3VBCA

Crystal structure of il-17 receptor b sefir domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
136
Chain Sequence
LLPLIKVLVVYPSEICFHHTVCRFTDFLQNYCRSEVILEAWQAAAIAEMGPVQWLTTQKQAADKVVFLLPSQDLFPLAFNLFCSDFSSQTHLHKYLVVYLGGADLKGDYNALSVCPQYHLMKDATAFHTELLKATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-17 receptor B
publication title Crystal Structure of IL-17 Receptor B SEFIR Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 40
structure length 136
sequence length 157
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08357 SEFIR SEFIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11530 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vbcA00
3VBCA
chains in the Genus database with same CATH superfamily
1PLJA 4CUZA 2X0JA 2C97A 1Z13A 4UFOA 4X1IA 2WYHA 5BRJA 2NG1A 3FJOA 3FUCA 4OJQA 4JXXA 1UMBA 5FPPA 2ZSKA 3AWIA 3CZQA 2CNKA 3K0FA 3G0GA 5ERGB 5AW9A 4GMXA 1S3SA 1JNXX 4GOLD 3PJFA 1QHHB 2UXBB 2O5EA 2YZGA 3KKQA 1TU0A 2BT4A 2VSFA 4QG3A 2QPLA 2C7QA 2DETA 3HCPA 4H7DA 1EAMA 4L74A 3TK1A 3PKJA 2QU8A 2EKPA 5EUQB 5TGDA 3UNXA 2ZBFA 1SN7A 1FFAA 3HLKA 1QP0A 1ADFA 1YJXA 2HQOA 4HNQA 4IJ6A 5TMEA 2SKCA 1EFPB 1O9HA 3GZ4A 3HB0A 3PQ4A 5K09A 2Q27A 1ZRSA 3TSCA 3UG7A 5D7NA 1L4UA 1QO0A 3EQ7A 5JEEA 1HPLA 2DKNA 1Y1LA 5FWXB 1N7JA 3HK2A 2FPOA 5DM2A 3AONB 1K88A 1UDRA 2IXDA 4MW1A 4PYJA 3G0CA 1JDSA 4EHLA 3TINA 4GM4A 1DAMA 2WRZA 4DQVA 1TTHA 4JEMA 3D59A 1RRVA 2XGOA 4TRNA 1ZOLA 2XTZA 1CUEA 1ACMA 3GLIB 4JBGA 1S8AA 4H17A 4CV2A 2JI4A 3VZRA 2QM0A 1EPUA 3BHJA 4UE6A 4YJ2A 3QKRB 2JA2A 2PMCA 2XPCA 2PYZA 4XYBA 4B17A 4CT0A 4U2DA 3NZEA 2B1JA 2ZJYA 3ZZ0A 3RS2A 5ADUS 3L77A 2QP3A 2RGRA 3DAFA 4S1WA 1B2LA 4WQMA 2HHLA 1GU1A 3O7MA 5C8VA 3K8QA 1G19A 4DBLE 2LXNA 4P36A 3C3JA 1Y3FE 2OHOA 3AFMA 3QPVA 4HGNA 1YZUA 3F3YA 1YRYE 3WWEA 4UULA 1EX1A 4K28A 4M8KA 4X7MA 1XMQB 4WCDA 3U1TA 3UT6A 3PWZA 2NXEA 1LJLA 1WL8A 2NUAB 5BUCA 2ODWA 3K1YA 3UMRA 2VP5A 5KAPA 3F78A 2QQFA 3JARA 4BV3A 2ASEA 3DGFC 1GJRA 1Y9DA 2BFMA 1T34A 3V00A 2VUSA 3UXHA 1E79A 3BHIA 3HRIA 3AUXA 3R20A 3IAS1 1CNFA 3NWOA 1E1KA 3T0FA 3PXCX 3D7NA 4H6PA 3OHPA 1BRTA 3FPJA 1L5SA 4GNKA 5CU7A 5BOVA 4GDFA 4D6YA 3LLCA 2QSUA 1I1NA 3E4CA 3KWJA 1GP2A 3WK5A 1YWGO 2D2IA 3FKSD 4IJMA 4GC5A 4L4ZA 4F3CA 1BNCA 1DG3A 3FHLA 4GLOA 5H02A 1QRTA 2WEKA 4RTSA 1DJNA 3PV0A 4HH4A 5AVSA 2OGZA 4D4IA 1RQPA 2R751 4IIJA 5EWLA 1KI1A 4CF7A 2XMDA 4OXYA 3QIVA 4H9GA 3RC2A 3KKPA 2NV2B 4DLXA 1WZUA 1U0JA 2R9VA 3ZEAA 2P6PA 4DUYB 2G8NA 1EUYA 1NYLA 5BQPA 2JFQA 4Y9DA 4IS3A 1UMDA 4BHTA 2C8KA 4XM0A 2OGTA 2OOKA 4US0R 4RY9A 2I7TA 1FFXA 3KU1A 2XXAA 1VSUA 1V9CA 2UYOA 2Q9AA 1JEYB 2C5LA 2H1LA 4MLDA 4V3CA 5BN1A 4BZZA 4ZHSA 3NHBA 4EK9A 1MIHA 3OJWA 1QHGA 1U2EA 2B6HA 3FRHA 4BMDA 4C7VA 2MOKA 3FSEA 4M1ZA 5B1IA 1RD4A 4W63A 4IL5A 4CKEA 1WU8A 4UPDA 4QGGA 3K0SA 4NV1A 2JBAB 2QTHA 3IGFA 5KKAA 2C54A 2HJRA 1OX4B 1XN4A 1N32B 1CZOA 1FTYA 3VU9B 4A5SA 4BKRA 3PLAE 1KYXA 1Z7GA 2VL7A 1UANA 4Q02A 2E21A 2JI7A 1FFDA 3NB0A 3IPCA 1CUUA 3DB2A 1JWBB 3OF5A 3JQ6A 2WK1A 2X2OA 3TYXA 2ZTSA 1JR6A 4HMQA 1P8AA 1LD3A 3I8XA 4GFDA 4RTPA 1NVEA 1JA0A 1AGYA 2C5AA 2K6GA 2UKDA 3DE0X 1Z08A 2ZRPA 4U6NA 3RFUA 4MV4A 2WQ6A 3QKWA 3UHPA 3FAZA 1Q0TA 4HNHA 1EQUA 5ITWA 1S9HA 4A0HA 4DY6A 4DV1B 2JJ1D 8ATCA 1QHNA 1C8BA 1MAAA 3NV7A 3C8DA 4LDJA 3W7VA 1AJEA 1R12A 3MJ4A 5LZ7A 1E5QA 1T29A 2QGNA 2WICA 3N87A 5DHQA 4LYDA 4PXAA 1BMDA 3I5YA 3QBDA 3HZRA 3EVFA 4YCJA 3ZGYA 3ZIUA 4OJMX 3S8EA 3HJFA 3PHIA 4JI6B 3EGCA 4HBZA 3UC5A 1GCGA 1UJ6A 4IDAA 1JFFA 2A4KA 2EZ9A 4D8WA 2R48A 4EKIA 5I5EA 5G4KA 1XZLA 4B81A 2R5NA 3OU6A 5BSRA 5LMZA 1GU0A 2X8WA 3GC6A 2AN4A 2CB9A 3FDZB 4BKPA 1A3CA 2KWIA 4W6QA 4ZQHA 4OG2A 3PVCA 4U2FA 3VC1A 4DBZA 3HJHA 2PTGA 2Y1LA 4GMGA 4L7VA 4DIBA 4B79A 4GOJA 4ZI5A 5JBQA 3BG5A 3QELB 3ETHA 1G6OA 3AUTA 1G8PA 1PV4A 1V8FA 3QVOA 4I1OA 5KYUA 4DQKA 4OTZA 4RK0A 1ICEA 1NQVA 3BIXA 3LCVB 1KMCA 3TCKA 5BSVA 1JJVA 1SUEA 2APJA 1QGUA 3WLPA 3K6SA 1E1RA 1W5AA 4PZYA 2GBGA 3TDNA 3VO9A 4WCFA 2I62A 1N2CB 2QRVB 4O3MA 3H5LA 1HE2A 1MQ8B 3D3KA 1D1TA 3QSYA 4BQQA 1DPGA 1T8TA 2VF2A 2IXGA 2VKQA 3D8TA 3K5WA 4E5VA 2ZI5A 3EMBA 5GQSA 1L5NA 3RYFA 4ZGWA 5C37A 4O8ZA 3SDSA 3B6ZA 1PJ4A 1X7XB 3HV0A 4IV8A 4ARAA 1KAEA 3M0EA 5KIAA 3PDHA 4MJ7A 2E87A 5CA0F 4FGZA 3RQSA 1A9XA 2CT8A 1XD9A 1TADA 2A67A 5EP1A 2IPNA 1ZNXA 1ODTC 1UBCA 5JMOA 3EWAA 5EHNA 3SKVA 4HY3A 2CL7X 1KH2A 3FPEA 4O4JF 4LJYA 1AXEA 1FYWA 1VXRA 1UM9B 5DOZA 1RZUA 5FBKA 1CE8A 1K5DA 1Y48E 5DU2A 1FMCA 1XROA 2PG3A 2V3WA 5E38A 4N3CA 2IV3A 4BNUA 2F48A 3TSAA 3ILVA 3RS7A 3N2ZB 2K7FA 4UM5A 2Y1XA 1YQEA 3LW7A 3PFGA 3TFQA 3TRFA 4EJFA 1BXGA 3G79A 1ZBQA 1Y8QB 4QOGA 3ZK7A 1ZCJA 4M54A 4QLBA 3E03A 2XAAA 3K09C 2BDUA 2HIHA 1UP4A 1ABBA 1OQAA 1N6OA 4KIUA 2O8EA 3NFYA 5GIOE 1YZKA 2GM3A 1TLLA 1KEUA 3JQ8A 1L6IA 4OKSA 4UAJA 4CMIB 3O9MA 1N6KA 4DMFA 1S8OA 3RU2A 2I55A 4TX1A 4FFMA 4E3WA 4REMA 5GAJA 4CEIA 2PX5A 1GPKA 1TO2E 4UU8A 3W5UA 4CODB 5K99A 2QRLA 1NVXQ 3FZYA 4YJDA 3R2JA 1JB9A 2V58A 4MVCA 4BMYA 3PQDA 4XGNA 3W5SA 1JQLB 2V0NA 1J8VA 4QPPA 5DSTA 4IQFA 4A9AA 4MR7B 2ZTHA 2VJAA 3H3FA 3O26A 4UNIA 4NBKA 4CQLA 3TSWA 4DGQA 1Z8DA 3L6DA 4JODA 4JX9A 2MYUA 3CZ9A 3NKFA 1GLGA 1ECFA 2I66A 4MULA 1D1PA 2GAOA 1QHSA 4FFNA 5KX5A 4TKZA 5CXUA 1E5XA 1P91A 4W6ZA 2FGJA 3PVZA 4JSTA 3QFCA 1MRSA 2ON6A 2YZ7A 4GI5A 1MPXA 4ZCIA 1H9CA 1ATIA 2PK3A 2CE7A 3DPSA 3FI0A 4ZOLA 4Q3EA 1JEQA 3R5KA 4C30A 3EIWA 3GV0A 4L16A 4DM7A 2ZIVB 5L3SA 1PL8A 1N2GA 4G97A 4GR5A 2ZR9A 1PQPA 5BW6B 3G7UA 4MV1A 5EQTA 5CFMA 1A0OA 4LCEA 2R8RA 3GUZA 4S2EA 5DLEA 3WTCA 3ELDA 3TLBA 4DM4A 5JQGF 1GPH1 1EFVB 1AQJA 4OK6A 1CQJA 4QARA 2VK2A 3IOEA 5JBIA 1OYVA 3DMRA 5LA6A 3BJEA 4QOJA 3NLLA 4ZMBA 5EKSA 5IKEA 1YQTA 2ZWMA 3QBVA 4YV7A 3VBCA 4F96A 5KPDA 4YXWD 3GDOA 4RMJA 4AM8A 3KQPA 4P4SA 4JJZA 3S1SA 1QIKA 1G2PA 2AXEA 3JR3A 3VC2A 2GZHA 2JDID 4F7WA 4K3UA 4RSRA 3RM3A 1I2AA 3VYSB 4YT8A 3A1CA 1F6WA 1R0KA 2UUAB 4QYIA 1YB5A 2MSEB 3ENVA 5DBEX 2GPJA 3NTXA 2M98A 3OLXA 3AC0A 3AFNA 3L07A 3WBJA 4LJ8A 3VDXA 3O8QB 4XGQA 1W29A 4O02B 3U4QA 1HBJA 1UIMA 2C95A 2NX2A 3F49S 4KKXB 1RHUA 3KUCA 4YRPA 3WHPA 3ZJ4A 5AW0A 4W9MC 3E9QA 4TWAA 4BRWA 1B3RA 1XCLA 3L49A 3LUPA 3ORRA 2IYRA 1YIOA 4URFA 2OYCA 4KFTA 4P3XA 2VUUA 1QK3A 4P5PA 5AJVB 4EA7A 2FK7A 1KSHA 3KZ1E 1G16A 2J5QA 2BKEA 3KSUA 4IP0A 3TW0A 3H86A 3S70A 1NUHA 4RL4A 1L9XA 2QORA 3M6MD 3NBFA 4I99A 4FWBA 2FUKA 2WWXA 3NUGA 4Q4DA 2QA5A 3CBGA 2EFCB 3JQFA 4YRLA 3M8KA 4JLJA 2NADA 4F45A 3Q72A 1M33A 1C80A 3O2NA 4M6WA 5HG0A 3P2EA 4O4JB 3WTBA 4Y8VA 3W6OA 2CSXA 4EF6A 2WA2A 2VLIA 1GY8A 3ZKWA 2BEWA 4LE2A 4J9UE 3TIIA 1Z5VA 5IDWA 3UMMA 1M66A 2VC2B 4ICIA 4DVGA 5LZ9A 4QU5A 1HC7A 2QE7D 3PDUA 2P40A 3N28A 3VH4A 4LDZA 5ALMA 1T6YA 4AJ4A 2ZRIA 1FQOA 3FX2A 4RZ3A 2IYTA 3FUTA 4LJ6A 1V3TA 1GV1A 3CQ9A 3D0QA 1U2PA 2FH5B 4BN0A 5EJEA 2KLBA 3EVNA 3H87A 2IODA 1REQB 3R8XA 5NULA 4LX0A 2I67A 3QKTA 5TPWA 3M81A 1MTZA 3DTTA 3EOZA 3HKCA 5TGZA 1VPWA 2ZIZA 3O47A 4Z53A 3WK9A 4IZOA 2ZATA 1NUUA 4ECEA 4AI6A 3QPBA 5DCWA 3H83A 2IYLD 2JFVA 1JIJA 2O48X 2ZIEA 3L8ZA 2Z9BA 2KPOA 1IN7A 1C81A 4YRTA 5LDHA 4TLLB 5TVGA 4WZZA 4RCYA 1S02A 5J1TB 2I8CA 5K8CA 1SU8A 2YIVX 2PZ8A 3F47A 2G6TA 1XLTA 4GSYA 5EMMA 3CSDA 3MRVA 1J8QA 4Q7LA 3S2IA 1HE8B 2JL1A 1DE0A 1I5OA 1FNDA 1RC8A 3UYKA 1U9CA 3PD1A 1OD6A 3R3XA 1W1WA 2ZEJA 4CEHB 1OH7A 1GTJ1 2JC3A 1DRVA 3EFOB 3IBGA 1BTOA 4XFKA 1DCMA 1RLTA 4FR0A 2QL5A 1T5BA 2X6TA 2AYYA 3RB8A 3ET4A 2AI2A 3KETA 2V59A 2WWYA 4JYAB 1EFCA 1IHOA 1W19A 1K97A 2Y67A 3FWKA 2RHDA 3PD7A 5JQGB 4URWR 1PU2A 5ED0A 1LVGA 1QU3A 1GT91 2V7GA 3OIYA 2OCXA 3D6MA 1J7JA 3KLPX 4G09A 2ZVPX 3D7KA 3KHKA 3PGMA 4L8WB 5IDQA 3HN7A 3THXB 4JI0B 1SKYE 1CJUC 1R15A 2W2OA 3JQ9C 2BGIA 3EULA 3O4FA 1UDAA 3GYGA 4OVKA 4DBVO 4LRSB 3L0BA 2X15A 1L4EA 1Y9ZA 4TT3A 5F7ZA 5J2UA 2Z3WA 3RS5A 5FPSA 2ZZKA 1Y80A 3DKKA 4RFVA 1CJVC 2XNKA 2Q8NA 5EQDA 3GPIA 3NWPA 2ENWA 3Q2IA 3GVXA 3KU4A 5IM4A 3QI7A 3QEOA 3O83A 8OHMA 3K70B 3LGSA 5BQ5A 3RIYA 5E6RA 1R10A 1YQUA 3BA6A 3W1VA 5K8UA 2IIBA 5AMXA 1Z37A 3GXBA 4BNGA 2BGNA 5EFZA 3EUEA 2WSSD 3SIPA 4QDOA 4HNUA 5KOHA 3FMOB 3A2MA 3H1TA 4JNKA 4V39A 4Y67A 3VYVA 3HACA 4IHJF 4ARVA 1KDOA 1USGA 5TQ2A 5BP7A 2A5DA 4GWKA 4HSGA 2OCIA 3OMWA 4NJOA 1LRKA 3RC7A 4JI1B 4QRIA 5EJ2A 1Q20A 4B5KA 2I6QA 2OEPA 1B43A 1NW6A 1O4WA 5H80A 4YUWA 2HAEA 1Q1BA 4XYLA 1DEXA 2QD2A 3QF4A 3A14A 4X7RA 2XCLA 3FSJX 4DG9A 3ZTWA 4Y1FA 1JQEA 3THYA 2FFBA 3IJPA 4KUGA 2YL2A 1OA1A 1TFUA 2P7IA 4FMDF 1CVIA 3HJCA 4CKZA 3P2IA 4F9GA 5KJEA 4ID9A 4C2BA 3C3EA 4AP9A 3ZLTA 5IFLA 4U6SA 4ZVUA 3GO4A 5J5AA 3URMA 2GT1A 5CDHA 4LHEA 3KNZA 3OZGA 3S2FA 1YVDA 2VI5A 3AZQA 4MVJP 5HP4A 5CNKA 4QGSA 1PG0A 4HVCA 3HNPA 4RS4A 2UZ4A 2YHIB 1IM5A 3AR5A 4RSMA 1N2OA 5I4CA 4NNPA 3FGNA 1SOWA 5F4ZA 4AY4A 1VL0A 4HDAA 5I7FA 5KQLA 3NP7A 3RREA 2PUVA 3TCNA 2A5YB 1ULUA 4LZPA 4UUAA 5JPDA 3TCXB 4MVJM 4ERNA 1SQ6A 3OZIA 4EO4A 4JYZA 1NXXA 4RW0A 1EVKA 3M4XA 4J3FA 3ZHRA 3KQUA 2UYGA 2AKYA 2FMIA 4GMDA 2JZCA 3ZE8A 3NHPA 4P4LA 1PW7A 1MB2A 4OEHA 3EEYA 3USCS 4KXYA 1U7HA 1Y37A 5K9ZA 1QM5A 1LKZA 2HWWA 4XUCA 3NHSA 4GZ3A 5FUXA 3UW3A 3RK4A 821PA 1USVA 2JIPA 1UXIA 1VPVA 1PNVA 2HIGA 3BCUA 1WX1A 3OE7A 4RF4A 4CJXA 3K70C 2JBHA 1XEWY 3MS4A 4L57A 3JQAA 1E1DA 3EMDA 4N3AA 3CZRA 4BO9A 4YJHA 2I2BA 3CUUA 4S3MA 1I36A 2ZS7A 3TVYA 1NNI1 3QY0A 2QX7A 2RFLA 2QNRA 3ANXA 3H7AA 1PV1A 4O2AA 3U7EB 3UMGA 1R4NB 4GMHA 1E0DA 2HADA 4P80A 3TTYA 3V7NA 3WRYA 5ITSA 5JY1A 3V4ZA 2O4CA 3FNBA 4R41A 1G3QA 1IBKB 4MEAA 1AF7A 4YFVA 4ZI7A 3A6HA 1VYUA 3V2GA 1HE5A 2GN1A 3WC4A 4E32A 2Z30A 1SA0B 4HR7A 1US8A 2GRAA 4MV6A 1W2GA 1I3NA 4TLAA 3K70D 2ABWA 3QFFA 1YBMA 5FBQB 4ZO7A 3Q0EA 3CRRA 1Q1ZA 2YV5A 1R8XA 2FZEA 5L40A 2O1XA 3GP3A 1GPJA 1XX6A 3LY5A 4Q3KA 4XIIA 3FJYA 5IMSA 3V1LA 4U7DA 2IZOA 1RKXA 1O7JA 2L82A 2QKYA 1GUFA 1ZIOA 3SC2B 3MPUA 2MSCB 5AICA 2ZJ3A 2E4WA 2YXNA 3IAM1 3C8HA 5IZ4A 1HDOA 1XDUA 1VTKA 1YO6A 3AEQA 3H9CA 5JCJA 1M2KA 4ML3A 1HT1E 1GRQA 5CP8A 6PFKA 5ER9A 4DLZA 5B37A 1EVZA 4EA8A 4DDWA 2ZYSA 2YY7A 4TROA 5F77A 4LF9B 4DLYA 2CJWB 1XZBA 3SSNA 5E1OA 4IHJB 1YRHA 1HSZA 4PE5B 1DT3A 3GW8A 3DD5A 5CR9A 3C16C 4DRXA 2GBPA 1JGTA 4R68A 1GXSA 5HDBB 5AHKA 1S2IA 3I34X 4X41A 4PXYA 4PINA 4JYCA 4XJVA 4DUGA 3U16A 4PIMA 2PX6A 2F1HA 3L7JA 4FGWA 4IPTA 5AJWA 5JS2A 4V1CB 2JFWA 2WUGA 1JZQA 4BMPB 1ZK4A 3R6GA 3ITNA 3LCJA 2G9QA 2J5RA 2JAOA 1XA0A 3AF5A 1GZ5A 1E8NA 3Q3HA 4FMDB 3EXIA 4R8LA 3CSSA 5DASA 5LZ8A 3R7DA 4ESOA 5CG1A 3G0HA 4Q9DA 2YIMA 3MS2A 1A97A 2JAPA 2WR8A 2XA2A 4PX9A 2D5LA 4U0KA 4WTOA 1IJBA 4E09A 4NH4A 1YA8A 4YH1A 3A4TA 3W8RA 5MHTA 3ZDYB 4JV5B 5CT8A 2HY7A 2CCKA 2A9RA 1V45E 1UINA 3OE1A 2QIOA 2PKCA 3T5AA 3BMQB 5ALXA 5CXSA 3EAFA 4IX1A 1PBTA 1Z29A 1MC5A 3F1KA 4MV3A 3B13B 4UNQA 1MAUA 3KRTA 1LWNA 5DGXA 5GIPE 3RAGA 3E22B 3EQ6A 3U9LA 2OV2A 4TKMA 1I7NA 1F17A 1IBSA 1WMAA 2A3RA 1T36B 1FFHA 1ZVQA 4AYXA 5CFZA 2HHHB 4B7AA 2BF7A 2BKAA 4FOOA 3CCBA 1K3TA 5KQSA 3TGLA 3PRJA 5U4QA 4P86A 3KVYA 3KQHA 3BFPA 2YJ6A 4PC6A 2NZYA 4IUYA 1VZ3A 3TAXA 3D43A 5K0NA 4RADA 2R25B 4RH1A 3OHSX 1B6SA 1IIBA 4NPCA 1Z82A 2BLNA 4JYPA 5AESA 2FWNA 1KHTA 4M9RA 3VSBA 1CYDA 2GARA 4DLVA 2CV1A 2BM0A 2WHEA 3QK7A 1TD1A 1M73E 1L8XA 1PSZA 2DCUA 1XTSA 4OD0A 5I9MA 1IJKA 3LY9A 3LC7O 4MZXA 4R7TA 4BE7B 2X8LA 3IX7A 1TZCA 4L4SA 1QKKA 2OFPA 4P31A 3V2HA 2R6GA 1B0UA 4N54A 1VFPA 4M98A 4UTOA 2F3RA 1I2DA 5CBPA 2X1LA 3CLUD 4PFJA 4BJ3A 3IDZA 1B42A 5AH0A 3ITEA 3EZLA 4RCVA 3QE2A 1T3HA 4NU6A 2AN3A 1WV1A 1GGEA 1OYWA 1TA9A 1XMVA 2VNJA 4CQMD 1RAAA 1Z2NX 5EIHA 3TLAA 1MN6A 4EDFA 2EZ4A 1VE6A 2IGTA 1M1YE 4QJBA 2VCHA 2VCYA 3T3OA 4H0CA 1N75A 1T8WA 3PCTA 3Q41A 4AO6A 3H5NA 3GXOA 3EA0A 1N5LA 1QDEA 1W2HA 4IGFA 4L95C 3D0KA 4EX6A 3RC8A 3N05A 3LPDA 4YBZA 2HHCA 3VKWA 1WXFA 3GFSA 3LECA 4IUCS 3TX6A 2QJWA 3OZXA 4LY3A 3LD9A 2OAEA 3TOVA 2GN6A 3MMXA 1NAIA 1WB9A 2CXTA 1XA3A 1GPLA 4MGHA 3KVVA 4MR8A 1E9DA 2BF4A 4B4KA 1M1YA 1YZHA 4WMLA 1BS1A 4UD6A 3JAWA 1KS2A 3EVDA 4E12A 1FS4A 3T7RA 4KYUA 4M9QA 5D5QA 3U4GA 1NF8A 3ZXSA 2LGJA 3I12A 5JRJA 2GETA 5AM2A 1X9HA 2WFLB 3GWZA 3VJLA 5IXYA 1QQ6A 5GVRA 2FPRA 4XD2A 4C0HA 5FBHA 2J9YB 4DZTA 1M5UA 4H3HB 4IG9A 4F04A 2P2YA 4PPQA 3RFFA 1FRZA 4WK2B 5BN5B 4KO8A 2RKBA 3LWZA 2C99A 4OCZA 5ESXA 4XRRA 5H9WA 2GCGA 3ZCUA 4E14A 2R85A 2P4HX 3EEOA 3MWEA 4FLMA 3GMTA 1QNFA 3M6UA 4XQ0A 1Y8ZA 1SU4A 1WU7A 2ORIA 5KC9A 4OFBA 4QVIA 2FPWA 2AN1A 4QFMA 2PRJA 4A92A 3G88A 2F3SA 3VR4H 1JEJA 1FP2A 1OXUA 4PO9A 5A4JA 1HETA 2FUEA 4P93A 1G8GA 4NEGA 1L1QA 1E1LA 2FW0A 3ABRB 5CYOA 3ROTA 3VHQA 5C7YA 5KPJA 3DAPA 3S0JA 5LMCA 4CR8A 1FZTA 2FN4A 1F2UB 5BQOA 3LA8A 4TWIA 1S2GA 1V1MB 2A1UB 4KQ2A 4FC6A 2I8LA 4HNRA 4JQYA 4PGGA 4N6OA 3SHOA 1OLUA 3UB4A 5IT0A 1GKKA 4CM3A 2IS1A 2HJWA 4MWZA 1EQ2A 1W4RA 3CMCO 2QV7A 1NTRA 2Q5IA 4PLCA 3IV6A 5GWXA 5H59A 1RZRA 3GMDA 4MCJA 3KWFA 1ISIA 1E6MA 1FE8A 3FFTA 3D3QA 2W6IA 2FPIB 1QF6A 2HI0A 1YRBA 3DZGA 3H9UA 4HAVA 4UQOA 3QBTA 2IOYA 2V4ZA 3F96A 1X14A 4GVPA 4R9NA 4XIJA 4EEKA 1M34B 1YNOA 2ISQA 2J7KA 3DONA 2BKLA 4TMYA 4AQ7A 3AUUA 1EK0A 4OHBA 1P3DA 2X8JA 4UFPA 4C7KA 4QM7A 3LX6A 3MUNA 3VMMA 4K88A 1KY3A 4PZAA 4UJ5A 5AVXA 1KI4A 3FTCA 3RK1A 1HEUA 3VRHA 2WKRA 1U6KA 1FFYA 3BB4A 1CQPA 3K4PA 2HXSA 3EY4A 4GU5A 4YPOA 1T5SA 2Q9UA 1NN0A 2UZ3A 2FPMA 2R5WA 5IJZA 1VCOA 4UHJA 3M3PA 3GLVA 4OQNA 4RL6A 5AI8A 3W3AD 4F91B 1MVOA 4AUNA 5FI1B 4IRXA 5IVDA 2HU2A 2QPAA 4FHEA 3TNFA 1HOTA 1N3BA 2FHPA 2R8BA 3KKEA 1PWEA 1G8SA 4HQNA 3V4FA 4BX8A 6ABPA 3ENQA 4R3NA 1ZNZA 1AXRA 1HDRA 4E88A 2I6TA 2FN9A 2OXRA 4K81B 2JKYA 3BD9A 2G80A 4YMSA 1HH4A 2JI9A 4TKUA 2JH9A 3AVOA 1CLEA 4TMTA 3CR7A 3I6YA 4DV3B 4XDYA 3L0YA 2HIAA 4NVRA 5FX2A 1P31A 3G02A 2YH2A 3LXRA 4DLWA 2G6BA 1UC8A 2OCPA 3PYLA 1JFRA 1J2YA 1GL6A 3M34A 3I04A 2C5SA 3B8EA 3LQ2A 4FHZA 2M2IA 2OENG 4LN1A 1UPXA 1ZY2A 5CCDA 5BMOA 2N47A 3BWCA 3GLTA 1RAIA 2ZAGA 3OFVA 3OOHA 2BHTA 4GKBA 4J16A 5CYGA 1O0CA 4YRCA 3BA1A 4L75A 2V7VA 1IVYA 2QJRA 4RPLA 2B0JA 2VDQB 4FKZA 4RPJA 2IXEA 2OB2A 3ITKA 4AJ1A 3C15C 1YTUA 1H23A 4P9NA 1SM4A 4JC4A 4A2CA 5A0VA 4Q3DA 2CBXA 4Q00A 1DBQA 4CIXA 1J1ZA 1F0PA 1M7GA 2PBLA 2QM8A 3UUEA 1LDMA 2YFQA 4QJIA 1HURA 4QATA 3OQJA 4EL5A 2R1TB 2H2DA 3B8HA 3QUAA 4CHGA 2PUFA 5JMPA 1CB7A 3BIJA 3G8YA 4J1NA 3ZY6A 1QRSA 4OHMA 4KHPB 1OAAA 3PCRB 5H3CA 5BSGA 2OHXA 4ZEXA 1OU0A 2QDXA 5HQ3A 2QZ4A 4YPVA 2RBKA 3DXZA 3UK0A 4WY5A 1B8OA 3RSZA 1YL7A 3IEMA 2KB0A 3N74A 1PUJA 1BDMA 2VHEA 1SB8A 4S2UA 3WZ2A 3ZZUA 1I5RA 4BYMA 4LF4B 2PDAA 5CK4A 4TV8F 3M6LA 2O8NA 4EJ6A 2W2KA 3EGOA 1XU4A 2EDAA 2R1VA 3RRNA 1WMDA 2W6PA 1XKLA 2ECPA 3IR5A 1FVXA 1KY4A 5GJWC 4U9HS 3MB5A 1GR0A 5K3AA 3DBVO 4IOKA 3KZNA 5EHQA 3LWNA 1ZVJA 2KJQA 2QTFA 2R65A 5LMNB 1SXJE 1GKYA 1T1EA 4ROSA 4DHWA 2OORA 3W5BA 1W1IA 2HH9A 3QXCA 2Q4TA 1IG3A 1R4MB 4L9AA 2XNJA 3DKIA 4P5EA 1WQ3A 2WYOA 4JVNA 4JEIA 5ADWA 4AUMA 3TG8A 3LK6A 4UBIA 1PYDA 1XD2B 3P4YA 2XRFA 2DQKA 3EAQA 3T54A 4Z0PA 1P60A 3EXHC 3FH0A 3SJAA 1VI5A 4YIHA 3LF1A 2WJJA 5C5IA 4H6WA 4IMJB 3KPJA 4P3KA 3IXQA 7ADHA 1YE8A 2B4TO 2RHMA 1BYIA 1NC3A 2V6BA 3LFTA 3RGWS 5LMUB 1SXJA 2FJPA 2G9UA 3SJCA 1J8FA 2VYCA 4ZU3A 1GPAA 1XLUA 1YUBA 4JJKA 3RRJA 1I3LA 1MU0A 3AESA 4A03A 1YI0A 2RI6A 3P9RA 3LFHA 2Z2JA 1O87A 4MRRA 1GQOA 1JRLA 1ZD9A 5JOQA 3C8UA 3QF7A 2DEUA 2CN1A 3GMIA 2OB1A 4ZQBA 5KINB 5AW8A 3GD5A 2BGGA 3V6MA 1I80A 5JD4A 1Z5OA 5JATA 4KE6A 3VI4B 5KHAA 1NXTA 4PGAA 2IS2A 3M89A 4D8TA 3VR3D 4HG2A 5FL7D 1DIOB 3FFAA 5MFZA 4DADA 2PUCA 3DZ8A 1OPRA 3NJ8A 4FP9A 3HVKA 1OB2A 1TJYA 3A1VA 3AEUB 3F9CA 1E69A 1KVTA 2JFXA 3SMQA 4RIGA 1TAUA 1NW7A 3LRPA 1HSOA 5AUQA 4BO4A 4KQXA 1DSSG 3V32A 4H3VA 1ESMA 4WCVA 4R1NA 5G0WA 1SMKA 2HJ9A 5G1PA 5GY7A 2AG8A 2DJIA 1CUCA 4EPXA 5FTLA 4PLHA 5K3BA 5KYYB 3BAZA 1BCSB 4ZO8A 5ISMA 2G09A 4M8SA 3B48A 1UPCA 4NRDA 1ISRA 4RVUA 1VKRA 4G8CA 4IGKA 4TYYA 3W78A 4WINA 2VDMB 2NXWA 1ECGA 1FQJA 2HRCA 1O96B 2AXNA 3EXFA 1NR1A 3FPAA 1XDZA 5LQSA 5B30A 1NOIA 4W5QA 1D4FA 1CR6A 2V45A 3BMCB 1E4EB 5D85A 4DR3B 2Q7XA 4ZVOA 3HVUA 4NR0A 2ZWVA 4H08A 1V5EA 2Z2KA 1EWYA 4EB6B 4EI7A 4N01A 1TZKA 4EY4A 2DBRA 1K9VF 4GS5A 2ZTUA 2BFEA 1JDUA 2YQ5A 1N57A 3GHHA 4PEVA 2IYUA 2CNWD 3JD4A 3PNOA 1XKQA 2QM7A 2W0MA 3AHHA 1B7GO 1ZRHA 3BWDD 3SQMA 4IRUB 1QIEA 1IQUA 1JJBA 1LZKA 2QT0A 1J2JA 3KYIB 3HNRA 4EPTA 1IXYA 1UBFA 1WTAA 1OXVA 1NHWA 4OB8A 2E9SA 5AJYA 2OV6A 3ABZA 4BP1A 4AJJA 5JRZA 2PE5A 2G5PA 2XWJI 2PQ6A 4L02A 1G6KA 1QKIA 1A5SB 2QX4A 3AT1A 4TV8B 1ZC4A 1DTEA 1R6DA 1TZ2A 1DFGA 2ETVA 2XUHA 3A58B 3HMKA 3B1FA 3SAJA 3WLEA 3W3AH 4DSTA 1HXHA 1Z7BA 2M6SA 1I3CA 2PH5A 4ZVKA 2PWPA 4DWOA 5KNBH 2XQJA 2C2YA 1V26A 2C9YA 2P4QA 3X2SA 4UVDA 4M49A 4R1QA 2DR2A 1YFKA 5CXQA 1NBHA 2COUA 4HWKA 3VO2A 4WBXC 2C2OA 2D59A 4DLLA 4GEKA 4R40A 3F9IA 2PT5A 1VA5A 2M1XA 4BMXA 3V9PA 3G2PA 3HU5A 2BGWA 2QVGA 3GLGE 1V6AA 2GUWA 3GLFB 2XX3A 1E3JA 2DLCX 3ROPA 4Q6BA 3H2IA 1VL2A 2B4AA 2PGNA 3Q3CA 1E18A 4FJ2A 2B9VA 1KE2A 1TZMA 3RRYA 3I9JA 4M55A 3SLKA 4EECA 4BFXA 1Z62A 1DAKA 3GBVA 5AFSA 2A0WA 2UYCA 1JHVA 2P78A 3ZG6A 4NIMA 4M0FA 4DSOA 4JZYA 4BE9A 1D1SA 4UHBA 3VNBA 2GLUA 1NF2A 2YNMD 4B2PA 1YR3A 3LX8A 5CX4A 4C6HA 4TS1A 5BW5A 8ABPA 5HOQA 1NBME 1ZCAA 3WWOA 3MINB 4F84A 5KEIA 2BSAA 4RD3A 2IUFA 4BY9E 1QANA 1U1EA 1VM6A 4BWVA 3P4XA 1DAIA 3OJ0A 3PDWA 3AZOA 4UCQA 3ZNNA 4DGSA 3IHLA 4EITA 4NV0A 4C2UA 2Z4TA 2QR2A 5EJMA 2EQ5A 1I0LA 2EOAA 3MNFA 2OCLA 3OO1A 1IOVA 2FDCA 4E07A 1U8FO 1VYTA 1AF4A 3S2EA 1TQ4A 3U31A 3QKSB 1BDHA 3I53A 1HQKA 3MLEA 1QE3A 3TBFA 4NZPA 4TVOA 2QS9A 5G2OA 3NVAA 2WLSA 3GDWA 3V80A 4OK3A 5DTIA 2C1ZA 3N07A 4FYXA 5FV4A 3S2YA 2BRUC 2Q21A 3HUDA 1IXRC 1NBMA 1P4JA 1E2HA 4IJVA 1MC1A 1YB4A 2HCFA 4J43A 4GPAA 4BC0A 1K6JA 1RVDA 1GRCA 2HRQA 3R44A 1PJBA 5TXGA 3ZIDA 4OI4A 1GYRA 4Q24A 3EIQA 3RRBA 2NNLD 2ATIA 3ZNOA 4B8YA 1RPAA 4YUYA 1UEIA 1CZHA 5JASA 2LPMA 3RWBA 2CHUA 3RRFA 2P5UA 4ZO9A 3W9UA 1UKEA 2XNDA 2FVXA 2R00A 1RQRA 2VEOA 3E15A 3E8XA 3NU1A 4XCXA 5BO5A 2Q1UA 1NU8A 2IZ6A 3WOVA 2JLVA 3COYA 1ZM3A 2XE4A 4L73A 1CF9A 4IV5A 3VYWA 3A4VA 3EK2A 2AD5A 3H5TA 4IDCA 3WKAA 2AFHB 2XCUA 2JD0A 2R60A 2XBUA 3NYRA 3KEQA 3HR7A 3CGWA 4LRYA 1ZUNA 1GNQA 3JVDA 4NP6A 2QTZA 5DBIA 1YAJA 1DCTA 5B6PA 1GPNA 2G07A 2JARA 3KOOA 2VJKA 2DRIA 1BWQA 2YFKA 1T5LA 1TUIA 4GZ6A 1J90A 3ROXA 1U9ZA 4V03A 3MXOA 3S5UA 3U4DA 1FEZA 3GVCA 2Q0SA 4Q7MB 3F90A 4UBOA 2ATXA 4V3BA 3U7QA 2GK6A 2Q6OA 3NRCA 4QC2A 1PQWA 3ENZA 2RHWA 2XIJA 1VQ1A 3P9XA 4EYQA 3WAKA 1MJFA 4ZIRA 4L15A 3MHTA 1KO8A 2WKPA 3OC6A 1J5XA 5FYDA 4REOA 4FFOA 1KKMA 1G3UA 5EE0A 1JSCA 2FOIA 2QRPA 4GIBA 1SOMA 3O4IA 3HDHA 2W2MA 1NXQA 4UU0A 4MAMA 5I7EA 4AXXA 1T2CA 4LJSA 2JFFA 2QVXX 3DEAA 3F5SA 4HB2A 1N6RA 2J3KA 3IDQA 3D6JA 1DRJA 4LXTA 1SIUA 4M89A 2ZM5A 2BFAA 2NAPA 2W6CX 4C06A 3N6RA 2J0VA 2TMDA 2XGJA 5AKHA 1LBQA 1ZISA 2L0XA 4UU7A 3TQRA 2RCNA 4BVGA 4DDHA 1RPTA 1U9IA 1D9XA 1UIRA 4B47A 1GUYA 5KJ6A 2FYTA 2OO5C 2ZSJA 1RWWA 4DVJA 2R8OA 1W7AA 1F8GA 4I1RA 2HA6A 1UBOS 4LYJA 3WQQA 4ENRA 3PYMA 1GTRA 1MVLA 1A8UA 1EDZA 5JZ9A 1ITZA 4JBHA 2I9PA 4CMCA 4F2PA 2YYAA 4W7IA 2RGBA 3NNDA 3DFZA 3G2QA 2CD9A 1MB0A 1Q21A 3MC1A 2QLMA 4FD3A 1G21B 5MGNA 1L7RA 4MV9A 1JLLA 2QTLA 4IVPA 4Y9UA 2DUNA 3DXYA 5ALDA 2HM7A 3UK7A 3VAYA 3CNLA 1ISSA 1MW9X 3E27A 3SZMA 2OHIA 2SNIE 2YBEA 2IBMA 1JXQA 3EDMA 4WLVA 1D6MA 1F2DA 4YLEA 1VP9A 1ZEMA 1T2VA 3TRHA 1R00A 1BDBA 4WZAA 3UWDA 2DC1A 3PGLA 5KC8A 1ODKA 1Z88A 2QLFA 2OQIA 4KIJA 4QPZA 4X93A 4YJGB 2A9JA 4QUKA 5HJ2A 3V55A 1QX3A 4PC2A 4S04A 5KJFA 2I4NA 3GIDA 5C8YA 3SX2A 5JYCA 4FNGA 2CL6X 4A2WA 1M2WA 4JWTA 4RPHA 3NVKI 1L7AA 4OYHA 4HL6A 4B83A 2OXCA 3FZEA 1O57A 3PRHA 2J9RA 1OWOA 1SIWA 3JYPA 5JARA 3TPCA 1FLVA 5INTA 2FOXA 3GEMA 1XCPA 3FBTA 3DHWC 4DE5A 4GZMA 2XNSA 2VZ8A 4K9PA 1DBRA 3CGGA 2JGFA 1UJNA 4KFSA 3AIKA 4MKXA 5KREA 4Q19A 1E1NA 1JFVA 1F8XA 3Q1LA 5K03A 3THYB 4L3WA 3T6KA 3CUVA 2G28A 1JLMA 4QHSA 5T8KA 1DV2A 1ZR2A 3HA2A 1CUFA 4RSGA 1SB9A 4Z8XA 4E6EA 3U6KA 1JHZA 3T3PB 3TPZA 4YAGA 1SKMA 1YZTA 4LGMA 1ZU4A 3E9CA 4I19A 3U3ZA 1TYEB 1NE2A 3LXUX 3OOJA 1O1YA 5FFMA 3IT1A 1P1CA 4XOUA 5CDUA 1JG3A 4FHCA 4F6RB 3SOPA 2YWCA 4G8JA 2Y68A 5T6BA 1E2MA 1O3YA 1W73A 1RJFA 3DMHA 3T3GA 4A4DA 4EG4A 3V4LA 5D01A 3OFNA 3NBMA 1E1QD 1PF7E 1O5IA 2ZUDA 3IAEA 1YH3A 3JD2A 4AG5A 2Z8XA 4EY5A 3HFJA 3NOXA 5EHGA 1I14A 4YAIA 1NNSA 1DWUA 3PEEA 1GPMA 2I29A 3PITA 1XKXA 4IH1A 4XA8A 4RULA 2P0EA 2DX7A 2VP4A 3QPUA 3T3MB 4DMKA 4QPDA 4I7EA 4X1OA 1DDGA 3EHEA 4Y2UA 1YCFA 3UHJA 4E2XA 1JG7A 4UUBA 4YASA 2HCRA 3FNRA 3D0RA 1GG9A 1CJTC 4YO7A 4HDKB 3BIOA 2MJLA 3WLSA 3HYRA 3OUZA 1O94A 4O5AA 3ZK8A 2VJMA 3JAMA 1WABA 1YI1A 2MSNA 3DP9A 3I8SA 2VZ9A 1OCEA 1PDVA 1EXVA 2OZPA 3LE8A 3A31A 3H11B 1V5WA 3JZDA 3R0QA 4N5HX 1T4CA 3W8FA 4PR3A 1U2GC 1WPXA 4C4TA 1USUA 1KZ1A 1NWHA 3VYRB 1MP0A 4E94A 5I7RA 3A6EA 5TNXA 2ADMA 2XCIA 3ZGNA 3UATA 4ARZA 4BVFA 4QD3A 2QX8A 1U0SY 1YNSA 4FT4A 5SZJA 1JPUA 4M21A 3C4QA 5FQNA 1DGQA 2YVQA 2BI7A 4C4RA 2WP0A 3OKAA 5EKTA 1DARA 3ITDA 1QWOA 4RZSA 1I7LA 1XQ6A 3HS3A 4RABA 5DNVA 4U39A 1UP6A 2OV1A 2CYCA 1Z36A 3PXDA 4J0HA 4FFVA 2GFHA 2DPLA 3KXPA 2P9BA 3JX9A 1NMYA 3KDSE 4QYXA 4LZAA 4GT1A 4J1SA 4AY6A 4AB1A 4MQFB 2XCTB 4M7WA 4PFSA 1E1MA 1W48A 3V8RA 5J4LA 1NLMA 1MF7A 4RDCA 4MI3A 5DJ5A 4M7RA 2J3JA 3PIRA 2WOJA 1IXZA 3GLSA 4QFBA 5EAIA 3ETLA 3MGKA 4OUDB 4MS3B 4QECA 2QENA 1P75A 2W22A 3KG2A 2Q5JA 3NXKA 2G40A 2CHGA 1G55A 4KIGA 3HLTA 4QXMA 2Q1TA 7MHTA 1GRRA 2OAGA 4CGZA 4MA5A 3V3TA 1WKBA 1I9GA 4W9RA 1DELA 3R3VA 1Y6QA 3NR2A 3A6ZA 1OFGA 1L5QA 1LSSA 2G0NA 3WGMA 2XYPA 1AKQA 4RHUA 1EESA 5A3SA 1UOEA 1W25A 2F2TA 1XEXA 3F4KA 2ATEA 5ALHA 3PQEA 1Q0ZA 4XDGA 5LU8A 3TEMA 3UVEA 2A9VA 2Y76A 4PYKA 1MZPA 3UPTA 2IGBA 4YY3B 1BD4A 1E61A 4OXRA 3SF8B 3ST7A 3ZH2A 2DULA 4M1TA 4DWJA 1YHYA 2W6QA 4MV5A 2NQ2C 4G65A 1XOIA 3O2QB 2XCQA 3PPYA 5FAXA 4AP5A 3NTUA 3UAVA 1P2BA 1N5JA 5DRTA 1HDXA 5T4FA 1E3DA 2CDBA 2QBYB 1PIWA 2FSFA 3OVMA 4J6FA 2HC9A 1Y3HA 2OCDA 3AY3A 3EG5A 1KRHA 1O89A 2IYAA 1L7VC 9ABPA 4DV6B 2Y92A 4ZWNA 2J7PA 4Q18A 2VBGA 3UQYS 4BV9A 3BXEA 1GTSA 3I83A 2R97A 5TV2A 3IR7A 4LHWA 2ATVA 1B6TA 2WPNA 1VKOA 4RXMA 5F1OA 4UTPA 4OQDA 3WADA 1Y8RB 3ZVLA 1NR7A 5CBKA 2BEUB 3MJCA 1M75A 2H5IA 1B74A 1LW7A 2IA5A 3DE1X 3KV3O 1N0WA 4L08A 4LXIA 1PR3A 1GHTA 1FP6A 4MVJI 3CUTA 5AK6A 2NO7A 3ZJUA 4DQXA 5H3LA 1WB4A 4QIHA 5EIFA 3W6NA 4WOCA 4CIAA 1B6RA 2QDKA 5ULLA 2J3QA 4Q9IA 2WG1A 4FSHA 1PJRA 1LBHA 2QRJA 5CUQA 4WKNA 1DINA 2PFKA 1W88B 4POAA 1CUAA 1KYYA 4WA7A 5FLEX 2YHUA 4UMVA 5BUZA 1R0RE 3V4OA 1Y3CE 1RTTA 1RJ9A 1BW9A 2FMXA 3L41A 5K4AA 3UMCA 2PEZA 1NZDA 1ZN7A 2I3ZA 1TCAA 3BMNB 1PSDA 2CMFA 4B9EA 3EZXA 3K8OE 5GADl 1DEAA 1LTHR 2QB5A 4U7JA 1PT6A 2FLKA 1EG7A 2HMUA 3FRIA 3G68A 4GVXA 4J0DA 5CDGA 2J09A 1IFXA 1A96A 2JGDB 1HNWB 4FC7A 4PZEA 1L7BA 1NU6A 1S01A 4C20A 1QG6A 3ETDA 2XD9A 1I9CA 5DBOA 1DHRA 3MRTA 4TLCA 4A27A 3CLHA 2ZUVA 2JIZD 3VHXA 1CG6A 4WZ6A 1IZ7A 1E2UA 3VTFA 4KAFA 4R2XA 4UHKA 1YIAA 2NU9B 5ILOA 2IQ5A 2P67A 3K5HA 2O5CA 1J7KA 2PUDA 1SCNE 1XF9A 1BKYA 2LKDA 3SC4A 3SP1A 3VPAA 3ZWXA 1PR2A 1HQYE 4MYHA 3TNDA 1CIJA 1GG8A 1TMGE 5ICGA 1XEWX 1FRVA 1XWFA 1UT5A 2AIRA 2D7CA 2KW5A 3O74A 4MKIA 4BWYA 3C85A 3PGA1 3J80A 1TA0A 4CQMB 1SCBA 4CDGA 2ZBDA 7REQB 5F2NA 1NVTA 5B12A 1Y4UA 4W1RA 1TJ5A 3PZBA 3ZHVA 1DZ3A 1A2KC 1FP4B 4AJPA 4DT1B 2DLNA 3V7FA 4DLAA 2UVQA 1RS0A 3DFMA 2DFTA 3WLRA 4DPLA 3J81k 3GF4A 1QQ7A 4RE6A 4Q9LA 4AJ2A 2VT7A 3TTTA 5BWCA 2BBOA 2CBZA 1D2HA 3JQEA 3RIHA 2YYZA 1P61B 1DT5A 3HP1A 1AKEA 2H1RA 1EP2B 1UADA 2WZQA 3H8JA 3NKVA 2BTQA 4QJ5A 2VUIB 4R9SA 4JJIA 2MCFA 1PZHA 4B6JA 2FE1A 4MQLA 2FPPA 3NOOA 4JLKA 5F21A 1G98A 3RFTA 2XQFA 3K1AB 1UPFA 1E5LA 2BGKA 1CEEA 4LJ7A 2EF1A 4PZPA 2Q2OA 5TDHA 1E99A 3O8BA 3O8RA 1WZNA 1EBUA 5ALNA 1Z4KA 3AEZA 4RSHA 3M6FA 4XI9A 5IF9A 3P27A 5ALIA 3RC3A 4A0RA 4TMZA 3TQTA 3VR5A 3QWIA 1R0LA 4IY1A 4ABYA 5CFPA 3LLVA 5LJIA 1EDDA 3EPRA 3FG9A 3PQ2A 2J9FB 3B6JA 3T7EA 3WV5A 2I4LA 4RZIA 2HV8A 3WFZA 1WQ1R 3ETCA 3IIIA 2C7VA 1B93A 2CDAA 1LPPA 2NMVA 2CWWA 1A72A 1HA3A 4TYMA 2JCSA 3LQYA 2QX6A 4Z9YA 4OHRA 2D74A 3IQWA 4FYWA 1CUYA 1E2FA 1M2EA 5BSFA 1I1OA 5M5BA 1DQSA 4ZYUA 4OU5A 3SZUA 4OI1A 1DKRA 1EXWA 3L8CA 3MG9A 4CQJA 4DIUA 3CUEF 4EJSA 3H04A 4M0KA 4U7PB 2GCOA 3AV3A 3A05A 5FUYA 3OLQA 5JCXA 1LEHA 4G1BA 5K05A 4YCNA 4OH7A 3OT4A 4F4CA 4MUKA 3V7YA 3ABIA 4I4TB 4YP6A 2O9JA 4HB0A 4QHTA 4ZOQI 2JLWA 4CI0B 4Z4EA 4BV8A 1LVHA 4JSRA 1IM8A 1ZMXA 2HWXA 4UKDA 3NIFB 4AX8A 1M2JA 3NC4A 1F0YA 2V0GA 3CLUC 2C4TA 2G70A 4WERA 5CDTA 3Q7QA 1KYVA 2I34A 2YW2A 2YIDA 4C3UA 1WMFA 3DEYX 1F7VA 1E9CA 1T24A 2HJGA 3HB4X 2BEVB 2QUKA 5FWXA 1CRQA 1YK1A 2IUUA 5EWMB 3WSVA 4BUZA 1MA0A 5E9JA 4TLMB 1TNDA 1EGQA 1YJ5A 3QLUA 4LSWA 4AZWA 5J4HA 1H6CA 4FYJA 3RSFA 2F00A 2OFOA 3KYCA 4OQEA 1KVSA 2FW9A 2HCBA 2AZMA 2G67A 3QRWA 1WIWA 3GLIA 2LRHA 1RYYA 2CE2X 4EHKA 5JSKA 3CYFA 3DEZA 4EGCB 4QZVA 3QKRA 2Z3VA 3STHA 2ZITA 1CU1A 1TU3A 3M33A 4HNTA 4R6XA 1MJNA 1RWVA 5GJCA 1IHPA 2G9RA 4G6ZA 1MEEA 1IL0A 3RSCA 2Q2QA 4BQRA 1GPBA 3L7NA 4PYLA 1G4HA 1NIPA 2JLUA 1CUWA 2B20A 1C3LA 1JVNA 1LI7A 1YQQA 3KS9A 1HT2E 4P7GA 5GOTA 3D7SA 1T35A 1PR9A 4LF6B 1ZK3A 1EFHA 1K0UA 4ZAYA 2SICE 3WJ1A 4BXOA 4OHYA 4FNMA 2LV8A 4P35A 4QBKA 2A33A 5CB8A 5JT1A 3DOUA 1T2DA 3IXMA 4MQ5A 5A71A 2XWSA 1AKWA 1EDOA 1H3EA 2B8NA 3ZW9A 2NUAA 3A7EA 3AMVA 5EVCA 3AF0A 3HKEB 4FCTA 1LPBB 2F8LA 5MN6A 4KPUA 2PRZA 3UGJA 1LNQA 1Q1AA 2A0XA 5DTEA 1A82A 2GK3A 1NFFA 1H69A 1P8JA 3QOFA 5FA5A 3SIRA 1JHRA 1JIIA 1POXA 4YCSA 1I5EA 3LRXA 3WK7A 3MTEA 4ZCPA 4BWGA 2VPQA 4I9GA 4GD3Q 1J42A 3CG0A 4ZC8A 3UA4A 1OXBB 1DHTA 2HLHA 5FTJA 3KZXA 1NUPA 2QMQA 4IXMA 2J3HA 2AT1A 1YF3A 4R2IA 1WWKA 1JR2A 2P35A 3QVWA 4QX6A 4X7BA 4KHZA 1U04A 3SE7A 1GPUA 1VIDA 2KE5A 2CVFA 4NNOA 1IY8A 5A4AA 3L0OA 1RMYA 4CTKA 1HDIA 1CJKC 1QRAA 5LXTF 4GWLA 3FNFA 4UHFA 1BE0A 3K31A 4LWPA 3I23A 1CX9B 2HSEA 3TIFA 3GRAA 3L0PA 4IIYA 2GCPA 5KWSA 5JALA 1RMQA 1JDPA 1V16A 1WCYA 2JA1A 1CDZA 1Z2PX 2Q9CA 2OPBA 1NW3A 3VR6A 4TPKA 1T2AA 1UWVA 3LUGA 3RLFA 4IJUA 3QEMA 4GSKA 3OTIA 3R8CA 1C5KA 1UKBA 3DLAA 4KQIA 1XAHA 5AWFC 2NU8B 3UO8B 1JEYA 4UOEA 4QDXA 4XVCA 1PJ3A 1TO1E 3EGXB 1CY7A 3CO5A 3LP6A 4QUBA 2GXUA 4BEJA 3MELA 2P9EA 4J0EA 4IDNA 1XMOB 1LCIA 2AG6A 2OZVA 2QX9A 3DBLB 4V2IA 4OHZA 1UBLS 4HAUA 1EP1B 3ZD9A 1RP1A 3MW8A 3Q88A 5DHUA 9GPBA 5G0TA 3WMWA 4KR9A 5CB0A 1DMSA 1OX4A 3KT6A 4R83A 1WMSA 4TSRA 4YI5A 1VE7A 1YTLA 4RELA 1C8KA 2GEVA 3ON5A 5GZ3A 3QU4A 5HNKA 1DAPA 3R4VA 2FDRA 1N6PA 2C4NA 2HD4A 3B5IA 4RA9B 5TC4A 4NK5A 3GGPA 5J4YA 4LOHA 1B14A 3BDVA 4F1JA 1YGPA 1P2VA 3UB2A 3U7RA 4C29A 2XMZA 2NACA 1Q22A 1XMPA 2BFNA 3TLMA 4P4UA 4EHDA 3R3WA 1NHGA 3ABSB 4EHHA 1B76A 1QYWA 2GRJA 2H4ZA 1RFGE 2ODPA 4BN5A 4G36A 1L4FA 1URPA 2P1DA 3EMVA 3L7YA 4TYNA 2QHXA 1GQYA 1W4LA 1WVIA 2JFNA 4MP8A 3AY7A 3V2UA 1T1RA 3O1LA 2CW5A 1XWWA 3DE4X 3SBEA 3N2NA 2D7DA 2QUZA 1RKVA 4KSYA 2I03A 4Q9JA 4D8VA 3Q3EA 3U3KA 4YIKA 3Q3JB 1XJCA 4A7PA 1VCNA 4YCBA 2IE0A 2NU6B 2WF7A 5AKEA 2GESA 5ALFA 2MU1A 2OBYA 3LW8A 1KIAA 3RVSA 2FFRA 2O14A 1R8JA 2HNAA 1P0PA 2NYVA 3GGJA 3GZJA 4G56A 5KDLA 2O8CA 4S1VA 4U63A 5DBGA 1UJMA 2OP1A 3PSHA 4Q0MA 2NUTA 1QFXA 3TLJA 1RWMA 1V8OA 2CF6A 2HJHA 3ZU2A 1IB0A 2OV3A 1E59A 2X3YA 1L5FA 3LFUA 4LDPA 3FOZA 1P9OA 3PA6A 5JTUA 1S96A 2F64A 3DJFA 3H4TA 4J0IA 1OXMA 4KDEA 4R51A 4RVNA 3SHFA 4GX0A 3TEJA 1U94A 1MFZA 1YULA 3BXPA 1CY2A 3HNOA 3MTAA 3I3SR 4QUHA 5ALGA 4U2KA 1E4VA 2PS9A 4RD1A 5D5HA 5ALKA 4DABA 1O6BA 4GZ5A 2NU7B 4BJ1A 1TE2A 2X9NA 3ZGXA 4EENA 3RVKA 1ZCFA 2OBNA 2PS3A 3HY6A 3V34A 1PDOA 1ZD8A 4YRKA 4CUJA 1OHHD 4Q34A 1ENPA 2YR0A 3H0KA 3CZAA 4MYRA 1H2EA 4G5GA 3CMMA 3IRUA 2QROA 2JCYA 3KYBA 3DEHA 2DFPA 5GVSA 1I51A 1E3QA 1XA4A 3I4FA 3OT5A 2GPYA 3VPSA 2AFIB 2I6FA 3BXZA 2Z6VA 5TT0A 2H00A 4BPRA 4PX3A 4MPDA 1WVGA 1USIA 2ODTX 3LX4A 2HK6A 3PENA 4FU0A 1U2TA 5MF6A 3G1WA 5FPHA 5CHYA 1G7TA 2J6HA 4ANFA 2QI9F 5JIBA 4HDMA 2ZJBA 2PSSA 1UJCA 3T06B 1G7RA 4YQYA 2NGRA 4M1MA 4AX4A 3MCTA 1OGIA 4D9JA 3F3SA 2G1KA 4YGYA 1T5IA 1BHSA 3OQPA 4TXLA 2X4DA 2Q4RA 4EY8A 2V96A 3A0UA 3CHYA 3FYTA 3M1AA 2WAOA 1BGWA 1NFRA 2B92A 4FFLA 1AE1A 1KA9H 1VJTA 1A4UA 1Z2OX 2X4GA 4D9MA 5F2OA 1FMLA 4FHFA 3NTVA 2VQ3A 4OP3A 4CMIA 5IT4A 2BE7A 1X8KA 2C9BA 3MCAA 1Z74A 4IVRA 4X20B 1KFKB 1SO8A 2IKQA 2J3DA 3H19A 3N8GA 1P5RA 2QMHA 3DR3A 2WMDA 5JZOA 3O75A 4MQEA 4XTRA 1R9GA 5AXAA 2XCOA 5BR4A 4PNHA 3RC1A 1KORA 3AY0A 1HYHA 3ICOA 1Z28A 3WGLA 5C1PA 4L8GA 5EE3A 1PGOA 1NVVQ 4FPXA 4OHPA 3RUDA 3UICA 4M38A 1WW8A 4G4JA 2I3BA 1OLXA 4QEDA 3RT9A 4ZZIA 4P54A 3GH3A 3NJ4A 3OPNA 1SVSA 3K8YA 3P9KA 5G0UA 5H4HA 4E22A 2VJBA 3OY7A 2A4MA 1J9ZA 1KJNA 4UUNA 1J0DA 4KYIB 4RH3A 4ZANA 2P9GA 3C3MA 3UAZA 1G7CA 2FW6A 1ORDA 2X7XA 5HKBA 4AQDA 3L8GA 2D00A 1YS9A 2PWYA 4RHYA 2OC4A 3DTYA 2ZAYA 1G5HA 3MOGA 4HDNA 3KVNA 4OBBA 5JSFA 4ZT6A 4RHXA 4ZJPA 2JHFA 4N8SA 2H8GA 5ECWA 3X1MA 3RYCB 3M1YA 1MB4A 1DTWB 4JI3B 2R6R1 2TRSB 1OW3B 2HA4A 2ERXA 3EQ2A 3NDJA 3ORYA 4DSAA 3HPRA 3OLYA 4ZT2A 1Y1KE 4HK4A 2XHEA 1EFVA 2FI1A 4I5EA 3TRJA 1ZR4A 2ORWA 3QJYA 4Z9FA 1AS0A 3ZD7A 2NPOA 1S5PA 3RIXA 4Z4IA 4TVSA 3RFVA 1OC2A 3ODPA 4OQYA 3KJNA 4LUCA 1FP7A 5A7HA 1UWKA 2IF2A 5K8TA 2WQZA 2XNHA 5K0BA 1I4TD 2YZ2A 4ZKDA 3C6KA 1XL1A 1LU9A 1R1DA 3QFSA 1I6LA 3O3MB 4ALIA 5I7WA 5C1DA 5AW3A 5EXTA 4EG3A 3LUDA 1TGYA 2WUVA 5E3HA 1QMPA 2JPDA 3GX1A 4MI6A 3V46A 1ZUWA 5LOVF 2CLFB 2OPHA 3HI6A 8LDHA 4L50A 5B7QA 2Q0XA 2V03A 1WMEA 3MRXA 2ZSEA 3WWDA 1DP4A 1WUKS 1EKXA 2XODA 4ZVNA 1FJXA 3PUWA 4OHWA 4RTNA 3JATA 1R9JA 2KYRA 4Q1AA 4F8EA 2B0CA 4L72A 3UV3A 1CQXA 1TMKA 3SEAA 4NCJA 4TT8A 4TKVB 3L7MA 4YREA 3MWFA 3JQ9A 5KTRA 4I4NA 4GOND 4KCGA 2VXBA 1AUXA 4KGZA 2FR8C 3EGDB 3JSXA 2H1SA 1C3EA 3VJRA 2FP3A 2FF5A 3JVEA 4RNDB 1UKYA 1TVKA 1ZMRA 3ZUGA 5K6AA 4XAQA 4C07A 3AETB 4YT5A 3SQXA 3ML1A 3RSLA 4JLUA 1N8KA 1PZNA 2JJ2A 2X3FA 3CG4A 3WLNA 5G0SA 4CKCB 5JSYA 5AW6A 5LNK6 3IJEB 1I13A 3LNTA 3WGQA 5JECA 2AFRA 4RA6B 4RAOA 1JHPA 3HDTA 2JVKA 5EG5A 4NCHA 4LRXA 3ISTA 1BVRA 1UM8A 4NU8X 2QL6A 4ECAA 1RZRD 2YNMC 3A9UA 4PS0A 4JJGA 4Q1FA 4BB5A 2VAMA 1GGHA 3INGA 1R50A 4ZODA 1REQA 2CDCA 2V5AA 3DBRB 2IWRA 5EJGA 3HBAA 3C87A 4XDHA 3LC0A 5BVHA 3K15A 3LHIA 1EX6A 2V8BA 4MUIA 3R7FA 4E51A 2H5LA 4LZLA 5L6MB 3U61B 4DB2A 1NE7A 1P6XA 2EBUA 2EFEB 4ZI3A 4BAUA 1PEYA 2QRGA 4NYIQ 5BRNA 4LX8A 3ZI0A 4BWFB 4INAA 3UJDA 4FLEA 1M6EX 4FT2A 5EJAA 4HJRA 3WNVA 1U99A 4PRYA 3P96A 4ILEA 1MABA 4QYSA 4RMNA 3DP7A 1UC5B 3KPYA 3SCZA 1KL7A 3C39A 3VSDA 2P2ZA 1E6UA 3EC2A 4EGSA 5I9LA 5HGJA 3BMOA 3D02A 3WGZA 3L05A 1FXWF 1HEYA 2EKDA 2B6NA 1P45A 1B8NA 4BO2A 1MOZA 3OJOA 1RKUA 1EGMB 2XA1A 3EFOA 3V2IA 2KI5A 4X65B 4B4VA 2JGJA 3PNVA 3C7KA 5K3EA 3ONEA 3DNPA 2UVDA 1Y1TA 2LVBA 1HG1A 2AJTA 3F7TA 1OV6A 3NIDB 4C5CA 3RAJA 1QZ3A 2OHJA 2G1AA 1VPTA 1DC8A 2CHQA 4UDOA 4OL9A 3DT6A 2H08A 4XQGA 2OGSA 4GZLA 4ZV9A 1P7VA 2QMUA 1Y7TA 1FYEA 1X74A 4XSGA 3THXA 4ASUD 4NWIA 1CDDA 3GHYA 4EHAA 3BX1A 1I4OA 1TEZA 2ORED 1KGDA 3OEYA 1GKLA 2QTVB 3IAFA 4JHLA 2H11A 4FFWA 4NBTA 1H4SA 3LPCA 4B34A 5JAOA 1ZIXA 3AP1A 4E3ZA 1MC4A 5NLLA 2BFDB 4DSZA 3U09A 5AVTA 1W8IA 3QJGA 2PWBA 4QTYA 2X9VA 5J3JA 1D4AA 1Z47A 2XF8A 4AZTA 2WJ3A 4BQEA 3LGXA 3BRSA 1FYVA 1SZJG 3DE5X 5FDFA 4HRYA 4NFHA 5A5VA 1EVLA 3OH8A 4LI3X 1TYAE 4KYTA 1XTPA 4Q21A 2ZQ5A 4WUVA 5CPFA 3OLCX 4C14A 5LOVB 3KFXA 4V0ME 2Z0MA 3W6ZA 3TFOA 1WSAA 3FNGA 3ZOKA 1QR6A 2EVWX 3LOUA 1RQGA 1U0EA 2NWQA 4RC9A 3I2FA 2COKA 2BP7B 2X9GA 4LRTB 4D44A 1PT7A 5MDHA 4S0ZA 1XZDA 1SVIA 3EF3A 4OOFA 1KZ9A 3C3CA 3M49A 5F1PA 3ZGVA 1OKKA 2P79A 4BFWA 5BR7A 1GNSA 5B58T 1JIKA 4OA5A 4C7BA 2BI8A 2WNSA 1AM4D 2HMWA 4JI2B 1RXCA 3S28A 1NY6A 1Y8CA 2D2XA 4Q4CA 1EK6A 3NOVA 2RG1A 3B7WA 4JL5A 4V0MA 3OBIA 1X15A 5GV7A 2J85A 3MEQA 2P9FA 5KYNA 3OU7A 1OXSC 2R84A 1U2QA 3A06A 1LC3A 3UG6A 4YX9A 5BRAA 4PPYA 2QN3A 3D4IA 1ESEA 3FPCA 5K3FB 3ZHOA 3I0MA 3ZCSA 3TRIA 3PUYA 5JCPA 3E35A 1J9GA 4HTAA 1WBJB 3R0IA 3TM5A 4DQ0A 2OM2A 4PHHA 3VJMA 1ADGA 3EPKA 2O3TA 2FU5C 5DFAA 2IHNA 1U28C 2GZSA 1XRSB 1AB6A 1U8TA 3OSZA 3TL6A 2QAGC 4M3NA 3EFHA 2DE0X 2QF7A 1M1UA 1U0OC 4UHHA 3WZLA 4CRWB 1R5NA 2V6JA 5LYJF 3DOFA 2AGVA 1SBNE 1LFAA 2JIQA 3KLOA 4XWWA 4KE8A 2IE8A 1OA0A 2JRCA 4NULA 4OOEA 1ZOPA 2GOYA 3OO0A 3QGMA 5FO1A 1GL3A 3C6XA 1QJ4A 1W30A 2I54A 3PEVA 2D0PB 2HYDA 2JI6A 2PXCA 5JV5A 1ILEA 1FYDA 4PTLA 4JOSA 1GA6A 3WMEA 3LSTA 2ILTA 4D46A 3UPUA 1JDBB 1WOMA 1X38A 3FXAA 5B1SA 1HYQA 3A2LA 1RYHA 4Y2QA 4CV1A 2AYXA 1KH1A 3PDIB 4E5UA 1E92A 3LDHA 4V0KA 3UTCA 3UXMA 3A32A 2XMBA 2FQ1A 2GERA 2LR0A 5ELMA 3K71B 1BA3A 3G23A 4DLKA 3N2LA 2RAPA 5DTRA 2B78A 3T5TA 3BH6A 2AOWA 4QGFA 5KYXB 4LRQA 1USKA 4HBGA 1OAKA 1ZJWA 1KZ4A 2VLBA 1DCFA 3B2NA 3BMXA 2MINB 2COEA 3SQLA 1OBVA 1R4NA 1ZX1A 3AF6A 2QN9A 4Y0VA 3DZFA 1YB2A 4GQIA 4EUFA 1PNQA 4X8LA 3K94A 2WNHA 4N3BA 3F6PA 3BXXA 2H1OA 3WYAA 3KCNA 1FDTA 4RMIA 1JWAB 2PANA 3OZTA 4GOXA 2PZLA 3GFFA 1E62A 2BFCA 4M9CA 5DN9A 1R6XA 3UYLA 4F2GA 4MVJF 1SA0A 1XTZA 2GASA 1XZPA 3EGIA 2PO5A 1H8HD 3KHUA 3QVSA 4XVRA 1YMVA 3WGYA 1B73A 1OV4A 3O9VA 1RLJA 2QUBA 2CVQA 3RBVA 1G66A 2V7QD 2I2DA 4N5IX 1XQYA 1WW3A 2VOEA 4BFSA 4N76A 1TM4E 1SQ5A 5AQ1A 2XA9A 1DUIA 4YEDA 1N34B 3WXBA 3NANA 2J3EA 1DAEA 2EEPA 2QY9A 4ITUA 3SC2A 2ZIAA 5HF8A 5TQ0B 5DT2A 4CCYA 2BGTA 2EG9A 3A0RB 4BFLA 3TPFA 4EL0A 2GEJA 4HEA6 3IAUA 1COZA 5E1MA 2R68A 2BMVA 3QPCA 1JDZA 2QN8A 3HN6A 4PN3A 2IY9A 5AI0A 3L1JA 3R7BA 2O1SA 5JH7B 1FFEA 5L7WA 5LJLA 2IVZA 3ZVNA 2FMKA 1WPGA 1XD8A 3MJRA 1EZ4A 2GAFA 2FQQA 3EZYA 2VF7A 2R3SA 3AB3A 4CMGA 4ZYWA 3L4BC 4QOFA 2OFWA 1RADA 2E7ZA 5AKKA 2HN9A 3I61A 5FB3A 1QCDA 4LKRA 5D1HA 4IO1A 4PQYA 4K8RB 2P68A 3RANA 2G17A 1SBCA 1IK4A 3LDGA 5KQRA 4OAOA 3WLKX 3A4NA 2JCBA 4YCLA 4TL8A 5ECDA 3TXYA 1W93A 1ONBA 4DCVA 4DN6A 4Z1OA 1YQXA 3SSMA 3UTDA 1EFUA 4URYR 2QP9X 3AERB 4ND1A 4KXVA 4MRMB 1DO8A 3JZMA 4L9SA 3ZY5A 1HKUA 4CTNA 1PR6A 1TEXA 1FA9A 2J4DA 3O7WA 3QMPA 1STOA 5T5QA 4ZEVA 4EMUA 4KQEA 4DA4A 3ZHBA 1L5MA 1PT9A 3PR3A 4UM8B 3DM9B 3RS3A 2WM8A 1OH8A 4ND8B 3WB1A 2LKCA 4EPWA 2IHTA 3EARA 3JQ7A 1J0EA 5LYJB 5FO0A 2Z1MA 4KDCA 4RLFA 1YASA 2V65A 1U0TA 1T36A 1BH2A 3C8MA 4LHSA 4B74A 4E5SA 5BXQC 1WPRA 3CEMA 3ODGA 3ZWNA 3UWOA 1VBMA 4JP3A 4TV9F 3PZRA 3NM6B 3TWOA 1P2DA 1RRCA 2BGUA 3IULA 4X3OA 3U3DA 3DV2A 1TK3A 4ZTZB 3E7XA 2F8MA 5MN4A 1NBOA 1HNNA 1UXOA 2WF6A 5ENDA 4X8MA 1VZ2A 4V38A 5F3RA 3SG0A 3F46A 2R6AA 3CZ4A 4OA8A 2QMYA 3DEIA 1DRKA 3DYVA 4LJ5A 1CSEE 4QQKA 4QQFA 4UW9A 1V7CA 4BQNA 5J1SB 2V1XA 2RH9B 4JROA 5CEFA 2MSWA 3ZIAA 2UU9B 1KVQA 2QN6A 3BIWA 1RACA 4KAXA 2PGJA 4AMBA 4GOKA 1QVAA 4KLAA 3M2PA 3M9WA 1E9VA 3LK7A 1XTUA 3RT7A 2VDUE 1T0HB 2MWMA 2BBSA 2ZSAA 9ATCA 5FEMA 1C3XA 4AZSA 4UAUA 1NA5A 2OK8A 4AMUA 1ANKA 4MHSA 2YASA 4RVFA 5LQMA 2AXPA 2BFFB 3BRWD 3NC0C 4TXMA 1EVIA 2O4UX 5EXPA 2VUHB 3G5UA 4KW7A 4JVMA 4NBUA 2VQSA 2UVPA 4X1YB 4N47A 1KARA 2EIXA 4Z49A 3RG8A 1KAOA 5B1DA 4AIRA 1YZ3A 4WZBE 3RBZA 5BN4B 3PFBA 3A36A 2EZUA 4RQAA 4NBVA 4U3JB 4WKBA 4LGCA 3L4SO 3DSRA 3QW4B 4JBYA 4OQFA 4W5JA 2O8FB 3ZHZA 1H6BA 5ECYA 3DBHB 4B3HA 5FHRA 3VX4A 4CM4A 4NI5A 5HRAA 2ZROA 3GJXC 4JQOA 3T5GA 3NCHA 2GYWA 3SBOA 4Q48A 4F46A 3OICA 3FFXA 4R1OA 4M1YA 1TRKA 4RTOA 5FUBA 1M6VB 4HQRA 4WOBA 3GP5A 1MEJA 1M6WA 2WFLA 4QU9A 2LE0A 3OZ7A 4WZBA 4DYVA 1ZZGA 1L8AA 3HP7A 3K4QA 3AIOA 3E3OA 2P9ZA 3LPLA 4I4IA 4KQ6A 2PGAA 4MJ3A 1L9KA 3OM9A 5F33A 5BN5A 5TE9A 4DIEA 3KKMA 3RSHA 1EUCB 3WBKA 4MW7A 1QAMA 1IEWA 4ALKA 3ZVMA 2AZTA 4HYYA 5LB4A 1F0NA 2P9YA 4J91A 5HIAA 2DF8A 3VVMA 5FNVF 4RGVA 1AN0A 3E82A 4E13A 3RF7A 5JVDA 2QXTA 3WE7A 5ED4A 3L40A 1X7ZB 3FFWA 3ZU4A 4MUHA 2JAQA 5TRTA 2YWHA 4ZOEA 5FTMA 3R5HA 3GJTA 4OJKA 3IEPA 1YGYA 4IEIA 3NDRA 1QRDA 4FJ1A 3LDFA 2VJYA 1JBKA 2OE2A 4XSHA 2E4AA 4N18A 4RO0A 3RS8A 4P32A 4EHNA 5LOVA 3LTNC 4HFMA 5ETJA 4OMFG 2JG3A 1KSFX 5E2AA 1WNFA 4BN4A 1FK8A 2OYRA 4R1LA 1G3IA 1PWHA 2P4SA 4MRNA 3RH0A 2FCRA 1P3Y1 4J7AA 1Q1QA 2ILVA 3AHFA 2P6RA 3DVAB 3CS3A 3I6BA 1JQAA 3V7UA 1MXFA 1M34A 4RBNA 1EMDA 3PX3A 4KN6A 3IILA 4YJ3B 3SS7X 1XNQB 2PUTA 3CH6A 2JD2A 4G25A 4XUEA 3HJUA 4GH5A 3EFBA 4K2HA 1GCIA 3AFOA 4AJIA 2F55A 4M22A 4YHHB 2E89A 3B6EA 2RI0A 4EG1A 3U7FB 1ODLA 2Q1WA 4TV9B 1JHYA 1P9WA 2CXHA 4ZVPA 2VSQA 5FADA 1YONA 1QVVA 2WSYB 3BHNA 3PB3A 3FNIA 4MB0A 4JNCA 6Q21A 1NMSA 3T9DA 5D5PA 3OEHD 4J1QA 1YFLA 1KIFA 3TLXA 1D4OA 5C4GB 5C8XA 2ZTLA 4B3MB 5H9VA 3MJHA 3DHYA 1E7QA 4QDTA 1KC1A 1FJGB 3IPRA 1Q2UA 1XCMA 2WU3A 3URKA 4EATA 5AKIA 2IKSA 4M0DA 1ZI8A 2JK0A 2O23A 4IQ0A 4OGKA 2ZT8A 1F1BA 3TIGA 3LMKA 3NEPX 3EXHA 2WTBA 3ONFA 1X7GA 1TJ3A 2H51A 4DIKA 4PG5A 3JQGA 4F3RA 2OV8A 3OPQA 4P0TA 5ITZB 1AQ6A 4NESA 3WVNA 1XUOA 3I04M 1XVIA 1T2FA 2GAAA 1QHXA 3H9JA 3AQ4A 3CZCA 5AVRA 3OZUA 2RD2A 2HA5A 3M1LA 2RGAA 1DRWA 1RJEA 1YACA 1CJBA 3HCBA 4I46A 2VKTA 4MEJA 3C97A 3PNYA 3ZHSA 1W581 3PUJA 1BXRA 1G7SA 1LF0A 1NJFA 4PCUA 5DGDA 3K92A 2RE8A 4DKJA 1U80A 4ZD6A 1TMYA 2XE8A 3W06A 3FKSA 4G23A 3PGXA 3TECE 3UUFA 2Z5LA 1OI4A 1H0RA 4IAOA 3RHSA 4JLWA 1DAGA 3ECCA 2WSMA 5KCMA 1KYIA 2P3SA 4WKOA 2WY2D 3MT8A 4M7PA 5EIXA 1ORHA 4YQZA 1T9GS 2ZIFA 4LHVA 1BQ3A 2XITA 3W77A 1GAWA 4BYGA 3T7TA 1EVJA 1ST2A 2A5FA 1I4DD 4NZYA 3TSOA 4JASB 1S0UA 3LOPA 4H7EA 2GN4A 4DV0B 4B7ZA 2NP6A 2AOUB 3LT4A 1L3IA 2GPWA 4KSBA 2L42A 2ZR0A 3AM4A 4L5CA 1WEHA 2AR0A 2D1TA 5TSDA 3EEQA 2Z6UA 3WSWA 4UOQA 1X70A 2ECQA 1NJGA 2XTMA 5B36A 5K0ZA 4Q6WA 2GKSA 4BFCA 1FP1D 3ANSA 3HQ4O 5K4HA 2IY7A 2R6CA 4RM2A 2ZYIA 2QQ0A 1T13A 4OHUA 4B6SA 1PGNA 1LS6A 1OFIA 4FW8A 4D02A 5GGXA 3DCYA 4JLNA 3VNSA 3I2IA 1EK2A 1Z4LA 1GITA 2O8VA 4WNIA 4F9FA 4C5AA 4BGDA 4IHQA 4D79A 1KQFA 3T9AA 2DVMA 8AT1A 2W7TA 2CJXA 3HC7A 3LG2A 4MS1B 4XCQA 5DK6A 3W4IA 4J76A 1P9NA 4HLNA 4M7OA 2V7UA 2RMKA 1QGZA 1M2OA 5IJXA 5TEWA 1Z45A 6REQB 5I3ZA 3W9BA 4AN4A 1UZMA 3UWSA 1GAJA 2ZIXB 1C2TA 5FCDA 1ESNA 1H8ED 3V1TC 1NMXA 7AT1A 4LZWA 3F7NA 3NYQA 4WFKA 3P9SA 3TKYA 4A6XA 5AUPB 4TS3A 2JJ8A 2JJ1A 1P2SA 2A9PA 1TECE 3DWGA 1Z7EA 4LDQA 3KVOA 2VEDA 2ZJAA 5KJCA 1ZZEA 2GCNA 2DHQA 4XZ3A 4AMZA 5KYWA 3UK2A 3EPJA 3DF7A 3INRA 4LE0A 1BC5A 2PAAA 4G5SA 4LYHA 2XRZA 1E94E 3GUCA 3H5IA 1C0IA 4MEBA 5LLDA 2F9MA 2J3LA 3CRMA 5TF0A 1Z6AA 1VCMA 1SUDA 4YB8A 4IDOA 3GQBB 3SQDA 4B46A 4Z4GA 2A58A 2PSEA 2I3DA 4WADA 4ZVMA 3UZUA 3THWA 1B4DA 1RXEA 4NEQA 3FLBA 1DXYA 2G25A 1E9EA 1YZVA 4DR7B 4RLQA 1TQ8A 4IIXA 1W4BA 3DMYA 4LSZA 4O4IF 1N25A 4QFDA 2B8JA 5BWLA 3N5KA 4TTVA 5JXHA 3MD0A 1N9KA 4XFJA 1I8TA 1LLQA 3CNQS 2IP2A 4NQRA 3OT1B 2EWMA 3QUBA 4XPZA 5ICSA 3BXOA 2PBZA 4C03A 2PMWB 3QVTA 3RE1A 4D9GA 1J25A 3TG2A 1VJDA 3NBKA 3IVRA 4TZTA 3VZPA 4NJEB 5KYYA 3S8MA 4H6VA 3ZV5A 3SM3A 2Y9PB 4M36A 1AURA 1UFQA 4P84A 1M2FA 3A9WA 1EXNA 3KSRA 2EIHA 4F5ZA 4ZYVA 1ZGCA 1H4QA 1O96A 4X64B 3JYHA 3SXUA 2J4CA 2G04A 1KFEB 2PX3A 3B1KA 4ONEA 1CR2A 3RQIA 1VIMA 3GVPA 2ZTVA 1E4EA 4C7XA 1C29B 3QEKA 1ZD2P 2J08A 5I7AA 3GDHA 4LWOA 2ADOA 1MFPA 3ESZA 2CDNA 1DX9A 4BP8A 1PLKA 1FX0B 2IT1A 1G38A 3BJIC 3KR2A 4HSEA 2B1RA 2EX4A 3A6GA 3AQIA 3REQB 4GLJA 1OWLA 5JE8A 2R8XA 3KQOA 5A4FS 3NNSA 5CD1A 2RAFA 3P8ZA 1LTKA 2PMEA 3WXMA 5K45A 2CFCA 3HCAA 4REQB 3FNHA 4JYBA 1A2BA 2YTZA 3MRSA 5ICEA 1JG4A 2QG9A 4IV0A 4Q4LA 4JB0A 5IJWA 3SM9A 2BRUA 3WSTA 4KQCA 4Q9KA 1U3WA 2J32A 4RV4A 1C7QA 1VKZA 2F62A 2VH2A 1ECCA 4FN5A 3U0BA 4JSYA 2ZUWA 3UAGA 3O8DA 1A2OA 4M1KA 4OV6B 4ARIA 3KT0A 1U3TA 2XCRB 1MO3A 1J0CA 1GNRA 4TN1A 1N0IA 3I9V6 4KR2A 1JHOA 1MQ9A 2C00A 2VHJA 5B5SA 1HNXB 4TV8A 3CVXA 3ZV3A 2JLSA 3GLQA 5FD8A 5HCNA 4CLOB 2VXYA 3LBAA 4CDMA 3S2ZA 4EYOA 3SJUA 2JCXA 3CTMA 4M1QA 5JWHA 3WJ7A 2LDBA 1R5OA 1P9LA 3EA4A 4ND5A 4INPA 1CZLA 1XELA 4Z51A 4HLDA 2EP5A 4F7DA 4ND3A 3D54D 1PT8A 4PLWA 1Y9EA 1V0JA 3FPHA 5CGQB 1H2AS 1XDGA 3FWPA 4QFCA 3QU9A 3D3WA 2C83A 1JF8A 4ZAVA 4AC9A 2AE1A 1JKIA 3HZHA 2A86A 2HA2A 3K20A 5AK3A 5C4IA 4BBJA 4AW9A 2VRWA 4E31A 5C34B 4LA4A 3QBJA 1U3DA 3DAGA 5ITVA 2NPIA 4DDUA 2HHJA 2Q3MA 4HWOA 3GLKA 2YVUA 4OI0A 4N9QA 3A26A 4X8HA 3R7WB 1AKNA 3P5SA 3QITA 5ALWA 3G13A 4JIMA 4R9RA 3PK0A 1A98A 2QLJA 4DNPA 2XQIA 4IHAA 2LP4Y 1RM5A 1NR5A 3IQIX 1E32A 1YE3A 2VRCD 3OZDA 3QOWA 4LVCA 4WACA 3AV0B 3T34A 4YRBA 5I7UA 4P08A 3E61A 2X5NA 3WDSA 4RF5A 3R5XA 2VZEA 1ORVA 3L92A 3MZ0A 1DLIA 1QYXA 4YXWA 1ZCZA 3EF0A 3HKDA 3MMNA 4LQ4A 1GGKA 1ZNWA 1V8PA 1DG1G 3AUYA 3DOOA 3HKBB 1W0JD 3IELA 3CH5A 3PT5A 1KQGA 4NOJA 2JDIA 1AGPA 3LUBA 1KJWA 1IY1A 2VT3A 5CIWA 4NS4A 4NHEA 1LDBA 2W5UA 3EEBA 3QKSA 4IJWA 4O4IB 4QWMA 1JSRA 3TUZC 1G8AA 4H1UA 1Z35A 2IU0A 1NVKA 2DWPA 4PY2A 3RVDA 4CW7A 2PUWA 2X77A 3RWMB 3LDAA 5J58A 3OUUA 3PD0A 1X0XA 4M8LA 4P34A 2O20A 3O5AA 1D0IA 4BZPA 5BWOA 1XZAA 5CT4A 1LJ8A 3NBYC 4RKEA 3A1DA 2AC7A 5LWQA 3AKDA 4PX5A 4RK7A 3RF6A 3M6WA 3IQHX 1L7MA 4JT4A 4RU1A 5JMTA 3JZFA 4K3VA 4KBYA 3GFVA 3IP3A 1WTCA 1V37A 2R7NA 4JUBA 3VTZA 3H6GA 1RNLA 1YB7A 1T5OA 3P0RA 4JBWA 2CD7A 5KSPA 5IVPA 5LP6A 2P91A 5M04A 2LUOA 2VP2A 3BULA 1SVNA 1ZGGA 2V5UA 3OZBA 4FB4A 5IXSA 2NSJA 2AQ8A 1SKAA 4DMCA 2Z57A 4MUJA 2PGDA 4WECA 1WDKA 3C6MA 4JB2A 3RNLA 4D9KA 3NIWA 4TMXA 2ZI3A 1NVDA 5J43A 4Q3BA 2VPWA 4J0JA 2XUIA 4NFYA 2CYBA 2BPOA 1XF1A 3TAUA 1R3UA 1UBMS 3U17A 2Q8PA 4ETMA 5C9ZA 2QE7A 3DB1A 1IIRA 4MYCA 5KWVA 3N0WA 4NONA 2DQZA 4N9WA 3SR3A 5E6SB 4X1KB 1BJTA 3UBTA 1OLOA 2A94A 4P81A 4B73A 3KYDA 3KSAC 1NSTA 4D9BA 2ACVA 3OWOA 4U1RA 1CDEA 3NDIA 4QICA 4L5BA 1E9AA 3K9CA 1MXHA 4LVNA 3LLSA 4XRGA 2ECFA 1KI6A 2GO1A 4M86A 1RI1A 1ZRMA 4H2DA 5EVJA 3GCWA 2OXEA 4K6KA 4LGVA 1L5WA 4UCFA 5EYPA 5EZYF 3VO8A 3EXG2 5AVKA 3WZMA 4CM1A 1PNRA 1Q7TA 1MHPA 2GPNA 4C2TA 5IHXA 1HY3A 4HYEA 1WSBA 2CXOA 4KFCA 2B35A 3ADPA 4HO1X 5IUKC 2QUAA 5I3CA 3OLWA 3RKSA 1G21E 4MV7A 2GD0A 4AZ0B 1TEVA 4FYVA 1YI8A 4GQAA 2VCEA 3PHBE 5JY6A 5LP6F 3P9PA 3FWHA 3SHVA 4M0EA 2VXOA 3DLTA 2AVNA 4FI3C 4KLNA 2PZMA 2EKQA 4NJMA 3R40A 5P8WA 2CSUA 4K6MA 4DYDA 2FV8A 1OZFA 1EUDA 5HFNA 3PQ7A 4LF5B 3EZGA 2PTHA 1E6CA 1HFJA 1G21A 1JW9B 3DTVD 3NQ41 4RENA 2BKXA 1XTRA 3CEAA 4WXEA 2C5HA 3GJ5A 2P6OA 4IXWA 5A1TA 1BU8A 5J4KA 1GTL1 1VXOA 2WTAA 1Y3BE 4K7JA 4H4DA 1QGOA 4X62B 4W5NA 1MH9A 5KS2A 5KYKA 3UM9A 4Z7JA 1LSUA 1JKJA 1U2GA 2HLDD 1LQTA