3VASA

Adenosine kinase from schistosoma mansoni in complex with adenosine in occluded loop conformation
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
345
structure length
345
Chain Sequence
DLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAACDLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGDAFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Putative adenosine kinase
total genus 123
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 3vasA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3vasA01
2HLZA 4E84A 3HYOA 1RKAA 3UQDA 4K9IA 3UQ6A 3RQQA 1YGKA 3UMPA 4EN4A 5TQIA 1ESJA 1C3QA 4KALA 5C40A 3B3LA 3BGKA 4WJMA 2C49A 2YXUA 2YXTA 3IBQA 2AJRA 3RTEA 3LHXA 4K9CA 3B1NA 5C3ZA 3NBVA 3OTXA 1UB0A 1LHRA 3B1PA 5COJA 3RS9A 4S1IA 4S1MA 1V1SA 2QHPA 3RS8A 2AFBA 3RTCA 4EBUA 2VARA 3IKHA 2AWDA 5BYEA 4N09A 2I5BA 4K8KA 3H49A 3MBJA 1V1AA 5EY7A 1RKSA 2AB8A 2R3BA 2HQQA 2ABSA 4LBXA 3LJSA 3NBWA 2PKNA 4YL5A 2DDMA 1RK2A 3Q92A 1U2XA 1V19A 4K93A 1WYEA 4XCKA 3ZS7A 3CQDA 5CM5A 4KADA 3UQ9A 1TYYA 1VI9A 5BYFA 3PL2A 4JKSA 4O1GA 3RT7A 1ESQA 3IE7A 3VAQA 4E8YA 3LKIA 3VASA 3NM1A 2HW1A 3KD6A 1V1BA 1RKDA 3NL5A 3H74A 1JXIA 4C5LA 3EWMA 4C5MA 3DZVA 4LBGA 4XF6A 2Q5RA 4EOHA 3IQ0A 1VM7A 2PKFA 3RPZA 3FHXA 1TZ3A 3JULA 3FHYA 3LOOA 3NC2A 3QAIA 4LC4A 3RM5A 3KZHA 4JKUA 3RRJA 1BX4A 2F7KA 2NWHA 3RSGA 3RSFA 3HPDA 4LCAA 1JXHA 1RFVA 2DDWA 3HICA 3RO4A 2PKKA 2DCNA 2C4EA 3RQ2A 3N1CA 1LIJA 4KBEA 4K8PA 3RY7A 1L2LA 2FV7A 3RRFA 2A9YA 2QCVA 3Q1YA 3NL2A 2AX3A 4DU5A 1EKQA 1RFUA 3B1RA 3NL3A 4E3AA 4YWRA 3K5WA 1KYHA 3UBOA 2A9ZA 2JG5A 3RTDA 3NL6A 2RBCA 2XTBA 3PZSA 1LIIA 3KTNA 4B8SA 3GO7A 4U7XA 1UA4A 1YGJA 3RU3A 1TD2A 4E8ZA 2PKMA 5BYCA 3RRBA 3B1QA 2I6BA 3RTBA 4N08A 3RT9A 3MBHA 4XDAA 1VK4A 1GQTA 4DC3A 1TZ6A 4C5NA 3RQ6A 3UQEA 3I3YA 5F0ZA 3RTGA 3UMOA 4E8WA 4EUMA 3RQ5A 3RREA 4X8FA 2I6AA 3RQHA 5BYDA 1RFTA 3NC9A 1LIKA 4C5JA 4S1IB 2JGVA 2JG1A 3BF5A 5B6AA 4PVVA 4KAHA 1LHPA 3NCAA 4B8RA 3RSSA 4S1HA 2AA0A 1DGMA 1GC5A 4C5KA 3RQXA 4K8CA 3RTAA 4O1LA 2ABQA 3DRWA 3RSQA 4E69A 2F02A 5C3YA 3GO6A 3NM3A 4KANA 1LIOA 5EYNA 3K9EA 5CGAA 5CGEA 2DDOA 2R3EA 5F11A 2AJPA 1EKKA 3IN1A 3B1OA 5TRWA 3GBUA 2V78A 3KEUA 4GM6A 4JJPA 1YHJA 3IH0A 4UBEA 4XF7A 3W4SA 4K8TA 3RPHA 3RQ8A 5C41A 3RU2A 3QA2A
chains in the Genus database with same CATH superfamily
2HLZA 4E84A 3HYOA 1RKAA 4CVMA 4CVKA 4K9IA 3UQ6A 3RQQA 1YGKA 5A5EA 3UQDA 2AM2A 3UMPA 4EN4A 5TQIA 2VORA 1ESJA 1C3QA 4KALA 3ZS7A 5C40A 3B3LA 3BGKA 1JBWA 4WJMA 2C49A 2YXUA 1W7KA 2YXTA 3IBQA 2AJRA 3RTEA 3LHXA 4K9CA 3B1NA 5C3ZA 3NBVA 3OTXA 1UB0A 1LHRA 3B1PA 3HN7A 3NRSA 4S1IA 4S1MA 1V1SA 2QHPA 5COJA 2AFBA 3RTCA 4EBUA 2VARA 3IKHA 2AWDA 5BYEA 4N09A 1E0DA 2I5BA 3H49A 4K8KA 3MBJA 1V1AA 5EY7A 2AM1A 1RKSA 2AB8A 2R3BA 2HQQA 2ABSA 4LBXA 3LJSA 3NBWA 2PKNA 4YL5A 2UAGA 4CVLA 3HJ6A 2DDMA 1RK2A 2XJAA 1U2XA 1V19A 3Q92A 1WYEA 4K93A 4XCKA 3RS8A 2UUPA 3CQDA 5CM5A 4KADA 3UQ9A 1FGSA 1TYYA 2WTZA 1VI9A 3ZL8A 1P3DA 3PL2A 4JKSA 5A5FA 5BYFA 2Y1OA 4C12A 1GQYA 2VOSA 2WJPA 1ESQA 3IE7A 3VAQA 4O1GA 2Y67A 3RT7A 4E8YA 3LKIA 3VASA 2GC5A 3NM1A 2HW1A 3KD6A 1V1BA 1RKDA 3NL5A 2VTEA 1JXIA 3H74A 3EWMA 4C5MA 3DZVA 4LBGA 4XF6A 2Q5RA 4EOHA 3IQ0A 1VM7A 2PKFA 3RPZA 3FHXA 1TZ3A 3JULA 3FHYA 3LOOA 3NC2A 3QAIA 4LC4A 3RM5A 3KZHA 4JKUA 3RRJA 1BX4A 2F7KA 2NWHA 3RSGA 3RSFA 2GC6A 3HPDA 4LCAA 1JXHA 1RFVA 2DDWA 3HICA 3RO4A 2PKKA 2DCNA 2C4EA 2Y68A 1EEHA 3RQ2A 3N1CA 1LIJA 2GCBA 4KBEA 4K8PA 1L2LA 2FV7A 3RY7A 3RRFA 2A9YA 4HV4A 4BUBA 2QCVA 3Q1YA 3NL2A 2AX3A 3QCZA 1EKQA 1GG4A 3RS9A 3ZM5A 1RFUA 4DU5A 3B1RA 3NL3A 4E3AA 4YWRA 2JFFA 3K5WA 1KYHA 3UBOA 1W78A 2A9ZA 2JG5A 3RTDA 3NL6A 2RBCA 2XTBA 3PZSA 1LIIA 3ZM6A 3KTNA 4B8SA 1JBVA 2F00A 3GO7A 4U7XA 1UA4A 1YGJA 3RU3A 1UAGA 1TD2A 4E8ZA 2JFGA 2PKMA 5BYCA 1GQQA 3RRBA 1O5ZA 3B1QA 2I6BA 1P31A 2JFHA 3RTBA 4N08A 3RT9A 3MBHA 4XDAA 1VK4A 1GQTA 3UAGA 4DC3A 1TZ6A 2Y66A 3RQ6A 3UQEA 3I3YA 4C5NA 3LK7A 4ZIYA 5F0ZA 3RTGA 3UMOA 4E8WA 4EUMA 3RQ5A 3RREA 4X8FA 2I6AA 3RQHA 4QDIA 4UAGA 5BYDA 1RFTA 4C13A 3NC9A 1LIKA 4C5JA 4S1IB 2JGVA 4QF5A 2UUOA 2JG1A 3BF5A 5B6AA 2VTDA 4KAHA 1LHPA 4PVVA 3NCAA 4B8RA 4BUCA 3RSSA 4S1HA 2AA0A 3N2AA 1DGMA 4C5LA 1GC5A 4C5KA 3RQXA 4K8CA 3RTAA 4O1LA 2ABQA 3EAGA 3DRWA 3RSQA 2X5OA 4E69A 2F02A 3W4SA 5C3YA 3GO6A 3NM3A 4KANA 1LIOA 5EYNA 3RU2A 3K9EA 5CGAA 5CGEA 2DDOA 2R3EA 3PYZA 5F11A 2AJPA 1EKKA 3IN1A 3B1OA 5TRWA 3GBUA 2V78A 3KEUA 4GM6A 4JJPA 1J6UA 1YHJA 3IH0A 4UBEA 1E8CA 4K8TA 4XF7A 2GCAA 2XPCA 3RPHA 3RQ8A 5C41A 3QA2A
chains in the Genus database with same CATH topology
2HLZA 4E84A 3HYOA 1RKAA 3UQDA 4K9IA 3UQ6A 3RQQA 1YGKA 3UMPA 4EN4A 5TQIA 1ESJA 1C3QA 4KALA 5C40A 3B3LA 3BGKA 4WJMA 2C49A 2YXUA 2YXTA 3IBQA 2AJRA 3RTEA 3LHXA 4K9CA 3B1NA 5C3ZA 3NBVA 3OTXA 1UB0A 1LHRA 3B1PA 5COJA 3RS9A 4S1IA 4S1MA 1V1SA 2QHPA 3RS8A 2AFBA 3RTCA 4EBUA 2VARA 3IKHA 2AWDA 5BYEA 4N09A 2I5BA 4K8KA 3H49A 3MBJA 1V1AA 5EY7A 1RKSA 2AB8A 2R3BA 2HQQA 2ABSA 4LBXA 3LJSA 3NBWA 2PKNA 4YL5A 3HJ6A 2DDMA 1RK2A 3Q92A 1U2XA 1V19A 4K93A 1WYEA 4XCKA 3ZS7A 3CQDA 5CM5A 4KADA 3UQ9A 1TYYA 1VI9A 5BYFA 3PL2A 4JKSA 4O1GA 3RT7A 1ESQA 3IE7A 3VAQA 4E8YA 3LKIA 3VASA 3NM1A 2HW1A 3KD6A 1V1BA 1RKDA 3NL5A 3H74A 1JXIA 4C5LA 3EWMA 4C5MA 3DZVA 4LBGA 4XF6A 2Q5RA 4EOHA 3IQ0A 1VM7A 2PKFA 3RPZA 3FHXA 1TZ3A 3JULA 3FHYA 3LOOA 3NC2A 3QAIA 4LC4A 3RM5A 3KZHA 4JKUA 3RRJA 1BX4A 2F7KA 2NWHA 3RSGA 3RSFA 3HPDA 4LCAA 1JXHA 1RFVA 2DDWA 3HICA 3RO4A 2PKKA 2DCNA 2C4EA 3RQ2A 3N1CA 1LIJA 4KBEA 4K8PA 3RY7A 1L2LA 2FV7A 3RRFA 2A9YA 2QCVA 3Q1YA 3NL2A 2AX3A 4DU5A 1EKQA 1RFUA 3B1RA 3NL3A 4E3AA 4YWRA 3K5WA 1KYHA 3UBOA 2A9ZA 2JG5A 3RTDA 3NL6A 2RBCA 2XTBA 3PZSA 1LIIA 3KTNA 4B8SA 3GO7A 4U7XA 1UA4A 1YGJA 3RU3A 1TD2A 4E8ZA 2PKMA 5BYCA 3RRBA 3B1QA 2I6BA 3RTBA 4N08A 3RT9A 3MBHA 4XDAA 1VK4A 1GQTA 4DC3A 1TZ6A 4C5NA 3RQ6A 3UQEA 3I3YA 5F0ZA 3RTGA 3UMOA 4E8WA 4EUMA 3RQ5A 3RREA 4X8FA 2I6AA 3RQHA 5BYDA 1RFTA 3NC9A 1LIKA 4C5JA 4S1IB 2JGVA 2JG1A 3BF5A 5B6AA 4PVVA 4KAHA 1LHPA 3NCAA 4B8RA 3RSSA 4S1HA 2AA0A 1DGMA 1GC5A 4C5KA 3RQXA 4K8CA 3RTAA 4O1LA 2ABQA 3DRWA 3RSQA 4E69A 2F02A 5C3YA 3GO6A 3NM3A 4KANA 1LIOA 5EYNA 3K9EA 5CGAA 5CGEA 2DDOA 2R3EA 5F11A 2AJPA 1EKKA 3IN1A 3B1OA 5TRWA 3GBUA 2V78A 3KEUA 4GM6A 4JJPA 1YHJA 3IH0A 4UBEA 4XF7A 3W4SA 4K8TA 3RPHA 3RQ8A 5C41A 3RU2A 3QA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLZ A;  4E84 A;  3HYO A;  1RKA A;  3UQD A;  4K9I A;  3UQ6 A;  3RQQ A;  1YGK A;  3UMP A;  4EN4 A;  5TQI A;  1ESJ A;  1C3Q A;  4KAL A;  5C40 A;  3B3L A;  3BGK A;  4WJM A;  2C49 A;  2YXU A;  2YXT A;  3IBQ A;  2AJR A;  3RTE A;  3LHX A;  4K9C A;  3B1N A;  5C3Z A;  3NBV A;  3OTX A;  1UB0 A;  1LHR A;  3B1P A;  5COJ A;  3RS9 A;  4S1I A;  4S1M A;  1V1S A;  2QHP A;  3RS8 A;  2AFB A;  3RTC A;  4EBU A;  2VAR A;  3IKH A;  2AWD A;  5BYE A;  4N09 A;  2I5B A;  4K8K A;  3H49 A;  3MBJ A;  1V1A A;  5EY7 A;  1RKS A;  2AB8 A;  2R3B A;  2HQQ A;  2ABS A;  4LBX A;  3LJS A;  3NBW A;  2PKN A;  4YL5 A;  2DDM A;  1RK2 A;  3Q92 A;  1U2X A;  1V19 A;  4K93 A;  1WYE A;  4XCK A;  3ZS7 A;  3CQD A;  5CM5 A;  4KAD A;  3UQ9 A;  1TYY A;  1VI9 A;  5BYF A;  3PL2 A;  4JKS A;  4O1G A;  3RT7 A;  1ESQ A;  3IE7 A;  3VAQ A;  4E8Y A;  3LKI A;  3VAS A;  3NM1 A;  2HW1 A;  3KD6 A;  1V1B A;  1RKD A;  3NL5 A;  3H74 A;  1JXI A;  4C5L A;  3EWM A;  4C5M A;  3DZV A;  4LBG A;  4XF6 A;  2Q5R A;  4EOH A;  3IQ0 A;  1VM7 A;  2PKF A;  3RPZ A;  3FHX A;  1TZ3 A;  3JUL A;  3FHY A;  3LOO A;  3NC2 A;  3QAI A;  4LC4 A;  3RM5 A;  3KZH A;  4JKU A;  3RRJ A;  1BX4 A;  2F7K A;  2NWH A;  3RSG A;  3RSF A;  3HPD A;  4LCA A;  1JXH A;  1RFV A;  2DDW A;  3HIC A;  3RO4 A;  2PKK A;  2DCN A;  2C4E A;  3RQ2 A;  3N1C A;  1LIJ A;  4KBE A;  4K8P A;  3RY7 A;  1L2L A;  2FV7 A;  3RRF A;  2A9Y A;  2QCV A;  3Q1Y A;  3NL2 A;  2AX3 A;  4DU5 A;  1EKQ A;  1RFU A;  3B1R A;  3NL3 A;  4E3A A;  4YWR A;  3K5W A;  1KYH A;  3UBO A;  2A9Z A;  2JG5 A;  3RTD A;  3NL6 A;  2RBC A;  2XTB A;  3PZS A;  1LII A;  3KTN A;  4B8S A;  3GO7 A;  4U7X A;  1UA4 A;  1YGJ A;  3RU3 A;  1TD2 A;  4E8Z A;  2PKM A;  5BYC A;  3RRB A;  3B1Q A;  2I6B A;  3RTB A;  4N08 A;  3RT9 A;  3MBH A;  4XDA A;  1VK4 A;  1GQT A;  4DC3 A;  1TZ6 A;  4C5N A;  3RQ6 A;  3UQE A;  3I3Y A;  5F0Z A;  3RTG A;  3UMO A;  4E8W A;  4EUM A;  3RQ5 A;  3RRE A;  4X8F A;  2I6A A;  3RQH A;  5BYD A;  1RFT A;  3NC9 A;  1LIK A;  4C5J A;  4S1I B;  2JGV A;  2JG1 A;  3BF5 A;  5B6A A;  4PVV A;  4KAH A;  1LHP A;  3NCA A;  4B8R A;  3RSS A;  4S1H A;  2AA0 A;  1DGM A;  1GC5 A;  4C5K A;  3RQX A;  4K8C A;  3RTA A;  4O1L A;  2ABQ A;  3DRW A;  3RSQ A;  4E69 A;  2F02 A;  5C3Y A;  3GO6 A;  3NM3 A;  4KAN A;  1LIO A;  5EYN A;  3K9E A;  5CGA A;  5CGE A;  2DDO A;  2R3E A;  5F11 A;  2AJP A;  1EKK A;  3IN1 A;  3B1O A;  5TRW A;  3GBU A;  2V78 A;  3KEU A;  4GM6 A;  4JJP A;  1YHJ A;  3IH0 A;  4UBE A;  4XF7 A;  3W4S A;  4K8T A;  3RPH A;  3RQ8 A;  5C41 A;  3RU2 A;  3QA2 A; 
#chains in the Genus database with same CATH topology
 2HLZ A;  4E84 A;  3HYO A;  1RKA A;  4CVM A;  4CVK A;  4K9I A;  3UQ6 A;  3RQQ A;  1YGK A;  5A5E A;  3UQD A;  2AM2 A;  3UMP A;  4EN4 A;  5TQI A;  2VOR A;  1ESJ A;  1C3Q A;  4KAL A;  3ZS7 A;  5C40 A;  3B3L A;  3BGK A;  1JBW A;  4WJM A;  2C49 A;  2YXU A;  1W7K A;  2YXT A;  3IBQ A;  2AJR A;  3RTE A;  3LHX A;  4K9C A;  3B1N A;  5C3Z A;  3NBV A;  3OTX A;  1UB0 A;  1LHR A;  3B1P A;  3HN7 A;  3NRS A;  4S1I A;  4S1M A;  1V1S A;  2QHP A;  5COJ A;  2AFB A;  3RTC A;  4EBU A;  2VAR A;  3IKH A;  2AWD A;  5BYE A;  4N09 A;  1E0D A;  2I5B A;  3H49 A;  4K8K A;  3MBJ A;  1V1A A;  5EY7 A;  2AM1 A;  1RKS A;  2AB8 A;  2R3B A;  2HQQ A;  2ABS A;  4LBX A;  3LJS A;  3NBW A;  2PKN A;  4YL5 A;  2UAG A;  4CVL A;  3HJ6 A;  2DDM A;  1RK2 A;  2XJA A;  1U2X A;  1V19 A;  3Q92 A;  1WYE A;  4K93 A;  4XCK A;  3RS8 A;  2UUP A;  3CQD A;  5CM5 A;  4KAD A;  3UQ9 A;  1FGS A;  1TYY A;  2WTZ A;  1VI9 A;  3ZL8 A;  1P3D A;  3PL2 A;  4JKS A;  5A5F A;  5BYF A;  2Y1O A;  4C12 A;  1GQY A;  2VOS A;  2WJP A;  1ESQ A;  3IE7 A;  3VAQ A;  4O1G A;  2Y67 A;  3RT7 A;  4E8Y A;  3LKI A;  3VAS A;  2GC5 A;  3NM1 A;  2HW1 A;  3KD6 A;  1V1B A;  1RKD A;  3NL5 A;  2VTE A;  1JXI A;  3H74 A;  3EWM A;  4C5M A;  3DZV A;  4LBG A;  4XF6 A;  2Q5R A;  4EOH A;  3IQ0 A;  1VM7 A;  2PKF A;  3RPZ A;  3FHX A;  1TZ3 A;  3JUL A;  3FHY A;  3LOO A;  3NC2 A;  3QAI A;  4LC4 A;  3RM5 A;  3KZH A;  4JKU A;  3RRJ A;  1BX4 A;  2F7K A;  2NWH A;  3RSG A;  3RSF A;  2GC6 A;  3HPD A;  4LCA A;  1JXH A;  1RFV A;  2DDW A;  3HIC A;  3RO4 A;  2PKK A;  2DCN A;  2C4E A;  2Y68 A;  1EEH A;  3RQ2 A;  3N1C A;  1LIJ A;  2GCB A;  4KBE A;  4K8P A;  1L2L A;  2FV7 A;  3RY7 A;  3RRF A;  2A9Y A;  4HV4 A;  4BUB A;  2QCV A;  3Q1Y A;  3NL2 A;  2AX3 A;  3QCZ A;  1EKQ A;  1GG4 A;  3RS9 A;  3ZM5 A;  1RFU A;  4DU5 A;  3B1R A;  3NL3 A;  4E3A A;  4YWR A;  2JFF A;  3K5W A;  1KYH A;  3UBO A;  1W78 A;  2A9Z A;  2JG5 A;  3RTD A;  3NL6 A;  2RBC A;  2XTB A;  3PZS A;  1LII A;  3ZM6 A;  3KTN A;  4B8S A;  1JBV A;  2F00 A;  3GO7 A;  4U7X A;  1UA4 A;  1YGJ A;  3RU3 A;  1UAG A;  1TD2 A;  4E8Z A;  2JFG A;  2PKM A;  5BYC A;  1GQQ A;  3RRB A;  1O5Z A;  3B1Q A;  2I6B A;  1P31 A;  2JFH A;  3RTB A;  4N08 A;  3RT9 A;  3MBH A;  4XDA A;  1VK4 A;  1GQT A;  3UAG A;  4DC3 A;  1TZ6 A;  2Y66 A;  3RQ6 A;  3UQE A;  3I3Y A;  4C5N A;  3LK7 A;  4ZIY A;  5F0Z A;  3RTG A;  3UMO A;  4E8W A;  4EUM A;  3RQ5 A;  3RRE A;  4X8F A;  2I6A A;  3RQH A;  4QDI A;  4UAG A;  5BYD A;  1RFT A;  4C13 A;  3NC9 A;  1LIK A;  4C5J A;  4S1I B;  2JGV A;  4QF5 A;  2UUO A;  2JG1 A;  3BF5 A;  5B6A A;  2VTD A;  4KAH A;  1LHP A;  4PVV A;  3NCA A;  4B8R A;  4BUC A;  3RSS A;  4S1H A;  2AA0 A;  3N2A A;  1DGM A;  4C5L A;  1GC5 A;  4C5K A;  3RQX A;  4K8C A;  3RTA A;  4O1L A;  2ABQ A;  3EAG A;  3DRW A;  3RSQ A;  2X5O A;  4E69 A;  2F02 A;  3W4S A;  5C3Y A;  3GO6 A;  3NM3 A;  4KAN A;  1LIO A;  5EYN A;  3RU2 A;  3K9E A;  5CGA A;  5CGE A;  2DDO A;  2R3E A;  3PYZ A;  5F11 A;  2AJP A;  1EKK A;  3IN1 A;  3B1O A;  5TRW A;  3GBU A;  2V78 A;  3KEU A;  4GM6 A;  4JJP A;  1J6U A;  1YHJ A;  3IH0 A;  4UBE A;  1E8C A;  4K8T A;  4XF7 A;  2GCA A;  2XPC A;  3RPH A;  3RQ8 A;  5C41 A;  3QA2 A; 
#chains in the Genus database with same CATH homology
 2HLZ A;  4E84 A;  3HYO A;  1RKA A;  3UQD A;  4K9I A;  3UQ6 A;  3RQQ A;  1YGK A;  3UMP A;  4EN4 A;  5TQI A;  1ESJ A;  1C3Q A;  4KAL A;  5C40 A;  3B3L A;  3BGK A;  4WJM A;  2C49 A;  2YXU A;  2YXT A;  3IBQ A;  2AJR A;  3RTE A;  3LHX A;  4K9C A;  3B1N A;  5C3Z A;  3NBV A;  3OTX A;  1UB0 A;  1LHR A;  3B1P A;  5COJ A;  3RS9 A;  4S1I A;  4S1M A;  1V1S A;  2QHP A;  3RS8 A;  2AFB A;  3RTC A;  4EBU A;  2VAR A;  3IKH A;  2AWD A;  5BYE A;  4N09 A;  2I5B A;  4K8K A;  3H49 A;  3MBJ A;  1V1A A;  5EY7 A;  1RKS A;  2AB8 A;  2R3B A;  2HQQ A;  2ABS A;  4LBX A;  3LJS A;  3NBW A;  2PKN A;  4YL5 A;  3HJ6 A;  2DDM A;  1RK2 A;  3Q92 A;  1U2X A;  1V19 A;  4K93 A;  1WYE A;  4XCK A;  3ZS7 A;  3CQD A;  5CM5 A;  4KAD A;  3UQ9 A;  1TYY A;  1VI9 A;  5BYF A;  3PL2 A;  4JKS A;  4O1G A;  3RT7 A;  1ESQ A;  3IE7 A;  3VAQ A;  4E8Y A;  3LKI A;  3VAS A;  3NM1 A;  2HW1 A;  3KD6 A;  1V1B A;  1RKD A;  3NL5 A;  3H74 A;  1JXI A;  4C5L A;  3EWM A;  4C5M A;  3DZV A;  4LBG A;  4XF6 A;  2Q5R A;  4EOH A;  3IQ0 A;  1VM7 A;  2PKF A;  3RPZ A;  3FHX A;  1TZ3 A;  3JUL A;  3FHY A;  3LOO A;  3NC2 A;  3QAI A;  4LC4 A;  3RM5 A;  3KZH A;  4JKU A;  3RRJ A;  1BX4 A;  2F7K A;  2NWH A;  3RSG A;  3RSF A;  3HPD A;  4LCA A;  1JXH A;  1RFV A;  2DDW A;  3HIC A;  3RO4 A;  2PKK A;  2DCN A;  2C4E A;  3RQ2 A;  3N1C A;  1LIJ A;  4KBE A;  4K8P A;  3RY7 A;  1L2L A;  2FV7 A;  3RRF A;  2A9Y A;  2QCV A;  3Q1Y A;  3NL2 A;  2AX3 A;  4DU5 A;  1EKQ A;  1RFU A;  3B1R A;  3NL3 A;  4E3A A;  4YWR A;  3K5W A;  1KYH A;  3UBO A;  2A9Z A;  2JG5 A;  3RTD A;  3NL6 A;  2RBC A;  2XTB A;  3PZS A;  1LII A;  3KTN A;  4B8S A;  3GO7 A;  4U7X A;  1UA4 A;  1YGJ A;  3RU3 A;  1TD2 A;  4E8Z A;  2PKM A;  5BYC A;  3RRB A;  3B1Q A;  2I6B A;  3RTB A;  4N08 A;  3RT9 A;  3MBH A;  4XDA A;  1VK4 A;  1GQT A;  4DC3 A;  1TZ6 A;  4C5N A;  3RQ6 A;  3UQE A;  3I3Y A;  5F0Z A;  3RTG A;  3UMO A;  4E8W A;  4EUM A;  3RQ5 A;  3RRE A;  4X8F A;  2I6A A;  3RQH A;  5BYD A;  1RFT A;  3NC9 A;  1LIK A;  4C5J A;  4S1I B;  2JGV A;  2JG1 A;  3BF5 A;  5B6A A;  4PVV A;  4KAH A;  1LHP A;  3NCA A;  4B8R A;  3RSS A;  4S1H A;  2AA0 A;  1DGM A;  1GC5 A;  4C5K A;  3RQX A;  4K8C A;  3RTA A;  4O1L A;  2ABQ A;  3DRW A;  3RSQ A;  4E69 A;  2F02 A;  5C3Y A;  3GO6 A;  3NM3 A;  4KAN A;  1LIO A;  5EYN A;  3K9E A;  5CGA A;  5CGE A;  2DDO A;  2R3E A;  5F11 A;  2AJP A;  1EKK A;  3IN1 A;  3B1O A;  5TRW A;  3GBU A;  2V78 A;  3KEU A;  4GM6 A;  4JJP A;  1YHJ A;  3IH0 A;  4UBE A;  4XF7 A;  3W4S A;  4K8T A;  3RPH A;  3RQ8 A;  5C41 A;  3RU2 A;  3QA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...