3VBOC

Crystal structure of formaldehyde treated empty human enterovirus 71 particle (cryo at 100k)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
239
structure length
239
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
molecule keywords Genome Polyprotein, capsid protein VP1
total genus 40
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vboC00
1R1A1 1AR83 4NWVA 1QQP1 1RUC1 2TBVA 1NOVA 3JD72 2GH8A 4RS5B 5CFCC 4GMP1 1PVC2 1OOPA 1X33A 2HWD1 1ND2B 3CJIB 4CDXC 3ZFEB 3ZFFC 1ND2A 2RS53 4CDXA 3CJIC 1RHI3 2HWD3 1MEC1 4QPGC 5BNOB 1VRH2 1HQNA 1HX6A 2FZ2A 1R093 5CFCB 1VBC3 4RS5C 1RUH3 1COV3 5BNPA 1RUF3 2X5IC 1NA1A 5ABJA 1AR92 4WM7C 1NCRB 1PVC3 4GB33 4AEDC 5ABJC 4WM7A 1VAKA 4FTSA 5K0UA 1H8TC 2WS93 4AEDA 1RUE3 4CEYB 1PGW2 1AUYA 4SBVA 2HWB3 1AYN1 2RM21 3VBSC 1ND3B 1AR82 1VBB3 4CDWB 1CJDA 1FOD2 1VBC2 4AEDB 2WLPA 4WM7B 1V9U2 3VBUB 3J8F3 1HRV3 1RVF1 1RUF1 2ZTNA 2HWC3 1PO11 5AC92 5C9AC 1ASJ3 2RR13 5JZGA 4Q4W3 1F8VA 1QJU2 1RUJ3 3TN92 1QJX3 1B35B 3ZFFB 3ZFEC 3TN93 1R081 4CEWB 3ZFEA 1K5MB 5A32A 1EAH2 3S6PA 2WZR3 2Y26A 1POV1 1C8NA 1TMF1 5AC93 4YVWB 1TME2 4N53C 4QPIB 1CD3G 2BPA2 5C8CA 1R082 2BFUS 4FTEA 4WM8C 5J98B 3VBRB 2R072 4PDWB 1QJY3 1AR73 3VBFA 1M06G 2XBO1 5C4WA 2ZAHA 2HWC1 5C4WC 3VBHA 4RHV3 3JBG2 4N43B 2HWF1 1RUE1 5ACA2 1PO13 4FSJA 1QJY2 1WCDJ 1OOPC 2R071 4QPIC 5C8CB 2PLV3 4IV3A 1FPN1 2WFF1 1NY71 1R1A2 5L7OA 4Q4X2 1K5MC 4CEWC 4Q4X3 1B35C 1RMU1 1VBB1 2RS32 1MEC3 2R041 1Z7S1 1FPN2 2PLV2 2WFF2 1MQTA 3JB8A 1NY72 1PGL2 1NA1C 1MQTC 3J8F1 1VBE1 2HWD2 1NCQC 1EV11 1ASJ2 2RR12 1H8TA 3VBUC 2RM22 2MEV1 3VBUA 4RQPA 1D4M2 1PIV2 4RHV1 2HWE3 1C8M2 4RQPC 3J8F2 2BBVA 5A33A 1VBD3 4N43A 1V9U3 1ND3C 3M8LA 1RB8G 3VBSB 1FOD3 5BNNB 1DDLA 4CEYC 1ZBA3 1H8TB 4YVSC 5BNPB 1PGW1 1HRV1 1RUD3 1RVF3 4YVSA 4GMP3 1COV1 4RR3A 1QJU1 3NAPA 4YVWA 4Q4W2 3TN91 1AR81 5JZGC 1EV13 1VB4A 1RUJ1 1AR61 1VBE3 2RMU2 5CFCA 1HRV2 4CDQB 5BNOC 1COV2 3ZFFA 2GSYA 1HRI1 1TME1 1RMU3 1RVF2 1RUD2 4CDXB 3NAPB 1ND2C 4RR3B 5GKAC 3CJIA 1OHFA 1BBT1 1AL21 1RHI2 4Q4V1 1AYM1 2QQPA 5BNPC 5D8AC 4RS5A 1VB2A 3VBHB 1RUD1 2X5IA 5D8AA 3ZFGB 2IZWA 1RUH1 5ACA1 1AYN3 2BFUL 4GH4B 1PIV3 5DDJ1 3JD71 1NG0A 1AR63 5K0UC 4RQPB 1PVC1 1ZBE2 4Q4Y3 1RUH2 4IV3C 5A33B 2R073 1VRH3 1RMU2 2RS31 2XBO2 3DPRB 4CDUC 1BBT3 1MEC2 2R042 1Z7S2 4IV1C 3VBOC 1MQTB 1ZBA1 1VRH1 2WZR1 1ZBE1 2RMU3 2RS11 1VBA1 1QJY1 1PO23 1VBA3 2BUKA 3JD73 3HAGA 1PIV1 4IV1B 5ACA3 1BEV2 2HWE1 1OOPB 5L7OB 1IHMA 2MEV3 5FMOL 1RUG3 4IV3B 2PLV1 1AR72 4N43C 1FMD3 1PGL1 1W39A 1Z7S3 4RFT0 5C4WB 1C8M3 4CEYA 1V9U1 1D4M3 1RUG2 2MEV2 1GFF2 1AR71 1D4M1 3VBFB 1C8M1 4PDWA 3VBHC 4NWWA 3VBRA 4YVWC 5FMOS 4GB31 1RUI3 2WFF3 1QJX2 1AYN2 1RUG1 1QJU3 2WS92 2VQ0A 1TMF3 1PO22 5CFDC 2XPJA 5BNOA 1AR93 1HRI3 2FZ1A 3FBMA 1VBC1 4Q4V2 1AYM2 4QPGA 5C9AB 1BMV1 2RS51 1PO21 1FMD1 5JZGB 2R063 1ZBE3 2RMU1 3VBOB 5FOJB 5DDJ2 4LLFA 3DPRC 4CDUB 4CDWA 1HRI2 1NCQA 1RUI1 5BNNA 4CDWC 5BNNC 1RUE2 3VBSA 3ZXAC 1R083 1NCRA 1ZBA2 5ABJB 2WZR2 4GH4C 1HXS1 1NCRC 1EAH3 4Q4X1 3JB4C 5LK7B 3ZFGC 2DF7A 5D8AB 2X5IB 3ZFGA 1NCQB 1RUC3 1NA1B 3JBG1 2HWF2 5C9AA 1X36A 1A6CA 1VBE2 2RM23 4QPGB 4RR3C 3NAPC 2HWF3 1QJZA 1EV12 1ASJ1 2RR11 2HWB1 1AR91 3IDEA 4CDQC 2RS12 1FPN3 4CDQA 4Z92B 1SMVA 1VBA2 5CFDB 5C8CC 1VBB2 2ZZQA 4Q4V3 4N53A 1AL23 3LOBA 4BCUA 2HWB2 1POV3 1VBD2 4YVSB 2R061 1F2NA 4Y4YA 1QQP3 2XBO3 1BEV1 1R091 4JGYB 4GB32 3VBFC 2HWE2 1OPOA 4PDWC 1QJX1 3VBRC 2WS91 4WM8B 1POV0 4Q4W1 5DDJ3 4QPIA 4RHV2 1VBD1 1RUF2 4JGZB 4N53B 1AR62 2R062 5AC91 1R092 5CFDA 5A32B 1K5MA 4CEWA 1BMV2 5L7OC 2RS52 4CDUA 1B35A 2RS33 1FMD2 1AYM3 3VBOA 5J96B 4Y5Z0 1FOD1 4GMP0 3VDDA 1AL22 1RHI1 3VDDC 4IV1A 1R1A3 1E57A 1BEV3 1TMF2 3VDDB 2RS13 1RUI2 1RUJ2 3DPRA 1PO12 1AL0G 3JBG3 4JGZA 2HWC2 2WWSA 4EJRA 4Q4Y1 4JGZC 1ND3A 1HXS2 1QQP2 1RUC2 1BBT2 2R043 1EAH1 4GH4A 1HXS3 4JGYA 4FTBA 1TME3 5K0UB 4JGYC 4WM8A 4Q4Y2
chains in the Genus database with same CATH superfamily
3MIFA 5A3PA 1O8SA 1UU5A 1ODMA 4LKEA 1QQP1 4LBOA 5A3MA 3ME2A 3VL9A 1X9PA 2OIIA 2CDPA 1KFUL 1LESA 2PHWA 3WF3A 5I0SA 1W8UA 4YLZA 4LNVA 3UETA 1ULGA 1OLME 4GMP1 3UNPA 1X8EA 2D5FA 2ET7A 1NQDA 4KMQA 3B9IA 1Y3TA 1VR3A 4CDXC 4QKNA 2AH2A 1ND2A 1QOOA 2FCUA 1NAEA 1U5YA 2B9UA 5B4NA 1XE0A 2VO5A 1L7LA 1A78A 1MEC1 3ACFA 4AAPA 1EY2A 3WINE 2WNEA 1W9TA 4Y1VA 2BBAA 1W2AX 3NNGA 3SKJE 1W8OA 4UF0A 1G9FA 3B93A 4W8JA 1RUH3 1XNDA 3MFCA 3H9AA 5FZDA 2DFBA 2X5IC 4DMIA 2DV9A 1Y9GA 1RJ8A 5GLTA 3UGFA 1NA1A 3HBZA 4IXLA 1DGRA 3NQHA 1OFNA 4KGGA 3PVNA 2JE8A 5ABJA 4P9WA 4WM7C 3ZYIB 3VV1A 3ZOIA 2QDNA 2JD4A 5HV4A 5JR2A 4O9GA 4M00A 5FOBB 4LUKA 1UX6A 1CAXA 3KGLA 3NJYA 4S2GA 2ZACA 4YM2A 2WDBA 4CEYB 4EN6B 2FD8A 5HCHA 4M4PA 3LF7A 4SBVA 2ATFA 1RINA 1VAMA 2HWB3 2QZ2A 3K4ZA 3WUCA 5FZBA 4DXSA 5FZGA 5KC6A 2YUEA 1AR82 5L73A 4AEJA 4AR2A 3BOWA 4FI9A 5LK5A 4NHYA 2P17A 5IK7A 1W8NA 1S0CA 1RYYA 1FXZA 4PIZA 1PGSA 1VBC2 2P3JA 3BTZA 4B4PA 5G04L 4ORFA 5A7QA 1J58A 2Z42A 4U2AA 1NLSA 2EXJA 4AI3A 3F95A 1OSGA 1BK1A 2GU9A 4RL7A 3SKVA 3VBUB 1JOJA 1O3RA 1LOFC 3M3QA 3GBWA 1YHFA 2YU2A 2K9ZA 1HRV3 3IPVA 3POSA 2VUCA 5DUWA 3AMQA 4P5HA 1F5JA 4O65A 4KG0A 5F3IA 1ZRDA 3N9QA 2F4PA 3RZMA 3NVCA 4QX5A 2A3XA 1FV2A 3VKMA 2ES3A 2W92A 3O1SA 5DUXA 1F8VA 1JXNA 5CZKA 4HVQA 3OGJA 2ZMNA 1RUJ3 2VECA 2OPWA 5JVVA 5E89A 3TN92 2XL9A 3WW4A 2BRTA 3H8UA 1H8VA 5CAZA 2W68A 1JI6A 2GNBA 2B8MA 1R081 1WBFA 5IT6A 3AXDA 5FZ7A 4TLGA 1EAH2 4KH9A 4GWJA 4AYUA 2GC1A 4XFHA 4Q0SA 1TMF1 5GLWA 2D6NA 3HT1A 3NNLA 5AC93 1UOGA 4LORA 4N8MA 4N53C 1XRUA 1GZ9A 1WW6A 4QB6A 4MG2A 5JOYA 2BFUS 2EF6A 4WM8C 2CV6A 2DFCA 2J7MA 2C26A 1OKQA 3PJQA 3VBFA 3THCA 3RYRA 3ZXJA 1J1TA 5FMBA 1Q3EA 2WYSA 3VBHA 2WA4A 3ILNA 3JBG2 3T30A 3H8XA 2HWF1 3AMHA 5FZ8A 1DYOA 1PO13 3U10A 5GZCA 3KV5A 4I09A 3VHOA 1T6GC 4EV0A 2LUWA 1WCDJ 3HT2A 1YQ6A 1PMJX 4AVCA 1WKYA 2TUNA 3POBA 1GU3A 3P3PA 2B46X 2VQTA 3U75A 1FPN1 2GDFA 3FJSA 1R1A2 3MICA 3ZYPA 3K77A 4A4AA 2D6PA 3OUHA 3AYAA 4Q4X3 2YFZA 3FZ3A 3M3IA 2CWMA 2ENRA 2PHRA 1RMU1 4E2SA 1XNCA 3WNXA 2GN3A 3BB6A 4R4XA 4TWTA 5FP3A 4BM8A 4K20A 4CCDA 4AEKA 2R041 3JB8A 1MACA 4LO5B 1MR5A 4AHWA 4DINB 3RQ0A 2ZA9A 4DUWA 3WDUA 2Q8DA 3IIAA 3A7QA 2NZ9A 2AC1A 1I9RA 3WQ0A 2PHFA 3DL3A 3EO6A 1G86A 2SBAA 2PELA 5DPNA 5HPOA 2XVKA 2BVBA 2JD9A 3NJXA 4AOCA 2OW4A 1A3KA 4FPEA 4HN1A 3VBUA 4YARA 4LA2A 1VJ2A 4RHV1 1UZYA 3PIJA 1U0AA 1FNZA 2BBVA 1D7PM 4ES8A 4A3XA 5A33A 2FCTA 2FCVA 4I0WB 4OLLA 3WY6A 1OLQA 4A44A 1W6PB 4XFIA 1R1ZA 2G19A 3ALQA 3JCIA 4Y4RA 4RGGA 5IVVA 1A8MA 2VCBA 3C2UA 4AHZA 4CEYC 1DDLA 3MZHA 4YM0A 4LOTA 2VNVA 1OMIA 1LOFA 3J26N 4ET7A 1SLLA 2NQYA 1H2MA 2JX9A 4RA0A 2WAAA 4RR3A 1IZ3A 1SFNA 3NAPA 4YVWA 2X53S 2IXKA 4LBMA 3T0BA 1AR81 4AVSA 5A7OA 3OF1A 5IAXA 4UF0B 4AQ6A 2ZGTA 3PMSA 5LEJA 4D0QA 4FVVA 1HRV2 2PHDA 4UW3A 5FPLA 3WQ7A 3ZFFA 4PIYA 1S0GA 2QJVA 2GSYA 3HMYA 1TME1 3ZXLA 3NV3A 1RJ7A 3VB9A 3V0BB 3RZGA 3K75B 4BLIA 3D0SA 4RR3B 1HV0A 3CJIA 5CIRA 5GKAC 4AXOA 4FQZA 4Q4V1 4OUMA 1AYM1 3IDAA 3I49A 5FCCA 3IIIA 5BNPC 2D6MA 1WW7A 1NXD1 1ULDA 1AXZA 2WN2A 3LEKA 4CU7A 2X5IA 2IZWA 2VTXJ 3RPQA 1W6QB 4FPKA 2YBPA 4M4RA 1W2OA 2BFUL 1QH7A 4GH4B 1O5LA 4LO6B 1W6NA 2ZGOA 2QQOA 3H1WA 2DTYA 4UW4A 4QX1A 1AR63 2FMDA 3GM8A 1LHVA 2XLAA 1H6XA 4F7ZA 1ZBE2 3J9SA 3B94A 1UL9A 4HPKB 5CBLA 2ID4A 2WWJA 4NHKA 1N3QA 1UF2C 3MGUA 2VM9A 3DGTA 3FHAA 4C1XA 1VRH3 1W6OA 5A3LA 4FT8A 4DRVA 2YFUA 1BBT3 2R042 3Q8CA 1F35A 2W39A 4IV1C 2R0HA 1X7NA 3AP5A 1X82A 5FZAA 3O1OA 1VALA 1WWYA 2UWAA 3M7AA 2LM3A 5FP7A 4JQRA 1DQ6A 3ZM8A 5IK8A 4LHLA 5KC5A 1WLCA 1QXPA 3D5OA 2AENA 2VCMA 1QJY1 4QHZA 4EYUA 1OF3A 3N4MA 3ZMOA 1IOAA 2BV4A 4QU1A 5FK7A 5JXGA 2LROA 3AJYA 1JYVA 4NIGA 2BUKA 4GJYA 3M1HA 1OQEA 4BIFA 4HANA 5EFUA 2WNOA 2VR4A 3SCHA 1UNBA 3KF3A 5L9BA 4CUCA 4IV1B 2PHUA 5ACA3 3KWVA 2WT2A 1BEV2 1IG0A 2Q8EA 5F9TA 2HWE1 3A23A 1XE7A 2B9VA 3R4UA 3KGZA 3LEMA 3QOPA 2MEV3 3K2OA 4OQ9A 5FMOL 1W2NA 1SLIA 2Z2SB 3SXWA 2PLV1 3V0AB 2Y8KA 4N43C 4LOSA 1O4YA 1W39A 1CJPA 3T1MA 4JQTA 4XAEA 4E4ZA 5B2GB 4UBGA 1IKPA 4BH9A 1OH3A 2VAUA 4LLOA 4CCKA 1C8M3 4NROA 5T55A 3L9JT 2GMPA 4C0BA 5FZMA 3GBFA 4OZXA 3PUQA 1XE8A 4B7EA 4TYSA 1SFPA 3W59A 2G4IA 3K4DA 5LA1A 2VMFA 3T3YA 4L9BA 4DXZA 5JMOA 1JN2P 4QGLA 3I54A 2P4EA 2JDKA 4XZUG 4LMFA 1RUI3 1CVNA 2WFF3 3OGGA 1AJKA 1L7RA 1AYN2 2AYHA 2VXJA 5FYZA 3N9MA 4UI9L 4AK3A 1WGPA 3KSCA 3PUIA 1OT5A 4LE4A 5A3OA 4AHYA 5CFDC 2D6OX 3TWIA 3WHTA 4O61A 2ZBJA 2VPVA 3T2QA 2W0XA 1VBC1 4FAHA 1BJQA 5F5AA 4XBQA 2DBNA 4W50A 5EWSA 2RJLA 1QDOA 5FZCA 2ADDA 1JUIA 4CTEA 5LWBA 3EBRA 5K7PA 4QDQA 3DYMA 2UU8A 4XUOA 3QH7A 3EYPA 1BXHA 1FMD1 5GJ6A 3LD8A 4ISRA 4MXVA 3MW3A 3AMNA 1FT9A 4P9LA 1I6XA 4Y20B 4FFFA 3W5NA 1QXJA 3AZXA 3CDZB 4PF5A 1SEFA 1XXNA 3FL7A 5I0UA 3SC7X 4HZFA 5DDJ2 3OCPA 4LLFA 3V65A 1TE1B 2E63A 4CDUB 1LEDA 4ES9A 5SV5A 3H1YA 1ZZ7A 1RUI1 1AF9A 4NPRA 5F3GA 2E32A 2VNGA 1QF3A 5A7PA 3VBSA 4QXKA 3MPPG 3ZXAC 2E51A 2VULA 5BXXA 1JYIA 1DGWX 2I74A 3B02A 1UY1A 1W9FA 2C6SA 1S2KA 3MF6A 2JDHA 3O1RA 2E7QA 4N7UA 3SEEA 3WZ1A 1YFYA 1ZBA2 3PVEA 2WZR2 4GH4C 2HLEA 4XF4A 1GP4A 1PNGA 4BLJA 4CCMA 5ABJB 3VD9A 2AUYA 2CTVA 1CX1A 1JZ5A 3JB4C 2W87A 1RITA 5FUNA 4MXWA 2HJIA 1QJFA 1I3HA 2P1BA 2X5IB 2R49A 4XJ9A 1AHSA 3RZHA 2WNUB 2YMZA 2W52A 2Y34A 4KGQA 4NMIA 4HVRA 3OD0A 3MDPA 3S0MA 4FOVA 2R0FA 2HWF2 4B7KA 1VE0A 1VBE2 2RM23 4QPGB 4RR3C 4QDRA 3LQCA 3POIA 4GULA 3Q8EA 3QCWA 1NXMA 3H7YA 2RE9A 2RR11 4KI5M 4A2UA 5C33A 3TBDA 5CISA 4P9XA 1JU4A 1EUTA 3KV6A 5GLZA 2A6ZA 3W5MA 1FPN3 1MZFA 2PQSA 4FPYA 4XBNA 4IESA 5FZOB 3MFAA 2XWJB 5FO9B 2TNFA 4QMAA 1VBB2 1YC61 1ZZBA 3VKOA 2ZMLA 4N53A 4QQHA 1AL23 2J1SA 3IM0A 4XURA 1UX7A 4ZZ8A 2WO2A 4BCUA 3HQRA 4CCEA 1POV3 2BP6A 2Q8CA 3AKPA 3T09A 4NIHA 4DXRA 4Y1UA 2Q5TA 3ZVXA 3BU0A 5JXHA 2WO3A 2WO1A 3ZSKA 1F2NA 3TOJA 4ARXA 3USSA 4UFIA 1SCSA 5FAXA 5CB7A 3VBFC 1ZREA 4Y5TA 5FLJA 4QD2A 5C3QA 4XPVA 3VBRC 3FFQA 1KQRA 5C5UA 5DG1A 1POV0 1WCKA 4YFWA 4Q4W1 1V70A 2VTXA 4QWNA 4QXCA 4S2HA 1VBD1 1RUF2 2CGOA 2DBIA 2OQ6A 3BIEA 5CNAA 2FBEA 4N53B 5AC91 1MS0A 5CFDA 3ZPYA 4N90A 1DLLA 2VBDA 1D2SA 4IW3A 4LHNA 4GJZA 1K5MA 1JZ3A 4CEWA 1S0DA 3GF6A 5CG9A 4CDUA 2IVIB 4D6QA 1L7QA 3I4IA 4FFHA 2X8KA 5FK8A 1AYM3 1W90A 3AKQA 3MW4A 2XJUA 4L8QA 1SDDB 4Y5Z0 1QY4A 3VDDA 5J96B 1RHI1 2C9AA 1Q8SA 4R9BA 2BJSA 5A6XA 4XDQA 1R1A3 3MUZ1 5JDBA 2VOTA 3WT3A 1MZ6A 2JICA 3T2TA 4D6SA 2ZCWA 3AJZA 4TLFA 3WHUA 1US3A 3ZYFA 3CZJA 5C3PA 1RUI2 2VY0A 2OT7A 3O7OA 3PHMA 2Q1MA 2DVGA 4LXLA 1RUJ2 1PO12 3D3AA 1N1TA 1XPWA 5FYBA 1XYPA 4YYOA 3LA7A 1WMFA 5FXXA 5B4XA 4NHMA 2QDRA 3O1UA 2J1AA 4OHXA 3AVRA 3NRUA 2HWC2 3LKJA 5DAPA 4E9KA 1N3PA 3E97A 1IS3A 2VH9A 2WKKA 4K9SA 5JWPA 1ND3A 4HLTA 4QPWA 1HXS2 2QE3A 1TZOA 5GM0A 3VHPA 3B5LB 2JG8A 3AXEA 1FAYA 1B09A 2JDAA 4ATFA 3WR0A 5K0UB 3LFIA 4Z2AA 4YW4A 4IEPA 5FBJA 4WM8A 4Q4Y2 4Y22A 5A80A 3RJRA 4LKFA 4MSVA 3KM5A 2Y0OA 3THTA 1AR83 1Y9QA 3DYOA 4YW6A 4NWVA 2KXLA 5J36A 3O1VA 1IQDC 2WNVA 1NOVA 1W6MA 3A22A 3KVAA 3M3OA 1S2EA 3JQWA 1GQHA 4FPLA 4Q0QA 3T1LA 5FR3A 5F5CA 1O3QA 4BPZA 4HN0A 1QOTA 1GANA 2JDZA 3GZUC 3OUJA 4GA9A 1I5ZA 4AF9A 4EQVA 1EPZA 1C1LA 4OCTA 1OOPA 3RNSA 4XMAA 2N7GA 4LQRA 4XIOA 2EIEA 3HQUA 1LR5A 4L97A 4PI2A 4CDXA 4EWDA 1L3JA 1XSQA 5LZ6A 1T6BX 4QPGC 3WCRA 3WNKA 1OUSA 5BNOB 1C57A 3FUQA 1UOBA 4NIDA 3HEIA 1R093 1UMZA 5CFCB 1VBC3 5KR7A 2XKOA 2YU1A 4QB1A 5BNPA 4YW3A 2VBBA 4Z07A 3AKRA 4OMCA 1ZRCA 5FYUA 1PMHX 1ALYA 3BUCA 2V72A 2QKDA 2GNMA 4LHKA 3QACA 2E6VA 4AEDC 5ABJC 3WXPA 3ZDSA 4FTSA 1H8TC 2WS93 4JZRA 2I45A 2VZUA 5LA0A 2JG8B 4UT5A 3O0WA 1AUYA 2X05A 2PAMA 3U37A 4HOOA 2HYKA 4L2NA 2V4VA 1UIJA 1STMA 2BGPA 3WW2A 2UWCA 1V6OA 1VBB3 3NNMA 5EYYA 5FY4A 3WLUA 1FATA 2XJTA 2IC1A 3CO2A 4DS0A 4P9YA 2ERFA 4KNCA 1SHWB 4COVA 2A7AA 4WM7B 5AVPA 1PX4A 5HCFA 4NIAA 2A3YA 4XMIA 4QGMA 2FQPA 3H50A 5LEKA 1NX9A 4YG0A 5A7SA 4C8DA 5F7UA 1REFA 2Q4SA 5T52A 2D3RA 1WCUA 5AC92 4JDMA 2D40A 3Q8BA 2VZOA 2Y6KA 5LBEA 4FXGB 4Q4W3 2WA3A 3K48A 4OQ8A 2XQXA 3MF9A 1EYBA 1B35B 3ZFFB 5FPVA 1V00A 2V73A 1SLTA 3TN93 4CEWB 1YRZA 4ZU5A 3D4KA 2C1FA 5FY7A 4LHSA 2R1DA 1POV1 3H0OA 4XILA 3KCCA 1N1YA 2JG9B 1N47A 1GNZA 1LHNA 4YVWB 4MLOA 5D21A 3TB0A 4D69A 2ZEZA 1O7FA 3GCWA 1UY4A 1R082 1S0EA 2LTNA 2W08A 2RDSA 3I59A 3ILFA 4CSWA 2YGLA 1H4GA 1W6NB 1IG3A 2OPKA 4EN8B 1K12A 3MV01 3PUHA 5EP9A 2R072 3AP6A 2W1SA 1QJY3 1AR73 3H42B 2A73B 4PDWB 5FY0A 2AGSA 1M06G 1DLCA 2ZX1A 4IEZA 4UOJA 1HB1A 1GICA 4XBLA 4UYBA 2F6BA 4MGYE 3WG3A 4KBZA 4N43B 3WP3A 1UMIA 1Q56A 2JG9A 2ARAA 3GZTB 1QNYA 3HNBM 2Y38A 3PU8A 5ACA2 3WDYA 4FSJA 1QJY2 1LGCA 2RJ2A 2QQIA 3MIBA 5DZEA 2JE9A 4DIQA 4QPIC 4HMZA 4ZONA 1R64A 1WMEA 3BCWA 1GNYA 5KWRA 2GP5A 4LTAA 3I2IA 4JAAA 3T4HB 2X10A 3WDWA 4KWKA 4UFKA 4OHWA 2UY9A 2ZXQA 3IMMA 2ZKLA 4E2GA 5KHJA 3LDKA 2ETEA 1K5MC 1NLRA 1X9TA 3CLPA 3MBWA 2YGMA 4JC1A 5EIYB 3M3CA 4GXLA 1VBB1 4CP2A 2KD7A 4UW6A 4XCBA 1LB2A 1MEC3 3FHQA 1P8JA 3PIGA 2PLV2 1UD1A 1YWKA 2ZS6B 4A3ZA 4YZ1A 1NY72 1PGL2 1A34A 4LT5A 1MQTC 3ZSEA 1GSLA 1SCRA 3DXTA 4XACA 2MNGA 3B69A 1NCQC 2P3KA 1DQ5A 1V6KA 2VVEA 1KDMA 5DUUA 4DO0A 5KXBA 1EUUA 2G9ZA 1WZXA 1GQGA 2YBKA 1ASJ2 1H1IA 2BGCA 5F3CA 1QJEA 1WLTA 1C8M2 1UZVA 1YJKA 4RQPC 5L19A 4Z8BA 4NRMA 3CZUA 4HK9A 1W8FA 4ZU4A 1ND3C 4FQ4A 5DAWA 3VBSB 1BQPA 3N3HA 4XUNA 4MGQA 1FOD3 2WR9A 3GHMA 5BNNB 2D6LX 4KL1A 1OKOA 1ULEA 4GWNA 4CA9A 5IVBA 3OBZA 2OX0A 3ILRA 5CG8A 3GJBA 3RZZA 3FUOA 1WW4A 2XG3A 3CU7A 4FBFA 2GMEA 5LA9A 2ZGLA 5BNPB 1PGW1 1RVF3 2GC2A 2DUQA 3DKWA 3DUIA 4NHXA 2P3IA 1JMUB 3JUUA 4ASKA 1YI9A 2VL4A 4EZHA 2A6YA 4KU8A 3TEWA 4RGKA 4YZ3A 2FDKA 1PNFA 4NRPA 3W9AA 2ZGPA 2XOMA 3ZN6B 4TTGA 1UZWA 1C4RA 4XCAA 1COV2 4LIVA 3ZXEA 3TNQA 5LRSA 1DQ0A 1RMU3 2VZRA 1RVF2 1RUD2 3OGRA 1ND2C 1UU4A 3OY8A 1OHFA 1PK6B 3KLSA 2QQUA 4A7ZA 2ZHLA 4MADA 4ZU7A 2QQPA 2ZX2A 1H2NA 4IQPA 3IPVB 4W6XA 5DMYA 2D44A 5FUIA 5HCBA 5CU1A 3FN9A 2Q0AA 5D8AC 1NUKA 1NT0A 4PQQA 3VBHB 3BVCA 1RUD1 5D8AA 2ARXA 2CU5A 1AJOA 4GWIA 3G6JB 5ACA1 1AYN3 4RGAA 2GAUA 5FP4A 2WC2A 4M3CF 5DDJ1 5FY8A 2EXIA 1XYNA 2YBSA 2AEYA 2BNNA 2UURA 4LBQA 2YV8A 4Y22B 1LOAA 2ORZA 3KHCA 1PVC1 2NLRA 4AZZA 5JXJA 4MZUA 4IV3C 4N9IA 1IS6A 1K5JA 1E5IA 1H6YA 4AFMA 1RUOA 1LNSA 2PAKA 4X6QB 4Y24A 3DPRB 5IUQA 5JIUA 1MEC2 2I07B 5DG2A 2OKXA 4LA3A 1VRBA 1HV1A 1VRH1 4OUEA 1CAWA 2RMU3 5CKQA 4RD7A 3WEZA 4UFJA 5JXIA 5IVYA 4IGOA 4LK7A 2ILMA 1ODNA 5EJZB 4N7IA 2DVAA 2FHRA 1SQ4A 3ST7A 4CP9A 4SLIA 1SPPB 3W58A 4CVUA 1UCXA 4OULA 5FPBA 2Q1ZB 4BDVB 1UZ0A 4BOWA 3S5AA 1O3TA 3AYDA 4KU7A 3H8OA 1ACCA 1XNAA 5L7OB 1UYPA 4AGVA 2DCYA 2VMHA 4CCLA 3AYCA 4CZSA 2WL1A 4MGTA 2IFWA 2WT1A 1RUG3 3PMEA 4MGIE 2VQAA 1SLAA 3BKZA 4BQWA 5C70A 2W1WA 1I1EA 2AR6A 3OBRA 3ETPA 4MYEA 3WSOA 5FQ0B 4DY5A 4EWAA 1PGL1 5C4WB 1NE4A 1REEA 2XH6A 3LEGA 3WNOA 3LPFA 1W0NA 4CEYA 1V9U1 2JKXA 4FO9A 4ASMB 1RUG2 2VJXA 3NMBA 5FZHA 3I59B 2HYXA 1CAUA 1GFF2 4IL7A 4KG8A 5KHHA 1VMFA 2JDPA 2QCSB 1XYOA 2WFPA 2ZMKA 1D4M1 2YDEA 2YG0A 3D0JA 2Z79A 2G1MA 3Q9OA 4PDWA 1FV3A 4XFAA 3SMHA 3VZLA 3H7JA 3VBRA 4QAWA 5HCAA 2YC2A 3K51A 4B1LA 2JDNA 4JRLA 3C7GA 3I8TA 4XFFA 1DHKB 5FPAA 1JH5A 3AM2A 4QX3A 2BOIA 1C5HA 5ANQA 1XU2A 5BV6A 2XPJA 2WSUA 3MYXA 5DAXA 5E1RA 1YXWA 5KXCA 4OFGA 2LS6A 5KXDA 1W06A 1ZYBA 4TN7A 5FZKA 1AYM2 5KHGA 1WLDA 4MV2A 3N7JA 1YI7A 3JXSA 3G7DA 4YW5A 1KDKA 2QNKA 4QPGA 3URFA 3I2DA 3WNMA 1HB4A 4Q8LA 3AVSA 3OD4A 3VLBB 1PO21 1V6IA 1FX5A 1J3PA 3I3QA 3FFZA 4M3CA 4YZ4A 3V64A 2BW8A 5JIAA 2E26A 2PXJA 2WYFA 1ZBE3 1YJLA 3E5QA 3VBOB 3AFKA 2VMIA 2VMCA 1BYHA 4XF1A 5L36A 2O8QA 1NCQA 5K8SA 3RG0A 4MGZE 2RVAA 2ET1A 2VC9A 2DCKA 4E4SA 5D1IA 4B4RA 4P08A 5JSRA 3AC0A 2D97A 4AI9A 1CX4A 1TG7A 2BNMA 1H4HA 5ANNA 3OG2A 2AACA 1OF4A 4MHRA 5A7WA 3LGRA 2YY1A 1NCRA 1ZRRA 3HN3A 5LBFA 2E33A 3ITQA 4Q4X1 2OS2A 1QGLA 4UAPA 2Q30A 3ZFGC 5C8WA 2WQ8A 3JU9A 2RDNA 4R9CA 1QDCA 3DF0A 1J83A 3RSJA 1HKDA 2IXJA 3T0DA 2R6QA 4XQDA 1UXXX 3E5UA 1URXA 4WVWA 1JOBA 3ZKUA 1X36A 1A6CA 4Q0UA 2VVDA 4OUSA 3NAPC 1PK6A 2HWF3 4YZ2A 2CNAA 1QJZA 2XUMA 3VZKA 2EA7A 3OEBA 4FOWA 4QKDA 2NPIA 3U4XA 2ZX3A 1ASJ1 3IB3A 2KM2A 4RN5A 3ZKYA 3CNAA 2ZGMA 3HQXA 4CDQC 3RS6A 4D7TA 1IKQA 2BTVC 3KV4A 4TSVA 2QQVA 4WVZA 3ZN6A 5T3NA 5JLVA 3POFA 2P37A 1SMVA 2WO7A 1LHUA 3MUY1 5A3NA 4B29A 1CONA 1W03A 2H0VA 5F5IA 4L99A 2C24A 4RSUA 5C8CC 2BYVE 1W2TA 2EXKA 4XYXA 4AE2A 2R30A 3LDBA 3ZXKA 4AQ2A 2ZGUA 5AFEA 1UPSA 2VE1A 1LULA 1S2BA 1YLLA 1CR7A 4YVSB 4B8EA 2W94A 3ZYJB 5G05L 2XBO3 2DURA 3TYJA 2H6CA 1OPOA 3N7MA 1TEIA 4HL0A 3OGVA 1HLCA 1YQ8A 3PJYA 4URTA 3LA3A 3HN1A 5F39A 3FLRA 4FPCA 1O6UA 4MO3M 1IGOA 3N9OA 5LASA 3R4SA 2B5HA 4RHV2 4XJZA 2WINB 4XF9A 2A70A 4ZKTB 2VUDA 1TNRA 4QM9A 3RWNA 2D3SA 1LKNA 4XIKA 1LCLA 3E6BA 5LW9A 1W8WA 3ZYHA 4PI0A 4XUPA 2DYCA 4J6GA 2D5HA 1FMD2 2XJQA 3DKQA 2Y33A 5FYMA 1W8TA 1FOD1 3PTRB 4D7YA 4COWA 1AL22 1ULOA 4GALA 4M01A 1RGSA 3K4AA 1K42A 3VDDC 4R9DA 4IV1A 3ETQA 5IVCA 3POEA 3ZIXA 1WBLA 4QXHA 1CGPA 2HEWF 5FREA 1MS8A 2UWBA 2VVFA 1JZ2A 3I2OA 3K3OA 2CGNA 2RS13 3BPZA 1JU3A 3ZLIA 4LO8A 4CU6A 2RJKA 3ZDVA 2D6KA 3BOPA 1W8HA 3LDRA 1GR3A 2VG9A 1IPSA 2XONA 4LIUA 4B4QA 2DVBA 4W6WA 4BK4A 4MGSA 2ZGSA 5IHRA 4BK5A 2ZGQA 1OUXA 3ACIA 1G8WA 1I5PA 3ZSLA 3OUIA 2WWSA 4I0AA 4CPBD 3KB5A 4Q4Y1 1ST8A 4JGZC 4OHZA 3OJBA 3OPTA 3OBAA 4CU8A 2Y6FA 2VW2A 2J1EA 4LBNA 3ZR6A 4GH4A 1KXGA 3PVBB 1TME3 4JGYC 4K3UA 4QQOA 3BTXA 2SLIA 5LATA 1UY3A 3UKNA 1LOBA 1F4AA 5I0DA 1YYNA 5IWFA 1WMDA 4CU9A 2E9QA 4X8PA 5C3SA 1W8ZA 3C7HA 4M0HA 3LSDA 3RDIA 3JD72 4WBBA 4LR4A 5J48A 3DEMA 4R9AA 4NN0A 4RS5B 1VAVA 4H2AA 1JODA 2XJRA 1OQ1A 1X33A 4C0HA 4DPNA 2HWD1 2DU1A 5FZOA 1ND2B 3KCYA 3T2PA 1SLCA 3CJIB 4NPLA 2VZ1A 5JOWA 1JW6A 1UY2A 4QX2A 1LODA 2YROA 4DNYA 3CJIC 5H9PA 5EYXA 1UQXA 1D0GA 1CIYA 2LRPA 3FWEA 3NKGA 3USUA 2PTMA 3ZYGA 1RC6A 1VRH2 1HQNA 4BQXA 2FZ2A 5ISLA 3ZPOA 3NKTA 4RS5C 4XF0A 1MS3A 1RUF3 5KXEA 4IEYA 5A3UA 4BWOA 3LOBA 1GUIA 1O91A 4BQ5A 2BQPA 4AQTA 1AR92 1K45A 1LTEA 1LRHA 3E6DA 3P3NA 1PVC3 4GB33 4WM7A 5FYTA 2EICA 5T5PA 4AEDA 1RUE3 1YEWA 1XJAA 4Y26A 3RYKA 4FPGA 5T50A 4K1ZA 2EALA 1YFUA 3B01A 3LOIA 3RYPA 4ZZ5A 4IE4A 4PF1A 1AYN1 4YRDA 5F32A 5FV3A 4JDOA 3ROUA 2IFRA 2RM21 3UJOA 3VBSC 3WOGA 3WW1A 3OB8A 1AXYA 5FWJA 4NAMA 5FRAA 4CDWB 1DGLA 3E5XA 1FOD2 5FDBA 1H0BA 1E5SA 1A8DA 1RUNA 4IERA 2WLPA 1V9U2 1HJGA 2UYBA 2X09A 4MX3A 2FDJA 3FC0A 4Y20A 1YFWA 2QQJA 3J8F3 1SPPA 2ZHKA 2VW0A 3MIDA 4NRQA 4UBHA 3THPA 4CP9B 3WX5A 1RVF1 4AW7A 1RUF1 3I3EA 3N7KA 2HWC3 5LBCA 1PO11 1HN0A 3RZLA 1AVBA 1ASJ3 2VNRA 2YC0A 4K21A 2H6BA 3I2JA 1W3VA 3I97A 4QQPA 4ZS3A 4BYYA 5AFBA 1OLMA 3TEZA 4JV4A 5JZGA 1ZZ9A 1HB2A 3MHZA 3K46A 3RMYA 1SBDA 4JHTA 1OBNA 2UY8A 1JTZX 3ZFEC 3O0XA 4HKLA 4UXAA 1MZEA 5FLIA 3MIHA 3ZFEA 2R1BA 4EN9B 2GMMA 4JCKA 3D8CA 1POQA 4NAOA 5A32A 5K9YA 5FY9A 1ENSA 3S6PA 3U4SA 4TZDA 4AL9A 5IFPA 4I2OA 1EPWA 2A3WA 1C8NA 1DCSA 1C5IA 4AG4A 5HXMA 3EQEA 1F4HA 1WLWA 1XC6A 2P2KA 1FYUA 3PVOA 2BPA2 1S0BA 2CY6A 4KBBA 3WF4A 2PYTA 1QMJA 4FTEA 4IE6A 5FYHA 3GYDA 5J98B 1W6MB 3T4VA 1Z0HA 3C7FA 3NV1A 3AMPA 2P34A 1DZQA 1QKQA 1DF0A 2WNVC 2XR4A 3OSDA 4WVMB 4XFGA 2ZAHA 3ZXGA 2DUPA 1UPIA 2ZAAA 1X50A 3CJXA 2A71A 4XVHA 4DEQA 3O1MA 5T5OA 1H1AA 1H9PA 1MVEA 2NYYA 5GLVA 3PURA 3KMHA 5LBBA 5LRRA 4FOYA 2BWAA 4H7MA 4AVAA 4EZ4A 2R071 1YNAA 1UN1A 2VW1A 2OVUA 4PCRA 3U14A 4FPJA 5LY1A 4PLMA 1GZWA 1NY71 2BZDA 1UIKA 5JUVA 3I7DA 4IEWA 1V0AA 2W47A 2BU9A 4QQLA 2CAUA 4JRAA 3C3VA 2FDFA 3CMGA 4BA6A 1GZTA 3BPSA 2W2IA 4ASLA 1CQ9A 3ACHA 1KGYA 1JOPA 2RG4A 4QXBA 1FPN2 2VOXA 2WFF2 1YO8A 2ZEYA 3AKSA 3IT8A 3POGA 4IETA 4JHZA 1NA1C 3FLPA 4JTOA 4V2WA 5L9VA 3PLQA 4M0NA 4XDPA 1CZSA 1VBE1 4ZXEA 1J59A 2YB7A 1TVGA 3VGIA 4UW5A 4V1PA 1EV11 2FDHA 2W5FA 1PM4A 3L2YA 3WQBA 2G9GA 2ZJCA 1LENA 4K6BA 2RR12 3ACLA 4XXPA 1OA4A 5DXDA 1OA3A 2RM22 3GCXA 1ZZCA 1YUDA 2V5YA 2V09A 4G4FA 4C91A 4Z82A 3KVBA 1D4VB 3QLQA 4S2DA 1D4M2 4I0BA 5SV8A 3QD6A 3U1XA 1QXRA 2D3PA 2JE7A 1F31A 2QFEA 1GKBA 4RYDA 1C28A 4Q2FA 3DV8A 1JZ8A 4N43A 1V9U3 4HPKA 1OURA 2XHNA 5KBFA 1S55A 4PBOA 2IXCA 3H8RA 1ZNPA 2Q8OA 4COUA 2B39A 3IBMA 2E53A 2JG8C 4I30A 5EPAA 4CRQA 5KHKA 4HFSA 1H8TB 3NL1A 3THDA 1CAXB 3EHKA 5J3UA 1DGRN 4YVSC 1W6QA 5FYCA 1RUD3 1SDWA 3MLKA 5IVEA 4GMP3 4P5YA 4YFZA 1IPJA 1COV1 2XJSA 1QJU1 4ISQA 4DUVA 4Q4W2 3TN91 4XEZA 3V0BA 3FHIB 4CE8A 5JZGC 1ZRIA 3ES4A 2KR2A 3N35A 1JYNA 4IDZA 1AR61 5BY5A 1SBEA 3HOBA 3A0KA 5JI7A 2FMYA 2QZ3A 2RMU2 4CDQB 1SACA 2J1RA 4O9EA 5A6YA 2OXBA 3MLLA 4P14A 2J1UA 4BU2A 3E6CC 1MS5A 3N7LA 1HRI1 2YZ4A 4YM3A 4CCJA 1MZ5A 5ERLA 1JZ7A 4YW1A 3A0NA 3NAPB 2QUOA 3AL5A 3HD8B 3PUSA 2OYZA 2WQZC 3AFGA 4NR1A 1AL21 2DVFA 5FZ0A 5IAVA 1Y9MA 2ZGRA 3QH6A 5CKMA 1O4TA 1RXFA 3RJ2X 3U11A 4HXCA 4AFCA 5I0RA 1PZ7A 3ORJA 2OA2A 2EIBA 4AAXA 4ITCA 1PX3A 4RS5A 3VUOA 5IK4A 1VB2A 4YW2A 4Y1YA 4YG6A 4OZOA 1CAUB 1PZ8A 3CIHA 1W6PA 5F8PA 4JDNA 1OD3A 5E6HA 2CGPA 1MS1A 2ZGKA 4BJ0A 5J37A 3WUDA 3FLTA 1H1MA 1PIV3 2C9KA 4FPFA 4HVOA 2TEPA 1AXKA 5FZ6A 4LBQD 3OYWB 1AX0A 3MPBA 4IEQA 3UYJA 4LULA 3T0AA 4AHXA 1QIQA 4OYUA 5A33B 1Q8VA 4V2VA 4E4DX 4BXSV 3H3ZA 5EJ3A 2OZJA 5FO7B 2B7YA 1RMU2 3TNPB 2Y64A 4YGEA 1HQLA 2VGDA 4XJWA 1JZ4A 4ATEA 5JR7B 3VBOC 5M0TA 2WZR1 2IUWA 2DU0A 1ZBE1 2K46A 4Q1PA 4XDOA 2WABA 4LBJA 3B00A 3GBGA 1KFXL 1VBA1 2IXHA 3VKFC 4UFMA 5FY1A 2JDMA 1G9CA 2CYFA 3PL0A 5FZIA 2ARCA 5GZFA 1PO23 5F37A 1DQ2A 1WMXA 2HKXA 2YYOA 2IVJA 5FXWA 3VZMA 1VBA3 4Y3OA 4K8FA 3RWKX 4A42A 3VL8A 1U12A 1JYTA 3JD73 5C7GA 2YHJA 3HAGA 4FP2A 1UKRA 2JDYA 3EJKA 3VKLA 4W4ZA 1W9SA 3SCFA 4BXFA 5BUVA 4KWJA 1OOPB 1LGNA 4E27A 4A6OA 1HB3A 3AP9A 1AR72 1W9WA 1XNBA 5IATA 1FMD3 1PVXA 4OHYA 4CXYA 5A3TA 1DU3D 4LBQB 4RFT0 1MS4A 4BQYA 5K4LA 5FY5A 2H0BA 2WNVB 3AL6A 3AZWA 5FJHA 1D4M3 1VP6A 1WUVA 2WT0A 5F6KA 2MEV2 2VUAA 3PUAA 1GOGA 2VUJA 1AR71 3DYPA 5GALA 1DQ1A 3POWA 3VBFB 1LOEA 1MVQA 2ZEXA 3AKTA 3KD4A 1XQNA 3IDBB 2YPDA 3ACGA 3VHNA 1VPHA 4KWUA 2QQKA 3NV2A 5FMOS 2QQWA 1JHJA 3BIWE 5DABA 4LKSA 5FBZA 5C6CA 1QJX2 3S30A 1RUG1 2W46A 3HR9A 4XXAA 2HBTA 2WS92 3RVHA 2Z69A 2P5BA 4I02A 4I3PA 5BNOA 1AR93 2XB6C 3CHXA 3AZYA 1HRI3 1QOSA 4GIQA 4LK6A 2E7TA 2EXHA 4DEVA 1N1SA 4YW7A 3PU3A 4QB2A 4PLNA 2WBKA 3MW2A 1ULCA 3N9NA 2L9LA 4XFCA 5FUPA 5FZEA 2VMGA 4AEMA 5EJ1B 5C9AB 1BMV1 1NE6A 3IAPA 4K8RB 4Y1XA 2RS51 4BMBA 2QQMA 5JZGB 3LZZA 1KS4A 1OVPA 1DYPA 2RMU1 1XSRA 1Y43B 2VTFA 4IGQA 4MGKE 4IE5A 1GZCA 2ZZJA 2XDVA 3DPRC 2JB8A 3WCSA 4CDWA 2VMEA 4JKKA 3AK0A 1U5IA 2JKBA 4CDWC 2X29A 5BNNA 1W6OB 2XHKA 5BNNC 2JEMA 4FFIA 5JI9A 5CYYA 1RXGA 3VZJA 5FYSA 2BERA 2VZSA 2G9FA 2DCZA 4HSLA 4H55A 3KZ4C 5LB6A 4D3WA 2KA3A 5T54A 2AREA 4XFBA 3I3BA 2VZ3A 3CBNA 4N9HA 2JECA 1HXS1 4J1WA 1NCRC 1NQJA 1EAH3 2ZHNA 3H3LA 1JBCA 1Y7BA 4KQ7A 4P9JA 5KHIA 4Q8KA 5FPUA 2XLFA 2NMNA 5LK7B 4YGDA 3ON7A 2DF7A 3WF2A 2GH2A 5J09A 4WV8A 3AP7A 1AX1A 3U0ZA 3AMMA 1NCQB 1RUC3 3GALA 1W28A 1HDKA 1JYCA 1AX2A 5FWEA 1NA1B 2ZABA 3JBG1 5EV7A 3R05A 1SLBA 1XOYA 3POJA 1KJLA 4FOQA 3MV11 4P02B 2V5DA 1WW5A 2WIIB 4IEXA 3ZYBA 1EV12 2Y6JA 3HWJA 4M3CB 5LA2A 3I2FA 1DGWA 2C0ZA 3LE0A 4LPLA 2A6WA 4QHBA 5DQ0A 3VDBA 1AR91 3JQXA 3APBA 4BISA 4WVVA 2RS12 2D7FA 4CDQA 3R4DB 3LSEA 1DG6A 3LB9A 4Z92B 1VBA2 2ZOEB 1YIFA 4NPMA 2LW8A 2GC0A 4A45A 5CFDB 4ZHNA 1BVP1 2GNTA 1TNFA 2ZZQA 1QU0A 4Q4V3 4COYA 2I2SA 1RTVA 3AB0A 4Q5OA 5I93A 3UT0A 4HBNA 1D2QA 2F17A 1VBD2 5HV0A 3KT4A 4AI0A 5FPXA 1UY0A 4XF3A 1AZDA 4Y4YA 1G9DA 1BEV1 1R091 2VCAA 4JGYB 4GB32 3WNLA 5C5TA 2CL2A 4A41A 1BK0A 1QJX1 4IEUA 2WS91 3J7LA 3WDTA 4Z1VA 1HN1A 1UMHA 3FX3A 4PHZA 4XUTA 4QPIA 3SITA 3BI3A 4CPBA 3D82A 5A3WA 4JGZB 4XAAA 1SG3A 4NUBA 2R062 1G9BA 3ZMNA 3HNYM 3BN6A 4YGBA 3WVJA 4BQ4A 2VU9A 3ATGA 5JSOA 3TEYA 2EVXA 3Q8FA 4IGPA 3IMNA 5I91A 1BMV2 2PQQA 5L7OC 4AI1A 4A7KA 2RS52 1B35A 2RS33 5FZ9A 1IQAA 3RRDA 1E5RA 1T2XA 4ZS2A 3HIFA 4BB3A 5CADA 4RFRB 1GLHA 3GGLA 1W05A 2W1QA 3IWZA 2WZEA 4EROA 1O3SA 4YZ5A 1E57A 1BEV3 2QTWB 3FMGA 3KT7A 4NOTA 5GZEA 1CAWB 1E5HA 3CF6E 4K1YA 1UZZA 4MH0E 2XJPA 3DPRA 4Q0VA 4E8DA 1IS5A 1RL3A 1PHMA 1AL0G 3JBG3 3A21A 4GQ7A 4META 4NO4A 2BDRA 4YG3A 1ZZ8A 4CUAA 2WSVA 1H2LA 2HEYF 1XU1A 2OZ6A 5H9SA 1WA6X 4YGCA 4IE0A 4LBLA 2VOWA 2AEZA 3C7EA 4LKDA 1UWWA 3NV4A 1UYXA 1QQP2 3DECA 1RUC2 1UXZA 1BBT2 2R043 3IN9A 3LCPA 3MI8A 5E88A 1Q8PA 2J22A 3D6EA 5CKNA 1EAH1 1O59A 1HXS3 3UGGA 1REDA 3SHRA 2AZ5A 3L2HA 3C7OA 4L11A 1VLNA 4Z2WA 1JZ6A 4GWMA 1KITA 3WF0A 4DFSA 5JPMB 2R32A 1NYWA 1WCQA 1C1FA 1GV9A 1R1A1 1QH6A 2F4LA 1XNKA 3MLJA 2WZPP 2B4KA 1RUC1 4Q1RA 1LECA 3S7IA 2TBVA 1GYKA 1BVVA 4CXWA 1UOJA 4QM8A 3NJVA 2DWRA 4YWAA 3BU7A 1ENRA 2VZPA 2GH8A 4I01A 4LBKA 3IZOA 5D2AA 3C8XA 4INDA 5AVAA 5CFCC 1PVC2 5BYNA 1Q8OA 3HVDA 4JTNA 2J1VA 5A7NA 4GAZA 4MUVA 4GZ9A 4QX0A 3VD5A 2W95A 1LGBA 3OY8B 5A70A 3SQOA 3PTYA 5H9QA 3O5SA 3ZFFC 3ZFEB 3N9LA 5F1RA 3DXUA 2RS53 4Q29A 4O7XA 1RHI3 2HWD3 2J42A 4XJ8A 3ZSMA 1G9AA 3KS7A 4DZGA 2EAKA 1HX6A 2RDRA 3P6BA 5FFOC 1BHGA 1ZA7A 3WDXA 2P3YA 2Z5WA 3OTFA 4AGGA 5IYYA 4LO4B 1COV3 1APNA 5CVRA 3VDCA 3WP5A 3FE5A 4XW3A 3GJAA 1O4ZA 4QKBA 1IPKA 1NCRB 1DZRA 2DVDA 3J7HA 1VAKA 4IEOA 5K0UA 2D43A 4W65A 2XWBB 5DZGA 4QKFA 3WNPA 2XQRA 4S2FA 2VZVA 1PGW2 3RZKA 3I2HA 3KHBA 3GNEA 1WD4A 3O1TA 4XHBA 5FZ3A 4XUQA 3EB7A 1UYYA 1ND3B 1M4WA 3WNNA 2DCJA 1CJDA 2P6CA 3AP4A 4W6YA 3TRSB 4F8AA 1DBNA 3AZVA 3LIHA 1CPNA 1NZCA 4AEDB 2JDUA 2RDQA 3ENRA 1S0FA 4OI4A 5T5JA 4Y5SA 3POYA 2BGOA 2E31A 3J7MA 3ZN5A 1V6JA 3UJQA 3TEXA 1WD3A 1SFYA 1W0OA 1CAVB 2XVLA 1BZWA 2ZTNA 2PMWB 3RI9A 4AI8A 5A1AA 3I2KA 4K40A 3WG4A 1LOCA 2Y6GA 1BCXA 2A5ZA 2RR13 5C9AC 2VOKA 1HJFA 2W91A 4NE9A 3S57A 5I8YA 1QJU2 4QDSA 1QJX3 3GZAA 3KQRA 4WZCA 3GZEA 5F3EA 4HG6B 4GKXA 5C71A 2VNOA 1OPMA 3IDCB 1K5MB 5FMDA 1W99A 1J84A 4UFHA 3ZIWA 1CESA 5J1XA 1DQ4A 2WZR3 2Y26A 4U36A 5F6LB 3W20A 2ZX4A 4F3JA 4D7SA 3O0VA 3ZSJA 1TME2 4QPIB 1CD3G 2D98A 3M4FA 1O5UA 2UYAA 4QT6A 5C8CA 5J7MA 5FP9A 1HQWA 4DOUA 3CL1A 5JCTA 5E16A 2BEOA 4IUGA 3VBRB 3WQ1A 3ZO0B 4XJUA 2OQ7A 2XBO1 2Y6HA 3KT1A 5C4WA 4NIIA 3HJRA 1W9YA 2HWC1 4PIXA 1F15A 1DFQA 3CQOA 3VN4A 5C4WC 2YC4A 5FQ0A 5JAXA 4RHV3 3Q8AA 1GMMA 1OLRA 1RUE1 3AYEA 3NJZA 2BWCA 5DUVA 3UL2A 1OOPC 5GLUA 4HK8A 3V56A 2JENA 5C8CB 2PLV3 3RZJA 4XJAA 1CN1A 4ONUA 4DY3A 4IV3A 1F5FA 1J1LA 2EIGA 2WFF1 3H1MA 3MIEA 2WQ4A 1JS9A 4JVAA 4XQWA 5L7OA 4FCAA 1YCIA 1MS9A 4Q4X2 4XHXA 3P5BA 5FPZA 4CEWC 4EE2A 3OEAA 2A75A 4IEVA 1B35C 5H9RA 2CDOA 2RS32 4JX0A 2PHLA 4H3WA 3SH5A 1CAVA 2JXAA 4XE9A 1Z7S1 3ZYRA 3EXUA 3SH4A 1MQTA 4LEJA 3S7EA 5EXOA 3NSTA 3NNJA 2XLGA 5A6QA 1SBFA 2HBUA 4P9GA 4ARYA 1W3XA 4OI2A 3J8F1 4BQ2A 4EWEA 1BKZA 1S0JA 1CIWA 2HWD2 4MXWB 3UKTA 5IJRA 4G3YC 5F2WA 1OC1A 3B9CA 5L9RA 4AFAA 3T08A 1H8TA 3VBUC 2MEV1 2CSGA 1KS5A 3BTAA 4HONA 4NHLA 5F5QA 2XVGA 4Q0PA 5FIXA 2VBPA 5FXZA 4RQPA 3UK9A 1PIV2 3ZX7A 2HWE3 4CCOA 2ZKNA 5I8TA 2A6VA 1OXCA 2VOVA 3J8F2 4LE3A 3WD5A 2XXZA 2Y60A 4A6SA 3IKWA 3M2MA 1VBD3 4URAA 3AX4A 3X29B 4XETA 2VZQA 3M8LA 1RB8G 3H3UA 1NLQA 4AVBA 2OUHA 1DYKA 3HNMA 3OGSA 1ZBA3 4YSFA 4FPHA 3J7NA 2GNDA 4HKOA 1ENXA 2K2SA 3WG2A 1KRIA 4CP1A 3VDAA 1CZTA 4XZPA 4AI2A 3J4UH 1HRV1 1V6LA 1OQDA 4YVSA 3CKHA 3INAA 5JOZA 1HW5A 4OHVA 4D8MA 1OD5A 1OH4A 2YPJA 1UO9A 2VXRA 1EV13 4YM1A 1O8PA 4ZPIA 1VB4A 5F2SA 1RUJ1 1CZVA 1UU6A 1YQ5A 3BALA 3PDQA 1S0IA 1VBE3 1ZX5A 2J1TA 1SZBA 5CFCA 4E2QA 3SCGA 5I0TA 3R0RA 5BNOC 1Y4WA 5I8SA 4LITA 5JSPA 1GZWB 4LUMA 5FZFA 3U07A 4CDXB 4UWDA 2Y6LA 5IK5A 2A1XA 4L0PA 1BBT1 1RHI2 3KF5A 4HKWA 5FP8A 2A6XA 4LO7A 1MPXA 5FKBA 1C3HA 1ULPA 4R4ZA 2IXIA 2O14A 4BE3A 2WNUC 3I3MA 3SEPA 2Q1FA 5GZDA 5C3RA 1US2A 5FLHA 2DCTA 3ZFGB 3MIGA 3GHNA 1RUH1 4WVMA 3ZR5A 1OA2A 3KV9A 4E4HA 1QWRA 4CYDA 3LPGA 3UV9A 1KJRA 3JD71 2HH9A 1NG0A 3P1IA 4MOAA 4Q27A 5K0UC 4RQPB 4ZXKA 2RV9A 3T2OA 5A7WB 4F83A 3M3EA 1W04A 4Q4Y3 4XTPA 1YIPA 1G7YA 1RUH2 2WRAA 2P6HA 5FYYA 3KCXA 5FO8B 5A1FA 2O0OA 3B7MA 3O1PA 2R073 1FI2A 1PZ9A 2RS31 3WDVA 2PAEA 3BYWA 3NO8A 2XBO2 5FMCA 4CDUC 5HI0A 1XNTA 1Z7S2 3E1F1 1MQTB 5E8AA 1ZBA1 2NMOA 3N36A 2RS11 4YNIA 4BZ4A 4JKLA 4I3GA 1GNHA 1YFXA 3K3NA 2ARBA 3WV6A 2PFWA 2VQUA 3FBYA 4DQAA 4DXTA 1XBFA 1RIRA 5DZFA 4X8NA 1W2UA 2OUJA 4AGRA 4XTMA 5JOXA 2Y0IA 3USUB 1ENQA 2JIJA 1H30A 1ZZ6A 4QU2A 1PIV1 2YXSA 2ZGNA 5FTTC 5FZ4A 2K0GA 4MHUA 2QBXA 4QQ2A 4P9IA 3TAYA 1LOGA 3BTYA 4HSJA 1IHMA 3OOXA 3VKNA 3I3DA 1LEMA 4DB5A 4IV3B 4AWDA 5IVFA 1W0PA 3VD4A 5DAQA 1D0HA 4GD4A 3RFRA 1VMJA 3M70A 1Z7S3 1QEXA 1ZVFA 4TXWA 2WN3A 3I2GA 5FYVA 4BMEA 1QHDA 2NP0A 3GDBA 2JWPA 3HBKA 1Z78A 5FYIA 3R6SA 2VD7A 1H2KA 1DIWA 1C8M1 3VBHC 4NWWA 4CCCA 1LJ7A 4Q26A 4OVEA 4YVWC 1ZRFA 4XOGA 2JG9C 4GB31 2DUOA 1JHNA 4CP0A 5A6ZA 2VCCA 2DTWA 4HETA 1DZTA 1QJU3 3O14A 2VQ0A 2MHFA 4E8CA 1TMF3 5T5LA 5JMCA 1PO22 2C5DA 1Q43A 3ABZA 2GALA 3HPNA 4DUXA 3FBMA 2FZ1A 1GBGA 4PT6A 2WWUA 1GWMA 4Q4V2 3ZN4A 3LAGA 1H9WA 5FJKA 4AVTA 4MVTA 4DRRA 5C3OA 1S1AA 5CA6A 1UAIA 1FNYA 2VZTA 1F9KA 2WNUA 3OPZA 4PJYA 4NJ4A 2WJSA 2E7AA 3WF1A 2R063 1IS4A 2PN5A 1U5XA 2XJVA 3ASIA 4EN7B 1X8MA 4COZA 5FOJB 3JZVA 1QNWA 2WZ8A 2WUHA 4BQ3A 1UW8A 4JKMA 5A1LA 1HRI2 1Q5OA 1UKGA 2QQLA 1ZA4A 1GWLA 3ZXFA 1RUE2 1YQCA 1OFSA 3GXUA 5BPXA 3MEPA 1R083 5FXVA 3DN7A 5EZWA 4KWLA 4G9SB 2W9XA 4OI1A 1XB9A 3LFMA 1DP0A 1LHWA 3RGBA 3AZZA 2BNOA 2QQNA 3LA2A 1ZM1A 4FPOB 4UFLA 3SISA 4C1WA 2GZWA 1GP5A 4NVPA 4Y1ZA 4M3CE 4P00B 3PNAA 1ULFA 3ECQA 1GQPA 3UGHA 4D6RA 5D8AB 1J3RA 3ZFGA 2Z4FA 2WAOA 2B45X 2RHPA 4Y33A 3RI8A 4WZFA 2W3JA 3F2ZA 3SLIA 3UKVA 5APAA 5C9AA 3W21A 1PK6C 4PBPA 2C4XA 1EP0A 2LALA 5TSWA 2IWGB 4OMDA 1LAJA 1KEXA 2BVVA 2VMDA 2O1QA 1CPMA 2GP3A 2EAAA 1BLZA 2ZPXA 1JYWA 3KQ4B 1OVSA 4R8HA 3VHRA 2HWB1 2PHXA 3VD7A 3IDEA 4CXXA 5LCWL 1LU1A 2V4AA 3NW4A 1UYZA 3ZXDA 2FDIA 1V6NA 2ADEA 1V6MA 4FXKB 1NKGA 1ONAA 4ZY9A 4D94A 2MPFA 3WP4A 3VZNA 4CUGA 3SH3A 2HWB2 4BHPA 3B3QE 3OPWA 2XUEA 3RMXA 4LJHA 4PLOA 4J25A 2DDUA 4QHOA 1WCSA 3VZOA 2BOJA 2GN7A 2R061 5IFTA 1QQP3 4IE7A 1GP6A 2XGXA 2HWE2 2HEVF 2B42B 2ZHMA 4PDWC 4AVVA 4CUBA 2PA7A 4WM8B 1TQ5A 5DDJ3 4A7YA 2XMLA 4AFBA 5FZ1A 4BIOA 2WLQA 3BGAA 3ES1A 1AR62 1LHOA 1YQ2A 4H14A 4AQSA 1R092 1LU2A 2D93A 5FKCA 2JJ6A 5A32B 4FAGA 1N3OA 1PMIA 1HIXA 5JPNB 2JIGA 2CWSA 2GC3A 3V0AA 1JUHA 2NN8A 1G6NA 1VMHA 4C90A 2R7EB 3DCQA 4QX7A 4XABA 4QX8A 4GKYA 1K3IA 1KD7A 3SNMA 3VBOA 2ZX0A 2IXLA 3N9PA 4GMP0 4B3NA 3NNFA 4H7LA 3LWCA 2PHTA 4FFGA 4PQ9A 4R52A 4QGNA 5HBAA 3WW3A 4OI0A 3A4UA 3BODA 5BNQA 5FZLA 4BQ1A 1CWPA 4FP3A 1TMF2 3VDDB 1JYXA 4XQ4A 2QVSB 3QBQA 2CAVA 4CCNA 1S4CA 4J1XA 3WG1A 5HXVA 2NM1A 5DAVA 4QPYA 4B1MA 3IAQA 2W1UA 3WP6A 3LIGA 1GOFA 2R16A 2FDGA 5GZGA 3S5QA 4X6RB 3ELNA 3LEIA 5DN2A 5LY2A 4AFDA 1J3QA 2JB4A 2CHHA 3VD3A 5IVJA 3NWKA 3U78A 1WA4A 4JGZA 5IW0A 3OBTA 2O8OA 4YPJA 4EN0A 2ZEWA 4EJRA 1N1VA 3O12A 3UESA 4L92A 5EQUA 1GOHA 2EIDA 3MO4A 4XC9A 2XL7A 1UOFA 1GWKA 1OI6A 4K7JA 3CEWA 5EHDA 1U5ZA 4FTBA 4JGYA 1NZIA 1PM7A 2XKPA 3EMRA 2ORXA 3OYWA 5CEHA 1VIWB 1Q8QA 4HT1T
chains in the Genus database with same CATH topology
3MIFA 1UU5A 1QQP1 4LBOA 3ME2A 3VL9A 2OIIA 1KFUL 1LESA 2PHWA 5I0SA 4YLZA 4LNVA 1ULGA 4GMP1 1X8EA 2D5FA 2ET7A 1NQDA 3B9IA 1Y3TA 1VR3A 4CDXC 2AH2A 1ND2A 1QOOA 1U5YA 2B9UA 1A78A 1MEC1 1EY2A 3WINE 2WNEA 4Y1VA 1G9FA 3B93A 1RUH3 1XNDA 3MFCA 3H9AA 2DFBA 2X5IC 4DMIA 2DV9A 5GLTA 1RJ8A 1NA1A 3HBZA 4IXLA 1DGRA 1OFNA 4KGGA 3PVNA 5ABJA 4P9WA 4WM7C 3ZYIB 3VV1A 2QDNA 2JD4A 4O9GA 4M00A 5FOBB 4LUKA 1UX6A 1CAXA 3KGLA 4S2GA 4YM2A 2ZACA 4CEYB 4EN6B 4SBVA 2ATFA 1RINA 1VAMA 2HWB3 2QZ2A 3WUCA 5KC6A 2YUEA 1AR82 5L73A 4AEJA 3BOWA 5LK5A 2P17A 5IK7A 1S0CA 1FXZA 4PIZA 1PGSA 1VBC2 2P3JA 4B4PA 4ORFA 1J58A 2Z42A 4U2AA 1NLSA 2EXJA 4AI3A 1OSGA 1BK1A 2GU9A 4RL7A 3VBUB 1JOJA 1O3RA 1LOFC 3M3QA 3GBWA 1YHFA 2K9ZA 1HRV3 3IPVA 3POSA 5DUWA 3AMQA 4P5HA 1F5JA 4KG0A 1ZRDA 2F4PA 3NVCA 4QX5A 2A3XA 1FV2A 3VKMA 2ES3A 5DUXA 1F8VA 1JXNA 4HVQA 3OGJA 2ZMNA 1RUJ3 2VECA 5JVVA 3TN92 5E89A 5CAZA 2XL9A 3WW4A 3H8UA 1H8VA 2W68A 2GNBA 2B8MA 1R081 1WBFA 5IT6A 3AXDA 1EAH2 4KH9A 4AYUA 2GC1A 4XFHA 4Q0SA 1TMF1 5GLWA 2D6NA 3HT1A 5AC93 4N53C 1XRUA 1GZ9A 1WW6A 5JOYA 2BFUS 2EF6A 4WM8C 2CV6A 2DFCA 1OKQA 3PJQA 3VBFA 3RYRA 3ZXJA 1J1TA 1Q3EA 3VBHA 2WA4A 3ILNA 3JBG2 2HWF1 3AMHA 1PO13 3U10A 5GZCA 4I09A 3VHOA 4EV0A 1T6GC 2LUWA 1WCDJ 3HT2A 4AVCA 2TUNA 3P3PA 2B46X 1FPN1 2GDFA 3FJSA 1R1A2 3MICA 3ZYPA 2D6PA 3AYAA 4Q4X3 3FZ3A 3M3IA 2CWMA 2ENRA 2PHRA 1RMU1 4E2SA 1XNCA 3WNXA 2GN3A 3BB6A 4R4XA 4TWTA 4BM8A 4K20A 4AEKA 2R041 3JB8A 1MACA 4LO5B 1MR5A 4AHWA 4DINB 3RQ0A 2ZA9A 3WDUA 3IIAA 2NZ9A 3WQ0A 1I9RA 2PHFA 3DL3A 3EO6A 1G86A 2SBAA 2PELA 2XVKA 2BVBA 2OW4A 1A3KA 4FPEA 4HN1A 3VBUA 4YARA 4LA2A 1VJ2A 4RHV1 1UZYA 1U0AA 1FNZA 2BBVA 4ES8A 4A3XA 5A33A 4I0WB 4OLLA 3WY6A 1OLQA 1W6PB 4XFIA 1R1ZA 3ALQA 3JCIA 1DDLA 4RGGA 1A8MA 3C2UA 4AHZA 4CEYC 3MZHA 4YM0A 1OMIA 1LOFA 3J26N 1SLLA 2NQYA 1H2MA 2JX9A 4RA0A 4RR3A 1IZ3A 1SFNA 3NAPA 4YVWA 2X53S 2IXKA 4LBMA 1AR81 4AVSA 3OF1A 4AQ6A 2ZGTA 3PMSA 5LEJA 4FVVA 1HRV2 2PHDA 4UW3A 3WQ7A 3ZFFA 4PIYA 1S0GA 2QJVA 2GSYA 3HMYA 1TME1 3ZXLA 3NV3A 1RJ7A 3V0BB 4BLIA 3D0SA 4RR3B 1HV0A 3CJIA 5CIRA 5GKAC 4AXOA 4FQZA 4Q4V1 4OUMA 1AYM1 5FCCA 5BNPC 2D6MA 1WW7A 1NXD1 1ULDA 1AXZA 2X5IA 2IZWA 3RPQA 1W6QB 4FPKA 2BFUL 1QH7A 4GH4B 1O5LA 4LO6B 1W6NA 2ZGOA 3H1WA 2DTYA 4UW4A 1AR63 2FMDA 1LHVA 2XLAA 4F7ZA 1ZBE2 3J9SA 3B94A 1UL9A 4HPKB 5CBLA 4NHKA 1N3QA 1UF2C 3MGUA 3DGTA 4C1XA 1VRH3 1W6OA 5A3LA 4FT8A 4DRVA 1BBT3 2R042 2W39A 4IV1C 2R0HA 1X7NA 3AP5A 1X82A 1VALA 2UWAA 3M7AA 2LM3A 4JQRA 1DQ6A 5IK8A 4LHLA 5KC5A 1WLCA 1QXPA 3D5OA 2AENA 3N4MA 1QJY1 3ZMOA 1IOAA 3AJYA 2BUKA 3M1HA 1OQEA 4BIFA 4HANA 5EFUA 3SCHA 4IV1B 2PHUA 5ACA3 2WT2A 1BEV2 5F9TA 2HWE1 1XE7A 3R4UA 3KGZA 3QOPA 2MEV3 5FMOL 1SLIA 2Z2SB 3SXWA 2PLV1 3V0AB 4N43C 1O4YA 1W39A 1CJPA 3T1MA 4E4ZA 5B2GB 4UBGA 1IKPA 4BH9A 4LLOA 1C8M3 5T55A 3L9JT 2GMPA 4C0BA 3GBFA 4OZXA 1XE8A 4B7EA 4TYSA 3W59A 2G4IA 4L9BA 4DXZA 1JN2P 4QGLA 3I54A 1RUI3 1CVNA 2WFF3 3OGGA 1AJKA 1AYN2 2AYHA 4AK3A 1WGPA 3KSCA 4LE4A 4AHYA 5CFDC 2D6OX 3TWIA 3WHTA 2ZBJA 2VPVA 2W0XA 1VBC1 4FAHA 1BJQA 4XBQA 5EWSA 2RJLA 1QDOA 1JUIA 4CTEA 3EBRA 5K7PA 2UU8A 3QH7A 1BXHA 1FMD1 5GJ6A 4ISRA 4MXVA 3MW3A 3AMNA 1FT9A 4P9LA 1I6XA 4Y20B 3AZXA 1QXJA 4PF5A 5I0UA 1SEFA 1XXNA 4OI0A 4HZFA 5DDJ2 3OCPA 4LLFA 3V65A 1TE1B 2E63A 4CDUB 1LEDA 4ES9A 5SV5A 3H1YA 1ZZ7A 1RUI1 1AF9A 4NPRA 2VNGA 1QF3A 3ZXAC 3VBSA 4QXKA 3MPPG 2E51A 2VULA 5BXXA 1JYIA 1DGWX 2I74A 3B02A 1S2KA 3MF6A 2E7QA 4N7UA 3WZ1A 1YFYA 1ZBA2 3PVEA 2WZR2 4GH4C 4XF4A 4BLJA 1PNGA 5ABJB 2AUYA 2CTVA 3JB4C 1RITA 4MXWA 2HJIA 2X5IB 1I3HA 2R49A 4XJ9A 1AHSA 2WNUB 2YMZA 2W52A 4KGQA 4HVRA 3OD0A 3MDPA 3S0MA 4FOVA 2R0FA 2HWF2 4B7KA 1VBE2 2RM23 4QPGB 4RR3C 4GULA 3QCWA 1NXMA 3H7YA 2RE9A 2RR11 4A2UA 5C33A 3TBDA 4P9XA 5GLZA 2A6ZA 1FPN3 1MZFA 4FPYA 4XBNA 4IESA 3MFAA 2XWJB 5FO9B 2TNFA 4QMAA 1VBB2 1ZZBA 3VKOA 2ZMLA 4N53A 4QQHA 1AL23 3IM0A 3LOBA 4BCUA 1POV3 3AKPA 4Y1UA 2Q5TA 3ZVXA 3ZSKA 1F2NA 3TOJA 3USSA 5CB7A 1SCSA 5FAXA 3VBFC 1ZREA 5FLJA 4QD2A 4XPVA 3VBRC 3FFQA 1KQRA 5DG1A 1POV0 1WCKA 4YFWA 4Q4W1 1V70A 4S2HA 1VBD1 1RUF2 2CGOA 5CNAA 2FBEA 4N53B 5AC91 1MS0A 5CFDA 3ZPYA 4N90A 1DLLA 1D2SA 4LHNA 1K5MA 4CEWA 1S0DA 3GF6A 5CG9A 4CDUA 3I4IA 2X8KA 1AYM3 3AKQA 3MW4A 4L8QA 2XJUA 4Y5Z0 5J96B 1QY4A 3VDDA 1RHI1 2C9AA 1Q8SA 4R9BA 4XDQA 1R1A3 5JDBA 3WT3A 1MZ6A 2JICA 3T2TA 2ZCWA 3AJZA 4TLFA 3WHUA 1RUI2 2VY0A 3O7OA 3PHMA 2Q1MA 2DVGA 1RUJ2 1PO12 1N1TA 4YYOA 1XYPA 3LA7A 1WMFA 4NHMA 2QDRA 4OHXA 2HWC2 3LKJA 4E9KA 1N3PA 3E97A 1IS3A 2VH9A 2WKKA 4K9SA 5JWPA 1ND3A 4HLTA 1HXS2 2QE3A 5GM0A 3VHPA 3B5LB 3AXEA 2JG8A 1FAYA 1B09A 4ATFA 3WR0A 5K0UB 4YW4A 4IEPA 4WM8A 4Q4Y2 4Y22A 3RJRA 4MSVA 3KM5A 2Y0OA 3THTA 1AR83 1Y9QA 4NWVA 2KXLA 5J36A 2WNVA 1NOVA 1W6MA 3M3OA 4FPLA 3T1LA 3JQWA 1GQHA 4Q0QA 1O3QA 4BPZA 4HN0A 1QOTA 1GANA 2JDZA 3GZUC 4GA9A 1I5ZA 4AF9A 1EPZA 1C1LA 3RNSA 1OOPA 4XMAA 2N7GA 4XIOA 4L97A 1LR5A 4CDXA 4EWDA 1L3JA 4QPGC 3WCRA 5BNOB 1C57A 3FUQA 1R093 1UMZA 5CFCB 1VBC3 2XKOA 5BNPA 4YW3A 4Z07A 3AKRA 1ZRCA 1ALYA 2QKDA 2GNMA 4LHKA 3QACA 2E6VA 4AEDC 5ABJC 3WXPA 3ZDSA 4FTSA 1H8TC 2WS93 2I45A 2JG8B 3O0WA 1AUYA 2PAMA 2HYKA 4L2NA 1UIJA 3WW2A 2UWCA 1V6OA 1VBB3 5EYYA 3WLUA 1FATA 2XJTA 2IC1A 3CO2A 4DS0A 4P9YA 2ERFA 4KNCA 4COVA 2A7AA 4WM7B 5AVPA 5HCFA 2A3YA 4XMIA 4QGMA 2FQPA 3H50A 5LEKA 4YG0A 1REFA 2Q4SA 5T52A 2D3RA 5AC92 4JDMA 2D40A 4FXGB 4Q4W3 2WA3A 3K48A 3MF9A 1EYBA 1B35B 3ZFFB 1V00A 2V73A 1SLTA 3TN93 4CEWB 1YRZA 4ZU5A 3D4KA 2C1FA 2R1DA 1POV1 3H0OA 4XILA 3KCCA 1N1YA 2JG9B 1N47A 1GNZA 1LHNA 4YVWB 4MLOA 3TB0A 4D69A 1O7FA 2W08A 1R082 1S0EA 2LTNA 3I59A 3ILFA 4D7YA 2YGLA 1H4GA 1W6NB 2OPKA 4EN8B 2R072 3AP6A 4PDWB 1QJY3 1AR73 2A73B 1M06G 2AGSA 2ZX1A 4IEZA 1GICA 4XBLA 2F6BA 4MGYE 3WG3A 4N43B 3WP3A 1Q56A 2JG9A 3GZTB 5ACA2 1QNYA 2Y38A 4FSJA 3WDYA 1QJY2 1LGCA 3MIBA 5DZEA 2JE9A 4QPIC 4HMZA 1WMEA 3BCWA 5KWRA 4LTAA 4JAAA 3WDWA 4KWKA 4OHWA 2UY9A 4E2GA 2ZKLA 5KHJA 2ETEA 1K5MC 1NLRA 3CLPA 2YGMA 4JC1A 3M3CA 4GXLA 1VBB1 4CP2A 4UW6A 1LB2A 1MEC3 2PLV2 1UD1A 1YWKA 2ZS6B 4YZ1A 1NY72 1PGL2 4LT5A 1MQTC 3ZSEA 1GSLA 1SCRA 2MNGA 3B69A 1NCQC 2P3KA 1DQ5A 1V6KA 2VVEA 1KDMA 5DUUA 5KXBA 1GQGA 1ASJ2 1H1IA 2BGCA 1WLTA 1C8M2 1YJKA 4RQPC 5L19A 4Z8BA 4HK9A 4ZU4A 1ND3C 4FQ4A 3VBSB 1BQPA 3N3HA 1FOD3 3GHMA 5BNNB 2D6LX 4KL1A 1ULEA 4GWNA 3ILRA 5CG8A 3RZZA 3FUOA 1WW4A 2XG3A 3CU7A 4FBFA 2GMEA 5BNPB 2ZGLA 1PGW1 1RVF3 2GC2A 2DUQA 3DKWA 3DUIA 2P3IA 3JUUA 1YI9A 2A6YA 4KU8A 4YZ3A 1PNFA 3W9AA 2ZGPA 3ZN6B 1C4RA 1COV2 3ZXEA 3TNQA 5LRSA 1DQ0A 1RMU3 1RVF2 1RUD2 1ND2C 1UU4A 3OY8A 1OHFA 1PK6B 3KLSA 4A7ZA 2ZHLA 4ZU7A 2QQPA 2ZX2A 1H2NA 4IQPA 3IPVB 4W6XA 2D44A 5HCBA 5CU1A 2Q0AA 5D8AC 3VBHB 1RUD1 5D8AA 2ARXA 1AJOA 3G6JB 5ACA1 1AYN3 4RGAA 2GAUA 2WC2A 4M3CF 5DDJ1 2EXIA 1XYNA 4Y22B 2UURA 2BNNA 4LBQA 2YV8A 1LOAA 1PVC1 2NLRA 4MZUA 4IV3C 4N9IA 1IS6A 4AFMA 1RUOA 2PAKA 4X6QB 4Y24A 3DPRB 5IUQA 5JIUA 1MEC2 2I07B 5DG2A 4LA3A 1HV1A 1VRH1 1CAWA 2RMU3 4RD7A 2ILMA 4N7IA 2DVAA 2FHRA 1SQ4A 3ST7A 4SLIA 3W58A 1UCXA 4OULA 2Q1ZB 4BOWA 1O3TA 3AYDA 4KU7A 5L7OB 4AGVA 2DCYA 2VMHA 4CZSA 3AYCA 2WL1A 2IFWA 2WT1A 1RUG3 3PMEA 4MGIE 2VQAA 1SLAA 1I1EA 2AR6A 3OBRA 4MYEA 1PGL1 5FQ0B 4DY5A 4EWAA 5C4WB 1NE4A 1REEA 2XH6A 4CEYA 1V9U1 4FO9A 4ASMB 1RUG2 3I59B 1CAUA 1GFF2 4IL7A 4KG8A 5KHHA 2QCSB 1XYOA 2WFPA 2ZMKA 1D4M1 2YDEA 3D0JA 4XFAA 2Z79A 3Q9OA 3SMHA 4PDWA 1FV3A 3VZLA 3H7JA 3VBRA 5HCAA 3K51A 4JRLA 3I8TA 4XFFA 1DHKB 1JH5A 3AM2A 1C5HA 1XU2A 5BV6A 2XPJA 2WSUA 3MYXA 5E1RA 1YXWA 5KXCA 4OFGA 5KXDA 1ZYBA 1AYM2 5KHGA 1WLDA 4MV2A 3N7JA 1YI7A 4YW5A 3G7DA 1KDKA 2QNKA 4QPGA 3URFA 3I2DA 4Q8LA 3OD4A 3VLBB 1PO21 1V6IA 1FX5A 1J3PA 3FFZA 4M3CA 4YZ4A 3V64A 2BW8A 5JIAA 1ZBE3 1YJLA 3E5QA 3VBOB 3AFKA 2VMIA 4XF1A 1BYHA 5L36A 2O8QA 1NCQA 5K8SA 3RG0A 4MGZE 2ET1A 2DCKA 4E4SA 5D1IA 4B4RA 5JSRA 2D97A 1CX4A 2BNMA 1H4HA 3LGRA 2YY1A 1NCRA 1ZRRA 4Q4X1 1QGLA 2Q30A 3ZFGC 5C8WA 3JU9A 4R9CA 1QDCA 3DF0A 3RSJA 1HKDA 2IXJA 2R6QA 4XQDA 3E5UA 1URXA 4WVWA 1X36A 1A6CA 4Q0UA 2VVDA 4OUSA 3NAPC 1PK6A 2HWF3 4YZ2A 2CNAA 1QJZA 2XUMA 3VZKA 2EA7A 4FOWA 2NPIA 3U4XA 2ZX3A 1ASJ1 2KM2A 3CNAA 2ZGMA 3HQXA 4CDQC 3RS6A 4D7TA 1IKQA 2BTVC 4TSVA 4WVZA 3ZN6A 5JLVA 5T3NA 2P37A 1SMVA 1LHUA 4B29A 1CONA 2H0VA 4L99A 4RSUA 5C8CC 2BYVE 2EXKA 4XYXA 4AE2A 2R30A 3ZXKA 4AQ2A 2ZGUA 5AFEA 1UPSA 1LULA 1S2BA 1YLLA 1CR7A 4YVSB 4B8EA 3ZYJB 2XBO3 2DURA 3TYJA 2H6CA 1OPOA 3N7MA 1TEIA 4HL0A 1HLCA 3PJYA 4URTA 3LA3A 3HN1A 3FLRA 4FPCA 1IGOA 3R4SA 2B5HA 4RHV2 4XJZA 2WINB 4XF9A 2A70A 4ZKTB 1TNRA 4QM9A 3RWNA 2D3SA 1LKNA 4XIKA 1LCLA 3E6BA 2DYCA 4J6GA 2D5HA 1FMD2 2XJQA 1FOD1 4COWA 1AL22 4GALA 4M01A 1RGSA 3VDDC 4R9DA 4IV1A 3ETQA 3ZIXA 1WBLA 1CGPA 2HEWF 5FREA 1MS8A 2UWBA 2VVFA 2CGNA 2RS13 3BPZA 4LO8A 2RJKA 2D6KA 3BOPA 4B4QA 1GR3A 2VG9A 2DVBA 4W6WA 2ZGSA 2ZGQA 1G8WA 3ZSLA 4I0AA 2WWSA 3KB5A 4Q4Y1 4OHZA 4JGZC 3OJBA 2VW2A 4LBNA 4GH4A 1KXGA 3PVBB 1TME3 4JGYC 4K3UA 4QQOA 2SLIA 3UKNA 1LOBA 1YYNA 1WMDA 2E9QA 4X8PA 4M0HA 3LSDA 3RDIA 3JD72 4WBBA 4LR4A 5J48A 4R9AA 4NN0A 4RS5B 1VAVA 2XJRA 1OQ1A 1X33A 4C0HA 4DPNA 2HWD1 2DU1A 1ND2B 3KCYA 1SLCA 3CJIB 5JOWA 1JW6A 1LODA 2YROA 4DNYA 3CJIC 5H9PA 5EYXA 1D0GA 3NKGA 3USUA 3FWEA 2PTMA 3ZYGA 1RC6A 1VRH2 1HQNA 2FZ2A 3NKTA 4RS5C 4XF0A 1MS3A 1RUF3 5KXEA 4IEYA 4BWOA 1O91A 2BQPA 4AQTA 1AR92 1LTEA 1LRHA 3E6DA 3P3NA 1PVC3 4GB33 4WM7A 5T5PA 4AEDA 1RUE3 4Y26A 3RYKA 4FPGA 5T50A 4K1ZA 2EALA 1YFUA 3B01A 3LOIA 3RYPA 1AYN1 4YRDA 3WOGA 3WW1A 4JDOA 3ROUA 2IFRA 2RM21 3UJOA 3VBSC 1AXYA 5FRAA 4CDWB 1DGLA 3E5XA 1FOD2 5FDBA 1H0BA 1A8DA 1RUNA 4IERA 2WLPA 1V9U2 4MX3A 2UYBA 3FC0A 4Y20A 1YFWA 3J8F3 2ZHKA 3MIDA 2VW0A 4UBHA 3THPA 3WX5A 1RVF1 4AW7A 1RUF1 3N7KA 2HWC3 1PO11 1AVBA 1ASJ3 2VNRA 2YC0A 4K21A 2H6BA 4QQPA 5AFBA 4BYYA 4JV4A 5JZGA 1ZZ9A 3RMYA 1SBDA 2UY8A 1JTZX 3ZFEC 3O0XA 4HKLA 4UXAA 1MZEA 5FLIA 3MIHA 3ZFEA 2R1BA 4EN9B 2GMMA 4JCKA 3D8CA 5A32A 5K9YA 4TZDA 3S6PA 1ENSA 4I2OA 1EPWA 2A3WA 1C8NA 1C5IA 4AG4A 3EQEA 1WLWA 2P2KA 1FYUA 3PVOA 2BPA2 1S0BA 2CY6A 4KBBA 2PYTA 1QMJA 4FTEA 3GYDA 5J98B 1W6MB 1Z0HA 3NV1A 3AMPA 2P34A 1DZQA 1QKQA 1DF0A 2WNVC 4WVMB 4XFGA 2ZAHA 3ZXGA 2DUPA 1UPIA 2ZAAA 1X50A 3CJXA 2A71A 5T5OA 1H1AA 1H9PA 1MVEA 2NYYA 5GLVA 3KMHA 5LRRA 4FOYA 2BWAA 4H7MA 4AVAA 2R071 1YNAA 1UN1A 2VW1A 2OVUA 4PCRA 4FPJA 4PLMA 1GZWA 1NY71 1UIKA 3I7DA 4IEWA 4QQLA 2CAUA 4JRAA 3C3VA 4BA6A 4ASLA 1CQ9A 1FPN2 2VOXA 2WFF2 1YO8A 3AKSA 3IT8A 4JTOA 4IETA 1NA1C 3FLPA 3PLQA 4M0NA 1J59A 1VBE1 3VGIA 4UW5A 4V1PA 1EV11 3L2YA 2G9GA 2ZJCA 1LENA 4K6BA 2RR12 3ACLA 4XXPA 1OA4A 5DXDA 1OA3A 2RM22 1ZZCA 1YUDA 2V5YA 2V09