3VATA

Crystal structure of dnpep, znmg form
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
469
structure length
458
Chain Sequence
GRARKEAVQAAARELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQRLVHVDRPILRIPHLAIHLQRNVNENFGPNMEMHLVPILATSIQEELEKGERHHSVLTSLLCAHLGLSPEDILEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCSAPASLAADPHVRMIALYDNEEVGSESAQGAQSLLTELVLRRISASPQHLTAFEEAIPKSYMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVASSVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTITLFKGFFELFPSLSRSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartyl aminopeptidase
publication title Insights into substrate specificity and metal activation of Mammalian tetrahedral aspartyl aminopeptidase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 141
structure length 458
sequence length 469
ec nomenclature ec 3.4.11.21: Aspartyl aminopeptidase.
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.250.10 Mainly Beta Roll Aminopeptidase i, Domain 2 Aminopeptidase i, Domain 2 3vatA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3vatA01
1AYEA 3B35A 4G1PA 3N5FA 4K3NA 2IQ6A 1TKHA 4DYOA 4MCPA 4YU9A 3FVLA 4P44A 4ZY2A 1Y0YA 3SI0A 1XMBA 4NGSA 1XFOA 3PBBA 3S9NA 2I3CA 1YSJA 2WZNA 2PCUA 4MXUA 4A37A 1LFWA 3IIBA 2QJ8A 4OMEA 2ZEDA 5LRKA 1Z5RA 3FH4A 3JRUA 2Q4ZA 2PJ6A 1LOKA 3SJEA 3WC5A 4GM5A 1JQGA 4JYWA 2V8VA 3FF3A 2OOTA 2CF4A 4NJRA 3PB8X 1ZG7A 4OC5A 2CTBA 4MCRA 1XBUA 2O53A 3DLJA 3FMCA 3BXMA 2F8HA 2RFHA 4R6TA 1YW6A 3LWUA 2GLJA 2PVWA 3NFZA 3D68A 3KQXA 3PB9X 5LYFA 1CP7A 1LAPA 5F09A 2ZEFA 2AFSA 2PJCA 3PFOA 1CBXA 1VHEA 4Q7AA 4UEEA 1NSAA 3BI0A 4IAVA 5HVHA 2PVVA 1VIXA 2JBKA 8CPAA 1HEEA 2AFXA 3FJUA 4ZY0A 2HB6A 2AFUA 3PB6X 4OC0A 4DUKA 3MN8A 2PE3A 4TWEA 3BI1A 2PJ9A 1TF9A 2PJ4A 3QNVA 2ANPA 4UF4A 3WC6A 1LCPA 3IEHA 3RBUA 4PXCA 5THWA 2PJ2A 2ZEHA 2PIYA 2IJZA 3D7DA 3FX6A 4ZYQA 2RB7A 2NYQA 5IB9A 4LQGA 3H8GA 4A38A 4MHNA 4KSIA 1CP6A 4EWTA 3HUVA 4OC4A 2IMOA 1CG2A 5LRJA 1LANA 2XEGA 4EMEA 2AFWA 2EK8A 3VARA 4ONWA 4P4EA 2C6CA 2EK9A 3L2NA 2ZOFA 3PFEA 4OC1A 3D4UA 4WJBA 3B2YA 2AFOA 1EE3P 2AFZA 3SJFA 1PYTB 4NGPA 4FWUA 1Y0RA 3KZWA 4MHPA 2GREA 4OC2A 1FT7A 4AXVA 3ISZA 1RTQA 4MHYA 1ARLA 4JZ0A 3KR4A 2ZEGA 2GU2A 5HXDA 1HDUA 2AFMA 3BHXA 3TC8A 4X8IA 5K8NA 3CDXA 3IO1A 3PEIA 4UIBA 2EWBA 3S9LA 2XEIA 2NSMA 5D8NA 2F7VA 3B3CA 5JGFA 3D66A 4OP4A 4DJLA 1LAMA 2C6GA 4MCQA 4MCSA 4OIWA 2V8GA 1DE4C 4OKOA 1XJOA 5K8MA 4NGQA 2JBJA 3RZAA 3PRTA 4H2KA 2G9DA 3FEEA 3WT4A 3I1UA 4MMOA 2CIJA 4IK2A 2ZEMA 4P4IA 2V8DA 4A94A 3FEDA 3NH8A 5CBMA 4NGNA 4R7MA 4NFRA 3IC1A 5J1QA 2PJ3A 1BAVA 3HLPA 4WWVA 3GB0A 3PB4X 4ZX8A 2QVPA 5LRGA 4P4JA 3FECA 5K8PA 4MHZA 2GLFA 3B3SA 2Q43A 4P10A 2PRQA 1CX8A 1Q7LA 5LYLA 2O4HA 1F2OA 5JH9A 5LYDA 2PJ0A 5DS0A 4P4BA 2C1CA 3NA6A 4O23A 4UEZA 5JM6A 1Z2LA 5CPAA 4IHMA 4EFDA 2PJBA 3VATA 4OIDA 4FBEA 2BCOA 1R3NA 1YW4A 3V38A 5D29A 3WC7A 3NH4A 3T8WA 1CPSA 4PXBA 2PJ1A 3WABA 2WYRA 1YMEA 4NJQA 4TNUA 4W9YA 3D7HA 2BO9A 3K9TA 1F2PA 3KASA 4PXDA 1HDQA 1GYTA 1Z8LA 3PBEA 1IGBA 3IWWA 1ZLHA 3GUXA 5HVFA 4NGMA 3KL9A 2CTCA 3IFEA 4X3RA 3IJ3A 1Y7EA 5ELYA 4PXEA 3TX8A 2ZEEA 4ZX9A 4Z65A 4ZY1A 2PIZA 2V77A 7CPAA 3KR5A 3VH9A 3KHZA 3MRUA 4RUHA 2ZOGA 2ZEOA 1TKJA 2XEJA 1DTDA 5K8OA 4BD9A 1XRYA 1TKFA 2HC9A 4P4FA 4P6YA 1ELMP 4FAIA 1ZG8A 2XEFA 3KI9A 5HVGA 1PCAA 4NGRA 4CPAA 3NH5A 1KWMA 2PJ8A 2OR4A 3B7IA 3LMSA 2PJ5A 3SI2A 1UWYA 3H8EA 3PB7X 4X2TA 2ZEPA 2ZENA 3KHXA 1BPNA 1H8LA 1ZLIA 2V8HA 3S9MA 2JEWA 3CPXA 2VL1A 3DGVA 3D67A 4PPZA 1R43A 4UIAA 1IY7A 1YLOA 1QQ9A 2FVGA 1QMUA 3V7ZA 4MRIA 3SJGA 1ZG9A 4F9VA 3B3VA 5I4MA 4B6ZA 1TF8A 1AMPA 4F9UA 3KQZA 4OC3A 2POKA 3CT9A 1F57A 2PJ7A 2ZELA 3RAMA 4A39A 4F8ZA 4PQAA 2QYVA 3B3TA 1ELLP 4NGTA 2BOAA 2Q51A 3K2KA 3CPAA 4P4DA 4R76A 1BLLE 2DEAA 2C6PA 2PJAA 5LYIA 1FNOA 3D7FA 4FUUA 1OBRA 6CPAA 4YWYA 3H8FA 3B3WA 4UEFA 4R8FA 1VHOA 3ISXA 1VGYA 3GLJA 4ZI6A 2ABZA 3SI1A 2J9AA 1M4LA 3SJXA 3D7GA 1TXRA 1BPMA 4P45A 3KGQA 1ARMA 1CPXA
chains in the Genus database with same CATH superfamily
1AYEA 3B35A 4G1PA 3N5FA 4K3NA 2P0WA 4CS0B 2IQ6A 1TKHA 3EXNA 4DYOA 2O28A 4FD7A 2Q0YA 4MCPA 1TIQA 4YU9A 3FVLA 2J8NA 5F49A 3TOAA 4P44A 4ZY2A 1Y0YA 3SI0A 1ZO0A 5HMNA 1XMBA 3F5BA 4NF1A 4NGSA 4YFJA 1M4IA 3EC4A 1XFOA 3GKRA 1Z8WA 3PBBA 4MFLA 3S9NA 2I3CA 1YSJA 2WZNA 3DR6A 3GIUA 2PCUA 4MXUA 4A37A 1LFWA 2B58A 1YQEA 4C7HA 4Y49C 4B5PB 4KOTA 3IIBA 2QJ8A 4YRHA 1WWZA 1CJWA 1XIXA 1ON0A 4OMEA 4KOXA 2Q7BA 2ZEDA 4CGMA 2F5IA 5LRKA 1Z5RA 3H4QA 3FH4A 1P0HA 3JRUA 2FT0A 4R3LA 3RNZA 3TT2A 2Q4ZA 2PJ6A 1I12A 4MJ8A 1LOKA 2PQ8A 2ZW7A 4RS2A 3SJEA 3WC5A 4CGPA 2Z3NA 3S6FA 1PUAA 3R9EA 4GM5A 3S6HA 1JQGA 4JYWA 3UY5A 2V8VA 1QSTA 1KUYA 2YNCC 3FF3A 2CF4A 5AGEA 2OOTA 4NJRA 3N7ZA 3PB8X 1ZG7A 4XNHC 4OC5A 2CTBA 1QSNA 2Q7SA 4M85A 4MCRA 1X10A 1XBUA 2O53A 2REFA 3DLJA 3TO6A 4B12A 4CGOA 3FMCA 1A2ZA 3FB3A 2ATRA 4GXHA 4X5KA 3IU1A 1M4DA 2BL1A 3A9LA 1UFHA 3TTHA 3BXMA 2HQYA 2F8HA 1QSRA 2RFHA 1YW6A 4FD6A 4R6TA 2FIWA 3LWUA 2GLJA 3NE7A 4XNHB 2PVWA 3NFZA 3D68A 2REEA 2Z3KA 2QIRA 3KQXA 1CP7A 1LAPA 3PB9X 4UFVA 1NSLA 5LYFA 2G3TA 1IB1E 2R98A 5F09A 1S7NA 2ZEFA 2AFSA 2PJCA 2Q4YA 3FRMA 2R8VA 4B14A 3PFOA 1BOBA 1CBXA 1VHEA 1KUXA 2B4BA 2QECA 4Q7AA 4UEEA 4A33A 1NSAA 2ZW5A 5A27A 3BI0A 4IAVA 5HVHA 5JQ4A 2PVVA 3TO9A 1VIXA 2JBKA 8CPAA 1HEEA 1S7KA 2AFXA 3DSBA 3FJUA 4QBJA 2K5TA 4ZY0A 2HB6A 4LUAA 2AFUA 4IF5A 3PB6X 2Q44A 4OC0A 4B5PA 2BSWA 4DUKA 3MN8A 4E0AA 2PE3A 5KTCA 4L89A 4TWEA 3BI1A 2PJ9A 1M44A 4QC6A 5AG6A 1TF9A 2HUZA 2PJ4A 2YNDA 1JWQA 1Q2CA 1Z8TA 4MFQA 3EFAA 5KTAA 1Y9WA 2ANPA 2ZW4A 3QNVA 2CNMA 1GHEA 2DPTA 4UF4A 3IWEA 4A30A 4RN7A 3WC6A 4CGLA 1LCPA 3IEHA 3RBUA 4PXCA 5THWA 2PJ2A 2J8RA 2HV2A 4M6HA 2Z3OA 4CYQA 2ZEHA 2PIYA 2CNTA 2IJZA 4A95A 3D7DA 4CAVA 3FX6A 4ZYQA 3DNSA 1NE9A 1XE4A 1J4JA 2GIVA 2RB7A 4DNCA 2GFQA 2NYQA 1R57A 5IB9A 4LQGA 2OU2A 3H8GA 1WK4A 3JUWA 4MHNA 4A38A 4KSIA 2YNCA 4KOVA 1CP6A 4EWTA 3HUVA 3MGDA 5EC4A 3R9FA 1L0CA 3TO7A 4UFWA 4OC4A 2IMOA 1CG2A 1S5KA 3C26A 4H89A 4JJXA 1LANA 5LRJA 4NEXA 2XEGA 2Z3MA 3W6SA 4EMEA 2AFWA 2EK8A 4F0YA 3VARA 4K30A 4ONWA 4P4EA 2B4DB 2IL4A 2BUEA 3CXQA 5C88A 4ORFA 4II9A 3JVNA 2G3AA 2C6CA 5H86A 4F0XA 1YGHA 5E96A 4XPLA 3KKWA 2EK9A 3L2NA 2ZOFA 1Y7RA 2ODFA 3PFEA 1KZFA 3F8KA 3D4UA 4OC1A 3B2YA 4WJBA 2BEIA 2AFOA 4CRZB 1EE3P 2AFZA 4KSAA 4B10A 3SJFA 4CYNA 4FD5A 2NMTA 1PYTB 4NGPA 4FWUA 4HPSA 1PU9A 1Y0RA 4KORA 4KUBA 2FXFA 4AVAA 1Y9KA 3FNCA 1Z8XA 2B3UA 1Z4RA 4R57A 2WUUA 3KZWA 4MHPA 2GREA 4OC2A 1FT7A 2JDDA 4M3SA 4AXVA 3ISZA 1RTQA 4UCMA 1RXTA 4MHYA 3QB8A 4R3KA 4CYOA 1ARLA 3E0KA 4B11A 4JZ0A 3KR4A 4QUSA 2PDOA 2ZEGA 2GU2A 5HXDA 4CRYB 3LACA 4MFPA 3WR7A 5I0CA 1XMTA 1HDUA 3FBUA 3G3SA 3VWEA 1B6BA 2AFMA 3R1KA 3BHXA 3TC8A 4Y49B 5KTDA 3PGPA 4X8IA 5K8NA 3CDXA 2VI7A 3IO1A 3PEIA 4UIBA 2EWBA 5F47A 3S9LA 2XEIA 4R9MA 3S6GA 2NSMA 5D8NA 2F7VA 3B3CA 1X12A 5JGFA 3D66A 4M6GA 4OP4A 1S60A 3PP9A 4R87A 1YR0A 1OZPA 4KLVA 4DJLA 1LAMA 2VZYA 3I9SA 2C6GA 1YLEA 4A2ZA 4BINA 4MCQA 1I21A 5IV0A 4MCSA 3SHPA 3P2HA 5G21A 4MI4A 3V8IA 1YK3A 2PR8A 4KVME 4OIWA 1IOFA 5IB0A 2V8GA 3K9UA 2FS5A 1DE4C 3CXPA 1IIDA 4OKOA 1XJOA 5K8MA 3PZJA 4NGQA 2JBJA 4C68A 3RZAA 3PRTA 4H2KA 2B5GA 2G9DA 2B4DA 3FEEA 3WT4A 3I1UA 4ZGYB 4ONUA 2J8MA 1YREA 4CAWA 3BJ7A 4I49A 4MMOA 3H5ZA 2CIJA 4IK2A 2ZEMA 4P4IA 2JDCA 1XOVA 2V8DA 4U9YA 3FEDA 3NH8A 4A94A 3LD2A 5CBMA 4NGNA 1S3ZA 2WPWA 4R7MA 2G0BA 4NFRA 2Z10A 3IC1A 4PK2A 5J1QA 4NSQA 5G1ZA 2PJ3A 5FVJA 1BAVA 3HLPA 1MJAA 4WWVA 5G22A 2YGWA 3GB0A 2OB0A 3PB4X 4ZX8A 2QVPA 1IOIA 5AG4A 5J8CA 4MY3A 3QAYA 2RC4A 4P4JA 5LRGA 3R96A 4U5YA 3FECA 5K8PA 4J3GA 4MHZA 2GLFA 3B3SA 2Q43A 4P10A 4YGOA 2PRQA 2Z3PA 1CX8A 2Q04A 1Q7LA 4LQ6A 1Q2DA 3D2MA 5J8FA 5LYLA 1IYKA 4JLYA 1IYLA 4MBUA 2O4HA 3FYNA 1F2OA 5JH9A 1Q2YA 5LYDA 2CXAA 2PJ0A 5DS0A 5H84A 3ZJ0A 2P6GA 4PSWA 1S7FA 4LX9A 4P4BA 2C1CA 3NA6A 2A4NA 4O23A 3QAHA 4UEZA 1VHSA 4UCPA 5JM6A 1Z2LA 3F0AA 4H6UA 4NXYA 5CPAA 3B8GA 4UWJA 4F8ZA 4IHMA 4EFDA 3DR8A 2PJBA 3VATA 4MFJA 5F48A 4OIDA 2GANA 1MJ9A 4OLLA 4FBEA 2BCOA 4KZTA 4XPDC 1MK4A 1R3NA 4C2YA 1YW4A 3V38A 4AG7A 1NMTA 5D29A 3WC7A 1M1DA 2B3VA 2VXKA 3NH4A 3T8WA 1CPSA 1KUVA 1SQHA 4PXBA 2PJ1A 3WABA 2DPSA 3JTKA 2WYRA 2B5GB 3IU2A 4E8OA 4H6ZA 3SXOA 1YMEA 1Z9UA 4NJQA 4KVXA 3GYAA 4TNUA 4CAEA 4W9YA 3D7HA 2ZXVA 2BO9A 2AE6A 2R7HA 3K9TA 1F2PA 5C82A 3KASA 4PXDA 1HDQA 1GYTA 2YNEA 1Z8LA 3IWGA 3RO0A 3D2PA 3PBEA 1IGBA 2DXQA 3IWWA 1QSMA 2GE3A 3IGRA 2JLMA 1ZLHA 3GUXA 5HVFA 4HNYB 3EY5A 5A28A 4NGMA 5HH1A 3KL9A 2CTCA 2OZGA 3IFEA 3ZZIA 2DF5A 4MFZA 4QVTA 4X3RA 3IJ3A 2ZPAA 1Y7EA 4C7IA 5ELYA 4AVCA 4CAFA 3DDDA 1VKCA 4PXEA 4U9ZA 1S7LA 3TX8A 2ZEEA 4ZX9A 4Z65A 5JPHA 4ZY1A 3TFYA 1N71A 1XF8A 3GY9A 4UBRA 3W91A 1V0CA 3S6KA 2PIZA 2Y0MA 4KS9A 2PSWA 3T9YA 2V77A 5EMIA 4BBHA 7CPAA 4UA3A 3KR5A 3VH9A 2D4OA 2ZW6A 3KHZA 5DWMA 3CZXA 3RYOA 1IICA 1B87A 4RI1A 2WSAA 3LODA 1YX0A 1CM0A 1RO5A 3MRUA 4RUHA 1P4NA 2ZOGA 2ZEOA 2JEVA 4M6IA 2R1IA 1TKJA 4AB7A 1IU8A 2XEJA 5EBVA 3OWCA 4F6AA 4JD6A 5CNPA 1DTDA 4CGNA 4BD9A 5K8OA 2D4PA 4KOYA 1XRYA 2VBQA 4A31A 1TKFA 4KOUA 3BJ8A 2HC9A 3SXNA 3FXTA 4MHDA 4P4FA 4P6YA 3TE4A 1U6MA 1M4GA 4KOSA 1XEBA 1QSOA 5IX3A 1ELMP 4Q36A 1ZG8A 4FAIA 2XEFA 3KI9A 5HVGA 4JXRA 4C2ZA 1PCAA 3P2FA 4NGRA 4OADA 5AG7A 4UCNA 4JWPA 4CYPA 4CPAA 3NH5A 2OH1A 4HKFA 4XPKA 2VEZA 4OAEA 1KWMA 2PJ8A 2OR4A 3TCVA 2EVNA 3B7IA 2AJ6A 3LMSA 4HNWB 1YVKA 2I79A 4C2XA 2PJ5A 3SI2A 5BWAB 1UWYA 3H8EA 1BO4A 2FCKA 3PB7X 4X2TA 2ZEPA 2ZENA 4IUSA 2Z11A 3KHXA 2VQYA 1BPNA 2C27A 1H8LA 1ZLIA 1K4JA 2V8HA 4AG9A 3I3GA 3S9MA 2CNSA 2FSRA 2JEWA 3CPXA 2VL1A 3DGVA 2FL4A 3D8PA 3D67A 4PPZA 3VWDA 1R43A 5DWNA 4L8AA 3FIXA 4UIAA 1IY7A 4ZBGA 3T90A 4FD4A 4B5OA 1YLOA 1QQ9A 2PR1A 2VZZA 2FVGA 2H5MA 2KCWA 1QMUA 4A32A 4UWIA 4BMHA 3EO4A 3R9GA 2CY2A 3V7ZA 2OZUA 4MRIA 1ZG9A 4KOWA 3SJGA 3B3VA 4F9VA 5F46A 2EUIA 5I4MA 4B6ZA 4EVYA 2FIAA 1TF8A 1AMPA 4F9UA 3KQZA 4OC3A 1Z4EA 2POKA 1F57A 1YVOA 2PJ7A 3CT9A 3D3SA 2PRBA 2FE7A 2ZELA 4KVOE 4NCZA 2ARHA 3RAMA 4A39A 1FY7A 2Q4VA 2QMLA 2QYVA 3B3TA 3CXSA 4PQAA 3TOBA 1ELLP 2Z3LA 4UFXA 4KLWA 4NGTA 5ISVA 2BOAA 2Q51A 2I00A 3K2KA 4PSXA 3CPAA 2Z0ZA 4AVBA 4P4DA 4HNXB 3R95A 5G20A 2EBJA 2PC1A 2X7BA 4R76A 1BLLE 4XPDB 1LRZA 2C6PA 2DEAA 2PJAA 5LYIA 1FNOA 3D7FA 4KSFA 2OZHA 4FUUA 5AG5A 2P6EA 1OBRA 6CPAA 4YWYA 3W6XA 3H8FA 3B3WA 4B13A 4UEFA 4R8FA 1MJBA 1VHOA 3ISXA 1VGYA 2P6FA 3GLJA 4QB9A 3G8WA 2ABZA 2WPXA 3SI1A 4ZI6A 1AUGA 4KUAA 4MFKA 4JXQA 4CAXA 1I1DA 2J9AA 1M4LA 3SJXA 4PK3A 3NE8A 3D7GA 1TXRA 1BPMA 4Q38A 2EO8A 4P45A 4MY0A 3BLNA 4PV6A 3KGQA 4GS4A 5GCNA 1ARMA 1CPXA 4E2AA
chains in the Genus database with same CATH topology
1AYEA 3B35A 4G1PA 3N5FA 4K3NA 2IQ6A 1TKHA 4DYOA 4MCPA 4YU9A 3FVLA 4P44A 4ZY2A 1Y0YA 3SI0A 1XMBA 4NGSA 1XFOA 3PBBA 3S9NA 2I3CA 1YSJA 2WZNA 2PCUA 4MXUA 4A37A 1LFWA 3IIBA 2QJ8A 4OMEA 2ZEDA 5LRKA 1Z5RA 3FH4A 3JRUA 2Q4ZA 2PJ6A 1LOKA 3SJEA 3WC5A 4GM5A 1JQGA 4JYWA 2V8VA 3FF3A 2OOTA 2CF4A 4NJRA 3PB8X 1ZG7A 4OC5A 2CTBA 4MCRA 1XBUA 2O53A 3DLJA 3FMCA 3BXMA 2F8HA 2RFHA 4R6TA 1YW6A 3LWUA 2GLJA 2PVWA 3NFZA 3D68A 3KQXA 3PB9X 5LYFA 1CP7A 1LAPA 5F09A 2ZEFA 2AFSA 2PJCA 3PFOA 1CBXA 1VHEA 4Q7AA 4UEEA 1NSAA 3BI0A 4IAVA 5HVHA 2PVVA 1VIXA 2JBKA 8CPAA 1HEEA 2AFXA 3FJUA 4ZY0A 2HB6A 2AFUA 3PB6X 4OC0A 4DUKA 3MN8A 2PE3A 4TWEA 3BI1A 2PJ9A 1TF9A 2PJ4A 3QNVA 2ANPA 4UF4A 3WC6A 1LCPA 3IEHA 3RBUA 4PXCA 5THWA 2PJ2A 2ZEHA 2PIYA 2IJZA 3D7DA 3FX6A 4ZYQA 2RB7A 2NYQA 5IB9A 4LQGA 3H8GA 4A38A 4MHNA 4KSIA 1CP6A 4EWTA 3HUVA 4OC4A 2IMOA 1CG2A 5LRJA 1LANA 2XEGA 4EMEA 2AFWA 2EK8A 3VARA 4ONWA 4P4EA 2C6CA 2EK9A 3L2NA 2ZOFA 3PFEA 4OC1A 3D4UA 4WJBA 3B2YA 2AFOA 1EE3P 2AFZA 3SJFA 1PYTB 4NGPA 4FWUA 1Y0RA 3KZWA 4MHPA 2GREA 4OC2A 1FT7A 4AXVA 3ISZA 1RTQA 4MHYA 1ARLA 4JZ0A 3KR4A 2ZEGA 2GU2A 5HXDA 1HDUA 2AFMA 3BHXA 3TC8A 4X8IA 5K8NA 3CDXA 3IO1A 3PEIA 4UIBA 2EWBA 3S9LA 2XEIA 2NSMA 5D8NA 2F7VA 3B3CA 5JGFA 3D66A 4OP4A 4DJLA 1LAMA 2C6GA 4MCQA 4MCSA 4OIWA 2V8GA 1DE4C 4OKOA 1XJOA 5K8MA 4NGQA 2JBJA 3RZAA 3PRTA 4H2KA 2G9DA 3FEEA 3WT4A 3I1UA 4MMOA 2CIJA 4IK2A 2ZEMA 4P4IA 2V8DA 4A94A 3FEDA 3NH8A 5CBMA 4NGNA 4R7MA 4NFRA 3IC1A 5J1QA 2PJ3A 1BAVA 3HLPA 4WWVA 3GB0A 3PB4X 4ZX8A 2QVPA 5LRGA 4P4JA 3FECA 5K8PA 4MHZA 2GLFA 3B3SA 2Q43A 4P10A 2PRQA 1CX8A 1Q7LA 5LYLA 2O4HA 1F2OA 5JH9A 5LYDA 2PJ0A 5DS0A 4P4BA 2C1CA 3NA6A 4O23A 4UEZA 5JM6A 1Z2LA 5CPAA 4IHMA 4EFDA 2PJBA 3VATA 4OIDA 4FBEA 2BCOA 1R3NA 1YW4A 3V38A 5D29A 3WC7A 3NH4A 3T8WA 1CPSA 4PXBA 2PJ1A 3WABA 2WYRA 1YMEA 4NJQA 4TNUA 4W9YA 3D7HA 2BO9A 3K9TA 1F2PA 3KASA 4PXDA 1HDQA 1GYTA 1Z8LA 3PBEA 1IGBA 3IWWA 1ZLHA 3GUXA 5HVFA 4NGMA 3KL9A 2CTCA 3IFEA 4X3RA 3IJ3A 1Y7EA 5ELYA 4PXEA 3TX8A 2ZEEA 4ZX9A 4Z65A 4ZY1A 2PIZA 2V77A 7CPAA 3KR5A 3VH9A 3KHZA 3MRUA 4RUHA 2ZOGA 2ZEOA 1TKJA 2XEJA 1DTDA 5K8OA 4BD9A 1XRYA 1TKFA 2HC9A 4P4FA 4P6YA 1ELMP 4FAIA 1ZG8A 2XEFA 3KI9A 5HVGA 1PCAA 4NGRA 4CPAA 3NH5A 1KWMA 2PJ8A 2OR4A 3B7IA 3LMSA 2PJ5A 3SI2A 1UWYA 3H8EA 3PB7X 4X2TA 2ZEPA 2ZENA 3KHXA 1BPNA 1H8LA 1ZLIA 2V8HA 3S9MA 2JEWA 3CPXA 2VL1A 3DGVA 3D67A 4PPZA 1R43A 4UIAA 1IY7A 1YLOA 1QQ9A 2FVGA 1QMUA 3V7ZA 4MRIA 3SJGA 1ZG9A 4F9VA 3B3VA 5I4MA 4B6ZA 1TF8A 1AMPA 4F9UA 3KQZA 4OC3A 2POKA 3CT9A 1F57A 2PJ7A 2ZELA 3RAMA 4A39A 4F8ZA 4PQAA 2QYVA 3B3TA 1ELLP 4NGTA 2BOAA 2Q51A 3K2KA 3CPAA 4P4DA 4R76A 1BLLE 2DEAA 2C6PA 2PJAA 5LYIA 1FNOA 3D7FA 4FUUA 1OBRA 6CPAA 4YWYA 3H8FA 3B3WA 4UEFA 4R8FA 1VHOA 3ISXA 1VGYA 3GLJA 4ZI6A 2ABZA 3SI1A 2J9AA 1M4LA 3SJXA 3D7GA 1TXRA 1BPMA 4P45A 3KGQA 1ARMA 1CPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYE A;  3B35 A;  4G1P A;  3N5F A;  4K3N A;  2IQ6 A;  1TKH A;  4DYO A;  4MCP A;  4YU9 A;  3FVL A;  4P44 A;  4ZY2 A;  1Y0Y A;  3SI0 A;  1XMB A;  4NGS A;  1XFO A;  3PBB A;  3S9N A;  2I3C A;  1YSJ A;  2WZN A;  2PCU A;  4MXU A;  4A37 A;  1LFW A;  3IIB A;  2QJ8 A;  4OME A;  2ZED A;  5LRK A;  1Z5R A;  3FH4 A;  3JRU A;  2Q4Z A;  2PJ6 A;  1LOK A;  3SJE A;  3WC5 A;  4GM5 A;  1JQG A;  4JYW A;  2V8V A;  3FF3 A;  2OOT A;  2CF4 A;  4NJR A;  3PB8 X;  1ZG7 A;  4OC5 A;  2CTB A;  4MCR A;  1XBU A;  2O53 A;  3DLJ A;  3FMC A;  3BXM A;  2F8H A;  2RFH A;  4R6T A;  1YW6 A;  3LWU A;  2GLJ A;  2PVW A;  3NFZ A;  3D68 A;  3KQX A;  3PB9 X;  5LYF A;  1CP7 A;  1LAP A;  5F09 A;  2ZEF A;  2AFS A;  2PJC A;  3PFO A;  1CBX A;  1VHE A;  4Q7A A;  4UEE A;  1NSA A;  3BI0 A;  4IAV A;  5HVH A;  2PVV A;  1VIX A;  2JBK A;  8CPA A;  1HEE A;  2AFX A;  3FJU A;  4ZY0 A;  2HB6 A;  2AFU A;  3PB6 X;  4OC0 A;  4DUK A;  3MN8 A;  2PE3 A;  4TWE A;  3BI1 A;  2PJ9 A;  1TF9 A;  2PJ4 A;  3QNV A;  2ANP A;  4UF4 A;  3WC6 A;  1LCP A;  3IEH A;  3RBU A;  4PXC A;  5THW A;  2PJ2 A;  2ZEH A;  2PIY A;  2IJZ A;  3D7D A;  3FX6 A;  4ZYQ A;  2RB7 A;  2NYQ A;  5IB9 A;  4LQG A;  3H8G A;  4A38 A;  4MHN A;  4KSI A;  1CP6 A;  4EWT A;  3HUV A;  4OC4 A;  2IMO A;  1CG2 A;  5LRJ A;  1LAN A;  2XEG A;  4EME A;  2AFW A;  2EK8 A;  3VAR A;  4ONW A;  4P4E A;  2C6C A;  2EK9 A;  3L2N A;  2ZOF A;  3PFE A;  4OC1 A;  3D4U A;  4WJB A;  3B2Y A;  2AFO A;  1EE3 P;  2AFZ A;  3SJF A;  1PYT B;  4NGP A;  4FWU A;  1Y0R A;  3KZW A;  4MHP A;  2GRE A;  4OC2 A;  1FT7 A;  4AXV A;  3ISZ A;  1RTQ A;  4MHY A;  1ARL A;  4JZ0 A;  3KR4 A;  2ZEG A;  2GU2 A;  5HXD A;  1HDU A;  2AFM A;  3BHX A;  3TC8 A;  4X8I A;  5K8N A;  3CDX A;  3IO1 A;  3PEI A;  4UIB A;  2EWB A;  3S9L A;  2XEI A;  2NSM A;  5D8N A;  2F7V A;  3B3C A;  5JGF A;  3D66 A;  4OP4 A;  4DJL A;  1LAM A;  2C6G A;  4MCQ A;  4MCS A;  4OIW A;  2V8G A;  1DE4 C;  4OKO A;  1XJO A;  5K8M A;  4NGQ A;  2JBJ A;  3RZA A;  3PRT A;  4H2K A;  2G9D A;  3FEE A;  3WT4 A;  3I1U A;  4MMO A;  2CIJ A;  4IK2 A;  2ZEM A;  4P4I A;  2V8D A;  4A94 A;  3FED A;  3NH8 A;  5CBM A;  4NGN A;  4R7M A;  4NFR A;  3IC1 A;  5J1Q A;  2PJ3 A;  1BAV A;  3HLP A;  4WWV A;  3GB0 A;  3PB4 X;  4ZX8 A;  2QVP A;  5LRG A;  4P4J A;  3FEC A;  5K8P A;  4MHZ A;  2GLF A;  3B3S A;  2Q43 A;  4P10 A;  2PRQ A;  1CX8 A;  1Q7L A;  5LYL A;  2O4H A;  1F2O A;  5JH9 A;  5LYD A;  2PJ0 A;  5DS0 A;  4P4B A;  2C1C A;  3NA6 A;  4O23 A;  4UEZ A;  5JM6 A;  1Z2L A;  5CPA A;  4IHM A;  4EFD A;  2PJB A;  3VAT A;  4OID A;  4FBE A;  2BCO A;  1R3N A;  1YW4 A;  3V38 A;  5D29 A;  3WC7 A;  3NH4 A;  3T8W A;  1CPS A;  4PXB A;  2PJ1 A;  3WAB A;  2WYR A;  1YME A;  4NJQ A;  4TNU A;  4W9Y A;  3D7H A;  2BO9 A;  3K9T A;  1F2P A;  3KAS A;  4PXD A;  1HDQ A;  1GYT A;  1Z8L A;  3PBE A;  1IGB A;  3IWW A;  1ZLH A;  3GUX A;  5HVF A;  4NGM A;  3KL9 A;  2CTC A;  3IFE A;  4X3R A;  3IJ3 A;  1Y7E A;  5ELY A;  4PXE A;  3TX8 A;  2ZEE A;  4ZX9 A;  4Z65 A;  4ZY1 A;  2PIZ A;  2V77 A;  7CPA A;  3KR5 A;  3VH9 A;  3KHZ A;  3MRU A;  4RUH A;  2ZOG A;  2ZEO A;  1TKJ A;  2XEJ A;  1DTD A;  5K8O A;  4BD9 A;  1XRY A;  1TKF A;  2HC9 A;  4P4F A;  4P6Y A;  1ELM P;  4FAI A;  1ZG8 A;  2XEF A;  3KI9 A;  5HVG A;  1PCA A;  4NGR A;  4CPA A;  3NH5 A;  1KWM A;  2PJ8 A;  2OR4 A;  3B7I A;  3LMS A;  2PJ5 A;  3SI2 A;  1UWY A;  3H8E A;  3PB7 X;  4X2T A;  2ZEP A;  2ZEN A;  3KHX A;  1BPN A;  1H8L A;  1ZLI A;  2V8H A;  3S9M A;  2JEW A;  3CPX A;  2VL1 A;  3DGV A;  3D67 A;  4PPZ A;  1R43 A;  4UIA A;  1IY7 A;  1YLO A;  1QQ9 A;  2FVG A;  1QMU A;  3V7Z A;  4MRI A;  3SJG A;  1ZG9 A;  4F9V A;  3B3V A;  5I4M A;  4B6Z A;  1TF8 A;  1AMP A;  4F9U A;  3KQZ A;  4OC3 A;  2POK A;  3CT9 A;  1F57 A;  2PJ7 A;  2ZEL A;  3RAM A;  4A39 A;  4F8Z A;  4PQA A;  2QYV A;  3B3T A;  1ELL P;  4NGT A;  2BOA A;  2Q51 A;  3K2K A;  3CPA A;  4P4D A;  4R76 A;  1BLL E;  2DEA A;  2C6P A;  2PJA A;  5LYI A;  1FNO A;  3D7F A;  4FUU A;  1OBR A;  6CPA A;  4YWY A;  3H8F A;  3B3W A;  4UEF A;  4R8F A;  1VHO A;  3ISX A;  1VGY A;  3GLJ A;  4ZI6 A;  2ABZ A;  3SI1 A;  2J9A A;  1M4L A;  3SJX A;  3D7G A;  1TXR A;  1BPM A;  4P45 A;  3KGQ A;  1ARM A;  1CPX A; 
#chains in the Genus database with same CATH topology
 1AYE A;  3B35 A;  4G1P A;  3N5F A;  4K3N A;  2P0W A;  4CS0 B;  2IQ6 A;  1TKH A;  3EXN A;  4DYO A;  2O28 A;  4FD7 A;  2Q0Y A;  4MCP A;  1TIQ A;  4YU9 A;  3FVL A;  2J8N A;  5F49 A;  3TOA A;  4P44 A;  4ZY2 A;  1Y0Y A;  3SI0 A;  1ZO0 A;  5HMN A;  1XMB A;  3F5B A;  4NF1 A;  4NGS A;  4YFJ A;  1M4I A;  3EC4 A;  1XFO A;  3GKR A;  1Z8W A;  3PBB A;  4MFL A;  3S9N A;  2I3C A;  1YSJ A;  2WZN A;  3DR6 A;  3GIU A;  2PCU A;  4MXU A;  4A37 A;  1LFW A;  2B58 A;  1YQE A;  4C7H A;  4Y49 C;  4B5P B;  4KOT A;  3IIB A;  2QJ8 A;  4YRH A;  1WWZ A;  1CJW A;  1XIX A;  1ON0 A;  4OME A;  4KOX A;  2Q7B A;  2ZED A;  4CGM A;  2F5I A;  5LRK A;  1Z5R A;  3H4Q A;  3FH4 A;  1P0H A;  3JRU A;  2FT0 A;  4R3L A;  3RNZ A;  3TT2 A;  2Q4Z A;  2PJ6 A;  1I12 A;  4MJ8 A;  1LOK A;  2PQ8 A;  2ZW7 A;  4RS2 A;  3SJE A;  3WC5 A;  4CGP A;  2Z3N A;  3S6F A;  1PUA A;  3R9E A;  4GM5 A;  3S6H A;  1JQG A;  4JYW A;  3UY5 A;  2V8V A;  1QST A;  1KUY A;  2YNC C;  3FF3 A;  2CF4 A;  5AGE A;  2OOT A;  4NJR A;  3N7Z A;  3PB8 X;  1ZG7 A;  4XNH C;  4OC5 A;  2CTB A;  1QSN A;  2Q7S A;  4M85 A;  4MCR A;  1X10 A;  1XBU A;  2O53 A;  2REF A;  3DLJ A;  3TO6 A;  4B12 A;  4CGO A;  3FMC A;  1A2Z A;  3FB3 A;  2ATR A;  4GXH A;  4X5K A;  3IU1 A;  1M4D A;  2BL1 A;  3A9L A;  1UFH A;  3TTH A;  3BXM A;  2HQY A;  2F8H A;  1QSR A;  2RFH A;  1YW6 A;  4FD6 A;  4R6T A;  2FIW A;  3LWU A;  2GLJ A;  3NE7 A;  4XNH B;  2PVW A;  3NFZ A;  3D68 A;  2REE A;  2Z3K A;  2QIR A;  3KQX A;  1CP7 A;  1LAP A;  3PB9 X;  4UFV A;  1NSL A;  5LYF A;  2G3T A;  1IB1 E;  2R98 A;  5F09 A;  1S7N A;  2ZEF A;  2AFS A;  2PJC A;  2Q4Y A;  3FRM A;  2R8V A;  4B14 A;  3PFO A;  1BOB A;  1CBX A;  1VHE A;  1KUX A;  2B4B A;  2QEC A;  4Q7A A;  4UEE A;  4A33 A;  1NSA A;  2ZW5 A;  5A27 A;  3BI0 A;  4IAV A;  5HVH A;  5JQ4 A;  2PVV A;  3TO9 A;  1VIX A;  2JBK A;  8CPA A;  1HEE A;  1S7K A;  2AFX A;  3DSB A;  3FJU A;  4QBJ A;  2K5T A;  4ZY0 A;  2HB6 A;  4LUA A;  2AFU A;  4IF5 A;  3PB6 X;  2Q44 A;  4OC0 A;  4B5P A;  2BSW A;  4DUK A;  3MN8 A;  4E0A A;  2PE3 A;  5KTC A;  4L89 A;  4TWE A;  3BI1 A;  2PJ9 A;  1M44 A;  4QC6 A;  5AG6 A;  1TF9 A;  2HUZ A;  2PJ4 A;  2YND A;  1JWQ A;  1Q2C A;  1Z8T A;  4MFQ A;  3EFA A;  5KTA A;  1Y9W A;  2ANP A;  2ZW4 A;  3QNV A;  2CNM A;  1GHE A;  2DPT A;  4UF4 A;  3IWE A;  4A30 A;  4RN7 A;  3WC6 A;  4CGL A;  1LCP A;  3IEH A;  3RBU A;  4PXC A;  5THW A;  2PJ2 A;  2J8R A;  2HV2 A;  4M6H A;  2Z3O A;  4CYQ A;  2ZEH A;  2PIY A;  2CNT A;  2IJZ A;  4A95 A;  3D7D A;  4CAV A;  3FX6 A;  4ZYQ A;  3DNS A;  1NE9 A;  1XE4 A;  1J4J A;  2GIV A;  2RB7 A;  4DNC A;  2GFQ A;  2NYQ A;  1R57 A;  5IB9 A;  4LQG A;  2OU2 A;  3H8G A;  1WK4 A;  3JUW A;  4MHN A;  4A38 A;  4KSI A;  2YNC A;  4KOV A;  1CP6 A;  4EWT A;  3HUV A;  3MGD A;  5EC4 A;  3R9F A;  1L0C A;  3TO7 A;  4UFW A;  4OC4 A;  2IMO A;  1CG2 A;  1S5K A;  3C26 A;  4H89 A;  4JJX A;  1LAN A;  5LRJ A;  4NEX A;  2XEG A;  2Z3M A;  3W6S A;  4EME A;  2AFW A;  2EK8 A;  4F0Y A;  3VAR A;  4K30 A;  4ONW A;  4P4E A;  2B4D B;  2IL4 A;  2BUE A;  3CXQ A;  5C88 A;  4ORF A;  4II9 A;  3JVN A;  2G3A A;  2C6C A;  5H86 A;  4F0X A;  1YGH A;  5E96 A;  4XPL A;  3KKW A;  2EK9 A;  3L2N A;  2ZOF A;  1Y7R A;  2ODF A;  3PFE A;  1KZF A;  3F8K A;  3D4U A;  4OC1 A;  3B2Y A;  4WJB A;  2BEI A;  2AFO A;  4CRZ B;  1EE3 P;  2AFZ A;  4KSA A;  4B10 A;  3SJF A;  4CYN A;  4FD5 A;  2NMT A;  1PYT B;  4NGP A;  4FWU A;  4HPS A;  1PU9 A;  1Y0R A;  4KOR A;  4KUB A;  2FXF A;  4AVA A;  1Y9K A;  3FNC A;  1Z8X A;  2B3U A;  1Z4R A;  4R57 A;  2WUU A;  3KZW A;  4MHP A;  2GRE A;  4OC2 A;  1FT7 A;  2JDD A;  4M3S A;  4AXV A;  3ISZ A;  1RTQ A;  4UCM A;  1RXT A;  4MHY A;  3QB8 A;  4R3K A;  4CYO A;  1ARL A;  3E0K A;  4B11 A;  4JZ0 A;  3KR4 A;  4QUS A;  2PDO A;  2ZEG A;  2GU2 A;  5HXD A;  4CRY B;  3LAC A;  4MFP A;  3WR7 A;  5I0C A;  1XMT A;  1HDU A;  3FBU A;  3G3S A;  3VWE A;  1B6B A;  2AFM A;  3R1K A;  3BHX A;  3TC8 A;  4Y49 B;  5KTD A;  3PGP A;  4X8I A;  5K8N A;  3CDX A;  2VI7 A;  3IO1 A;  3PEI A;  4UIB A;  2EWB A;  5F47 A;  3S9L A;  2XEI A;  4R9M A;  3S6G A;  2NSM A;  5D8N A;  2F7V A;  3B3C A;  1X12 A;  5JGF A;  3D66 A;  4M6G A;  4OP4 A;  1S60 A;  3PP9 A;  4R87 A;  1YR0 A;  1OZP A;  4KLV A;  4DJL A;  1LAM A;  2VZY A;  3I9S A;  2C6G A;  1YLE A;  4A2Z A;  4BIN A;  4MCQ A;  1I21 A;  5IV0 A;  4MCS A;  3SHP A;  3P2H A;  5G21 A;  4MI4 A;  3V8I A;  1YK3 A;  2PR8 A;  4KVM E;  4OIW A;  1IOF A;  5IB0 A;  2V8G A;  3K9U A;  2FS5 A;  1DE4 C;  3CXP A;  1IID A;  4OKO A;  1XJO A;  5K8M A;  3PZJ A;  4NGQ A;  2JBJ A;  4C68 A;  3RZA A;  3PRT A;  4H2K A;  2B5G A;  2G9D A;  2B4D A;  3FEE A;  3WT4 A;  3I1U A;  4ZGY B;  4ONU A;  2J8M A;  1YRE A;  4CAW A;  3BJ7 A;  4I49 A;  4MMO A;  3H5Z A;  2CIJ A;  4IK2 A;  2ZEM A;  4P4I A;  2JDC A;  1XOV A;  2V8D A;  4U9Y A;  3FED A;  3NH8 A;  4A94 A;  3LD2 A;  5CBM A;  4NGN A;  1S3Z A;  2WPW A;  4R7M A;  2G0B A;  4NFR A;  2Z10 A;  3IC1 A;  4PK2 A;  5J1Q A;  4NSQ A;  5G1Z A;  2PJ3 A;  5FVJ A;  1BAV A;  3HLP A;  1MJA A;  4WWV A;  5G22 A;  2YGW A;  3GB0 A;  2OB0 A;  3PB4 X;  4ZX8 A;  2QVP A;  1IOI A;  5AG4 A;  5J8C A;  4MY3 A;  3QAY A;  2RC4 A;  4P4J A;  5LRG A;  3R96 A;  4U5Y A;  3FEC A;  5K8P A;  4J3G A;  4MHZ A;  2GLF A;  3B3S A;  2Q43 A;  4P10 A;  4YGO A;  2PRQ A;  2Z3P A;  1CX8 A;  2Q04 A;  1Q7L A;  4LQ6 A;  1Q2D A;  3D2M A;  5J8F A;  5LYL A;  1IYK A;  4JLY A;  1IYL A;  4MBU A;  2O4H A;  3FYN A;  1F2O A;  5JH9 A;  1Q2Y A;  5LYD A;  2CXA A;  2PJ0 A;  5DS0 A;  5H84 A;  3ZJ0 A;  2P6G A;  4PSW A;  1S7F A;  4LX9 A;  4P4B A;  2C1C A;  3NA6 A;  2A4N A;  4O23 A;  3QAH A;  4UEZ A;  1VHS A;  4UCP A;  5JM6 A;  1Z2L A;  3F0A A;  4H6U A;  4NXY A;  5CPA A;  3B8G A;  4UWJ A;  4F8Z A;  4IHM A;  4EFD A;  3DR8 A;  2PJB A;  3VAT A;  4MFJ A;  5F48 A;  4OID A;  2GAN A;  1MJ9 A;  4OLL A;  4FBE A;  2BCO A;  4KZT A;  4XPD C;  1MK4 A;  1R3N A;  4C2Y A;  1YW4 A;  3V38 A;  4AG7 A;  1NMT A;  5D29 A;  3WC7 A;  1M1D A;  2B3V A;  2VXK A;  3NH4 A;  3T8W A;  1CPS A;  1KUV A;  1SQH A;  4PXB A;  2PJ1 A;  3WAB A;  2DPS A;  3JTK A;  2WYR A;  2B5G B;  3IU2 A;  4E8O A;  4H6Z A;  3SXO A;  1YME A;  1Z9U A;  4NJQ A;  4KVX A;  3GYA A;  4TNU A;  4CAE A;  4W9Y A;  3D7H A;  2ZXV A;  2BO9 A;  2AE6 A;  2R7H A;  3K9T A;  1F2P A;  5C82 A;  3KAS A;  4PXD A;  1HDQ A;  1GYT A;  2YNE A;  1Z8L A;  3IWG A;  3RO0 A;  3D2P A;  3PBE A;  1IGB A;  2DXQ A;  3IWW A;  1QSM A;  2GE3 A;  3IGR A;  2JLM A;  1ZLH A;  3GUX A;  5HVF A;  4HNY B;  3EY5 A;  5A28 A;  4NGM A;  5HH1 A;  3KL9 A;  2CTC A;  2OZG A;  3IFE A;  3ZZI A;  2DF5 A;  4MFZ A;  4QVT A;  4X3R A;  3IJ3 A;  2ZPA A;  1Y7E A;  4C7I A;  5ELY A;  4AVC A;  4CAF A;  3DDD A;  1VKC A;  4PXE A;  4U9Z A;  1S7L A;  3TX8 A;  2ZEE A;  4ZX9 A;  4Z65 A;  5JPH A;  4ZY1 A;  3TFY A;  1N71 A;  1XF8 A;  3GY9 A;  4UBR A;  3W91 A;  1V0C A;  3S6K A;  2PIZ A;  2Y0M A;  4KS9 A;  2PSW A;  3T9Y A;  2V77 A;  5EMI A;  4BBH A;  7CPA A;  4UA3 A;  3KR5 A;  3VH9 A;  2D4O A;  2ZW6 A;  3KHZ A;  5DWM A;  3CZX A;  3RYO A;  1IIC A;  1B87 A;  4RI1 A;  2WSA A;  3LOD A;  1YX0 A;  1CM0 A;  1RO5 A;  3MRU A;  4RUH A;  1P4N A;  2ZOG A;  2ZEO A;  2JEV A;  4M6I A;  2R1I A;  1TKJ A;  4AB7 A;  1IU8 A;  2XEJ A;  5EBV A;  3OWC A;  4F6A A;  4JD6 A;  5CNP A;  1DTD A;  4CGN A;  4BD9 A;  5K8O A;  2D4P A;  4KOY A;  1XRY A;  2VBQ A;  4A31 A;  1TKF A;  4KOU A;  3BJ8 A;  2HC9 A;  3SXN A;  3FXT A;  4MHD A;  4P4F A;  4P6Y A;  3TE4 A;  1U6M A;  1M4G A;  4KOS A;  1XEB A;  1QSO A;  5IX3 A;  1ELM P;  4Q36 A;  1ZG8 A;  4FAI A;  2XEF A;  3KI9 A;  5HVG A;  4JXR A;  4C2Z A;  1PCA A;  3P2F A;  4NGR A;  4OAD A;  5AG7 A;  4UCN A;  4JWP A;  4CYP A;  4CPA A;  3NH5 A;  2OH1 A;  4HKF A;  4XPK A;  2VEZ A;  4OAE A;  1KWM A;  2PJ8 A;  2OR4 A;  3TCV A;  2EVN A;  3B7I A;  2AJ6 A;  3LMS A;  4HNW B;  1YVK A;  2I79 A;  4C2X A;  2PJ5 A;  3SI2 A;  5BWA B;  1UWY A;  3H8E A;  1BO4 A;  2FCK A;  3PB7 X;  4X2T A;  2ZEP A;  2ZEN A;  4IUS A;  2Z11 A;  3KHX A;  2VQY A;  1BPN A;  2C27 A;  1H8L A;  1ZLI A;  1K4J A;  2V8H A;  4AG9 A;  3I3G A;  3S9M A;  2CNS A;  2FSR A;  2JEW A;  3CPX A;  2VL1 A;  3DGV A;  2FL4 A;  3D8P A;  3D67 A;  4PPZ A;  3VWD A;  1R43 A;  5DWN A;  4L8A A;  3FIX A;  4UIA A;  1IY7 A;  4ZBG A;  3T90 A;  4FD4 A;  4B5O A;  1YLO A;  1QQ9 A;  2PR1 A;  2VZZ A;  2FVG A;  2H5M A;  2KCW A;  1QMU A;  4A32 A;  4UWI A;  4BMH A;  3EO4 A;  3R9G A;  2CY2 A;  3V7Z A;  2OZU A;  4MRI A;  1ZG9 A;  4KOW A;  3SJG A;  3B3V A;  4F9V A;  5F46 A;  2EUI A;  5I4M A;  4B6Z A;  4EVY A;  2FIA A;  1TF8 A;  1AMP A;  4F9U A;  3KQZ A;  4OC3 A;  1Z4E A;  2POK A;  1F57 A;  1YVO A;  2PJ7 A;  3CT9 A;  3D3S A;  2PRB A;  2FE7 A;  2ZEL A;  4KVO E;  4NCZ A;  2ARH A;  3RAM A;  4A39 A;  1FY7 A;  2Q4V A;  2QML A;  2QYV A;  3B3T A;  3CXS A;  4PQA A;  3TOB A;  1ELL P;  2Z3L A;  4UFX A;  4KLW A;  4NGT A;  5ISV A;  2BOA A;  2Q51 A;  2I00 A;  3K2K A;  4PSX A;  3CPA A;  2Z0Z A;  4AVB A;  4P4D A;  4HNX B;  3R95 A;  5G20 A;  2EBJ A;  2PC1 A;  2X7B A;  4R76 A;  1BLL E;  4XPD B;  1LRZ A;  2C6P A;  2DEA A;  2PJA A;  5LYI A;  1FNO A;  3D7F A;  4KSF A;  2OZH A;  4FUU A;  5AG5 A;  2P6E A;  1OBR A;  6CPA A;  4YWY A;  3W6X A;  3H8F A;  3B3W A;  4B13 A;  4UEF A;  4R8F A;  1MJB A;  1VHO A;  3ISX A;  1VGY A;  2P6F A;  3GLJ A;  4QB9 A;  3G8W A;  2ABZ A;  2WPX A;  3SI1 A;  4ZI6 A;  1AUG A;  4KUA A;  4MFK A;  4JXQ A;  4CAX A;  1I1D A;  2J9A A;  1M4L A;  3SJX A;  4PK3 A;  3NE8 A;  3D7G A;  1TXR A;  1BPM A;  4Q38 A;  2EO8 A;  4P45 A;  4MY0 A;  3BLN A;  4PV6 A;  3KGQ A;  4GS4 A;  5GCN A;  1ARM A;  1CPX A;  4E2A A; 
#chains in the Genus database with same CATH homology
 1AYE A;  3B35 A;  4G1P A;  3N5F A;  4K3N A;  2IQ6 A;  1TKH A;  4DYO A;  4MCP A;  4YU9 A;  3FVL A;  4P44 A;  4ZY2 A;  1Y0Y A;  3SI0 A;  1XMB A;  4NGS A;  1XFO A;  3PBB A;  3S9N A;  2I3C A;  1YSJ A;  2WZN A;  2PCU A;  4MXU A;  4A37 A;  1LFW A;  3IIB A;  2QJ8 A;  4OME A;  2ZED A;  5LRK A;  1Z5R A;  3FH4 A;  3JRU A;  2Q4Z A;  2PJ6 A;  1LOK A;  3SJE A;  3WC5 A;  4GM5 A;  1JQG A;  4JYW A;  2V8V A;  3FF3 A;  2OOT A;  2CF4 A;  4NJR A;  3PB8 X;  1ZG7 A;  4OC5 A;  2CTB A;  4MCR A;  1XBU A;  2O53 A;  3DLJ A;  3FMC A;  3BXM A;  2F8H A;  2RFH A;  4R6T A;  1YW6 A;  3LWU A;  2GLJ A;  2PVW A;  3NFZ A;  3D68 A;  3KQX A;  3PB9 X;  5LYF A;  1CP7 A;  1LAP A;  5F09 A;  2ZEF A;  2AFS A;  2PJC A;  3PFO A;  1CBX A;  1VHE A;  4Q7A A;  4UEE A;  1NSA A;  3BI0 A;  4IAV A;  5HVH A;  2PVV A;  1VIX A;  2JBK A;  8CPA A;  1HEE A;  2AFX A;  3FJU A;  4ZY0 A;  2HB6 A;  2AFU A;  3PB6 X;  4OC0 A;  4DUK A;  3MN8 A;  2PE3 A;  4TWE A;  3BI1 A;  2PJ9 A;  1TF9 A;  2PJ4 A;  3QNV A;  2ANP A;  4UF4 A;  3WC6 A;  1LCP A;  3IEH A;  3RBU A;  4PXC A;  5THW A;  2PJ2 A;  2ZEH A;  2PIY A;  2IJZ A;  3D7D A;  3FX6 A;  4ZYQ A;  2RB7 A;  2NYQ A;  5IB9 A;  4LQG A;  3H8G A;  4A38 A;  4MHN A;  4KSI A;  1CP6 A;  4EWT A;  3HUV A;  4OC4 A;  2IMO A;  1CG2 A;  5LRJ A;  1LAN A;  2XEG A;  4EME A;  2AFW A;  2EK8 A;  3VAR A;  4ONW A;  4P4E A;  2C6C A;  2EK9 A;  3L2N A;  2ZOF A;  3PFE A;  4OC1 A;  3D4U A;  4WJB A;  3B2Y A;  2AFO A;  1EE3 P;  2AFZ A;  3SJF A;  1PYT B;  4NGP A;  4FWU A;  1Y0R A;  3KZW A;  4MHP A;  2GRE A;  4OC2 A;  1FT7 A;  4AXV A;  3ISZ A;  1RTQ A;  4MHY A;  1ARL A;  4JZ0 A;  3KR4 A;  2ZEG A;  2GU2 A;  5HXD A;  1HDU A;  2AFM A;  3BHX A;  3TC8 A;  4X8I A;  5K8N A;  3CDX A;  3IO1 A;  3PEI A;  4UIB A;  2EWB A;  3S9L A;  2XEI A;  2NSM A;  5D8N A;  2F7V A;  3B3C A;  5JGF A;  3D66 A;  4OP4 A;  4DJL A;  1LAM A;  2C6G A;  4MCQ A;  4MCS A;  4OIW A;  2V8G A;  1DE4 C;  4OKO A;  1XJO A;  5K8M A;  4NGQ A;  2JBJ A;  3RZA A;  3PRT A;  4H2K A;  2G9D A;  3FEE A;  3WT4 A;  3I1U A;  4MMO A;  2CIJ A;  4IK2 A;  2ZEM A;  4P4I A;  2V8D A;  4A94 A;  3FED A;  3NH8 A;  5CBM A;  4NGN A;  4R7M A;  4NFR A;  3IC1 A;  5J1Q A;  2PJ3 A;  1BAV A;  3HLP A;  4WWV A;  3GB0 A;  3PB4 X;  4ZX8 A;  2QVP A;  5LRG A;  4P4J A;  3FEC A;  5K8P A;  4MHZ A;  2GLF A;  3B3S A;  2Q43 A;  4P10 A;  2PRQ A;  1CX8 A;  1Q7L A;  5LYL A;  2O4H A;  1F2O A;  5JH9 A;  5LYD A;  2PJ0 A;  5DS0 A;  4P4B A;  2C1C A;  3NA6 A;  4O23 A;  4UEZ A;  5JM6 A;  1Z2L A;  5CPA A;  4IHM A;  4EFD A;  2PJB A;  3VAT A;  4OID A;  4FBE A;  2BCO A;  1R3N A;  1YW4 A;  3V38 A;  5D29 A;  3WC7 A;  3NH4 A;  3T8W A;  1CPS A;  4PXB A;  2PJ1 A;  3WAB A;  2WYR A;  1YME A;  4NJQ A;  4TNU A;  4W9Y A;  3D7H A;  2BO9 A;  3K9T A;  1F2P A;  3KAS A;  4PXD A;  1HDQ A;  1GYT A;  1Z8L A;  3PBE A;  1IGB A;  3IWW A;  1ZLH A;  3GUX A;  5HVF A;  4NGM A;  3KL9 A;  2CTC A;  3IFE A;  4X3R A;  3IJ3 A;  1Y7E A;  5ELY A;  4PXE A;  3TX8 A;  2ZEE A;  4ZX9 A;  4Z65 A;  4ZY1 A;  2PIZ A;  2V77 A;  7CPA A;  3KR5 A;  3VH9 A;  3KHZ A;  3MRU A;  4RUH A;  2ZOG A;  2ZEO A;  1TKJ A;  2XEJ A;  1DTD A;  5K8O A;  4BD9 A;  1XRY A;  1TKF A;  2HC9 A;  4P4F A;  4P6Y A;  1ELM P;  4FAI A;  1ZG8 A;  2XEF A;  3KI9 A;  5HVG A;  1PCA A;  4NGR A;  4CPA A;  3NH5 A;  1KWM A;  2PJ8 A;  2OR4 A;  3B7I A;  3LMS A;  2PJ5 A;  3SI2 A;  1UWY A;  3H8E A;  3PB7 X;  4X2T A;  2ZEP A;  2ZEN A;  3KHX A;  1BPN A;  1H8L A;  1ZLI A;  2V8H A;  3S9M A;  2JEW A;  3CPX A;  2VL1 A;  3DGV A;  3D67 A;  4PPZ A;  1R43 A;  4UIA A;  1IY7 A;  1YLO A;  1QQ9 A;  2FVG A;  1QMU A;  3V7Z A;  4MRI A;  3SJG A;  1ZG9 A;  4F9V A;  3B3V A;  5I4M A;  4B6Z A;  1TF8 A;  1AMP A;  4F9U A;  3KQZ A;  4OC3 A;  2POK A;  3CT9 A;  1F57 A;  2PJ7 A;  2ZEL A;  3RAM A;  4A39 A;  4F8Z A;  4PQA A;  2QYV A;  3B3T A;  1ELL P;  4NGT A;  2BOA A;  2Q51 A;  3K2K A;  3CPA A;  4P4D A;  4R76 A;  1BLL E;  2DEA A;  2C6P A;  2PJA A;  5LYI A;  1FNO A;  3D7F A;  4FUU A;  1OBR A;  6CPA A;  4YWY A;  3H8F A;  3B3W A;  4UEF A;  4R8F A;  1VHO A;  3ISX A;  1VGY A;  3GLJ A;  4ZI6 A;  2ABZ A;  3SI1 A;  2J9A A;  1M4L A;  3SJX A;  3D7G A;  1TXR A;  1BPM A;  4P45 A;  3KGQ A;  1ARM A;  1CPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...