49 A;  2DDO A;  3IE7 A;  2ABQ A;  3N1C A;  4S1I B;  2AB8 A;  3RT7 A;  1UA4 A;  3RY7 A;  2C4E A;  3RPZ A;  4N08 A;  3UMP A;  2DDM A;  4C5L A;  4LBX A;  4XCK A;  3RTE A;  4DU5 A;  4E69 A;  2JG5 A;  4EUM A;  5B6A A;  3RSS A;  3NCA A;  1YGK A;  4E8Z A;  4C5M A;  2I6A A;  5F11 A;  4E8W A;  3KEU A;  2HW1 A;  2A9Y A;  4XDA A;  3FHX A;  3HYO A;  3IBQ A;  4KAH A;  1LHR A;  1VI9 A;  3GO7 A;  3PL2 A;  3RQ2 A;  3RSG A;  2HLZ A;  3MBH A;  5C41 A;  4LC4 A;  5F0Z A;  3RS8 A;  3BF5 A;  4U7X A;  2I5B A;  2QHP A;  2ABS A;  2VAR A;  3HPD A;  2FV7 A;  3Q92 A;  3QA2 A;  5CM5 A;  4WJM A;  3LOO A;  3RQ8 A;  4B8R A;  1RFT A;  2AJR A;  1JXI A;  3Q1Y A;  3RT9 A;  2XTB A;  4JKU A;  1L2L A;  3NM1 A;  3KZH A;  3I3Y A;  4O1L A;  3B1P A;  3B3L A;  4B8S A;  3RQX A;  2YXT A;  3NL2 A;  3LKI A;  5EYN A;  4K8K A;  4YWR A;  1WYE A;  3PZS A;  3OTX A;  1EKQ A;  3HIC A;  4JKS A;  4C5N A;  5BYD A;  1LIO A;  1V19 A;  3RU3 A;  3IKH A;  2PKK A;  5BYF A;  3ZS7 A;  1RKD A;  2AFB A;  4S1H A;  2QCV A;  4K8T A;  4E3A A;  5BYE A;  3EWM A;  3IQ0 A;  3RS9 A;  3NBV A;  4K8P A;  3JUL A;  3RTA A;  3RU2 A;  4E84 A;  1LHP A;  3RM5 A;  2F02 A;  4UBE A;  1JXH A;  3RQQ A;  4DC3 A;  4K9I A;  2F7K A;  5BYC A;  1ESJ A;  1YGJ A;  2I6B A;  5C40 A;  3W4S A;  4KAD A;  3RPH A;  4X8F A;  3NC9 A;  1DGM A;  3VAQ A;  2RBC A;  3FHY A;  3BGK A;  5EY7 A;  3UMO A;  3KTN A;  2DCN A;  3RQH A;  4EN4 A;  4GM6 A;  2PKF A;  3RTC A;  1ESQ A;  1GQT A;  1EKK A;  3RRB A;  3RQ5 A;  2V78 A;  3RTD A;  3RSQ A;  2NWH A;  2JGV A;  3B1R A;  2YXU A;  3RO4 A;  1V1B A;  1U2X A;  3B1Q A;  4K8C A;  4C5J A;  3CQD A;  4N09 A;  1RKS A;  3UQ9 A;  2R3E A;  3KD6 A;  4LBG A;  4E8Y A;  1LIK A;  3RRJ A;  3VAS A;  1RKA A;  4KAN A;  5C3Z A;  2PKN A;  3NL3 A;  4KBE A;  1LII A;  2R3B A;  5TRW A;  1GC5 A;  3H74 A;  3NM3 A;  4S1I A;  1TZ6 A;  3K5W A;  3GO6 A;  3RTB A;  1TZ3 A;  2DDW A;  3NC2 A;  3NL5 A;  2Q5R A;  3H49 A;  3RRF A;  2A9Z A;  3DRW A;  3RQ6 A;  1RK2 A;  5C3Y A;  3RTG A;  4XF7 A;  3MBJ A;  5TQI A;  3NBW A;  2AJP A;  3B1N A;  1VM7 A;  3UQ6 A;  2AX3 A;  3B1O A;  1RFU A;  4YL5 A;  1TD2 A;  3UQD A;  1C3Q A;  4K93 A;  1KYH A;  2JG1 A;  4O1G A;  4S1M A;  5CGA A;  1V1S A;  4PVV A;  5COJ A;  3GBU A;  4C5K A;  5CGE A;  3LHX A;  1LIJ A;  2HQQ A;  1BX4 A;  4JJP A;  3K9E A;  1TYY A;  3UQE A;  1UB0 A;  1VK4 A;  3RSF A;  2AA0 A;  1RFV A;  3LJS A;  4LCA A;  3DZV A;  3QAI A;  4EBU A; 
#chains in the Genus database with same CATH topology
 2GC6 A;  2VOS A;  2AWD A;  4K9C A;  4KAL A;  1GQY A;  3N2A A;  1YHJ A;  3IH0 A;  1V1A A;  2PKM A;  3PYZ A;  3QCZ A;  1W78 A;  4XF6 A;  3RRE A;  3IN1 A;  3NL6 A;  4EOH A;  2C49 A;  2DDO A;  3IE7 A;  2ABQ A;  3N1C A;  4S1I B;  2AB8 A;  2AM2 A;  1UA4 A;  3RT7 A;  3RY7 A;  2C4E A;  3LK7 A;  3RPZ A;  4N08 A;  3UMP A;  2DDM A;  4C5L A;  4LBX A;  4XCK A;  3RTE A;  4DU5 A;  4E69 A;  3HN7 A;  3ZL8 A;  2JG5 A;  4EUM A;  5B6A A;  3RSS A;  3NCA A;  1J6U A;  1YGK A;  4E8Z A;  4C5M A;  2I6A A;  2WTZ A;  2VOR A;  4E8W A;  5F11 A;  2XJA A;  3EAG A;  3KEU A;  2HW1 A;  2A9Y A;  4XDA A;  3FHX A;  3HYO A;  3IBQ A;  4KAH A;  1LHR A;  1VI9 A;  3GO7 A;  3PL2 A;  3RQ2 A;  3RSG A;  2HLZ A;  3MBH A;  3ZM5 A;  4LC4 A;  5C41 A;  3RS8 A;  1EEH A;  3BF5 A;  4U7X A;  2I5B A;  2QHP A;  2ABS A;  2VAR A;  3HPD A;  2FV7 A;  3Q92 A;  3QA2 A;  5CM5 A;  4WJM A;  3LOO A;  3RQ8 A;  4B8R A;  4CVM A;  1RFT A;  2AJR A;  1JXI A;  3Q1Y A;  3RT9 A;  1P3D A;  2XTB A;  1JBW A;  4JKU A;  3UBO A;  5A5F A;  1L2L A;  3NM1 A;  3KZH A;  3I3Y A;  4O1L A;  3B1P A;  3B3L A;  4B8S A;  3RQX A;  4BUB A;  2YXT A;  2X5O A;  3NL2 A;  3LKI A;  5EYN A;  4K8K A;  2UUP A;  4YWR A;  1WYE A;  3PZS A;  3OTX A;  1EKQ A;  3HIC A;  4JKS A;  4C5N A;  5BYD A;  1GQQ A;  4C12 A;  1LIO A;  1V19 A;  1E0D A;  3IKH A;  2PKK A;  3RU3 A;  3ZS7 A;  1RKD A;  2AFB A;  2VTD A;  2QCV A;  4K8T A;  4S1H A;  4E3A A;  5BYF A;  3EWM A;  3IQ0 A;  3RS9 A;  3NBV A;  4QF5 A;  4K8P A;  3JUL A;  3RTA A;  3RU2 A;  4E84 A;  1LHP A;  1P31 A;  2GCB A;  3RM5 A;  2F02 A;  4UBE A;  1JXH A;  3RQQ A;  4DC3 A;  4K9I A;  2F7K A;  5A5E A;  1ESJ A;  5BYC A;  1YGJ A;  2I6B A;  2Y68 A;  5C40 A;  3W4S A;  1W7K A;  2Y1O A;  4KAD A;  4QDI A;  4X8F A;  3RPH A;  3NC9 A;  1DGM A;  3VAQ A;  2RBC A;  2UAG A;  3BGK A;  3FHY A;  5EY7 A;  3UMO A;  2XPC A;  2DCN A;  3KTN A;  3RQH A;  4EN4 A;  4GM6 A;  2PKF A;  3RTC A;  1ESQ A;  2GCA A;  1GQT A;  1EKK A;  3RRB A;  3RQ5 A;  2V78 A;  3RTD A;  3RSQ A;  5F0Z A;  2NWH A;  2JGV A;  3B1R A;  2YXU A;  3RO4 A;  1V1B A;  1U2X A;  2Y66 A;  3B1Q A;  4HV4 A;  4K8C A;  4C5J A;  3CQD A;  4N09 A;  1RKS A;  3UQ9 A;  2R3E A;  2JFG A;  3KD6 A;  4LBG A;  4E8Y A;  1LIK A;  1GG4 A;  2AM1 A;  3RRJ A;  3VAS A;  1RKA A;  4KAN A;  5C3Z A;  2PKN A;  3NRS A;  3NL3 A;  4KBE A;  1LII A;  2R3B A;  5TRW A;  1GC5 A;  2VTE A;  3H74 A;  3NM3 A;  4S1I A;  1TZ6 A;  3K5W A;  3GO6 A;  5BYE A;  3RTB A;  1TZ3 A;  2DDW A;  2JFH A;  3NC2 A;  3NL5 A;  2Q5R A;  3H49 A;  4CVL A;  3RRF A;  2A9Z A;  3DRW A;  3RQ6 A;  1RK2 A;  5C3Y A;  3RTG A;  4XF7 A;  3MBJ A;  5TQI A;  3NBW A;  2AJP A;  3HJ6 A;  3B1N A;  3ZM6 A;  1VM7 A;  3UQ6 A;  2AX3 A;  3B1O A;  1RFU A;  4YL5 A;  1TD2 A;  3UQD A;  1C3Q A;  4K93 A;  1KYH A;  2JG1 A;  4O1G A;  2UUO A;  4S1M A;  1V1S A;  5CGA A;  4PVV A;  5COJ A;  1E8C A;  3GBU A;  4UAG A;  4C5K A;  4CVK A;  5CGE A;  1FGS A;  4C13 A;  2GC5 A;  3LHX A;  1LIJ A;  2HQQ A;  1BX4 A;  2F00 A;  2JFF A;  4JJP A;  1UAG A;  1O5Z A;  3K9E A;  1TYY A;  2WJP A;  3UQE A;  1UB0 A;  1VK4 A;  4ZIY A;  3UAG A;  4BUC A;  3RSF A;  2AA0 A;  1RFV A;  3LJS A;  4LCA A;  3DZV A;  3QAI A;  1JBV A;  2Y67 A;  4EBU A; 
#chains in the Genus database with same CATH homology
 4K9C A;  2AWD A;  4KAL A;  3UBO A;  1YHJ A;  3IH0 A;  1V1A A;  2PKM A;  4XF6 A;  3RRE A;  3IN1 A;  3NL6 A;  4EOH A;  2C49 A;  2DDO A;  3IE7 A;  2ABQ A;  3N1C A;  4S1I B;  2AB8 A;  3RT7 A;  1UA4 A;  3RY7 A;  2C4E A;  3RPZ A;  4N08 A;  3UMP A;  2DDM A;  4C5L A;  4LBX A;  4XCK A;  3RTE A;  4DU5 A;  4E69 A;  2JG5 A;  4EUM A;  5B6A A;  3RSS A;  3NCA A;  1YGK A;  4E8Z A;  4C5M A;  2I6A A;  5F11 A;  4E8W A;  3KEU A;  2HW1 A;  2A9Y A;  4XDA A;  3FHX A;  3HYO A;  3IBQ A;  4KAH A;  1LHR A;  1VI9 A;  3GO7 A;  3PL2 A;  3RQ2 A;  3RSG A;  2HLZ A;  3MBH A;  5C41 A;  4LC4 A;  5F0Z A;  3RS8 A;  3BF5 A;  4U7X A;  2I5B A;  2QHP A;  2ABS A;  2VAR A;  3HPD A;  2FV7 A;  3Q92 A;  3QA2 A;  5CM5 A;  4WJM A;  3LOO A;  3RQ8 A;  4B8R A;  1RFT A;  2AJR A;  1JXI A;  3Q1Y A;  3RT9 A;  2XTB A;  4JKU A;  1L2L A;  3NM1 A;  3KZH A;  3I3Y A;  4O1L A;  3B1P A;  3B3L A;  4B8S A;  3RQX A;  2YXT A;  3NL2 A;  3LKI A;  5EYN A;  4K8K A;  4YWR A;  1WYE A;  3PZS A;  3OTX A;  1EKQ A;  3HIC A;  4JKS A;  4C5N A;  5BYD A;  1LIO A;  1V19 A;  3RU3 A;  3IKH A;  2PKK A;  5BYF A;  3ZS7 A;  1RKD A;  2AFB A;  4S1H A;  2QCV A;  4K8T A;  4E3A A;  5BYE A;  3EWM A;  3IQ0 A;  3RS9 A;  3NBV A;  4K8P A;  3JUL A;  3RTA A;  3RU2 A;  4E84 A;  1LHP A;  3RM5 A;  2F02 A;  4UBE A;  1JXH A;  3RQQ A;  4DC3 A;  4K9I A;  2F7K A;  5BYC A;  1ESJ A;  1YGJ A;  2I6B A;  5C40 A;  3W4S A;  4KAD A;  3RPH A;  4X8F A;  3NC9 A;  1DGM A;  3VAQ A;  2RBC A;  3FHY A;  3BGK A;  5EY7 A;  3UMO A;  3KTN A;  2DCN A;  3RQH A;  4EN4 A;  4GM6 A;  2PKF A;  3RTC A;  1ESQ A;  1GQT A;  1EKK A;  3RRB A;  3RQ5 A;  2V78 A;  3RTD A;  3RSQ A;  2NWH A;  2JGV A;  3B1R A;  2YXU A;  3RO4 A;  1V1B A;  1U2X A;  3B1Q A;  4K8C A;  4C5J A;  3CQD A;  4N09 A;  1RKS A;  3UQ9 A;  2R3E A;  3KD6 A;  4LBG A;  4E8Y A;  1LIK A;  3RRJ A;  3VAS A;  1RKA A;  4KAN A;  5C3Z A;  2PKN A;  3NL3 A;  4KBE A;  1LII A;  2R3B A;  5TRW A;  1GC5 A;  3H74 A;  3NM3 A;  4S1I A;  1TZ6 A;  3K5W A;  3GO6 A;  3RTB A;  1TZ3 A;  2DDW A;  3NC2 A;  3NL5 A;  2Q5R A;  3H49 A;  3RRF A;  2A9Z A;  3DRW A;  3RQ6 A;  1RK2 A;  5C3Y A;  3RTG A;  4XF7 A;  3MBJ A;  5TQI A;  3NBW A;  2AJP A;  3HJ6 A;  3B1N A;  1VM7 A;  3UQ6 A;  2AX3 A;  3B1O A;  1RFU A;  4YL5 A;  1TD2 A;  3UQD A;  1C3Q A;  4K93 A;  1KYH A;  2JG1 A;  4O1G A;  4S1M A;  5CGA A;  1V1S A;  4PVV A;  5COJ A;  3GBU A;  4C5K A;  5CGE A;  3LHX A;  1LIJ A;  2HQQ A;  1BX4 A;  4JJP A;  3K9E A;  1TYY A;  3UQE A;  1UB0 A;  1VK4 A;  3RSF A;  2AA0 A;  1RFV A;  3LJS A;  4LCA A;  3DZV A;  3QAI A;  4EBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...