3VBCA

Crystal structure of il-17 receptor b sefir domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
136
Chain Sequence
LLPLIKVLVVYPSEICFHHTVCRFTDFLQNYCRSEVILEAWQAAAIAEMGPVQWLTTQKQAADKVVFLLPSQDLFPLAFNLFCSDFSSQTHLHKYLVVYLGGADLKGDYNALSVCPQYHLMKDATAFHTELLKATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of IL-17 Receptor B SEFIR Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Interleukin-17 receptor B
total genus 40
structure length 136
sequence length 157
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08357 SEFIR SEFIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11530 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vbcA00
3VBCA
chains in the Genus database with same CATH superfamily
2ZSFA 1S2LA 3IIEA 3IOCA 5JARA 1NSTA 1NUPA 4RBNA 2EX1A 1AUXA 3LTNC 2R8RA 3ZOKA 1JYEA 5ALVA 3DYIA 5DRYA 4US0R 4Y1RB 4I3FA 3IHKA 4BN4A 1ML4A 1C7JA 5F7OA 2HJGA 1JHRA 3A11A 4DQDA 4RSRA 3G2IA 4O4LF 5JCOC 2B8EA 4BWFB 3U56A 1AQYA 2Z8ZA 3AB8A 2TMGA 4IHJF 3SSNA 2WJHA 3PRYA 3E3LA 2OUIA 1Y9JA 3SZLA 1WHTA 2HFJA 3Q7EA 1W0CA 2BGLA 3LPCA 5GJWC 1YR9A 1VA5A 4M22A 4U63A 4BVLA 5I7EA 3I2KA 1DBSA 3BXFA 3CNQS 4YT5A 1RPZA 1ZBQA 4JMLA 2NUPA 1H6DA 4S1NA 1QGOA 3EWIA 2IJGX 4HFRA 4HCJA 4IXDA 4ZEXA 3P20A 1XLTC 3E58A 3ZNPA 4BYMA 4R7GA 1KVSA 1ZGGA 1E2QA 3CV3A 4MLDA 1NONA 4FYKA 4A6PA 4DCGA 4WFQA 5CA1F 2WUVA 3U4MA 4FFSA 1JAZA 1RLJA 3U48A 1SXPA 1W87A 4ZCQA 4BNVA 4MS1B 3E81A 1PFVA 2ZJYA 2QGFA 2M1XA 3ILHA 2QLBA 4LY0A 3OQIB 3KT6A 1SEVA 1WMEA 1W48A 4FBGA 1RQXA 1YS4A 4P58A 3OCCA 1K6MA 1ADCA 1N1DA 2C4TA 1JJIA 1KVRA 4HO1X 1YXMA 3DR5A 2XT9A 4CM3A 2HF9A 3OCXA 1YHYA 4X6XA 2LV8A 1XD2A 5FB3A 4MW1A 4DV0B 5EMMA 3OEHA 4N8SA 2XT0A 2R2AA 3HWRA 3PJDA 3RK0A 2Q2WA 3OT5A 3ZDYB 4YJ3F 3E0QA 3TRKA 4QT4A 2DWQA 2GEFA 3KNZA 1ST3A 1U0SY 2RGBA 3PL5A 4GUAA 3AOEC 4BVHA 4DS3A 1QP0A 4P93A 2RHDA 3VNSA 3M4XA 1N2HA 2HIGA 1UF9A 5J43A 4IMRA 4DV6B 1M1UA 2E0IA 5DEOA 2AKAB 2GNAA 5I7RA 4TSFA 2JZOA 2XTAA 3N53A 4YMVA 3QE4A 4KQMA 3LKVA 4WV3A 1JWBB 2W0MA 5HF5A 4RHYA 1WPQA 1IN1A 4HBGA 5CFNA 4C6TB 1BJTA 1S3SA 1SZDA 3L01A 1J5PA 3TCXB 3WNCA 1LZLA 4E22A 3U19A 3V7FA 2PH1A 3FX2A 521PA 4DUZB 4ER6A 1VBFA 2IYQA 4Q9HA 2QTTA 3EDYA 1X42A 4J75A 4EW2A 4PE5B 1VYTA 4YI5A 4I55B 1ULHA 2CF6A 1SVWA 2JH9A 1M1YA 4NECA 5BN5B 2D2EA 2VZ8A 5EP4A 3ESDA 3P4UA 2EERA 3H6GA 1E9BA 2I9KA 4NCHA 3CLTD 5D3ZA 3EUWA 4FFVA 3STWA 1SOMA 2G9RA 2L69A 5EVJA 2IW3A 3SDBA 4DDMA 1FQKA 1Q44A 4D0SA 1XK7A 1ZUD1 2Q3JA 3G7UA 3HJUA 3GRRA 4KV7A 3PNKA 2J09A 3M7IA 5FR1A 5SZHB 3WICA 5IDQA 3QVTA 3KTAA 7REQA 2NU6B 4S35A 1L5KA 3UG6A 2ZAMA 1L8LA 1C81A 2GJKA 1FNBA 2VDVE 2ZUWA 1YOVB 3FMPB 2G70A 2DR2A 3AR6A 2C54A 5EXXA 4FE4A 4TVBA 4GQBA 3PR3A 4I0WB 1KMQA 3JZMA 4NZNA 5JAQA 1JEEA 4DCPA 1BHQ1 4ND7A 3I61A 4KZKA 5I9MA 5I4BA 1NUHA 4DUGD 1Z34A 3RRZA 1GNSA 1V11B 3IVXA 3UVEA 4BV2A 1JPUA 2WAMA 4RLQA 1KYIA 4A6XA 4R0VA 3RSLA 3FSEA 1AV7A 4EG1A 1TQ8A 3AM3A 3LO8A 1X74A 3R3UA 1JQDA 2GERA 3V8RA 3GF4A 1GOTA 4A8JB 2OUKA 2FWJA 1WUHS 5CURA 5CMLA 2HGSA 1OLSA 2W37A 4QRIA 2G5CA 4C4YA 1T8WA 4X24A 3ZV5A 3MT8A 4A7PA 1DAPA 1GPDG 1UKYA 2FR8A 4PG4A 5KTOA 2P27A 3G0DA 4G0YA 4KSYA 3C5CA 3TSAA 1CQJB 1UZUA 3ZWWA 4P7KA 3R4VA 1J39A 4QUHA 3QW4B 2ZWIA 1OX4B 2DLNA 3KUUA 3CNEA 4OJMX 4B5LA 5KOYA 1DT3A 2NU8A 4ETIA 5HKAA 5GONB 3S0JA 1Y3BE 1V39A 4UNSA 3BK2A 3ZJYA 2Q1WA 1JS1X 1AK1A 4JB3A 1TK3A 1JLLA 1JAYA 2FAXA 1XFAA 3OPYB 4F38A 4Z6KA 3UJNA 3QVGA 2IYNA 1UJ4A 3AGPA 1RM0A 2DBRA 1N6LA 3PDJA 1FEZA 1FU4A 4YJFA 4EPWA 3HKBB 3K1AA 1KQGA 1U80A 2II6A 4TLDA 1LF5A 2DHRA 3BHIA 3LLMA 3C3YA 1ZNZA 5IVIA 1C3XA 1N2ZA 4LZNA 1E60A 3INRA 3UJBA 3IRUA 2W2NA 2DHCA 4PLWA 2JAPA 1NY5A 3LF1A 3SYTA 2GSDA 4BMVA 4F8YA 5LN1A 4O2RA 4XKJA 4Z5XA 2C5AA 3PXEA 4CEJB 4RNCA 5AM5A 2ZR0A 1USGA 1KI7A 3PXUA 3DV9A 2HQSA 4EG3A 4UVIA 3FTQA 4B0OA 3DDWA 2J4DA 5IYZB 2WVAA 3WLEA 1U3DA 3BSWA 3K6SA 4ZWNA 2XYPA 4I4TF 4ZQFA 3EEFA 4YP7A 3TSWA 4DNXA 5DEIA 2R7KA 3LC2O 3MWEA 4MWBA 2FXVA 1XHEA 5ILGA 5I9BA 1PG0A 2E21A 5KBYA 2WG1A 3LX8A 2LGJA 2AFIE 1LRKA 4EY6A 4M1SA 2JLWA 3EXFB 4ZT7A 4UVDA 5C7OO 5ALFA 3CO0S 3W3AD 3LK7A 3WLQA 4BNDA 1XDZA 2QWXA 3OJXA 1LGYA 2VDJA 4MYRA 1UADA 4M9QA 5F2NA 3BRWA 3MCWA 2CBZA 1TMKA 4LZPA 1TUBA 4AN1A 2QTRA 3RS9A 4RVHA 1J25A 1QS0A 2HC9A 2YYYA 4PYQA 4MTLA 1SR8A 1GN8A 3VHXB 3N2IA 4BL5A 3QEJA 1GRRA 1SOAA 3DWFA 3LP8A 4PSCA 2O0HA 4RS4A 2OLKA 3KKNA 3SXJA 5AOBA 4D02A 4AX4A 4XYLA 3HLKA 3LC0A 2IYSA 3I53A 4LN1A 4KVGA 3VKGA 1OMOA 3W7AA 5CDGA 4KVAA 1C29B 4O2BA 1CUYA 2HEIA 1LU9A 2REQB 2VHJA 4QEZA 4U5XA 5C37A 2ONZA 1FQWA 1ESCA 3JQ8B 4RE6A 3TQSA 4RH3A 2ZYVX 4C7BA 2IPMA 1MVLA 1HEIA 3VDNB 4EAQA 5ALJA 4CMGA 2IW1A 2PIAA 3VR4H 1U8TA 1Y6ZA 1V1RA 2DFLA 2BM1A 3RWBA 1IXKA 1TF2A 1F6DA 2FP4A 4F4IA 1XCBA 1F9AA 4I6GA 5F2KA 2F3UA 1C9NA 2B82A 2HBRA 4L50A 5JSYA 5LUBA 3CLRD 5F7XA 5CGQB 5J2UA 5B1YA 1JFRA 2CDNA 3WB9A 3CUUA 3DJFA 3I04M 1QDLB 5HILA 1P91A 3RC9A 3V7YA 3V8VA 3CQ9A 3X44A 4B09A 5AW8A 4CPDA 2CL6X 2XVZA 3K0FA 4OQYA 1QZ3A 3T5DA 2CZGA 5GP1A 1IVYA 4BO7A 3ROEA 2PS9A 5FFFA 1CUBA 2F1IA 2JEZA 3R0IA 4GS5A 2ZVQX 1OFGA 1IPFA 1Y8QA 3LCRA 3CNLA 2P41A 2C5BA 1K63A 1N2IA 3T95A 3UM9A 2UXBB 1RHKA 2JHGA 3F8WA 5C9ZA 4CL0A 1L5NA 4H4EA 4F0JA 3K70D 1PDOA 3JYPA 3KHUA 3E3OA 1AZTA 5DYNA 1ONPA 3AF5A 2ZYIA 1XZFA 4G97A 4QU9A 3ZZ1A 2FZ5A 1XXHE 4RY8A 2IYXA 4YJFB 4PFSA 5JVDA 1SVKA 3KOXA 3QQ5A 2MOKA 2ZI5A 3IBYA 4OGWA 2XE6A 1JDVA 1N6PA 4LJLA 5AHOA 4BJ1A 2JA1A 1NBIA 2JIRA 2XNSA 4CMAA 4KFTA 1ULUA 2YQ4A 4U1RA 1JBQA 1TCUA 3PT5A 4JFRA 3D8UA 4LXQA 4NYJR 4XSGA 5TPZA 1H4QA 2P75A 3CGGA 5AVXA 1F4VA 3PFKA 1DQYA 1W29A 3HLYA 5C31A 3EK2A 4YV1A 4OLHA 5IAKA 1CR4A 4YJKA 1G8HA 3NW9A 4IDBA 5EZQA 3FWKA 4RZQA 1GQ2A 3C87A 4BQQA 4FKBA 4JVOA 1FTNA 2W6CX 5DULA 4MYHA 3ER9A 1NBHA 1RXUA 3HCBA 4TYMA 5K8VA 3F2VA 2B4YA 4S12A 4Z9YA 5KSPA 3SZOA 3VR6H 1G6OA 1WV1A 2HLHA 5F4ZA 4AUNA 4NXNB 3AERA 1T4CA 2WB4A 3FCOA 4DA8A 5KQRA 4FDTA 4Y6PA 4IUCS 4NFYA 3M81A 2GD2A 2Z6VA 5AJYA 2DPYA 4V02A 1R5NA 4A0SA 4YB8A 3SD7A 1I51A 1JKFA 3B9QA 3EFHA 3E1KA 3M1YA 1LS6A 1NSFA 1Z4KA 3QFRA 4DILA 121PA 3TVYA 4RDXA 3S7ZA 1ESZA 1MRZA 3FE2A 4G24A 5K20A 3MD9A 1B3BA 3H5TA 1SPXA 3MC1A 1HLDA 2AUNA 2XLCA 2AK2A 4QLAA 5ALHA 4M88A 1HPLA 3QVKA 3T9DA 1SD2A 3U3XA 4CIXA 4EF5A 5HM8A 1G8YA 4CDRA 3ZS8A 2F3RA 3WLLA 4X1YB 1T25A 3UHFA 1XWFA 1Y9DA 3DF7A 1WVMA 5DU2A 3ONFA 2KYRA 1YDWA 1Q83A 1R7RA 3R1IA 3D6NB 1G19A 1Q0TA 1H3FA 2VCHA 3M1LA 1OH8A 1YJBA 4R2KA 3II6X 2ID8A 4Z4HA 5C4MA 4TOIA 4MH0R 1Q0UA 2VHVA 2VQ6A 1R6XA 5AQ1A 3MTQA 2C4HA 1CJMA 4RXUA 5TB5A 3WBBA 2BI8A 1CIJA 2YHUA 2ZWPA 3ANXA 3D2BA 4PN3A 1ZICA 3FMOB 1XYYA 4EY7A 2GM4A 1JWLA 4M36A 2KS6A 1PK9A 2LDBA 2GPNA 5CVTA 4F9FA 3ASZA 3ROXA 1NFQA 2VH5R 3RK4A 4WOJA 4TWAA 3WGOA 5GJBA 3PNPA 3G1TA 4IDHA 1OQAA 1EK0A 2XX3A 4M9RA 4RD2A 2FPXA 3HU1A 4MWZA 3D3WA 4MVYA 2B1JA 1YBMA 3TIGA 2DT8A 4AW9A 2QMYA 2B9VA 3FHOA 1ZGHA 2CVZA 2JBHA 2QQEA 4YCJA 5FO1A 1S8AA 3N8DA 2K4MA 5ENVA 5IAGA 1PZHA 1XPOA 3BF8A 2HT1A 9MHTA 3W5JA 2IIPA 3RT9A 4PIMA 4DCTA 1UDXA 3EZ9A 3RFFA 1YR1A 4E11A 2JKYA 4NPAA 4Q3NA 4EUFA 2GARA 2WQ6A 1C5KA 1USUA 2FZGA 1B6RA 2V7UA 4W5HA 4FYMA 1QAQA 2IY7A 2P5TB 1XL0A 2FRDC 1RAGA 4BMOB 3VGPA 1G18A 2BF7A 2PN1A 4Z99A 1A8QA 1KAGA 1NQOA 1Y5LA 4G0XA 1KSHA 4AICA 3U62A 3NHRA 4HG2A 5F5NA 2WUGA 1W49A 1A5TA 4FS3A 1XN1A 2HMTA 1Z3IX 3VU3A 3MJVA 4CN9A 2CCGA 4JMPA 4M54A 4JA2A 4KWEA 1P8JA 3TR5A 1IC6A 2G80A 4B48A 4BBJA 1XPRA 1NR7A 3CF6R 4YO8A 2B35A 3WWEA 1DPFA 1YU9A 1Y4SA 1CFZA 2XNJA 4BNGA 1OC2A 4RV4A 3FTEA 2ZJAA 3MTJA 1W59A 5F52A 3NBMA 4KNYA 3MCVA 1M0EA 2BT4A 2GHRA 1AKRA 2R8XA 4YHBA 1IOWA 1SXHA 2L82A 1Q21A 2WDZA 3A0RB 3RREA 3RVJA 5D6NA 1HQDA 3SC2A 1J2RA 5GOZA 4U3JB 4TVSA 3OJ0A 4EG5A 3AERB 2J3EA 4ACAA 5HGXA 1C50A 2ZKIA 2HWWA 2R8YA 2PXXA 1JEYA 1LUAA 1J1ZA 2QLTA 1TD9A 1ESMA 2BFMA 2IF2A 4NOLA 4YWJA 2YFYA 4LNUB 4RJKA 5CT8A 4DQXA 3DW3X 5FI5A 1F8YA 3QW2A 2WF9A 1RWPA 4FFRA 4G8BA 1ENZA 1LDGA 1SHJA 4HR7A 4M1TA 4TTTS 2C88A 3U3OA 4EENA 4F4DA 5LWQA 1Z5VA 1KYWA 3FKSD 1TQHA 3LUGA 2P2SA 1IM5A 1EFHA 4Q02A 1F8FA 4LRSB 2CMKA 2QJWA 3OI7A 3B85A 3MINA 4O4IF 3G9ZA 4TX1A 1YONA 1OLXA 3KO8A 1XVUA 4PQEA 2BMVA 1ZIPA 1HBJA 4ZAZA 2E5LB 2NTEA 4QUJA 2XJ4A 4G84A 3V32A 4LQDA 4Q18A 4G5RA 4CL8A 1QVRA 2ZCVA 2O8CA 5IDYA 5HWSA 1E1CA 4CQJA 3SG0A 5INTA 4HKTA 4LMPA 1WV0A 2B34A 3UJ8A 4YT8A 5HF6A 1H5NA 1RM5A 2VNSA 2XOXA 1OXSC 3KFXA 4I66A 4LCBA 1CJVC 3KDPA 3E9MA 5BUSA 4OPMA 2UAGA 3HPRA 4WI1A 4EB8A 2RI1A 2PYZA 1UZAA 5GM2A 1KDYA 3M5CA 5M5BA 4W8OA 2VH2A 3MBIA 1FFSA 3V7NA 5IKXA 3T99A 5HKOA 2EW2A 4UNPA 4QTYA 2ZIZA 4NEHB 2W4MA 5ALSA 1CETA 2IY9A 3ELWA 2X0NA 3TQFA 1QQ6A 2QN1A 3ABOB 2ZRFA 2DHQA 1UK6A 2Y1KA 3NEPX 5BRAA 1K6JA 1OI7A 1JLKA 1R3DA 2H3EA 2V6MA 4MB2A 2XMBA 3UHOA 4UMEA 3U9TA 2Z8XA 3ICPA 3IVMA 1JXAA 2XECA 1TUGA 1RWWA 2UVPB 3G82C 3I1FA 5GONF 2X0DA 3WFZA 4DCVA 2QTLA 4RHFA 5FHRA 5LCXA 3WVNA 4LTNA 3DW1X 3PWZA 1YRLA 2LDXA 1NM5C 1R6AA 4HDRB 2VC2B 3ZWAA 1QKIA 3U44B 2I6GA 3GARA 2OZKA 3H2ZA 4GXQA 3P2OA 5CFMA 1PL0A 1E2EA 2A5LA 5LB4A 2OHOA 2OHJA 2B98A 1RWVA 1AZSC 2FHPA 3IE0A 4O6VA 1IVSA 3UEOA 3LLCA 1ULSA 2C99A 2Q7XA 2P0EA 1R00A 3A3PA 5D1NA 4F04A 4N41A 1YB2A 1IHXA 3RBVA 1J0BA 1ZNYA 4ILEA 4KCGA 5FD8A 3T94A 3GC6A 2HKIA 1VCOA 3HY3A 1PX2A 1TCVA 3MWYW 3NHFA 5EIOA 3HJBA 5CBKA 4HV4A 2BBSA 1ZD5A 5FV7A 1OXMA 3OLCX 5EHGA 1VXRA 3SEFA 4D74A 2YX1A 2POCA 1Z88A 3I9MA 1IONA 3LHSA 3QFSA 3JVEA 2VNHA 2Y1EA 3ND8A 4CDGA 1RLUA 1E9FA 1ZW1A 2AF4C 3LQKA 2LUOA 4JZYA 5TT1A 3ZHRA 1H3NA 2JHFA 4WZAE 1JU3A 3C8ZA 3GVPA 4WXMA 3W4JA 2BRUC 1LEHA 3SLRA 4E1AA 3DLTA 1NASA 4ALJA 4TM8A 3F2IA 4QOJA 2AEMA 3UA4A 2CUTA 4RQTA 3W5DA 4NU6A 1KK0A 3VMMA 3D6HA 1U2PA 5GOTA 5C8VA 1X8LA 4BB0A 4PC6A 4ZVOA 2INGX 4KQJA 4B8WA 1NBMD 1XAJA 1H5QA 4YREA 1IBSA 4NU8X 5KU1A 2DTEA 1YE5A 4RKFA 2GPJA 3WR5A 1ZHFA 1D2HA 3RPEA 4W5OA 5EWMB 3ZXUB 4BUJA 1PZMA 3ROZA 2QVXX 3B1XA 5HM6A 1GVHA 2P65A 2VRCD 3FPFA 4QRDA 1FNMA 1LW7A 3PGKA 4ZYXA 4M1MA 4J8PA 1NJGA 2QV0A 5TQJA 1GIAA 5JD3A 2OWEA 3I62A 3HA3A 4MMXB 4BKUA 5FLEX 5TMEA 4B2IA 1R74A 2PQMA 3KKPA 2EWWA 3M6XA 1NTRA 3EFOB 2RBEA 3BIOA 2ZG6A 4R54A 1DC3A 2CXXA 1VG8A 2QVBA 1PWHA 2JFUA 2WVJA 3F7OA 4OYYA 4WKPA 3VO2A 2IOHA 2PX5A 3DS8A 4HX9A 2N1BA 1YFJA 1ODSA 1ISJA 1EVIA 1UJCA 4WAUA 2GN9A 2LNDA 4W7HA 1CR6A 3EA4A 1JMYA 3P32A 4GR9A 3PEYA 1ODFA 3LK6A 2O06A 2EJCA 4Q9NA 2DPHA 1TU3A 2CHQA 2H5IA 4OXQA 5JSZB 1ZNQO 2H4JA 3CNBA 5K45A 3PDUA 5IMSA 3QA9A 1KSGA 3DPIA 5LNK1 4KO2S 1Y98A 1EIZA 1M7BA 1FUIA 4X71A 5DJ5A 4ZI7F 4GYKA 2JLBA 3O92A 4BQEA 3N0WA 3USCS 2G1KA 1B4DA 1PJQA 3PF8A 4ETMA 4ZQBA 3K0AA 4YBRA 5MFPA 1TLFA 3F3YA 3KOOA 2CXNA 3KYBA 1C1DA 3PC2A 3RM3A 4D43A 3KQNA 1KR2A 3I9V6 1UJ5A 3K6RA 1BDIA 4EP1A 2HRBA 2W2VA 2O23A 5ITSA 3WWZA 3DBHB 3QE0A 1KBZA 4FILA 4D46A 2A9JA 1Y8ZA 1UBHS 1KXZA 1VMEA 2VAMA 4Q1BA 5BURA 4KK4A 3FFWA 3C3PA 2QMUA 1DP4A 3N8KA 1J2YA 4OYRA 5HIAA 2GS9A 3KEOA 3ASVA 4AB1A 5CRIA 4IGFA 4L0CA 3CH5A 4ACBA 3TL3A 2FWIA 3BC1A 1LPBB 2ZUSA 5F1KA 2PZJA 3OY7A 4QM6A 3A2NA 3BWVA 4G4GA 4WGGA 1IULA 1WZNA 3LCUA 3OHSX 4MPRA 1IEQA 4Y2SA 5DSZA 1YK0A 4DR2B 2HQRA 2EBWA 2ZYUX 3D54D 1VECA 3KR0A 3V42A 3AR3A 2RC6A 2HCFA 2C2HA 1BCSB 5KJFA 4YJ2A 4RABA 3T1TA 4JYPA 5C51B 4JVLA 2C4UA 3EG5A 3I58A 2CSXA 2HV9A 2WWXA 1T9GS 3E18A 3U7FB 2I1WA 4IJKA 3ONWA 4XIJA 5F3RA 5FI1B 1GQYA 1T4CB 1SG9A 1WUYA 5ALXA 2QR2A 1G9TA 1L9KA 4MI6A 1DOHA 3FYSA 4DLUA 5DLYA 4AWAA 1PSDA 2VP6A 1D7AA 3FWYA 3PC6A 1XA4A 1PFWA 1B8OA 1BXZA 1P80A 2D2IA 2VXOA 3HCOA 4C04A 1XQWA 4CN8A 1T3GA 5C8YF 3TF5A 1XNRB 4MROA 2Q29A 5H80A 5M2QA 1EGHA 2P2DA 5JS2A 4WLEA 3IQDB 1G7RA 3EF0A 4OHFA 3FUUA 4JBXA 2J3MA 1A8UA 3PXGA 5E1OA 3TQQA 2DUWA 4E31A 1DKUA 4FCVA 4IWXA 2QTVA 1KDZA 4J76A 4FC7A 3IB6A 1YUMA 2IFTA 1GLGA 1ADJA 1SXJB 4TS3A 1KFCB 3C8MA 4MW2A 3VPAA 3LY8A 2Y27A 3FTNA 3I9FA 1U7ZA 3KB1A 1YB5A 5AWFC 1W4AA 3ZTTA 4JT9A 4Q66C 4UE2A 1VLQA 3HY4A 1DV2A 1GZDA 4Q9IA 4CWAA 5KNBH 1VSTA 4DF3A 1T6NA 4CJXA 5JCPA 4ZQEA 4Z1MA 4LYJA 2GBPA 4K87A 5AKXA 3ZYZA 2O3SA 5FFNA 3FNRA 4H7EA 1E3EA 4U6SA 4BVJA 4KBYA 2I4OA 4RVCA 1EBUA 3UY4A 1FDVA 1EDBA 2OHVA 3AQIA 4J9VA 1Z5NA 2FPGB 4C7KA 4BX0A 4YA6A 4BQFA 2H2GA 1RWQA 4FIDA 1P0CA 4RSHA 1CJCA 1J09A 3N07A 4FONA 1XR3A 3G0OA 3NX4A 2DERA 1O08A 5GINE 1JB9A 3R9XB 3MT9A 3V97A 4IAOA 3DLAA 3NQ41 1Y7PA 3K0HA 3I9NA 1CU1A 5L3QB 5BWNA 5IC4A 2EZ9A 2C7BA 4Z0TA 1VYHA 4YUXA 4KPEC 3ZZNA 1E9DA 1UM9A 2V3WA 3ACDA 3G68A 3KPVA 3O9MA 2RGEA 2YH2A 1LPPA 2CLKB 3B1ZA 5DWDA 2VQSA 1QFMA 5G4KA 3NC0C 4ZREA 2W42A 1KI1A 4GM0A 2RH8A 2NTVA 2HPZA 2I4TA 1UBGA 2K7ZA 3KB8A 1Z6ZA 1XRPA 1G291 2R44A 1XMPA 2WJ6A 3A0UA 4CHGA 4EYGA 4Z4IA 3GFSA 4FDAA 1M0TA 1CRZA 2E4YA 5FTJA 3JR3A 3G0CA 4FOPA 1WSBA 5EYPB 5FA6A 4A5OA 3ZLJA 2L2QA 4B44A 4G0UA 2WAYA 1UPFA 2YWJA 3WGVA 2QYHA 4DQKA 1QUEA 4E6PA 5JYDA 1JX6A 3G0GA 4HWRA 1YD7A 1AKTA 4UBJA 1ABFA 1ORTA 3GZNA 3U26A 3Q15C 4S0ZA 1KOGA 4BMCA 4L5BA 4NF2A 2JFHA 3R7SA 2A9QA 3NDJA 1HY3A 4OI4A 4F6CA 3ZD7A 3IX7A 4JEIA 1CDEA 3UQYS 3ENNA 3TGPA 2H4XA 4YUYA 4ARUA 1SO8A 1X94A 2YXPX 3PHHA 3HSSA 4JBYA 4KRYA 2A14A 1L7VC 2P4HX 3HYNA 5FFMA 4JIMA 1RLMA 3PUYA 3VOAA 2FN3A 3E3MA 1A7KA 5B1IA 2C97A 2H1HA 3ZDDA 1VE1A 2PG3A 3PKZA 4DJ5X 3GLGB 3AI1A 3WB2A 1NQVA 4HYQA 3IE2A 1AA9A 3B3GA 4K1LA 1X19A 2XTMA 2XH8A 4GAEA 1J7JA 2G9ZA 5CX1A 1ACLA 3QVXA 4A03A 1YZQA 4CODB 1S0UA 2GZ3A 5I45A 4IJUA 4FMCF 4DG8A 1UWVA 3FYUB 4TV8A 3BFPA 4EHAA 2OKGA 4JLDA 1EBBA 1CJBA 1FVOA 1N3IA 1RW4A 4AZWA 4MUAA 5HFAA 4PG8A 4GYJA 3OMLA 4QGHA 3F5MA 4XIYA 5G0VA 4Q7QA 2EHDA 2XUAA 2O14A 2ZE6A 4PZ9A 5A7FA 5D00A 3VAZA 1EFPB 3MGBA 4XQ0A 3MNFA 3NWBA 3R24A 3CH7A 4EJMA 3BTSA 2F9LA 3O95A 3EWNA 1IRIA 4NCIA 4ZO9A 4TRRA 3RR2A 5BWLA 5JNUA 2YRWA 4IDGA 2UZAA 2Z3VA 5EZSA 1YBVA 2AJCA 1HURA 1R4AA 3DWIA 3KXDA 4IYRA 4EA9A 1M2WA 3W1EA 4MVJH 3PPWA 2ZWOA 2ECQA 1TQ6A 3L8MA 1VB3A 1HE8B 3MTDA 3RFUA 1MN6A 1SQ5A 4C7JA 2ACKA 3GA0A 3SICE 4QWWA 2NNWB 1T8RA 8ADHA 5TJHA 5C4GB 5IT5A 2LXNA 5L7TA 1N78A 1JWAB 1NWHA 4QBIA 4YAEA 2PA0A 4OHZA 4JI2B 4LZLA 2VSXA 1ST2A 2VBCA 1PS8A 1AGPA 3W9BA 4GR5A 1TYAE 2BC9A 3L0IB 3I4LA 4UUOA 4MSUA 4YR7A 2LP4Y 1PV4A 1B26A 2C58A 1XTVA 1U0GA 2QZJA 4LE0A 3OQJA 4YJHB 4EY4A 2WJ4A 3SQMA 2ZJOA 5KC8A 4M1EA 1D6NA 5IHPA 1OC4A 3OIWA 2ZAOA 5JH7F 3TPFA 1NP7A 3I73A 4LY9A 2QSJA 4P3OA 4U7DA 2JFQA 3QPVA 1J00A 2ZDHA 4R8SA 1VZ3A 4I14A 1T0JB 3K2IA 3R0ZA 5B58T 2QUAA 2D0PB 4KXUA 1X1AA 5M7EA 1AZWA 2ENUA 2J3LA 2ZYHA 2IDZA 4IFTA 1BX0A 3VHXA 2D8AA 2DUUA 1PNVA 2JBAB 3U5TA 4MHSA 1ZPDA 3RVLA 2QVLA 2O7SA 2QVCA 4MP8A 4B33A 3MHTA 1KHHA 2ZRGA 2R6DA 1KZYC 1YIDA 1WAMA 3KJIA 1XCOA 2AWOA 2QU8A 3F97A 4JLNA 5IYZA 5JJBA 4ZYUA 3SQNA 3TBHA 4KQ9A 2Q6VA 2YJTD 3H2JA 4IGKA 3UFBA 3VAYA 4IVQA 1GXSA 2W6OA 4YROA 1A50B 3W9YA 4H59A 1CQWA 2I66A 5CB4B 3U6KA 3PJRA 3TE7A 4FR5A 4R7TA 4G1MB 1Q0QA 2ZP1A 1T5IA 4G2NA 1KEWA 4FXPA 5CR9A 1Q1NA 2CHUA 1EA5A 2WU0A 4MLZA 1IEWA 2AEEA 4OQQA 3MT7A 4H3KB 2FK8A 3QUBA 1A77A 4BO2A 1FFXA 4M76B 1TVKA 3ZWBA 5BWCA 4RF4A 3MUOA 3GEMA 3D7KA 1D0VA 4QICA 4LS3A 5DM2A 4GLFA 3S99A 3FSGD 3CISA 2BP7B 2E1PA 4FFOA 3RROA 3ZTWA 4F86A 2UZ1A 3KK0A 4Q1AA 2VSNA 2V6IA 1CNEA 3A4YA 4E1VA 1IY9A 1ZJJA 2NX2A 3IUPA 2V8BA 2VUTA 3FCYA 2Q3FA 4AU1A 1XF1A 3A58B 1VP3A 4QTUB 1V2HE 1MORA 3B53X 2Z2XA 4BV8A 1RTTA 1IXRC 2LCQA 5AIBA 2MYUA 3FOCA 1RJDA 4G0WA 1XYVA 3PJEA 4TMWA 1TCAA 4CM4A 1B74A 3GCXA 2XUQA 3INGA 2VAPA 2XB6A 3BB4A 1B0PA 1V25A 3HYCA 1NX9A 4HYYA 4RVOA 4DIBA 5K7SA 1SM4A 4ENPA 1G8AA 4A0HA 1SC4A 5B2ZA 4BNZA 5EXEA 3GL9A 4ZMBA 1W30A 4YAFA 5BR4A 4DV1B 2NGRA 1U0RA 2WTMA 3MJTA 4ILKA 3TPCA 4LI0A 4H1HA 4YIHA 1E7WA 4LYYA 3S2ZA 1KJWA 4RM3A 3Q3IA 4LNAA 2EX4A 3AOEA 1RI2A 3RYFB 1T2UA 3MOSA 2VATA 1BEZA 1M1YE 2XSZD 3GYGA 4II7A 3W3AH 1TT5B 1ZIYA 1E58A 3DHWC 3ZDFA 1YS9A 3MAGA 1EFDN 3TG8A 3BE4A 4ZC8A 5KAMA 4TTRA 3VOBA 1QHGA 4MCAA 3UMBA 5JATA 1GLVA 4OTZA 4UHKA 3R7WB 2XZPA 3OZRA 4AQ7A 4A2QA 3JAKB 4LEIA 4OK3A 3U4GA 3ORHA 3GLIE 2PGLA 3HYTA 3RUDA 4K9NA 5A6SA 4FYVA 3QI2A 5CJPA 4QHYA 1IL0A 1YRWA 2BMEA 4JLBA 2B94A 2VXBA 5CHEA 1ZVKA 3UB3A 3AFGA 3QF4A 1Z4OA 4J0FA 1GFWA 2K2WA 1YV9A 2HA2A 2VF7A 2VHEA 4F3KA 2Z43A 4CEIB 3WNDA 1Z73A 3FZYA 1T1JA 2N0SA 4WY8A 3ZHOA 3WISA 2AT1A 3AEQA 2B6HA 3T9CA 2XQFA 3H1TA 3RRMA 2WLSA 4XJVA 1TRKA 1LLDA 3SYMA 2DH5A 1TKAA 4OBEA 2AG5A 5BRJA 4O33A 2AMFA 4D5EA 4GZ5A 2YNMA 3ZW8A 5FOVA 3HBNA 3I2GA 3KYIB 2EJVA 1EFLA 3MS7A 3FIUA 2TECE 4X6LA 4NDNE 1V35A 2TMKA 1L4KA 3KVRA 2H51A 2FMIA 3K8YA 1R9JA 4Q6BA 5ES3A 3RUHA 4B6FA 1M0SA 4DXAA 4DLRA 2BGJA 1U0JA 3NVDA 4OXIA 5KWJA 4HEHA 1VFPA 3FFAA 3HZRA 1A9YA 2DQKA 3R77A 1KJQA 3MTIA 1I10A 5SV2A 1U3FA 4MGEA 3PGJA 3AC0A 4W6ZA 2RGRA 5AW4A 4HGYA 3IR7A 1PR6A 2VJDA 1PAUA 1NNSA 4DREA 1HYBA 4G1EB 4B71A 1XL1A 4JZKA 5IFKA 5JXHA 1FP1D 2FMHA 2OV4A 3G88A 3OA0A 3QVUA 3QVWA 1CNFA 4WZZA 3IQGX 3RVDA 3CURA 3KRTA 1PIWA 1GGKA 3NP7A 2V59A 3LO5A 2ZRPA 1IWOA 3A1EA 3ZCRA 4YDSA 1ZMRA 1XO1A 2XMPA 3WBFA 4D9CA 2P2GA 1K4YA 3IEKA 5J2TA 4N76A 3R0QA 5BORA 2FZKA 3UXYA 1C9JA 4YXWA 1ZH8A 1E63A 1JG2A 1NUQA 4JS0A 3SJUA 4CTMA 5BUQA 1WW3A 1HLPA 4RWEA 2ID7A 5K0BA 2NOAA 4IIGA 1CUVA 3GNLA 3HE3A 4PWYA 3DXYA 3H4VA 1UEXC 3NHMA 3CLSD 1E2GA 2DWUA 1NMZA 1N1EA 3CRW1 2BELA 4KGXA 1RAAA 1MVNA 2VYVA 2YWGA 3DZKA 3GW8A 1YR6A 3STTA 3TSYA 3GAMA 2XKKA 1LNQA 1PNQA 3V4PB 3AFOA 2HY7A 1EIWA 4PSUA 4BQRA 1HYHA 3BM5A 4J0JA 1M76A 3BQ9A 2AHOA 5HKLA 4OI0A 3M70A 3PLRA 4TYYA 2ZVPX 3R3SA 3I1JA 2X41A 2CYBA 1GSIA 3K2EA 5ESRA 1PGJA 3EZFA 4BE7B 2RHBA 4JVMA 3SE7A 1FTYA 1QCZA 3CZQA 3NJ8A 3W8NA 4PONA 4AN0A 5CD9A 3RYTC 3EXHB 4QOHA 2XSZA 2UV8A 3FWPA 1IB0A 3KM0A 4M89A 3CZCA 3CEAA 4B32A 1DKRA 2I99A 4GL4A 1WU7A 2YRXA 4LG1A 1JKIA 4LOHA 1UDCA 1GPWB 1OTYA 5TF4A 5JCXA 4HLCA 3A31A 4NY1A 5KOJB 3IDAA 2V7TA 4OB7A 1X39A 3CLSC 1K86A 2W6NA 1IG0A 2VP4A 1UJMA 3C48A 2FDRA 4JROA 1B00A 3IT0A 2R5FA 3E7WA 2G1UA 1U2QA 3B20A 2V0GA 5EMKA 1CDDA 4C76A 1RYNA 1M6VA 2JCYA 2C92A 4GH5A 1FC0A 3OJCA 3VQTA 2FKNA 4K0RA 3W3ZB 3IVGA 1G2OA 1VZ2A 1K3FA 2OAGA 3LGXA 4PX9A 4XIGS 4LJRA 4Y1RA 3E15A 4L7QA 3S3TA 4NYMQ 1DUSA 1QM5A 2FJ0A 1RRCA 1CULC 2XA9A 3HL4A 4NZYA 3CN7A 4BE9A 3DJYA 3E35A 1XB2A 2XCLA 3HEBA 3OSUA 4RD4A 2JLZA 1NAIA 4RMIA 1N5DA 5IJAA 2NXJA 3H11B 4IMIB 3TFQA 3ZDXB 3OCZA 1UDBA 5AI9A 3FCSB 5D1HA 2E37A 4I36A 2V58A 3PV0A 4LHVA 1QJCA 4Y98A 3FLMA 4CIYA 2QJTA 1NW9B 3KLOA 1NRXA 5JCJA 4CCYA 1L3IA 1OGIA 4HAVA 3PQEA 4MS3B 4OUDA 5DGHA 5MGNA 1L9XA 3D3JA 4MV1A 4YRCA 4QJ3A 1GPLA 1UODA 2GM3A 4KBFA 2WG2A 1RC8A 2XGJA 4R7ZA 4G1VA 1GPH1 1TUIA 4QJ5A 2ZRMA 5CVJA 1Q17A 4E94A 4NS1A 2CXQA 2VHUA 2VSQA 2QENA 3GFFA 3O03A 3VKFA 2V4ZA 3AFNA 1U94A 2CGEA 3N0XA 4IPTA 3HADA 3LDAA 3PQ7A 4KXYA 1P0FA 4MPDA 3TQHA 1D5WA 2I67A 2Y77A 3FXAA 3PQCA 2AE1A 3CZRA 3GZNB 4GX5A 4QYXA 5EQJB 1RJFA 3RS4A 4A0FA 1DG1G 1LNSA 2O5RA 4P80A 1RADA 2HFKA 3SX2A 4DAEA 2C7RA 3HHEA 1BS2A 2CXSA 1VPTA 4WX2B 1GRNA 2WU8A 3BTOA 4LHYA 4URWR 3AU9A 4WJKB 5CG1A 3JVUA 4UZFA 1MJNA 5I8WA 4F7DA 1EEXB 2YV1A 5JZMA 6ADHA 2O0MA 1KJNA 1GAEO 2EV9A 3DLCA 3LU1A 1NC1A 1R12A 1QFSA 1TL7C 3OAAA 1H8EA 4WGFA 3RKSA 3S5JA 1X70A 2FG7C 1WXWA 3N39C 3TBFA 5UKDA 1F48A 1E62A 2C4WA 2J4CA 2G71A 2CMGA 1AKUA 1U0FA 2X2EA 3EIQA 3O84A 4Y6GB 4B4OA 1BE6A 4NV1A 3WADA 4ZCMA 1GGHA 2DB3A 3FAKA 1J1IA 2OY0A 5KTSA 2PSFA 1ZY2A 1KYXA 3E9EA 3K0CC 3OX4A 5DX1A 5EPUA 2NXNA 5L3ZA 2NV6A 1PLLA 3KV3O 5DGCA 2QRVB 2PRSA 4KFCA 4YQYA 1M6YA 2WDPA 3Q3EA 1J2TA 3GLUA 4X20B 3AF6A 3L02A 3WGYA 3P0EA 1Z5OA 5KCMA 1KAHA 2PV0A 1JHVA 3JXEA 5AXBA 4EFDA 5ADHA 2C00A 1XD8A 3AXSA 3CR7A 3K15A 3OBIA 4PANA 2ZB8A 4G1BA 2JHAA 4X63A 3VPFA 1K0UA 1BHO1 1DQRA 4OL9A 5B4VA 2A1UA 1I7QB 1SAYA 3E5NA 4M4SA 3FUVA 1GG2A 1PVDA 4DM7A 5BNIA 1OA1A 2YY6A 1L6IA 1QR6A 3LUKA 3LYHA 3OKPA 4XB2A 3TW0A 3TTVA 1TYZA 5KVQA 1HQKA 1TOAA 2D4AA 2IE8A 1LJLA 1BJKA 2YJGA 2A30A 3E7FA 3D3NA 2EFJA 1K8ZB 5IT4A 2HO4A 1N4DA 1YOVA 1B23P 3RFVA 1O95D 4I55F 4ZZ1A 1RZRA 3SSAA 2YXEA 2BGKA 1MNQA 2ZT6A 4O8CA 4NOKA 3UHAA 1AU9A 3QEMA 1YGYA 3TM5A 4AD8A 4EX6A 4TKVB 3AEUB 5DYIA 3KB6A 4ITUA 4DKXA 4MDFA 1CP3A 2C9DA 5PGMA 4M0FA 1E4EB 2R2GA 2GCEA 3ZCUA 4I5IA 2ZTMA 3GA5A 2GYUA 2RDMA 2ZBUA 3L6UA 3DAGA 4COOA 3BZWA 3U49A 2CCKA 2P91A 1Z25A 5CG2A 3H86A 2Q3DA 3KAJA 1L5FA 2EFDB 4X7BA 1W85A 1COZA 3A1CA 3Q5GA 4LYFA 3GAAA 4IZOA 2OBNA 3L3BA 4I5DA 3ZS9A 5KHOC 3OZTA 4R8KA 3UXEA 1OB2A 3SJAA 1J22A 1UWLA 1NT4A 2ADOA 2IEAA 2A88A 4GPTA 5LA6F 4E2WA 1ZONA 1E3WB 4YQEA 4LGYA 5F64A 2G0NA 3BGOS 1WZUA 5CAEA 3EGXA 4AZ3A 2EW1A 3WK9A 1HLGA 4R71A 1O95C 5EHXA 5JLJA 2OECA 3GUVA 1GHTA 4CF7A 5BV7A 1HEYA 1U3WA 3DPSA 4CKWB 4YFYA 4A15A 1E1QD 1HYGA 3IERA 3K32A 4QPPA 1ZYUA 2FLKA 1HMPA 2OBXA 4CCAA 1OB5A 4G36A 4HDMB 5A3QA 3OH8A 1N33B 3MWKA 3U60B 2EDCA 1YB1A 2NU7A 2BM9A 5AI5A 4Z9XA 3VJLA 3C8HA 4DLVA 4IVNA 5EG5A 3SQXA 4P6VF 4OKIA 3SPXA 1RACA 1RHRA 1PJBA 2YMQA 2R47A 1KH3A 2ZYDA 2R6JA 4LV8B 1UFKA 4ZI7B 3ACCA 3IUBA 4OP2A 4PO9A 2FA9A 1TMYA 2VWPA 1LFAA 5K09A 4NATA 5K0NA 1WNTA 1YRBA 2WB2A 4YVFA 2ZROA 3GEBA 4Q19A 3MLBA 1M10A 3LW7A 1QOZA 1G5FA 4Y1EA 4ESEA 3QX3A 2ZTSA 4IRXA 1Y48E 2ATCA 3EBLA 3SP1A 4BLTA 5BN4A 4CMIB 4EKIA 1Z2DA 1UJ2A 1N6KA 1X2BA 3ANTA 3IVCA 4UJ3A 1GR1A 4P53A 1XJCA 5TQ2A 4Y6SA 1ZVVA 4KIGA 2ZCJA 3S1AB 1S1CA 2X6TA 3L8HA 4XPZA 1PJ4A 4UHBA 5TT0A 2C7VA 1BIFA 1H6AA 2E55A 2QEQA 1TAQA 2QRVA 2G3YA 3WLKX 2QNBA 1LD3A 5CLHA 5K6RA 2B20A 4I19A 1AX9A 3BDAA 3P2MA 1K27A 4RJIA 4WBNA 1XXHB 2IXBA 1AXRA 4HLUC 4RIHA 4HS4A 1C1DB 4Z7NB 3EDOA 3WGKA 3LY5A 5JXIA 4R2JA 4FYYA 4JLOA 2YUIA 3FFBA 3JVIA 5A4DA 2HI0A 5LQAA 2OZVA 3IP7A 2RK3A 1DMRA 1VLJA 1P7ZA 5FL3A 4AJEA 3EOAI 5CPFA 3WMEA 1UQRA 1G7CA 5A6SB 3UH0A 3V33A 2OZLB 3RVBA 2HMYB 1ZMTA 1F20A 2HF2A 3OWOA 4QBGB 3I5YA 2ZTLA 3NXKA 2BH9A 3EYWA 4UEQA 2IU0A 4CKYA 1DL5A 1V1MB 2FUKA 2R7MA 4ZDKA 3JWHA 4G9EA 3OMXA 2ATXA 1NG9A 2QBYB 1BJRE 1PJRA 4NBNA 1O6GA 1F0YA 4TV9A 3RYHA 1LBEA 3TD6A 5K3OA 1RBZA 3GG9A 4UC0A 5JD4A 1L0BA 3MSCA 4JKYA 2B69A 2QL5A 3IL2A 2HPVA 1TJYA 3MUEA 4HMQA 4PG7A 5BQFA 1JALA 4RJLA 3KVNA 4BCCA 1A88A 4C87A 3GUHA 2D2XA 1V41E 3E8SA 2I6QA 4XIIA 2AG0A 1OXTA 2HAEA 2AC4A 3LYAA 3TOXA 3UWPA 3AUFA 5HFNA 1DRUA 2AOUA 2FQQA 2HK7A 2YASA 1FP4B 1I2BA 4BIIA 3T3NA 3WNVA 3DXFA 2HMAA 4WK6A 3ANLA 2V7VA 3MERA 1BXKA 1IAQA 1NF9A 3I9KA 3FKSA 3RT1A 3QA3E 2J5KA 3NTXA 4ZD6A 1WEKA 1JPJA 1K98A 4AK9A 1V5FA 3OM9A 4PYMA 4BU0A 2Y0BA 3CB2A 3GZTB 4EAAA 4X9XA 3CJRA 4ZARA 3RS0A 3FPSA 1YI0A 1QC5B 1DBPA 2NQ8A 4FSHA 3QOFA 2BE7A 4IHKA 4Y7CA 5ALNA 5AO9A 3UATA 4DQVA 2WKSA 5BOSB 1OWMA 5J1TB 5J4VA 3GLTA 3OX3A 3ER8A 4DLPA 3NYQA 2G4LA 1MT3A 1HE5A 1VIDA 3DMDA 1QCDA 3P27A 4FN5A 5COQA 4LGMA 2R6FA 5DI3B 1BCSA 1V47A 1VCIA 1T3TA 1MO5A 1R50A 4RKWA 2VBGA 4NULA 5CVVA 3AV0B 3FI0A 4B5KA 4ZALA 4G01B 1QJ4A 3OQ6A 1BHSA 1Y3CE 2P3SA 2FW8A 3HWX1 3PIRA 2ORIA 2R00C 4OLBA 3EXEA 4HLDA 3NCTA 4UM9B 1SHKA 2A3NA 1QRDA 2A9RA 2VWHA 3IKJA 4QPJC 1QP7A 1MJFA 3FW1A 4P4SB 3RTAA 1Z0IA 4I6EA 4EGFA 1N2GA 5AKHA 1FSFA 4ZVUA 1N8SA 1DDIA 5T64A 4GPD1 5KSZA 5EJ2A 4M99A 1OAOA 3H5RA 3ZK9A 1ZN9A 2VSOA 3TH5A 5E8RA 1K7EB 1VRCA 4HP8A 1YS1X 2OKCA 1T4GA 4YAJA 2WWTA 5LKAA 1UKBA 4L9SA 1QAOA 3L84A 4P4LA 4R2WA 5DNAA 3P19A 2XWQA 3W9UA 2ZUCA 3U7IA 3HJTA 1U8ZA 4Z49A 5AW6A 4N7RA 1ZKDA 4WWHA 1UMDB 3LQFA 5JBIA 5GADl 1ZOLA 4HZGA 5HR5A 1KY5A 3THYB 3GRPA 2HXYA 3LQRA 2G06A 3KJEA 1K7XB 4F46A 4GP7A 5K0JA 1UXOA 2GASA 2XWJI 4WZAA 1YS6A 3TQTA 2Z30A 1DVRA 2NO5A 1ZA2A 2WD8A 4G0VA 1II0A 2OO5A 3PC8A 1X87A 1AHIA 2XMQA 3LUJA 2HLPA 2HSZA 4UNQA 4DMKA 3L4JA 2AF3C 1YAJA 1YL5A 4LTMA 1B7GO 1UBCA 3BRCA 3CFYA 4IUBS 5CA0A 2Y66A 1GCGA 5IASA 4F3TA 3Q3JB 3VVMA 1PFGA 4V0ME 5DNYB 2FTKE 1VIAA 2GEVA 3GK3A 2W9XA 4ND4A 5D5HA 4FOSA 1DOAA 3PDWA 1GV0A 1UMCB 1K89A 1M2NA 2JGJA 2ORED 3EC1A 3OKCA 3F6BX 3BHJA 4IHJA 1EEHA 5K2OA 3S1LA 3HO6A 3N0TA 1FF9A 5C3MA 1QMPA 3N28A 5CDYA 1SGWA 2HQBA 2RC5A 5G0SA 4O59O 3MWLA 1H23A 2O3UA 2OFPA 4Y18A 4ZK6A 1R9NA 2XWPA 3F9CA 4ZRMA 2J3DA 2RBKA 3W8EA 3OSZA 4QBKA 2I34A 2CLOB 3WWPA 4D3DA 1T6ZA 5CA1A 2JGAA 2ZYWX 4HATA 4IKPA 2V7QD 4JASB 2A67A 2VI5A 1XNHA 1ZO8A 3ETCA 3JD4A 4UU1A 4ZI3A 5SZIA 4WNCA 3AFIA 4F2DA 4PVDA 1DQPA 1LS1A 3Q85A 3ZE1B 5JHHB 1M74A 4WZBB 2BEVA 2Y1GA 4R9SA 3OOSA 3KJHA 4PYLA 5P8WA 4ZYZA 4OSEA 5LQUA 1CRPA 1KGSA 3L7OA 4S2EA 1ZU4A 1EINA 4C2BA 1J2EA 3LOPA 3FGPA 1TO6A 1Z4PX 1O58A 5A06A 5KYWB 2QMHA 2YDYA 2ZS8A 4D6YA 2IWRA 2Z6UA 5C80A 1W7AA 1LWNA 1P33A 3E9ZA 1A5ZA 4QOEA 1EE2A 1GPJA 2D1TA 4OQNA 5KTKA 1G4AE 2NXEA 4F5YA 1A9QA 1E5LA 1MAAA 1Q74A 1SUPA 2XD9A 5E6UB 3U3JA 2CFTA 2ECPA 4U7FA 1BMFD 3PEEA 1L7PA 4G5OA 3GA7A 3KKZA 2IBSA 5KDLA 4EB6A 4RVUA 1HT1E 2I9PA 1XJQA 2K7FA 3MS4A 1P5FA 1B8VA 1R1DA 2ZUBA 4FJ2A 1VJTA 3GEEA 2JCBA 4LXTA 4WK2B 5FPSA 1XNGA 1I94B 1WM1A 5AKGA 1KOJA 2WFZA 4LVCA 4C20A 4DANA 4YCCA 2GFIA 4KO8A 4NESA 4RV5A 2X8LA 2VHCA 1W0JD 1NZJA 3PC7A 3VZCA 4B7UA 4BP1A 1CYEA 4R1NA 3ONVA 4U2FA 1YDHA 3BHMA 4DRYA 2WQZA 3DUWA 1XJ0A 2ILTA 2JAHA 3Q87B 5K3BA 1LJUA 2XMGA 2Q3CA 1ZAYA 3ZGZA 4J0CA 5SY9A 4KRXA 2JZNA 2VG8A 3G2HA 1OWNA 3NHSA 2ZJBA 1Z35A 2C77A 4MK4A 3F3MA 1AMNA 3S8YA 3O4IA 4YT2A 3DEFA 4UMFA 1J4AA 1CUWA 1PL7A 2IIQA 3B6JA 5C1DA 4FFLA 3L6OO 3AUUA 1T0BA 2GEUA 3AF4A 5GZ6A 1A8SA 1BEUB 1P6QA 1U8AA 2X8JB 4NR0A 3O8CA 3TZEA 2VNKA 1Z6XA 2YDXA 1EX9A 2AG8A 3PVZA 1PGQA 4ARZB 2EQBA 2GZDA 2OBLA 3DOIA 3TLJA 2BHTA 1GZHB 2BZ1A 3OFND 3VNAA 3WOVA 1FW6A 1QANA 2HM7A 1A2QA 1I4EB 2CXHA 1SKMA 3LP6A 3V1TC 5EMLA 4YDQA 3KVOA 1DOZA 2SCUA 3FFXA 2R8ZA 3IUMA 1LJ8A 3KZVA 3OEWA 4K88A 2OFXA 4PM4A 4W8HA 4YMIA 4GW3A 3WO1A 1M34E 1PT8A 4EPVA 3TXYA 4B35A 4HZUB 1E3QA 1EVEA 1A72A 3DEZA 2PA3A 3NJRA 2RONA 3T3MB 4OKNA 3KPWA 3QX8A 3FN4A 5C81A 2V3VA 3D7RA 4P22A 1U8YA 4RACA 3TDMA 2E82A 2PTGA 3L9XA 4CLHA 1DU4A 3MAAC 5EQFA 3EDRA 5KO2A 1OPXA 1PL6A 5BW5A 1VJ0A 4IM7A 1OVGA 4KMSA 3DAPA 3CVUA 5A71A 2O2GA 3NHAA 5KOHA 2XOKA 4BGVA 2V45A 1B42A 1T6BY 5A4JA 2ASVA 2MYTA 3DDCA 5T6BA 1M2EA 3OLQA 2EIXA 3Q98A 2CZQA 5IUJC 4CM8A 3JYNA 1FCJA 4YCLA 1X14A 2RHMA 1CG6A 4URFA 2NV0A 3CWZA 3IMKA 2OORC 2JARA 4X85A 4R8LA 1NWCA 2A0UA 1Q0ZA 1ADGA 3JR7A 3EGOA 4JC5A 2FFBA 4RK1A 2LTAA 3RRFA 1UJ6A 3CW2A 3INTA 3GIWA 1QRTA 2IPAB 1VSBA 2ORWA 3KOZA 1XRMA 4RPCA 1ZMBA 3I1YA 4G5GA 5LDGA 1S3GA 1ISHA 2FE4A 4XLZA 4B80A 5C4IA 3I39X 3U61B 1DRVA 1IQ0A 5DNWA 5HX7A 3KYDA 4I4TA 4M98A 3VHRA 4DA0A 4QDZA 4I3HA 1X9IA 2BZGA 5IBCA 4CI9A 2YWCA 1CY1A 3BBLA 1NDUA 221PA 5JNRA 1F8GA 3SFTA 4DARA 4JYMA 4TKUA 3RK1A 4QYWA 4FLMA 2ODQA 4QEKA 4PEVA 3AH8A 1A95A 2L18A 3BMNB 1RKBA 1THGA 4B6QA 1N3YA 3A36A 3C6BA 4L16A 1LF0A 3U17A 2BFPA 2CHVA 3UUEA 2MU1A 3HEMA 3L8FA 4IIVA 2ZRHA 1YB4A 3T7CA 3VZDA 4YRSA 4RFSB 4NARA 3NEAA 1FTSA 4ARZA 2IDJA 2JFGA 4C0HA 3RWOA 5C7IO 2HDNB 3R9KA 1DXYA 4F96A 1AY0A 2E49A 4DIMA 4Q3EA 5LYJF 4C89A 1GU7A 3NT2A 3CUKA 1XZAA 1YZLA 2QRUA 4GE3A 2JD1A 4NHOA 1RHQA 2B8WA 1MDFA 3G79A 4OQMA 4DADA 5LD2C 5JTUA 1SXJD 2WSYB 3RYCB 1QIFA 3PP8A 4NG5A 2N47A 4PY2A 4KXNA 4LZOA 3KZMA 2WFAA 4LY6A 1CRQA 2O52A 3S81A 1Z7YA 4QUEA 1A2KC 4A3SA 4BO9A 1OF1A 4II3A 3UWOA 3N2NA 1I4WA 3NTOA 2WOJA 4KQXA 5ELXA 1GG8A 3OZCA 5J63A 3BGWA 3IPRA 4GD3Q 1O0SA 1M7GA 5JY1A 3ITDA 2W0SA 2Q1TA 4JQSA 4WBNF 2PUCA 1SY7A 3KZCA 1CEEA 1WY7A 4GECA 2QRPA 4J1SA 2NO6A 1CD5A 1UJBA 3S28A 6LDHA 5KX5F 3EPRA 4GO1A 4XJXA 3JQFC 4TYNA 1EK1A 4AQDA 5TQVA 4DV5B 3PGLA 1PYOA 1XALA 1QKJA 1U2DA 2XUJA 2ZYGA 3CZPA 3JQ8A 3UJDA 4UTPA 1WSDA 1AQJA 3B8HA 3N2GB 3UAXA 1W1WA 1SXJC 4RIEA 1UPXA 2H57A 2ZIFA 4ZTBA 1GGMA 1UKEA 3BULA 4X1YA 5J2TB 4HH1A 2QUIA 4I4CA 1L4YA 1Y34E 3EISA 4WJZA 5IBPA 3HUEA 4YRRA 1G21A 4OHXA 4FPXA 2V7EA 1JAIA 1K4KA 4D25A 5IM4F 3WKEA 2QW1A 1DQZA 4XYGA 2FZCA 2IS2A 3E2PA 1MC8A 1R5OA 2X1MA 2FSPA 3AHFA 4E5NA 3K7EA 5CYFA 2YVLA 3QHAA 2Q8QA 3W5IA 4C6HA 4EG7A 3A05A 1QOQB 3VI3B 1KETA 5G40A 2Q8PA 3L8CA 1COWA 2OFOA 3Q6IA 5EPEA 1E2UA 3OM1A 4IWYA 3VPDA 4CLEA 5IUNC 3E5HA 1GCIA 3LIIA 4QKQA 2XMZA 2QQFA 2H7XA 3BGSA 3ROQA 1Z47A 4OKSA 4N0EA 2GN2A 1J33A 4QXPA 2HIMA 5JS7A 2EL7A 3OZDA 1U1IA 2AD1A 4II2A 2B25A 3FUXA 2P9YA 3FF1A 4GG1A 4MB6A 4F9EA 1Q6ZA 3ABIA 5CX4A 3EZ7A 1RU3A 3O1IC 4LK2A 1WA5A 4UASA 1O6ZA 1JA9A 1V7PC 4R1PA 2HLNA 4DDTA 1X7WB 5BMOA 1BMQA 4TZTA 2HU8A 2A1TS 2WJIA 1P5JA 3FSJX 4WK4B 4AUEA 4IH1A 2AG1A 1KJ9A 4LJAA 2HNAA 2J0UA 3ZC3A 4EB0A 4BO3A 5G0TA 3P0RA 5LOVF 2OG1A 5B3JC 1S4MA 4PCVA 2J7KA 2XUKA 3RTBA 4RJTA 4BWVA 4JD5A 3FYHA 3LDGA 2BFCA 2GVZC 1YFLA 4PPNA 2I2XB 3BWYA 4KG7A 4X3CA 3GWZA 2FI1A 2IXFA 5BT9A 2H63A 4N4AA 3T7JA 5K9ZA 4EI9A 3QTTA 4U8HA 1RQ7A 3LM8A 3L1IA 1FQOA 3DGEC 4KHZA 3TTSA 5BSMA 1D4OA 2B7BA 4OHCA 4RHEA 3H8SA 4UUBA 4IHAA 4WASA 4X6YA 5D7BA 2VBFA 3SQWA 1L4LA 4TT8A 4QPNA 1MJGA 2IYEA 4LNUA 3IILA 5B2EA 3I45A 3NT4A 3V4VB 3BGDA 2OZLA 1U5BB 1KC3A 1G0NA 4GQAA 1A82A 1E6MA 5DCLA 3WXBA 2G8LA 4FZRA 4MCIA 1JJFA 1FYWA 2J32A 4IDNA 4YUVA 3STVA 1IBRA 4GUDA 4LF6B 3EEYA 5DTQA 3K9LA 3QFFA 2DUNA 1XA3A 2AEFA 2NQTA 3VU0A 2F3TA 2ZBQA 1BGVA 3I42A 4B4DA 4BNJA 4BRZA 2V6GA 5LDDC 3KETA 2P3LA 4C03A 5AVVA 5BN3A 1CDZA 4PAMA 5ED0A 5ERGB 3SC4A 3PQ5A 4HWOA 4MQ4A 1SVOA 1NATA 4J91A 2BFBA 4JR2A 1MJGM 5FOUA 4CDNA 4EMSA 1T5TA 4XSVA 3SWWA 3FFTA 1VOTA 3U1VA 1PO7A 1TJ4A 4D4HA 5I01A 2ZUEA 3WGLA 4HEQA 5BSHA 2EP7A 4JQOA 5CT5A 3PYXA 4LI3X 5EWJB 2CVPA 4Z4FA 5ERXA 3DDHA 1RT9A 3K09A 3TRFA 1LRLA 4E3WA 5I9SA 1X3SA 5LU9A 3GR6A 3DP9A 2BTQB 3LBNA 2G9NA 3IP1A 1AF7A 3L6CA 4DCNA 3AY7A 1E32A 1JEOA 1G6Q1 1MO2A 2AMJA 2PGXA 4OHYA 4ENTA 2FPSA 1M2KA 3GVIA 3UT5A 4R6XA 2VQEB 1TEXA 2BHNA 2Z5GA 3P1JA 4TYQA 3EDMA 1X7WA 2IV2X 4WA8A 1Z17A 3B3JA 4JKOA 2HCRA 2ZS9A 1T2VA 3AR5A 4P3KA 2PZAA 3FLAA 5TS3A 4E12A 2JLVA 3ELUA 4YALA 1AGRA 2XTJA 4KPYA 1JR3D 1LI7A 5AD1A 4ABTA 2UUPA 2H07A 3HCDA 3MILA 2HLDD 4IIHA 4XARA 2BDUA 2YIJA 4Q21A 1S4QA 2PZ8A 4X7RA 4D3XA 5DTIA 5JAOA 2DEUA 3QVMA 1X1SA 2ZKLA 3HKCB 1IK6A 4TUYA 4P83A 5JY6A 1MJHA 3BQMB 1XI2A 5CJ2A 3BMOB 3ZTYA 1EUZA 4A10A 1YZVA 2BFFA 2FSGA 3IO5A 1C0LA 1GNRA 1WVGA 3BT7A 4OFXA 1JAHA 5IAJA 1GQOA 3FUCA 2IE0A 4QGBA 4GRIA 2JGEA 2OD2A 4DV7B 4OLJA 4R8MA 1YACA 5LYJA 5TR9A 3O75A 4JVNA 1V7QA 4JENA 1V6CA 3M6LA 4FSXA 4B8ZA 1ILWA 4WIAA 2OL4A 4YCNA 3PUZA 3Q8XB 3IUQA 2NV2B 4PO8A 4BNYA 1IBKB 5BSRA 1ZINA 4NC9A 2GQ0A 4WFKA 2EKBA 3EY4A 4CKBB 1OROA 1C1HA 3BH0A 2BEUB 3MOIA 1MVOA 1G20A 3D9QX 5BRNA 2BGUA 4UAJA 1NVUQ 3IA7A 5E4JA 1J5EB 2ZIGA 4WN9B 5EQDA 3FCCA 3K9GA 5CGZA 1LVHA 2RE8A 2BFDB 1H0RA 2KLHA 4OAPA 4UFOA 3ZQKA 3ESQA 4HAZA 3RYCA 3ZCQA 1LPAB 1A76A 1PU2A 4OSOA 1QVZA 1LSJA 4LJ4A 4MVJD 2PMWB 3ZHYA 3EQ2A 5E9QA 1KPIA 1CVLA 4LZAA 4UXHA 5FR2A 2NU9B 3UJPA 4D6XA 4DXDA 1V16B 2VHTA 5EAIA 5KEIA 4B6PA 3DTVD 3GRCA 3HB9A 3T1VA 2DWPA 5JMPA 3IQZA 4R9UC 9ATCA 4JGBA 3IPYA 4L2IA 5IWAB 2H4WA 1JBEA 4UHEA 1SNYA 1VIVA 1VSUA 2DHDA 4LV6A 4PAGA 3TI9A 2XE7A 4WXHA 1OZ0A 1WHTB 3H1AA 2HRRA 2NZWA 2YY7A 4TV8B 1YA4A 2OZPA 3GJSA 5IARA 5DBIA 2QLFA 1G6KA 2FP4B 4HFMA 4IIEA 4KAJA 8MHTA 3SLKA 1B6SA 2ZOSA 1YA8A 3DMTC 4HQ6A 4BNLA 4BVEA 4AJNA 3QOYA 4QU8A 3TLYA 1GTL1 1JIUA 2FVXA 4R6WA 5B12A 1A2OA 3ZBQA 3QBVA 1RJGA 1Z74A 5LA6B 3GT7A 2YHIB 3UXHA 1BXGB 2VXYA 1NU6A 3BMNA 3O0TA 4NDZA 4DC9A 4G8JA 3HUDA 3IAUA 3T0GA 3LT4A 4AMVA 4FMCB 2QE7D 1XTBA 3CW9A 4HQ0A 2IITA 4MVWA 5A6VA 1Y1LA 3HP1A 4ES6A 3JALB 1OGJA 4FGLA 4ZRNA 3T7SA 3R0VA 3N8NA 1RYZA 5LIRA 4AKIA 2A5JA 2OPBA 3D0QA 4UXIA 4A6EA 1C9YA 2EWMA 4ZO7A 4B4WA 3PFHA 3FVRA 3RE1A 4UTVA 4RGBA 3BWDD 2JIZD 3G13A 1F2VA 3JD2A 4HRAA 4A0RA 1BQ3A 2QYOA 1PNRA 2NLOA 3WSWA 1NG1A 2IYZA 4F21A 4P5EA 2FEPA 2ECOA 4G4JA 4OBWA 1G17A 1KEUA 4CCYB 4FVTA 4W9RA 2UZ0A 2G08A 3K5IA 3I09A 3ME5A 4G0OA 1AM4D 2QHXA 2IYUA 3KJFA 1CNMA 4RF3A 3OQNA 2B4KA 1JR3E 1SCNE 1SB9A 1S9HA 1YJ8A 3WWYA 3ADDA 2XXAB 5KQSA 1HA3A 3OZWA 4H7FA 5C52B 2AN9A 4B81A 3MVEA 4ZZ3A 3AP2A 4A92A 1W94A 5I5EA 2O59A 1LTQA 5AVYA 3D6VA 5GGYA 2RH9B 3FCXA 3O1LA 3DWEX 2V7BA 1M34B 1ZIXA 1A5AB 4ZKEA 3TAXA 4BO8A 1KMIY 2HA4A 4PS1A 2RB4A 4FD3A 1GQQA 3DCJA 1XRLA 2X3FA 5IN5A 3IP3A 5C46F 5JCZA 4HN4B 1RI3A 2HSDA 1N6NA 2N46A 2WHEA 3B6IA 3IV9A 1B41A 4AJ9A 4FZ3A 1TZMA 1GVNB 5C32A 1OX6A 3P0IA 4L0DA 2JLQA 4RYLA 2OHFA 2NSJA 1Q20A 2VPIA 3AJ9A 3QELB 5JNTA 4Z0PA 2DKNA 4WLUA 4I1YA 1QIDA 3K0SA 3AJRA 2PMKA 1FSSA 1TGYA 3V8PA 3WKAA 4DR5B 2WF8A 3VSCA 4PRLA 3BERA 3V5NA 1J42A 1FNSA 2YICA 4OAQA 2EBUA 1PTKA 4LDZA 3BAZA 2AKYA 3NFYA 3ZUPA 3STYA 4AS1A 1Y8RA 3PUWA 4PZZA 1NVWQ 5HCNA 1ORRA 2VAWA 2ZTVA 2X2FA 4B3GA 1MZPA 1SOVA 1T1IA 4OGLA 5DYTA 5ICGA 1YS2X 2Z2ZA 3PFGA 2OB2A 4L95C 3QWBA 1RSZA 2JH8A 3FNQA 5K8UA 3GUYA 3IRVA 4Q9LA 1I9GA 3IV6A 3SIXA 3L40A 1G60A 2SHKA 5BQ3A 5HKKA 1ZVMA 1Z0JA 1JNXX 3DOJA 1ID8A 4JBNA 2JIMA 2XNCA 3D5EA 3WNZA 2QL7A 1KI6A 2AYXA 3DV0A 3ZD6A 3CZAA 4DTIA 3PGXA 4HDQB 4L5CA 1E9SA 1G8SA 5FHQA 3A7DA 2CDCA 1M6EX 2X3YA 2I03A 2JLCA 4FNGA 2HTEA 4FQ8A 1PJ2A 2O57A 2NUTA 5DM4A 4HDNB 2IC5A 4CLOA 3QUQA 4L9AA 3NPAA 4FYJA 2ZIXA 3EEBA 2BSQA 3Q5EA 2P9EA 2ONCA 2PZBA 2R68A 4PGFA 4S1TA 4GWGA 3TAHA 1XQ9A 1H8HA 1I2CA 3NOQA 3IVRA 4KXVA 2GEBA 3EXEB 3M9WA 4ARAA 4BEBA 2GAFA 2WMNB 1TX4B 1IBCA 2GO1A 4PO1A 4MS4B 1L7RA 4MOWA 1KI3A 4MUFA 5LZ8A 4HPWA 1E2BA 5DMHA 2QW0X 1NQUA 4DHEA 3GLHA 1JDTA 1PR5A 5E95A 3AG6A 3L7AA 3K1AB 4DRXA 5H9WA 2QTWB 4YONB 4AG5A 1U2RA 1E79A 4ZOLA 1QGYA 4ZAGA 4CU2A 3R7WA 5LQRA 5HS6A 3PNQA 4MTCA 2CL7X 2PH7A 1GSHA 1THMA 4IQ0A 4TLEA 2D6FA 2OCGA 1YR3A 3DO5A 6Q21A 5EZ5A 2B1QA 3CF4A 4B31A 5IM4A 2OCLA 2JJ1A 4L1KA 4ZP1A 1QV7A 4I9UA 1J6UA 3K0BA 4J0HA 3UB4A 4M6WB 1I3MA 4YCDA 4ZOCA 5JW6A 4JXZA 4INOA 2O7QA 2VF8A 4DG9A 2XTZA 3OF3A 4HDSB 2X8BA 3AEQB 2WSIA 3CRQA 1N9GB 3N9IA 1A9XB 2YBDA 1HORA 3MWEB 1WSWA 1D4ZA 1JH9A 3FOFC 1P5HA 3NALA 4MVJF 3RRBA 3RV3A 3RC8A 3UW1A 3IP6A 2OLEA 3K0EA 4NBTA 3T35A 3TEMA 5AVSA 2X8AA 3SHOA 1AKYA 1QZZA 1QHEA 1NXWA 2R6GA 3MMZA 1IJFA 2W8BA 4L3VA 1WB5A 4E0BA 3WAGA 3HSKA 1KI9A 1S01A 1Z82A 2H11A 4PYRA 3T7AA 1JLMA 5IZCA 3SVTA 4RZHA 4C6SA 3I5AA 5C5IA 3TNJA 3UCEA 2W71A 2A3RA 8OHMA 5FLXA 3EMBA 1GNQA 2O3JA 5JCOA 2Z2KA 2XGMA 2J4FA 2Z4SA 4YRFA 4JI7B 1T4MA 2VJPA 2C3UA 2VRNA 4QDOA 4UUPA 5KNDD 2NXCA 2ZRNA 3LDHA 3QH4A 1F0NA 1ZMOA 3OICA 1EWQA 1EAMA 1I7SB 2X0RA 4RCYA 1R0KA 2AVDA 2QROA 2YVUA 3MM4A 4ZYLA 2JLUA 3PD0A 3W1VA 1ZN7A 3SS7X 4I2VA 3KU1A 2OHXA 4K9QA 4E7OA 3F6PA 5C7LO 3EVEA 1NVAA 2AUMA 1BKYA 1V3UA 2VJAA 3MMPA 1JMVA 4MUMA 1VMDA 4HWGA 3VC2A 3GB9A 1DTSA 1VI6A 2ZSEA 2AV6A 5AK5A 2PVSA 1SVSA 2WM9B 1BX1A 3M33A 1T9CA 2OWDA 1DEKA 5IF3A 3PFWO 1Y3DE 2IH4A 1ORHA 1G8MA 1Y4AE 2QXYA 1KP3A 2P9TA 2W58A 5IJ0B 5CIWA 5CW1A 2GN8A 3DV0B 2DQSA 4JB8A 4TPKA 3ZWDA 1RAEA 2GA9A 1ZSYA 5CVUA 3VZRA 5IJXA 3WRXC 1NP3A 3B70A 1TW2A 4D4IA 4OU5A 2OQIA 3VKUA 3OT1B 2ZQ5A 1YT5A 4AC9A 1BE1A 1QRAA 2ZU0C 3GPCA 4M0PA 1H42A 1ZEJA 4G65A 2FXIA 1W88A 3FNGA 3HU2A 5FUXA 2QTAA 2XNHA 4JJ6A 5KJCA 4IG9A 1ML3A 2H65A 2PL9A 4M2LA 4ZHQA 3RAJA 1NJSA 3C8UA 1SC6A 3A06A 1EWRA 1VJDA 3FPBA 3MG9A 4E5YA 2B5OA 1XMVA 5EGSA 4HLNA 4JFAA 1XFDA 3GLHB 3SHFA 3DSRA 2Q27A 2ZETA 3KXKA 3WGTA 1H22A 1YRHA 3UC5A 4OJYA 2I1VB 1CJUC 3I6QA 4RZXA 3SZRA 3U7QA 5KYWA 1RHMA 4MV3A 1N0IA 3IIJA 3A9WA 3O8QB 2JI4A 2CNBA 5EMNA 2HSWA 1TMGE 2OCAA 5E7JA 5T67A 5E3HA 5L8VA 5FWYA 4KAXA 1HZZC 1I3CA 2BI4A 1T1SA 2O0LA 1MJ5A 1I6LA 3G02A 1OXUA 3G1UA 3HQ4O 4IEEA 4NZ9A 4C29A 1J56A 4N9WA 1PJ8A 5JO0A 3EXAA 4XYMA 1NVVQ 5DNCA 4GR4A 3ZJ5A 5HXAA 2CXTA 2G8NA 4MS3A 4OUDB 3GRAA 1UT6A 2HHLA 1SC9A 3E82A 1J0AA 3RSOA 3WMGA 2I4IA 3WLOA 3THXA 3EPLA 3Q6NA 1GZVA 5GJCA 2WIJA 4WNYA 3G85A 4N3AA 4NJEB 1VJ1A 4R1LA 4EUEA 1NURA 3VYTB 4HAUA 3ONNA 1L8AA 2F48A 1OFVA 1R10A 2NZYA 2MSNA 3EGCA 3OEED 1KJYA 2W2QA 2XMRA 3OKAA 4YACA 5JCJD 2CMDA 5LXTA 4ARIA 3NTVA 1O87A 2B99A 3OP1A 3H2BA 3QMMA 1X1QA 4BVBA 5L53A 4XVQA 2ISSD 2P9FA 4PTLA 2UYHA 2XUIA 2DCUA 1GGJA 2AFVA 2YXLA 1C2YA 3PNLA 2P40A 4ARSA 1GCAA 4J0GA 5B7QA 2JLXA 4BLPA 1MB0A 3PDCA 1RIIA 3UHJA 4WLNA 1N1GA 1QLJA 4AFNA 3GLGE 1HSZA 1IQUA 2AWNA 2W43A 1Q19A 4LQCA 4P54A 1F7UA 4EATA 1G0OA 2JLSA 5F23A 4X84A 4ADSG 4JP8A 4EI2A 1IHDA 1E1MA 3WLRA 5KQPA 1EFPA 1XDWA 2Z3ZA 4DG5A 1DAHA 4PCAA 3NVAA 4CCSA 2VWGA 5IXJA 1LCIA 3DUFA 5B3KA 4Y9DA 3CSDA 1ZUNA 3JYHA 4OG2A 1WJGA 3OOWA 3VR2A 1BD4A 4LE1A 3H9JA 1M2FA 4IOMA 3NM6B 3B78A 3OPYI 2M32A 3NNDA 3OPYA 1XZQA 3E5MA 4XCQA 4PO3X 1KSJA 3KUKA 5TMPA 4FU0A 2CV2A 5HDQA 1JSZA 3QVLA 2B4RO 2BDTA 3QYPA 3PQFA 2ZK7A 4JB0A 4HGOA 5EHNA 5FWXB 2DE0X 3EXFA 4L15A 1N6HA 3GAFA 5LJLA 2PQ6A 4N0MA 1KO1A 3IEIA 1T29A 4U9UA 3TTXA 5L4LA 1EH5A 3PQ3A 4L3WA 3D0KA 4Q03A 4UTNA 1WW8A 3KEMA 4NAUA 1O96A 3L05A 1PJLA 2VHZA 3OIYA 3EGDA 4YP5A 4LJ8A 1TFUA 2PT9A 3FHCB 3LBIA 1YZTA 2ZYTX 1M7HA 1E6WA 2V5UA 1V95A 3DTVA 4KRFA 1ZOPA 4DOMA 1JHUA 3OZFA 4O4JA 3DBIA 4KAAA 2WRZA 2Y67A 1GZ6A 3HK2A 1OA0A 2QRLA 4RPGA 5DYGA 3D3EA 4H7JA 1TQ2A 3GN1A 4RD3A 3WL4A 3U16A 3BKWA 4RIGA 4HX5A 4IZHA 4PZYA 4RF5A 3PNVA 3IAAA 1OE0A 3ZCVA 4C14A 2IY8A 2XADA 2QNRA 1PFKA 2CBGA 2R25B 2YIDA 4BLRA 5EIXA 1BFUA 5KYNA 4R1MA 1JHMA 1SU7A 1WCIA 4HAIA 4OL0A 3RYFA 2OILA 2PCJA 1V5WA 2FZLA 3FUTA 4L4XA 2IKSA 1T5OA 1ZNXA 3GHYA 1YS7A 4F2HA 1KEVA 4FUTA 6YASA 1TZJA 3IBGA 1H8HD 1HDIA 1P1RA 3ZOZA 3CLUC 5I48A 3R8CA 4EHFA 2ENWA 2IZOA 4P3XA 3X2SA 4F2PA 3KL4A 5LC1A 1AKMA 2YJ6A 4X65B 2HJRA 1ZEMA 2I7VA 2I6TA 3L5OA 4GSYA 1SC3A 2QK4A 4ICIA 3ZWNA 2O48X 3DE2X 3T3OA 3WGJA 1VJ5A 3F5FA 3GPBA 1U7UA 1JDSA 2HU5A 2YZGA 5EUCA 3BXGA 3C3DA 2KW5A 4MCHA 4OATA 3T12A 3WGMA 1NHGA 3PC3A 2F55A 2P2NA 4BTVA 2RCNA 2IV3A 3FYTA 2F9MA 2A4KA 1CIPA 1UM9B 5LUAA 4OUKX 2AW5A 3D8TA 1UC8A 2FUG1 5AT1A 2ABWA 1MX5A 4LQLA 1UR5A 4QNMA 3W4IA 1DUVG 3WNBA 2WK1A 3WJAA 4BNWA 2AJTA 4O3MA 5C1IA 1KKUA 2PGAA 3ZZ0A 2WYIA 2ZJ3A 3TLGA 4BNHA 3GJ6A 1SJ9A 1K7YA 1M2JA 2F4NA 4GFDA 5AKKA 3OQIA 3PG5A 2HR1A 4NPCA 1RZUA 3H2GA 3LIPA 3ELDA 4EEKA 3DYVA 3ROFA 2GKSA 3V8MA 5JD5A 1VG9B 1R4NB 2GVNA 4ND1A 1E3JA 1OX5A 1EUQA 3JQAB 4HNRA 2B1RA 4MRMB 4X8MA 3RI3A 4C7VA 1KYVA 1A5BB 3SR4A 1AC5A 3KZOA 5K8TA 5H1YA 3EVCA 5EHZA 3K6KA 4HJXA 1GLNA 1M2VA 3GNQA 3O1HB 1XELA 3IUSA 1MGPA 1YE3A 4EMUA 2JFFA 2CXUA 2YJ4A 1GKYA 1X86B 5JDCC 3CVYA 1U3GA 1T4DA 3STUA 3W06A 4Y2HA 5IH3A 3RVOA 4IBOA 3DZHA 4AJKA 1LZKA 3ZQJA 1R0LA 2V9PA 3FYCA 5IJ0A 5GVRA 2P6OA 3RV4A 1Z36A 2P11A 4DLZA 4IHQA 1VHDA 1VP9A 4H35A 1PEYA 1DSSG 4J16A 2WWVD 5JRZA 3PCXA 3COWA 2QX8A 3VU8A 4L08A 4ENVA 3OQOA 2IDMA 2HV8A 1OFTA 1V48A 3BFKA 3VR5H 3AGQA 1J90A 3EAQA 3RTEA 4Y2XA 4BN0A 3X1WA 5KNBD 1RRMA 5EUQB 1M66A 2GXQA 3H3JA 4OJKA 4DIUA 2ZSUA 3Q0EA 3C5VA 2L19A 2X5OA 2RFLA 4US2R 2VF4X 4C7OB 2AJBA 3K94A 2GJ8A 4KP7A 1T13A 2VUSA 4ESOA 3DKIA 3NHPA 3GLIA 1T9ZA 4ZDIA 3KQOA 2QKYA 4D92A 2W6ID 1E2DA 3PRHA 3WK8A 3ULKA 1KKMA 1LC3A 2VK4A 4B7ZA 1EWYA 4UJ5A 1GXSB 3EC2A 3L04A 3H9GA 5EN4A 2QNIA 2G63A 1NJ8A 4ZO4A 1SCKA 4HGRA 3CR3C 4KJZA 5EKXA 2DJ5A 5CB6A 1Q11A 3ORRA 4PF1A 3OPMA 3G0HA 2VJLA 3C3KA 3Q11A 4G56A 3O4FA 3WI7A 4AP9A 3LX4A 2IHNA 3VHLB 1W9MA 4HQLA 2DULA 2PUVA 4TRNA 4DZRA 4K9RA 3KOMA 2Z2YA 1ZR2A 1H65A 4DGSA 2O8DA 1M34A 2HOQA 3Q2OA 4EHJA 3EPKA 1PW5A 1NVFA 3P2IA 2YV2A 4K7JA 4ZAYA 3PIIA 5B7NA 1YCHA 1N34B 5JJ5A 4H3SA 2ID9A 1QHYA 3ZHVA 4ZOLF 4PFKA 4X64B 3LY9A 4D2IA 3PQ8A 1R88A 5IVHA 1TM4E 4XGKA 4RZIA 3V7WA 1NW3A 2E48A 1L7AA 2QG6A 1SURA 3T4EA 1DELA 3TL2A 1L3BA 2HXGA 4OXNA 3M89A 2I8CA 3IKMB 3K30A 4DPMA 5E0OA 2VQ3A 1XSEA 4BZQA 1X1RA 3DKPA 2XRFA 4JN6B 4Q34A 2DTDA 4ZVKA 2ZAGA 3KHSA 1A4IA 3UF0A 3GPLA 4HYTA 3OIGA 2H0AA 4A1FA 3L7NA 2EATA 2VT3A 1NP6A 3BJMA 3BA6A 3MTAA 3EAFA 5DTMA 3ZXIA 5H02A 5BQ5A 4KITB 1KARA 5LP6A 1PHPA 1SKYE 1CQIB 1XRNA 3L92A 4C2UA 4HTFB 7MHTA 1RLTA 3F67A 1UXKA 3AFHA 3AZQA 4I81A 4MVJA 1ZNWA 2GJSA 4TWRA 3W5HA 2EYQA 3UJ6A 2H1IA 4GWLA 3K5HA 3ROPA 5GV8A 1Y3AA 4YS6A 3R7FA 1ISGA 3AJDA 2QZSA 2JA2A 1NFRA 3DMTA 1FPMA 4BKQA 2QG4A 4PC7A 1XHFA 4YAGA 1QPBA 5LSAA 4N65A 4P4SA 1N7GA 3BN3A 3UOWA 2WBLC 3DD1A 3WSTA 3QP9A 1WWKA 4MUYA 3G5TA 3EFOA 4N6OA 3RIEA 3DL0A 2D1SA 5AXAA 2W6IA 3C1OA 3VNUA 3CN9A 2GH1A 1M6NA 4I4NA 4UZSA 1NVKA 3TRDA 5HRCA 2HWXA 5TEWA 1VE7A 4RA6A 5CB0A 2V96A 4ITRC 1ZC4A 2V8OA 5HIIA 2YWHA 1Q0HA 4A2CA 2OXIA 4HH4A 5CDFE 2CLSA 2JAXA 3D6TB 4KR7A 1LLFA 2CW5A 4LRWA 3H5IA 1ECPA 2NIPA 1RPNA 5EUMA 3RSZA 4KIJA 4IKEA 1SHLA 4B4VA 1VPVA 2RKWA 1J07A 1UUFA 3A9TA 1W5FA 4H6VA 2VSYA 3A26A 1ZWKA 1WCXA 3GMIA 1I01A 3KR9A 3AL3A 1NX6A 3N7TA 2VYNA 3ILYA 3PX2A 2MYNA 1L1RA 1V3TA 3PPXA 3PUKA 4EUKA 4NAVA 1EDDA 1HKUA 1TKCA 2D7JA 2KBFA 3D59A 1YDMA 4FWBA 3L7MA 4RFVA 1JBKA 2A5DA 3AO0B 5ALWA 4DL9A 2O5CA 3OURA 2PT6A 4P31A 1GUYA 4HYEA 3NONA 1ZJYA 5IXYA 1LPOA 4L8YA 3HA7A 2HB6A 1EWKA 3CWQA 2H06A 1YIOA 3R75A 1LPSA 2WU4A 1DKNA 3ABRB 1DXHA 3ET4A 4UEJA 3LLUA 1RYFA 1F38A 1QE5A 3HV0A 1JHZA 1Y5MA 5KPDA 1EUDA 3WK4A 1KEEA 1FE8A 1NRJB 2Q4BA 3BFJA 2B8NA 3UV3A 1XTSA 1U0EA 3HKCA 4H7IA 4MP6A 4TUYB 1ACMA 2R4UA 1OCEA 1RYEA 4P4NA 2XDWA 3CTPA 1ZCZA 3IQEA 3G6WA 1HG1A 4HNGA 4I08A 4BLQA 2VDRB 5D3QA 3UA3A 4OB6A 1O89A 1IRXA 2D5IA 2YHSA 1I4LD 3BS4A 4L07A 1KQFA 4MWCA 4BXOA 3HU3A 1B0ZA 1Y89A 2WA1A 3Q2KA 4PCUA 2CFIA 1WPRA 2W90A 1JFFA 3BK1A 2BMAA 1G21E 1EP9A 1PGOA 1D4AA 4PBRA 1GTG1 2P3QA 1KZ4A 2PUJA 3RS3A 4RORA 1RC0A 2C59A 5KYYB 4WZBA 1HOXA 3ZBUA 3EXHC 3QMWA 5AVOA 3VZBA 5IPFA 1DINA 2CLCX 1XDDA 3KWLA 4DLBA 3P2JA 3M6AA 4JKIA 1EA7A 1WXXA 5CNKA 3UC9A 2H5EA 4B79A 3BJRA 1I0IA 1NN0A 2DFNA 3E2MA 4W4TA 3RRNA 5LZ9A 1D2NA 1TECE 4KVFA 2AQ8A 4M0UA 3SKXA 1H6BA 4MYUA 1CY4A 2GF2A 4HTFA 1L5SA 4MEBA 4TLBA 2F90A 3TMYA 2AMVA 2OLJA 2R97A 1PS9A 1DCMA 2ZJ0A 3DZCA 5FT9A 1PUJA 5E2IA 3QSYA 3FMGA 2A6PA 3PNMA 5EIHA 3ZIAD 2VP0A 5LXTF 4GICA 5DH9A 1JJAA 4HF7A 3NCHA 5I9IA 3X43A 2AD5A 4FW9A 4RU1A 4Q1CA 4LCJA 4MR9B 1KOFA 4PN7A 4YRKA 4C4OA 2HSEA 1XTTA 1NA5A 4UVHA 1GZ7A 1RBMA 1JKJA 3CRZA 3VPGA 3A6JA 2UDPA 2UUAB 4F5DA 1SXJA 4KQ6A 1I33A 1PR0A 1WB4A 3AZOA 4MUEA 3ZPXA 4EGAA 1W5SA 3GGSA 3KQHA 1L5MA 3C1TA 3RSHA 4E13A 4TKMA 3ZEAA 2YWBA 5FRDA 5T3YA 3UMVA 1K97A 2IODA 4P92A 3WYFA 3MSXA 4F56A 1WEHA 3J81A 1Z2PX 4DMHA 3H3FA 3NNNA 1L4FA 1EDZA 1OIXA 2R4TA 3DMHA 4C0XA 4QFDA 2Z98A 1WP9A 1UP4A 2VK2A 3VC1A 2R1ZA 1WPGA 3HN2A 2WUFA 4GPBA<