3VBOC

Crystal structure of formaldehyde treated empty human enterovirus 71 particle (cryo at 100k)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
239
structure length
239
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
molecule tags Virus
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
total genus 40
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vboC00
3JBG2 5C9AB 2FZ2A 1PIV2 1DDLA 3CJIB 4RHV1 1RUJ3 3ZFFC 4CDQB 3HAGA 4QPIC 2X5IA 2RMU1 2RR11 1CD3G 3ZXAC 1COV1 1HRV2 4YVSC 1OOPC 1HX6A 1R082 4FTBA 3ZFEA 1HXS3 5AC91 1W39A 2R062 2XBO1 2GSYA 1RUE3 1QJU2 1NCRA 2HWC1 1H8TC 2ZTNA 1PVC3 2HWD1 1ND3C 5BNPB 1BMV2 4JGZC 4N53A 4CEYA 1RHI3 1POV3 4IV3B 1EV12 4QPGB 5FOJB 1RVF1 1RMU2 5CFCA 1RHI1 2HWB1 1NCRB 1NCRC 1BEV2 1PGW2 4GMP0 1RUI2 1PVC2 3ZFGB 2XBO3 1VBC1 5L7OA 1AYM2 1R092 1AR61 1ND3B 1OOPB 3VBSC 1H8TB 1BBT3 1X36A 4PDWA 2HWE1 1AR63 1VRH3 1MEC2 2PLV3 5CFDA 4Y4YA 1RUI1 3VBFB 4GB32 1AL23 1QJX2 1IHMA 4EJRA 1ND2A 5C4WA 1RUH2 4AEDC 3ZFEC 5C8CC 1EV11 2RMU3 3TN93 1RUJ2 2VQ0A 1FPN3 1EAH2 1MQTA 3JD73 1ZBE3 4WM7B 4CDWC 3LOBA 1RUD2 4JGYC 1HRI1 1AYN2 3VDDC 1M06G 2R042 1AL22 1K5MA 1VBA2 1RUH3 1RUE1 1R081 1PGL2 5A32B 1RUC2 3VBOA 1RUF3 1NA1C 1HRV1 4QPGA 4WM7A 3FBMA 2HWD3 1AL0G 2HWF3 2RM21 2RS11 3VBUA 1V9U1 5A33B 4RFT0 3JB8A 3ZFGA 2RS31 3VBOB 3VBSA 5GKAC 1VBD3 5L7OB 1FOD1 4AEDB 2BFUL 4QPIA 2WZR1 3J8F3 1R083 4Q4V2 2RM22 2RS12 4FTEA 1OPOA 5C8CA 3VBSB 1AR93 1PO11 5D8AC 1RUE2 4RS5C 2WS92 2WFF3 4IV1C 2GH8A 1VBA1 5K0UC 1CJDA 1EV13 5LK7B 5BNOA 1SMVA 1C8M2 3ZFGC 4CDXC 1RUD3 1FOD3 1QJZA 4CEWB 1PO12 1ZBE2 2RS33 3VBRA 4N43B 4QPGC 4GMP1 2BBVA 3JB4C 1QJY3 4Q4V1 2RS52 2R071 1AR81 1PIV3 1PIV1 4SBVA 5BNPC 1R1A2 1C8M3 1MEC1 4YVWA 1HRV3 3VBUB 1NCQB 2WLPA 2RS32 4GH4C 1TME2 1EAH3 1V9U3 5DDJ3 1AR62 4IV1A 4JGZA 1TME1 4YVSB 1FMD1 1B35A 5DDJ1 1VBE1 5JZGB 4AEDA 4QPIB 2Y26A 4YVWC 4NWVA 3CJIC 2WZR3 1PGL1 2RS51 5D8AA 1MQTC 1WCDJ 3ZFFA 5BNNC 3VDDA 1VB4A 1QJY1 4Q4V3 1B35B 1ZBE1 5JZGA 1HRI2 4Q4Y3 1TMF1 1VBB3 1C8M1 4FTSA 2IZWA 4Q4X1 1BBT1 2FZ1A 4Q4X3 1QQP1 2BFUS 4Z92B 5AC92 2WS91 2PLV1 1K5MC 2R063 5CFCC 3VBHB 1C8NA 1OHFA 4RR3B 1QJU3 1RVF3 5BNNA 1NCQA 1Z7S1 1RMU3 4RQPB 3VBHA 1PVC1 1R1A1 1E57A 1RUI3 2R072 1V9U2 2X5IB 3CJIA 2WS93 1RVF2 1RUC3 4NWWA 1RUC1 4Q4W3 5C4WC 1QQP2 3S6PA 3DPRC 4CDUA 3J8F2 3NAPB 1BBT2 3VBFA 1PO21 1RUD1 1VB2A 4JGYA 1D4M3 1HRI3 4GH4B 1NCQC 1RUJ1 4WM8C 1VBB2 4N53B 4IV3A 1RUH1 4RHV2 1AR91 3NAPA 4GB31 1TME3 3VBRC 3JBG1 1ASJ2 4N43C 4CDQA 4N53C 2HWE2 4WM8B 1AR71 3DPRB 1F8VA 1NOVA 1OOPA 1GFF2 1VBC2 3M8LA 1PO23 2RR13 1ZBA2 1H8TA 4GMP3 3TN92 4RHV3 5A33A 2X5IC 1ND2B 5C4WB 1HXS1 4WM8A 5CFDB 5BNPA 4Q4Y2 5ACA2 2HWB2 4GB33 1RHI2 1RMU1 1VBB1 2R043 1AYN1 4Q4X2 1BMV1 3JD72 3JBG3 1PO22 4RQPC 2HWC2 5L7OC 5BNOC 1POV0 2XBO2 2R061 2ZAHA 2HWB3 3VBHC 2QQPA 5ABJB 1K5MB 4RR3C 4BCUA 5FMOS 3TN91 5A32A 5ABJC 1D4M1 1ZBA1 5BNOB 1COV3 1FMD2 4CEWA 1TMF3 1QJX3 4Y5Z0 5AC93 2HWF2 2DF7A 3DPRA 2HWE3 1Z7S2 2HWF1 1RB8G 1MQTB 1BEV3 5CFDC 1NY71 1AR82 1RUG1 1B35C 1ND2C 1VBA3 4YVWB 2WFF1 5C8CB 1FMD3 1Z7S3 2HWD2 3VBFC 4LLFA 1FPN1 1QJU1 3J8F1 5JZGC 2R041 3VBUC 1VAKA 1AUYA 3VBRB 1AR83 1EAH1 2HWC3 1NA1A 1QJY2 5FMOL 2RR12 2RMU2 1RUG3 5ABJA 1VRH1 5ACA1 4N43A 1QQP3 1X33A 2RM23 2RS13 1HXS2 4CEWC 2RS53 2BUKA 4CDXB 5ACA3 4IV3C 2MEV1 1AR73 1VBE2 3NAPC 5K0UB 2BPA2 5DDJ2 2WWSA 4IV1B 4JGZB 4RS5B 1RUF2 1ZBA3 1AYM1 1R091 1AYM3 1R093 2MEV2 4CDXA 1ASJ1 1D4M2 1ASJ3 5J98B 1AYN3 5D8AB 1PGW1 1BEV1 1MEC3 2PLV2 1AR92 1VRH2 4RS5A 3IDEA 1VBD2 4CDQC 1AL21 3ZFFB 4FSJA 4Q4W2 3JD71 2MEV3 2XPJA 5C9AC 1TMF2 4Q4W1 1F2NA 4PDWC 3VBOC 4CEYB 1NG0A 1VBD1 1FPN2 2R073 4CDWA 5CFCB 4Q4Y1 1VBC3 1QJX1 1NA1B 2TBVA 4YVSA 1COV2 1R1A3 4CDUB 5C9AA 4CDUC 1A6CA 2WFF2 4RR3A 2ZZQA 1RUG2 1NY72 4JGYB 1RUF1 5J96B 4CDWB 4GH4A 2WZR2 1ND3A 1HQNA 4WM7C 1POV1 1FOD2 4RQPA 5K0UA 1AR72 1VBE3 4CEYC 1PO13 4PDWB 3VDDB 5BNNB 3ZFEB
chains in the Genus database with same CATH superfamily
3MZHA 5I0TA 4XW3A 2FZ2A 4IE7A 2AUYA 4P9LA 3CJIB 2OUHA 4QAWA 1G8WA 1LENA 2VZQA 2JB8A 5DXDA 3WNLA 5ISLA 3MLJA 2W46A 2W95A 4YGDA 3PVNA 3ZSMA 4QQOA 2JX9A 2W68A 3UGGA 3ASIA 3CMGA 1I3HA 5DUWA 4IESA 4AW7A 4YVSC 4XHBA 1YIPA 1GQGA 4FTBA 1P8JA 3SLIA 4OUEA 2R062 2XBO1 4A45A 5FZEA 3SEPA 3USUB 4QT6A 4AI0A 4OULA 2HWC1 3CEWA 2ZTNA 2E51A 2WYSA 4BIFA 2JICA 5I8TA 1D2SA 2XJTA 1MS8A 4HSJA 4EWDA 1AXKA 5J37A 1ND3C 5FKBA 3C7EA 1UYPA 2GN7A 3ACLA 5BNPB 2JDMA 1SZBA 1BMV2 4Y1ZA 4AYUA 4CEYA 5JDBA 2RG4A 1CZVA 1POV3 5LWBA 5HV4A 4QPGB 1N3PA 4EN9B 1RVF1 2CV6A 1RMU2 1SDWA 1W0PA 4Q0SA 1YFXA 2B9VA 4W4ZA 3HT2A 1WBLA 4LBOA 2WO7A 1NCRB 3T1MA 4BE3A 1BEV2 1W8OA 1VPHA 4LO6B 1JZ5A 3ON7A 2VE1A 1H1AA 4GMP0 2XG3A 5DN2A 1PVC2 2IFRA 4QX8A 4S2DA 3ZFGB 3FE5A 1HW5A 5LY1A 3FUOA 4CTEA 5K9YA 4FI9A 5HCBA 1O91A 1R092 1ZRCA 1ND3B 4FXKB 1POQA 1W9FA 2DCKA 1WA4A 1X36A 1J3PA 4PDWA 5FQ0B 4EWEA 5JXIA 3FFZA 4H2AA 4DMIA 1UMIA 1Q8OA 2Z69A 2FQPA 4GIQA 2GMMA 4JKLA 1LEMA 4GB32 1AL23 1MS1A 4QPWA 3RGBA 1RUH2 4CCKA 1NKGA 5CKMA 1F35A 3IMMA 5C8CC 2XWJB 2ZHNA 1RUJ2 4UT5A 1RYYA 5F7UA 5A3LA 1UY0A 2W91A 1ZBE3 4M3CB 4WM7B 1UX6A 1RUNA 2JG8C 1OF3A 5A3UA 1RUD2 4QWNA 1Q8SA 1HRI1 2WWUA 4MGQA 5FPBA 4XF3A 4AF9A 1E5HA 2YUEA 1AYN2 1OPMA 4NRPA 4GA9A 2ZMNA 3NV1A 3WW3A 4MX3A 4KWUA 2RJ2A 1OA3A 1J84A 4L99A 4OHVA 4FAGA 1W05A 5EJ3A 2YC0A 2GALA 2XJVA 3R4SA 3WD5A 5KXCA 1V6LA 4CXYA 3O1UA 4NIGA 1F15A 1NA1C 1ULPA 1PVXA 5KXDA 1I6XA 1F4AA 1GOFA 2WSUA 1CPNA 4WM7A 5CA6A 4EZ4A 3O1VA 2KD7A 1BYHA 2BRTA 2OQ7A 1V9U1 2WRAA 3BU7A 4UBHA 1VAMA 4PJYA 3TEWA 4AEKA 1XRUA 2PAEA 5F1RA 2A71A 3E6CC 3PURA 4MZUA 4S2HA 4P9WA 3K4ZA 3I3DA 1Q3EA 3TNQA 3ZM8A 1YFUA 5GKAC 5L7OB 1FOD1 4XE9A 5FZKA 2D6MA 2BFUL 1VMFA 3IDCB 1HN0A 4R8HA 2BWAA 4XFHA 4YW2A 3ZN4A 2ES3A 2TNFA 4G3YC 3GBFA 3W59A 2CL2A 4A4AA 5H9RA 1GWMA 1CAXB 2ZHLA 3ZSEA 4AFCA 5KXEA 5DUVA 2WN2A 4AFDA 2W9XA 1D0GA 1DBNA 4AAPA 2J22A 3N36A 1G9AA 3AYEA 1OURA 1W2NA 2DBIA 2WNUC 3PUHA 5CIRA 3B01A 3B00A 2YYOA 3POIA 4W8JA 2VZOA 2FHRA 2VBBA 4KBBA 4BJ0A 1EV13 2QZ3A 2WL1A 5IJRA 1C8M2 4AVBA 4CXWA 1ZVFA 1CAVB 4CDXC 4LQRA 1FOD3 3PIJA 4CPBD 2ZCWA 2O1QA 2W1QA 3MPPG 2W1SA 2HH9A 2IXJA 2ZPXA 5EV7A 5LA9A 1VE0A 1DZRA 5F39A 4LO8A 1MZEA 4M01A 4PIYA 3M3CA 1N1VA 4IEWA 5AFBA 1WCUA 4YVWA 4BB3A 4XFAA 3FFQA 2RJKA 3VBUB 1CIWA 2WLPA 3M4FA 2G9GA 1TME2 3ZYBA 3S30A 5FZ4A 2BNNA 4TXWA 5FZGA 4AI8A 1JODA 1W0NA 4QGMA 4YVSB 4W65A 4BQYA 5C3OA 4BQXA 4Q8KA 4Y33A 1ZZ6A 2VCBA 2B5HA 4QPIB 2NYYA 2EXIA 1DIWA 1QDOA 2Y26A 4OQ9A 1WMXA 3LPGA 3BTYA 3NWKA 4JQRA 4NHKA 4QU2A 4FPGA 2ZHMA 3OGJA 5LBCA 3WZ1A 2W1WA 1DGRA 3NL1A 3RZHA 5BNNC 3GHNA 3VDDA 4AAXA 4H3WA 4FOWA 4YGBA 4Q4V3 4AFBA 1B35B 4CCOA 3O1SA 5T5PA 4UFJA 2E7AA 2P6CA 3RSJA 1DQ6A 4CP2A 4Q4Y3 3VUOA 1VBB3 2G1MA 4KU8A 4TTGA 2IZWA 4Q4X1 4ASMB 4D69A 3BOWA 4J1WA 3WNMA 1HIXA 1NYWA 2BFUS 4KGQA 2WNVC 4P5YA 4QQHA 4BZ4A 4IGOA 3KHBA 4LKDA 3DEMA 2KM2A 5FK7A 5LW9A 5KHJA 3AKTA 3PTRB 5L9VA 2LW8A 3AMMA 4D0QA 1KITA 1ZZ7A 3KWVA 3C7FA 4I3GA 4LUKA 3RJRA 3TRSB 1C8NA 5JSRA 1EPWA 2JDHA 3ZKYA 4OYUA 4YPJA 2Q0AA 5G05L 1NE6A 4UFKA 1UKRA 4PBOA 1QJU3 4B3NA 3NNGA 4EROA 5IVEA 1RVF3 2WYFA 3DYMA 3IDAA 5F5AA 2BVBA 1C1LA 1CPMA 4Z82A 4R9CA 3ZYHA 4TZDA 4OVEA 4HOOA 1X82A 4YG3A 2D40A 3VBHA 3THTA 3BTZA 1E57A 2ZJCA 2W52A 5JOZA 4LKSA 2VMGA 4TLGA 1E5IA 2R072 2LS6A 2X5IB 4XF1A 2C26A 2LROA 4LEJA 3MI8A 4LOTA 2WS93 1DGWA 5KWRA 1GP4A 4D94A 1G7YA 1CWPA 1LCLA 1ZX5A 2WT0A 4NOTA 3WNXA 1CAUB 1L7LA 5C5UA 4TWTA 4BU2A 1URXA 5LZ6A 3K46A 1ZRIA 2DTYA 5LA0A 5IWFA 2CTVA 5DPNA 5SV5A 2G19A 2ARXA 4I01A 5GLZA 4E2SA 3WP3A 4JQTA 1D4M3 1W2AX 2Y8KA 2ZEWA 4MXWA 3RZLA 3O1TA 2JD9A 1BVP1 4N90A 4AQ6A 2R16A 2R7EB 1HDKA 2VXRA 3APBA 2R1BA 4Y22B 1UX7A 2P1BA 2FMYA 2F4LA 3VDBA 5FYMA 5FO7B 1AR91 1N3OA 3CZUA 3VBRC 1APNA 2YU1A 4NAMA 2QQVA 3JBG1 4M4PA 5JOYA 3I3QA 4LHLA 1S0BA 5A3WA 4N43C 2XHNA 1CN1A 2HWE2 2BQPA 4WM8B 2DFCA 1WCKA 1OOPA 1QJEA 5C71A 5FJKA 1X8MA 1UN1A 5H9SA 3M8LA 1PO23 1U0AA 2BV4A 1KXGA 3RZJA 1LOFC 4P9YA 2VL4A 2WNUB 1NLRA 1IPKA 1LESA 1W2TA 4XOGA 5A33A 3ACHA 5FUIA 1LHVA 1UD1A 4WM8A 1WW6A 1OLRA 2A7AA 2VPVA 3AFKA 1K3IA 2VQAA 1ODMA 2I07B 3QH7A 1RHI2 4GZ9A 3ZKUA 3J7HA 2XB6C 3A0NA 2XJSA 3UKTA 1VBB1 2ETEA 1NAEA 2VCMA 4YZ4A 1AYN1 4Q4X2 4KWJA 3F2ZA 4NE9A 2QQJA 2DYCA 2WNUA 4Q8LA 1JMUB 2EXKA 4L0PA 1NXMA 3ELNA 1PO22 3SCHA 3KVBA 4RQPC 5G04L 5L7OC 1CAWB 4IQPA 2OW4A 5ANNA 4M3CF 4QDSA 4LBJA 1WW5A 1BLZA 1QIQA 1JZ7A 4LBQA 3HN3A 3VL8A 2QQPA 2YG0A 4RFRB 1MPXA 2W87A 1DZTA 2XJUA 2E33A 4ZU4A 4JTNA 4RR3C 1S0CA 3OGGA 1YJLA 5FMOS 5FZ1A 3TN91 5ABJC 1XB9A 4QB6A 4R9DA 2WAOA 1XE7A 3KV4A 2JJ6A 1C5HA 1W9SA 3KCYA 1ZBA1 4UFHA 3LB9A 1NX9A 3H1MA 4Q0QA 5LY2A 3R6SA 5A6XA 4U36A 3I2GA 3HQRA 2X05A 1QJX3 4LBQB 1H2KA 5BXXA 4AG4A 5FOBB 2WFPA 1OH3A 2DF7A 3IKWA 5LEJA 4O9GA 4PLMA 4LJHA 1IZ3A 3WG2A 3EXUA 1GBGA 1U5IA 1GZWA 1MQTB 3LSEA 1W2UA 1W6QB 4IUGA 1NY71 2ERFA 4AGRA 3ES1A 4YVWB 2Q1ZB 1SLLA 3D8CA 1XNDA 4JKKA 5D21A 4DUXA 2JE7A 2W94A 4K7JA 5C8CB 4AZZA 1QHDA 4HK9A 5FYVA 1OLQA 2QTWB 5GZDA 1Z7S3 4XBLA 5KBFA 3B02A 4IEVA 1YFWA 2JECA 4RN5A 4QKFA 1T6BX 4LLFA 2N7GA 4U2AA 1HB4A 2XJRA 5CB7A 1KDMA 4W50A 4I3PA 1MACA 2AH2A 3J8F1 3RVHA 2XUEA 3VBUC 4FFHA 4XJ9A 4DQAA 3U4SA 5J7MA 2VNGA 2DUPA 3S5QA 4EN8B 3VZOA 1YWKA 2Y0IA 2RVAA 4I09A 1OF4A 1SDDB 3W9AA 4E4DX 4B8EA 1C5IA 1QJY2 2WT1A 5A7QA 2RR12 3MLLA 2XVLA 5ACA1 4N43A 1A34A 1I9RA 1QXJA 3K2OA 1RL3A 2RS13 3AL5A 5E89A 3O14A 1HXS2 3RFRA 4BMBA 4FAHA 1OD3A 2CDOA 2VZ1A 5ACA3 4IEXA 3QD6A 4CU8A 2H0BA 2PAKA 4Y5TA 4Y4RA 1XSRA 4O9EA 5IVYA 2AYHA 3UJOA 1E5SA 3C2UA 4P5HA 5KHHA 1S4CA 4LA2A 1K42A 2WNVA 1R091 2Q8DA 1F9KA 4NAOA 3NV4A 1Q5OA 1GNHA 4BYYA 2QFEA 4YW4A 2A5ZA 1A8DA 3DXTA 3D4KA 3LCPA 2ZS6B 1ASJ1 1D4M2 1EYBA 5FPVA 1W03A 1A8MA 1OUSA 3HQXA 3IPVA 3FC0A 4LBNA 3CL1A 5D8AB 3U75A 3FBYA 1BEV1 4QX1A 4HLTA 5A7PA 1W9WA 4P08A 1TQ5A 2JE8A 4CP9A 2BGPA 5JI9A 2IVIB 1IQAA 1LGBA 2RHPA 4NMIA 1ULEA 4XTPA 4AHXA 2XR4A 2BW8A 3DL3A 4DXSA 3VD5A 4E8CA 5F2SA 5KHGA 3P3NA 1OBNA 4QPYA 3WY6A 1ST8A 1KFUL 2JENA 2ZACA 4COWA 3MHZA 2FCVA 2PELA 5CNAA 2J7MA 5FYTA 2P6HA 5IAXA 5L73A 3N7MA 1XNAA 5HV0A 3LFIA 4BA6A 2JDAA 2HYKA 4XYXA 2R073 4CDWA 3PUSA 3U78A 4LE4A 1QJX1 3ZXDA 4ATEA 1LR5A 4XVHA 3OTFA 3WF0A 1OVPA 3ZYIB 2XHKA 4NHXA 4AEJA 3A22A 3LQCA 4A6OA 4CDUC 4DIQA 2WAAA 2P3JA 4EN0A 5B4NA 2XLFA 5J96B 1YQ5A 4CDWB 4GH4A 1QMJA 1AF9A 3JUUA 1ND3A 4WM7C 4OHYA 4RQPA 5K0UA 3HN1A 4CEYC 4A3ZA 1PO13 2VZVA 2VTFA 3HT1A 1G9BA 2FDJA 5BNNB 5IFTA 3ZFEB 3JZVA 4Z1VA 3JBG2 3TB0A 1JI6A 5C8WA 1W8TA 1PIV2 5DZGA 1LOGA 1CR7A 1CJPA 1GNYA 2QDRA 2GC0A 1RUJ3 3ZFFC 4ZS3A 4CDQB 3HAGA 4QPIC 4CU9A 4KI5M 3WF3A 3U10A 2QDNA 1COV1 1IOAA 1JHNA 2A3WA 5DMYA 3GM8A 1HX6A 1S2KA 2VVEA 2ZEYA 5FY8A 4SLIA 1H4HA 1K12A 1S2BA 1UKGA 2VC9A 4XAEA 4LO5B 1QY4A 1LB2A 3OYWB 3V64A 1LGCA 1RUE3 2MNGA 3T2OA 5L9RA 3THDA 3ZO0B 2CGOA 1WMDA 1PVC3 1EPZA 2OPKA 1E5RA 1KD7A 1LNSA 2VD7A 3WG1A 1HJFA 3MUY1 4JGZC 4DY5A 2D97A 4E4HA 3MYXA 5LRRA 4PBPA 4AFMA 5EYYA 1EV12 1YYNA 3S0MA 1SHWB 1OLME 4PHZA 3IMNA 2HEWF 4Q26A 2SBAA 2A6VA 1PGW2 4BM8A 1KQRA 3WP4A 1D7PM 1RUI2 3V56A 2WT2A 4L11A 3OSDA 1JOJA 2Q4SA 3N9MA 2VOWA 4OHXA 4NJ4A 4QMAA 2QQOA 3K4AA 2XBO3 1AZDA 5FYIA 5FLJA 5LBEA 5L7OA 1HQWA 2VM9A 3ZSJA 1MVQA 2NLRA 3H0OA 3VBSC 2ZMLA 3LOIA 1OFNA 3H9AA 2HWE1 2W39A 1AR63 1UF2C 3AMNA 3I8TA 3M7AA 1HN1A 4Z8BA 2FDGA 1IG0A 1NXD1 2D3PA 1PMJX 2WBKA 2PLV3 1QGLA 5IK7A 3VD4A 4Y4YA 1RUI1 4LHNA 2VY0A 3VBFB 1O5LA 1IHMA 5C4WA 4IE0A 4ONUA 5A7OA 5EHDA 5K4LA 3ZFEC 1Q8QA 1EV11 2RMU3 3HNBM 5A7SA 5C3PA 1W0OA 3V65A 2NQYA 4CCCA 3M3QA 4YW7A 4H7MA 1JYTA 1FPN3 1MQTA 2RJLA 3JD73 3LZZA 4WV8A 1H1MA 1YHFA 3FHQA 4XCBA 3TAYA 3B7MA 3GCWA 3IWZA 4RA0A 2BJSA 4CDWC 3LOBA 1JYXA 3MIFA 3S7IA 4OMCA 4DRRA 3AXDA 3VDDC 5JAXA 2B39A 2VULA 3N7JA 1AL22 2P34A 4K8FA 4NPRA 3VZNA 3WNPA 4EJRA 1VBA2 3J26N 4META 5J36A 4FPYA 1UCXA 2EIEA 2VH9A 1RUF3 4BQ1A 4F83A 4HPKB 1HRV1 1BKZA 5FPZA 4LTAA 4COUA 1CX4A 4WZCA 1S0FA 5FLHA 1MZ5A 2BOIA 2HWD3 4YLZA 2HWF3 2VUAA 2RS11 3ZSLA 1K45A 4YYOA 4IE5A 1KJLA 1QOOA 2JDZA 3NV2A 1F31A 5J98B 1MR5A 4R9AA 4DPNA 1T6GC 2OIIA 1GU3A 3HJRA 2JG8B 1WLWA 2W2IA 3ILRA 2V5YA 3JB8A 4LT5A 3G6JB 2DU1A 2DUQA 4KL1A 1WLDA 4MUVA 5CG8A 3VBOB 2BOJA 2D93A 4NROA 4XAAA 2D6LX 5GZFA 3EJKA 3POEA 5F3IA 4AEDB 4XFIA 3CHXA 3AM2A 2WZR1 3LDKA 4QPIA 2K2SA 3J8F3 1MZFA 1DFQA 2J1TA 3C7OA 3KM5A 3MLKA 4FPEA 4OCTA 5FQ0A 3AKQA 5A6ZA 3BTXA 3KT1A 2DURA 2RM22 2RDRA 3DKWA 4KMQA 5GZCA 4Q0VA 2VMEA 2DVAA 4CP1A 5A1AA 4XBNA 3PNAA 5I8YA 1IS4A 3DGTA 4OI2A 4UAPA 3WDTA 1RUE2 5FY9A 4E4SA 3PJYA 3TEXA 4HANA 5FWJA 4HZFA 2DWRA 5FFOC 2E26A 4QGLA 5K0UC 4B7EA 4IETA 2EAAA 5DUUA 3IPVB 1SMVA 3WW4A 3ZFGC 3CBNA 1GMMA 5FZ6A 2ZKNA 3LKJA 2V5DA 4PQQA 1JH5A 1PO12 2JKXA 1CONA 1PZ9A 3VBRA 1DYOA 2PHWA 1PM7A 2YC2A 3L9JT 4I30A 3ME2A 2ZEZA 4QPGC 1YQCA 2JIJA 4ZS2A 3ZVXA 5GLWA 2E32A 2X8KA 2ZAAA 4PI2A 1ULCA 4NIIA 3FJSA 5BNPC 2ZEXA 4BXFA 1C8M3 4RSUA 4Y3OA 4AHZA 1QXRA 5A1LA 5EIYB 2YROA 3POYA 4UWDA 2RS32 4GH4C 4IEOA 3B94A 1EAH3 4ZY9A 1SBFA 5DDJ3 2AENA 4IV1A 4JGZA 3HBZA 3O1PA 5JLVA 2DDUA 2SLIA 4PIZA 4XQDA 5DDJ1 3WHTA 5JZGB 4Q1RA 1QNWA 3NNMA 4E27A 2Y6GA 3TBDA 2P17A 3RMXA 1HB1A 5AVPA 4XDPA 5B4XA 4YGCA 4YVWC 2ADDA 2VOXA 1SLTA 2QZ2A 3CJIC 1H6YA 1XXNA 1ZA4A 2H6BA 1MQTC 4D7SA 4N7IA 3MIBA 4PIXA 1QOSA 4CCJA 1V6OA 3ZIXA 4AI3A 1N1SA 2ZXQA 3V0BB 3V0AB 2WKKA 1REEA 2VVFA 4XUPA 1BCXA 5JZGA 3OBAA 1R1ZA 1L3JA 4JDNA 2VMIA 5DAWA 4FTSA 1BBT1 3BN6A 1GP6A 5CG9A 4QGNA 3PL0A 2CWSA 4MXWB 2JIGA 4QXHA 4AEMA 1O4ZA 2ZX1A 4HVQA 1X50A 3K4DA 1QQP1 2JG9C 5DZFA 2C0ZA 4LO7A 4AGVA 2WZEA 1FV2A 3AP9A 3AVRA 2PLV1 3LEIA 4FPCA 3MIDA 4A7ZA 2R063 5BUVA 1ULOA 4XXPA 5EQUA 3EHKA 3TYJA 5F3CA 5C33A 5FYSA 2CSGA 2BEOA 2E63A 2VOTA 4K3UA 4CCLA 2DBNA 2ZGMA 2OUJA 1AX1A 5FR3A 2J1VA 3ES4A 2PAMA 3GJAA 4OI0A 4BH9A 5IK5A 1UPSA 5FY5A 1GZTA 3H8RA 3EBRA 3OCPA 4BQWA 1RMU3 3FMGA 4IERA 4MGKE 5GZGA 3N9LA 4PT6A 1LOEA 4PQ9A 4Y26A 4MV2A 5A70A 1UY4A 3UETA 3KF3A 3E5UA 4TSVA 4FT8A 1V9U2 3E6BA 2IXKA 4M4RA 1KRIA 5AFEA 3KQRA 3QH6A 3ZPOA 4FOQA 2VR4A 2NM1A 3U11A 4NWWA 3J4UH 2ZOEB 2W08A 1GZCA 3AP7A 3WLUA 3OYWA 5CAZA 2EICA 2VMFA 5EYXA 5T3NA 2AREA 1ULFA 3S6PA 3SCFA 4FFFA 3J8F2 3NAPB 5A80A 1VLNA 2ET7A 2WSVA 3SNMA 1RUD1 2PHUA 4X6QB 1H2LA 3UGHA 1WD4A 4Q2FA 4IE6A 1S0IA 1GWKA 2RDQA 1KJRA 5CKNA 1NCQC 1PNGA 1RUJ1 3MW4A 1T2XA 1RGSA 1OC1A 2NMNA 3ORJA 1D2QA 4XJ8A 1RUH1 4I0AA 5FZ7A 1ZZCA 2ARCA 2JB4A 3NAPA 2W0XA 3WDXA 4GB31 5F5IA 4NHLA 1ULGA 3AZWA 1JS9A 3MV01 3EYPA 4B29A 5B2GB 4JDMA 3VB9A 1LGNA 3N7KA 4IXLA 4AK3A 4C0HA 4N53C 1W90A 3HEIA 4KQ7A 1AR71 3E97A 3ETQA 4IEQA 1DF0A 3UYJA 3KV9A 3VZJA 2FD8A 1LOAA 4HPKA 5JCTA 2JE9A 1GFF2 2XWBB 2OKXA 4M0NA 2RR13 1UZ0A 2IWGB 1PZ8A 1AJKA 4C0BA 1OA2A 3NRUA 3T3YA 2QJVA 3N9NA 4HVOA 5A7WB 1WW7A 4RHV3 3U07A 2X5IC 3CNAA 5C4WB 3ROUA 3AZVA 2O14A 1UYXA 2BGCA 1BK1A 5BNPA 4JRAA 5JIAA 2HWB2 3NSTA 3PUQA 3IM0A 4FQ4A 4GAZA 4ISRA 5DABA 5T5OA 3KMHA 3LPFA 3A0KA 4UW3A 5DAXA 3C3VA 5EJZB 3VHOA 4EN6B 3AZXA 3AFGA 3LIGA 2D6OX 5GJ6A 1BMV1 1TVGA 4BQ2A 4YFZA 1QJFA 3K51A 1OMIA 4FPOB 1O3QA 3JD72 2OPWA 2HWC2 3KV5A 4ZZ8A 4ORFA 2P3IA 5IK8A 1GWLA 4XILA 1H9PA 2XBO2 1ENRA 2ZAHA 5CISA 4A42A 1GQPA 1K5MB 4L2NA 2G4IA 4AVSA 3UK9A 3POWA 2D6KA 2BP6A 4HN0A 5IFPA 1PMHX 1JBCA 2QKDA 1J3QA 3ABZA 3Q9OA 2V72A 3HNMA 4IEPA 1COV3 4Y1UA 4WZFA 1XNTA 4H7LA 3WF2A 3ATGA 3JQXA 1SQ4A 3P5BA 4CEWA 4ISQA 1XU2A 1IS3A 1TNRA 4QHZA 1NE4A 5FZHA 2OYZA 4Q0PA 2GNMA 3DPRA 1Y3TA 2J1EA 5BNQA 1Z7S2 1DQ5A 4MGZE 1DG6A 2GNDA 1UMHA 1YI7A 4Y1XA 4L9BA 3I2KA 2HWF1 2W92A 3U14A 2J1UA 1XQNA 5BYNA 3NQHA 4YARA 5D1IA 3WDUA 3UT0A 1O6UA 2YHJA 3HQUA 4M3CA 5BV6A 3WDWA 3ZLIA 2IUWA 5IVFA 3KGLA 2QQNA 1ND2C 1Y9QA 4J1XA 3IB3A 2UYAA 1LECA 2CU5A 2XONA 3U1XA 4XDQA 4XDOA 2J1SA 1RJ8A 3LWCA 3NO8A 5DZEA 2L9LA 3CIHA 3HPNA 3IN9A 5FXZA 1FPN1 2XH6A 3FZ3A 2AEYA 5JZGC 1ZREA 2R041 4IEUA 2BU9A 3I7DA 4QXCA 5KHKA 4BDVB 4LORA 3JU9A 1LHWA 1AR83 2PYTA 2PHDA 4W6XA 5F32A 1RINA 5FMOL 2CNAA 1TG7A 1MVEA 4AGGA 5IVBA 2Y6LA 2EVXA 3ZMNA 4HG6B 4YNIA 5C6CA 1QQP3 3ZYPA 5C70A 1J3RA 2DU0A 1GZ9A 2X10A 4R4XA 4LXLA 5FY7A 4ATFA 2OXBA 2QBXA 2RS53 1SFYA 1UIJA 1YXWA 2W3JA 3AL6A 4QXKA 3T1LA 4CDXB 1JYNA 1S1AA 2Q8EA 1PX3A 3MF9A 1WW4A 4LKEA 2MEV1 1VBE2 3LA7A 3VHRA 2BPA2 1CAXA 1YCIA 1WCQA 4UOJA 1N3QA 1ZM1A 2ATFA 3RI9A 3WF1A 1QEXA 1SEFA 2A3XA 2ZGSA 4BK5A 3BU0A 2JG9A 1RUF2 1ZBA3 4YM2A 1R093 3AP4A 3O1RA 1EUUA 3AX4A 4QKNA 3ITQA 3M1HA 2ARBA 1RIRA 2VCAA 2R1DA 2ZBJA 3VZMA 4GALA 4B4RA 4YSFA 1DLLA 2HBUA 4COZA 1GV9A 5E16A 1UW8A 4P9GA 2Y0OA 3MO4A 4YZ1A 1MEC3 1YO8A 1AR92 3MFCA 5E6HA 3MUZ1 3I2IA 3O1OA 1NLQA 1VRH2 2EA7A 2UU8A 4M0HA 4CUAA 1G6NA 3HVDA 1YEWA 3ZR6A 4WVWA 2XL7A 1O8PA 1W04A 1DYKA 1AL21 2UURA 3OBRA 4TYSA 2E6VA 1HQLA 4HMZA 2YPDA 3BVCA 1GSLA 5APAA 4N9HA 4BQ5A 4FSJA 5E1RA 1YUDA 5C9AC 2C9KA 2WZ8A 1PK6C 4RYDA 1F2NA 4K9SA 1W6PA 2LALA 2P5BA 3VHPA 3ZXEA 4PDWC 4AVAA 4LA3A 4XABA 3VBOC 1NG0A 1VBD1 3VV1A 4FXGB 2H0VA 2VZPA 2B46X 5FZ9A 4Q4Y1 4UFLA 4TLFA 1NA1B 2VTXA 4CRQA 4MH0E 1OI6A 3SKVA 2TBVA 4YVSA 1COV2 1R1A3 1UPIA 3EQEA 3LEGA 1N47A 3KGZA 3OJBA 3Q8FA 1REDA 3UJQA 4ASKA 4RR3A 4UYBA 3I2JA 1F4HA 3BTAA 4CCDA 1SFNA 2Y6FA 1NT0A 2R6QA 2QNKA 1POV1 1G9CA 3OD4A 5F9TA 1XYPA 1FV3A 4B1MA 1AR72 4BWOA 4I0BA 3KZ4C 5H9PA 5KHIA 3VDDB 3FHIB 1LJ7A 3VDAA 2QQMA 1JTZX 2I2SA 2P2KA 5DAVA 4ES8A 2CAUA 1UOJA 4LIUA 4EE2A 1ZYBA 4BK4A 1DDLA 3R0RA 2ZZJA 4RHV1 1V6IA 2H6CA 3RMYA 3SKJE 1JYCA 3ACIA 5FUNA 2KR2A 3D82A 1H2NA 1UOBA 2X5IA 2ZGOA 2RR11 3LA2A 4HXCA 1B09A 4QQLA 3H7JA 3H7YA 3WR0A 3ZXAC 4A41A 1W06A 4WVMA 1ENXA 5FY1A 1IKPA 1W8UA 4Z2WA 3S57A 3GCXA 3WQ0A 3SC7X 1HXS3 4FOYA 5AC91 1W39A 2GSYA 2WR9A 4LO4B 4XJAA 3UV9A 4A7KA 2D6PA 3DYPA 1QJU2 1NCRA 4IDZA 1PGSA 4YW5A 1H8TC 2ZGRA 4IE4A 5IAVA 1GOHA 2DCTA 2HWD1 1U5XA 4MGSA 2UY9A 1SCRA 1FATA 4NPMA 1JU4A 4P9JA 3O7OA 1RHI3 5F6KA 4DY3A 1SACA 4IV3B 3ZPYA 1PX4A 3DXUA 5FOJB 3C7GA 5CFCA 2HWB1 1RUOA 1RXFA 4HKOA 1LU2A 1VP6A 4URAA 1UZVA 2ORXA 4I2OA 1J1TA 3SCGA 1J1LA 1VIWB 2JG8A 1LODA 2E9QA 3E1F1 2R30A 3OPTA 1W8WA 3RYRA 1J59A 4JV4A 4OMDA 1C3HA 1XPWA 5HCAA 2TUNA 4AQSA 3T4VA 2HEVF 2J1AA 2ORZA 2Q1MA 2BNOA 2D3SA 4MVTA 2Z2SB 5GM0A 4JHTA 1OOPB 4XFCA 1ENQA 3MW3A 4XTMA 1H8TB 5FPUA 2A75A 2FBEA 4IW3A 4UW4A 3WG4A 1MEC2 1LRHA 1JYVA 1U5YA 4LHKA 4AXOA 4YFWA 1Q8PA 2ZGLA 5FREA 3FHAA 1QJX2 2JEMA 3H3LA 3OBZA 3I97A 1EY2A 4G4FA 4HFSA 4MGIE 3P3PA 3A21A 4UBGA 4Y24A 5DAQA 5K7PA 2UWAA 1DU3D 3SH4A 3GNEA 2EXHA 3T4HB 2VMCA 2VQ0A 2YB7A 1EAH2 1G9DA 1X7NA 4QXBA 2LUWA 3M3IA 2VOVA 2PTMA 3LD8A 5CBLA 3AK0A 4JGYC 3ILNA 1OQ1A 3BPZA 1M06G 5A3MA 2DVFA 3DV8A 5LA1A 1ZRRA 1K5MA 4Q29A 3MIGA 1ACCA 4Q5OA 4C1XA 1Y9MA 3SMHA 1G9FA 4R9BA 3WX5A 1PGL2 4HETA 5A32B 3CJXA 4OZOA 2D7FA 4XZPA 2ARAA 1OXCA 1AL0G 3DKQA 5L19A 3R4DB 4W6YA 3OB8A 2YU2A 2C1FA 3PHMA 4LIVA 5A33B 1I5ZA 2C9AA 2BZDA 4BLIA 5FP9A 3F95A 3ZXFA 3WEZA 2RS31 3POGA 4R4ZA 1US3A 4XFFA 4RL7A 1VBD3 4LK7A 4QX2A 2PA7A 5JXGA 5FYUA 3PDQA 2NPIA 2WQ4A 5LBBA 1JZ4A 3S7EA 1IPJA 1S0JA 3AYCA 1MS3A 1SLCA 2K0GA 1R083 5JR7B 1CGPA 3GALA 1OPOA 1SLBA 5CEHA 3W5NA 1W9TA 4NO4A 2C24A 3WQBA 2D5FA 3JXSA 3ACFA 5C8CA 2KXLA 1PO11 2Y34A 5D8AC 3WNNA 4K1YA 2XVKA 2VUJA 2WFF3 4IV1C 4K20A 1FXZA 2GH8A 4HVRA 4QDRA 1QDCA 4X8NA 5FZOA 1JZ6A 4IEYA 1SBDA 5LBFA 2CGPA 4BQ4A 5LK7B 4CZSA 5BNOA 1IG3A 3EO6A 4QKBA 3UKVA 4Z2AA 4WBBA 1UAIA 1RUD3 1UNBA 1O59A 4JKMA 4XHXA 1QJZA 3OBTA 5FZ8A 2RE9A 4YW6A 4AR2A 2GZWA 2RS33 2OVUA 3U0ZA 4KU7A 4KWKA 3W58A 4OLLA 4UW5A 3BUCA 2E31A 3DECA 2BBVA 2A6WA 3JB4C 3LA3A 1W6MB 2A6ZA 3O12A 3CLPA 4JVAA 4Q4V1 1NZCA 3QOPA 2R071 1FNYA 1YQ8A 1GYKA 1PIV3 2Q30A 1OKQA 1F5FA 4SBVA 3VD7A 3ST7A 1FT9A 1MEC1 2C5DA 1GANA 5JXJA 1FYUA 2LRPA 1W3XA 5IUQA 5J09A 2FCUA 5JSPA 1Y7BA 4TN7A 3URFA 2Q8CA 2FDIA 4MGTA 2PQQA 5FYHA 2A3YA 2ZX2A 1V9U3 4B4PA 2FDKA 2FDHA 1W6MA 3GXUA 1DGWX 4Y20B 3VKNA 1FMD1 4QDQA 1B35A 5FZMA 5L36A 1VBE1 3ALQA 5T5LA 4AEDA 2HJIA 4QQPA 5LB6A 4DFSA 1BJQA 1V6JA 5I91A 3GHMA 2WN3A 5FP8A 1O4YA 4NUBA 4LR4A 2DFBA 2WZR3 1IS6A 2E7TA 2RS51 5D8AA 3UKNA 1LU1A 1WCDJ 3ZFFA 3MPBA 4FO9A 5IVCA 4X8PA 2YC4A 4ZZ5A 1H9WA 4WVVA 2XKOA 3TEZA 2BTVC 1O4TA 1H6XA 1VB4A 1X9TA 3FN9A 2EIDA 3MIHA 1UZZA 1HLCA 1ZBE1 2V4VA 5T50A 4C1WA 2PHTA 1TMF1 2WWJA 2QQUA 5EWSA 4PLOA 1MS9A 5JR2A 4XQWA 2VGDA 3PUIA 4LHSA 3OY8A 2Y64A 3GZEA 5F8PA 4Z92B 4PF1A 3THPA 5AC92 2WS91 2YMZA 5F6LB 3GDBA 2AZ5A 5IT6A 1V70A 3SITA 2FMDA 3VGIA 3Q8CA 4GJZA 3WP5A 3X29B 1QWRA 4XFBA 4YW1A 1AVBA 1QF3A 3LGRA 3QBQA 3AC0A 4K8RB 2ZGQA 5CFCC 3VBHB 3SXWA 1UY2A 2LM3A 4D6QA 3RZKA 3OY8B 1OHFA 4OHWA 2VAUA 1ENSA 3ZXJA 3H42B 1PK6B 1WA6X 3CZJA 4MXVA 5FP7A 2W1UA 3GYDA 1J58A 1JYWA 4LBLA 2VNRA 2R0FA 1NCQA 1BHGA 1Z7S1 1YI9A 2G9FA 5DG1A 4RQPB 1DQ4A 1MS4A 2PQSA 1HJGA 4RGKA 5FP3A 2CDPA 1RUI3 3SH3A 1VALA 1CIYA 5CU1A 3MV11 4CXXA 2XJQA 2VZUA 4GJYA 2VW2A 4XETA 4P02B 1RUC1 1SLIA 4OZXA 3Q8AA 4Q4W3 2O0OA 4OUMA 2D6NA 3H50A 4BQ3A 5C4WC 1WMEA 2OX0A 3IAPA 5F3EA 3ZXLA 3NJVA 5FO8B 2YFUA 3GZUC 4ET7A 4CDUA 1LTEA 2V4AA 3B93A 1OLMA 2XJPA 4XZUG 2XKPA 2DV9A 4KWLA 4MSVA 2NN8A 3B9IA 3OGRA 4DO0A 4CUGA 3NJZA 3TEYA 1VB2A 3RYPA 4NVPA 4DXTA 1NQDA 2WJSA 4A6SA 4XF9A 1HRI3 2VW1A 4GH4B 4BPZA 2GC3A 2R49A 4KG0A 4UFMA 2JXAA 3FWEA 4COVA 4WM8C 4DINB 1ZRDA 4N53B 4IGQA 5FBJA 1JZ8A 4BMEA 4CU7A 5KR7A 2XVGA 1GP5A 1IQDC 3B69A 4XQ4A 2BNMA 2FCTA 1IKQA 3I59B 3IBMA 4Y1VA 2O8OA 2WNEA 3I2FA 3MFAA 1V00A 1W9YA 2YBKA 1UU4A 1W6NA 2JWPA 4UF0A 4FPKA 4CDQA 1W2OA 3BIWE 2AACA 1DLCA 3DPRB 1YIFA 2HEYF 2JDKA 3ACGA 1F8VA 1U12A 1NOVA 4QX3A 4PLNA 4GKYA 4DB5A 4P14A 4Y22A 4XUTA 2ZA9A 4CSWA 1EUTA 1VBC2 3OGVA 5FPLA 2D43A 3I59A 1O3TA 1UQXA 3H8OA 2VCCA 2YPJA 3CKHA 1Y4WA 3K48A 5DG2A 1H30A 1W6NB 3LF7A 4QKDA 4GWMA 3POFA 4AWDA 5EFUA 1C1FA 2VBDA 3IIAA 4OI4A 3ZR5A 1UIKA 2PFWA 3OUHA 5CFDB 3IAQA 3ZSKA 1REFA 5FXWA 4CP0A 1YQ2A 4GB33 2O8QA 3PVEA 1LHNA 1RITA 4V2VA 2XDVA 3WF4A 5IVVA 4JCKA 2ZABA 3HWJA 3LIHA 3NJYA 5BPXA 1QH6A 5CVRA 1TE1B 5L9BA 4NIHA 1HV1A 3JBG3 1PHMA 3HNYM 4DUWA 5BNOC 4AHYA 4AOCA 3POSA 2ZGUA 3VBHC 2HWB3 3A7QA 2ET1A 1ZA7A 2GP3A 1FAYA 2WO2A 2ZGTA 2WQZC 2VMDA 1YC61 5C3SA 3C7HA 3VKLA 5FDBA 1D4M1 1XOYA 3INAA 3AYDA 3PTYA 4MOAA 1WGPA 5BNOB 3TNPB 3LFMA 1FMD2 5FPAA 4BXSV 1CAWA 3VZLA 4DUVA 1TMF3 3JQWA 3MEPA 4AQ2A 5HBAA 4HN1A 4ITCA 3RNSA 1I1EA 1GUIA 2JG9B 2IFWA 2VNVA 2HWF2 4AVCA 1NZIA 3J9SA 5AC93 4HSLA 1ALYA 2HWE3 1JZ3A 2UWBA 2A1XA 5I0DA 3PMEA 1O5UA 4KNCA 3PLQA 3GJBA 2K46A 4FPLA 1ULDA 2Y38A 3RG0A 1X8EA 1BEV3 5CFDC 1RUG1 5F5CA 1VBA3 2X29A 1DZQA 3E5XA 4GWNA 1XNCA 2QCSB 2ZX3A 4LE3A 2Y6KA 5T52A 2BGOA 3N9PA 3I3BA 5FIXA 3WP6A 1FMD3 1XNKA 4YM3A 3FX3A 4OFGA 2VJXA 2HWD2 3K3OA 3EB7A 3KF5A 3POBA 2DTWA 5FZ0A 4E4ZA 1QJU1 3M3EA 3MGUA 4XACA 2WLQA 1JW6A 2B4KA 1UOFA 2DVBA 4HONA 4AI9A 1UYYA 3W21A 3RWKX 1VAKA 1AUYA 3GZTB 1L7QA 1EAH1 1NA1A 1XBFA 4CPBA 5CKQA 4I02A 4F7ZA 5ABJA 3FLPA 1OT5A 3NW4A 1FX5A 1HKDA 1WLCA 2RM23 4IL7A 4O7XA 1GNZA 2WUHA 4LMFA 5FBZA 4XIOA 2BUKA 5GALA 3LSDA 5A1FA 4V2WA 2IC1A 4IV3C 1JXNA 3NAPC 3WXPA 5DDJ2 2WWSA 4GKXA 5LCWL 2LTNA 4QX0A 1WMFA 2GP5A 1UXZA 4RS5B 3OUIA 5ERLA 3J7LA 3RRDA 2JDPA 1AYM3 5EPAA 4XUNA 5I8SA 4FOVA 5IVJA 4CYDA 2WC2A 1S0DA 3N9QA 2HLEA 3D6EA 3RYKA 1W28A 1HB3A 2AEZA 3VZKA 2ZGKA 4HKLA 5FZIA 3WVJA 1TNFA 2EXJA 5FK8A 3D5OA 1QH7A 2PLV2 3AMPA 5FZCA 2EAKA 3ZYRA 2E53A 5HCFA 4WVZA 2VZTA 4RS5A 3IDEA 3VDCA 1LHOA 1VBD2 2QQKA 1AJOA 3ZXGA 3KCXA 4CDQC 3NNLA 1PMIA 4BISA 4CVUA 2MPFA 3AMQA 5JOXA 4NN0A 3MDPA 2MEV3 4XUOA 1NUKA 5IK4A 2C6SA 4URTA 4Q4W1 1BQPA 1MS5A 4C91A 2VECA 3CF6E 5JI7A 4IGPA 4CUCA 5A3PA 5HPOA 4CEYB 3PU3A 4K6BA 3WCRA 2F4PA 4LK6A 5CFCB 3UNPA 1VBC3 3ZYGA 1UL9A 4K40A 3K77A 3D0JA 4KH9A 2UWCA 4CDUB 2QUOA 3GBGA 3AYAA 4EV0A 5C9AA 3N4MA 3VD3A 1PK6A 1R64A 4YG0A 5EXOA 3ZYFA 1DGRN 1RUG2 5BY5A 2VXJA 1AX2A 1NY72 1SPPB 3KT7A 1RUF1 1WWYA 2WZR2 3H8XA 4XCAA 1VR3A 2OZ6A 3KB5A 3RZZA 4BHPA 1UY3A 2UYBA 3MICA 4PDWB 3PU8A 1CX1A 3NKGA 3TOJA 3I3EA 2PHXA 5C9AB 2UY8A 2V09A 5C3QA 2AR6A 4J6GA 2NZ9A 5A3OA 4F8AA 3K3NA 3U37A 4D7YA 3NMBA 3WUDA 2VOKA 5A3TA 5HXMA 2E7QA 1QXPA 2RMU1 4E9KA 1CD3G 1GLHA 1W6OB 1CAUA 2KA3A 2YBSA 4NIAA 2PXJA 1HRV2 2VTXJ 2VW0A 3BGAA 1A78A 1OOPC 2VO5A 1R082 3ZFEA 2PN5A 2ILMA 3AB0A 3HR9A 3NJXA 3T30A 3N35A 4FPHA 3B9CA 1IS5A 1V6NA 3M2MA 1XSQA 4EYUA 1LOFA 3N3HA 2AGSA 2GNTA 1ZZ9A 4XMAA 4Y5SA 2VVDA 3T0AA 1YLLA 4RGAA 3S5AA 3ZN5A 3LEKA 2OQ6A 1OVSA 4N53A 2PMWB 4P9IA 1NLSA 3WCSA 4ZXKA 2XLGA 3T0BA 3WSOA 5F37A 5IATA 5T5JA 2BBAA 1UO9A 1RHI1 2XOMA 3WQ7A 2WO3A 4DZGA 3U4XA 2P37A 5IHRA 2BYVE 3AKPA 4UFIA 1AXYA 5FZDA 1S2EA 1NCRC 5IW0A 1SG3A 5JVVA 4AE2A 2CYFA 2DCYA 3BB6A 1LHUA 1CZSA 2OT7A 1YRZA 1O3RA 2VZRA 1VBC1 3AZZA 2XMLA 4MGYE 2B42B 4V1PA 1AYM2 1YNAA 2D98A 1AR61 3GBWA 5SV8A 3OPZA 5H9QA 5A7NA 4RD7A 1BBT3 3EMRA 3D3AA 2GNBA 1WUVA 1VRH3 2DCZA 1FNZA 2B8MA 2WA3A 3Q8BA 4E8DA 1HB2A 5CFDA 1VMHA 2CWMA 3IZOA 1ND2A 1ZZ8A 3R05A 4AEDC 3MIEA 4QHOA 3TN93 3WG3A 3HMYA 3RZGA 4N7UA 2XGXA 3LDRA 4XUQA 3ILFA 4QB2A 5CYYA 5JPNB 3OGSA 1CAVA 1JOPA 4GULA 3SH5A 4EZHA 4FPJA 3OD0A 5DQ0A 2R042 1OD5A 4NPLA 3SQOA 3WINE 1UU6A 2Z79A 4GWIA 1RUH3 3D0SA 4XEZA 2BVVA 3AVSA 1RUE1 1UZWA 1R081 5FXVA 1KEXA 1N1YA 1QOTA 1RUC2 2JDNA 4H14A 3VBOA 4C8DA 4GD4A 4QPGA 3O5SA 3FBMA 2GN3A 3ETPA 3K75B 4D6RA 1PZ7A 2RM21 1YQ6A 3JCIA 5FRAA 1L7RA 3KS7A 3VBUA 1W8FA 4EN7B 2WINB 4MYEA 1PM4A 5KC5A 3P6BA 4RFT0 4R52A 3ZFGA 1DQ1A 2GH2A 4QX5A 2QQIA 4GWJA 3R4UA 5FZLA 5I93A 2VUCA 5FZAA 4D3WA 3VBSA 1ZZBA 2F17A 4UI9L 2NMOA 3SHRA 4D8MA 2VU9A 1RC6A 2A6XA 1W6QA 1JU3A 1SBEA 3RWNA 1J83A 3OEBA 4RGGA 5D2AA 5FMDA 1KS4A 3SEEA 2XLAA 5LK5A 1DCSA 5FCCA 3ECQA 2W47A 3WHUA 4A2UA 4B4QA 3CDZB 2RS12 4Q4V2 5LA2A 4FTEA 2D5HA 1S55A 4XJWA 3VHNA 3THCA 4S2FA 1Z0HA 3PMSA 5ANQA 4P9XA 4HK8A 3ZYJB 5J48A 3FL7A 3CU7A 1KDKA 4NR1A 3ZN6A 5A6QA 3VBSB 1AR93 3KQ4B 1LKNA 4N9IA 4Y1YA 3FUQA 5FP4A 4RS5C 1LAJA 4F3JA 2TEPA 2WS92 5HCHA 2Z4FA 3WW2A 3WDYA 1O7FA 3WV6A 5A6YA 1VBA1 5GLVA 3KHCA 1ODNA 4YM1A 3O1MA 1CJDA 4CUBA 4L92A 5CADA 3AP6A 1CESA 4LLOA 4O65A 4PI0A 1V6MA 2V73A 4Q1PA 4OHZA 3T08A 4AQTA 4EQVA 4CEWB 4FQZA 3M3OA 1ZBE2 4CP9B 4K1ZA 5FLIA 2YDEA 5FMCA 3ZN6B 1Y9GA 3C8XA 3ZMOA 4FP3A 1V0AA 2X09A 3H8UA 1QU0A 2MHFA 4LKFA 4N43B 3T09A 4ARYA 4GMP1 1QJY3 2Y6HA 3CQOA 5GZEA 4B1LA 2RS52 2Q5TA 1DQ0A 4GXLA 4M00A 1AR81 4PCRA 4XXAA 1PIV1 1R1A2 2VZ3A 3TWIA 1HRV3 2P3KA 3CO2A 1LOCA 3GGLA 1NCQB 1ONAA 5GLUA 2HKXA 1CQ9A 4X6RB 4L97A 1AX0A 1H0BA 2A70A 1W8NA 1AR62 3VKMA 4XURA 2X53S 1TME1 2PHLA 3I3MA 2Y33A 2Q1FA 2A6YA 3BOPA 4H55A 1G86A 4CCMA 2IXCA 1H8VA 3AKRA 3BYWA 4AI1A 5DUXA 1UWWA 4MG2A 3PVBB 4NWVA 3BKZA 5FZ3A 1M4WA 1PGL1 1HV0A 3T2QA 5FYYA 3I2HA 2VG9A 4QB1A 1UYZA 3A23A 3J7MA 2B7YA 5FZBA 2RDNA 3N9OA 1QJY1 2EIBA 1DGLA 2WDBA 1EP0A 3OOXA 5M0TA 1HRI2 1DYPA 4OUSA 4QM9A 1N1TA 3WT3A 1Q8VA 4ZHNA 3BPSA 2B9UA 1C8M1 1YFYA 2VQTA 4BOWA 2FZ1A 1W8HA 2IVJA 4Q4X3 1W6PB 4LBQD 3RI8A 2RV9A 1WLTA 3T2PA 2YGLA 3A4UA 2YV8A 1GOGA 3DCQA 1XE8A 3T0DA 3MF6A 5FZFA 1K5MC 2ADEA 1UU5A 4XPVA 1ZNPA 4YG6A 5GLTA 1D0HA 5LRSA 3ZOIA 4JRLA 4XJZA 5EJ1B 1SPPA 3NNFA 4LNVA 2ID4A 1XU1A 4LPLA 1GKBA 1LEDA 1QKQA 4RR3B 4MLOA 2GMPA 3OUJA 5DAPA 4E2QA 3H1YA 1Y43B 4FFGA 4NIDA 5BNNA 3P1IA 3NKTA 4HBNA 1XNBA 2GMEA 2WA4A 3MBWA 4XJUA 2Q8OA 5KXBA 2VZSA 2QVSB 4HL0A 3WDVA 2HYXA 3W20A 1PVC1 1XYOA 1R1A1 2I74A 3KLSA 4A3XA 3AKSA 4L8QA 4FP2A 4JZRA 3DF0A 4DNYA 4DXRA 2VNOA 3CJIA 1W6OA 2ZX4A 4GQ7A 1RVF2 3VLBB 1IPSA 1JUHA 1BZWA 1GQHA 1RUC3 2CAVA 4J25A 2P3YA 4A7YA 4LUMA 1PNFA 2ZHKA 2Y6JA 2WABA 4WVMB 2W5FA 1QQP2 3HOBA 4G9SB 4Q0UA 5FTTC 5FJHA 3DPRC 4AHWA 1Q56A 3HIFA 3KCCA 4JTOA 1BBT2 3I54A 3VBFA 1PO21 2BWCA 2F6BA 2JKBA 5EZWA 2ZX0A 4HT1T 3MW2A 3USUA 4D7TA 4QM8A 3RS6A 2Z5WA 4LOSA 2CGNA 4JGYA 4KBZA 4LULA 3ZX7A 3UGFA 4YRDA 4QHBA 1VBB2 3QACA 4OI1A 3RDIA 5JWPA 2CHHA 1XC6A 2WIIB 4XFGA 4IV3A 3BI3A 2VMHA 4FVVA 4RHV2 3RQ0A 5I0RA 4XF0A 2YBPA 3ENRA 1TME3 4QX7A 2PHFA 5T54A 2RDSA 4AVTA 1ASJ2 3O0WA 1D4VB 5A7WA 5FV3A 1JUIA 4UW6A 1ZRFA 4S2GA 4YM0A 1XYNA 2OA2A 3IT8A 2VQUA 4ASLA 4Q27A 4ZKTB 1O8SA 5A3NA 4QU1A 5KC6A 4MADA 2GC1A 4E2GA 5FYZA 1LULA 1SLAA 1VRBA 1UOGA 1C4RA 1ZBA2 2HBTA 3L2HA 3LEMA 5TSWA 1H8TA 4QQ2A 5HI0A 4FFIA 4GMP3 2XXZA 5JSOA 5J1XA 2D3RA 3O0VA 4I0WB 1AXZA 5F5QA 1ND2B 3TN92 5T55A 1HXS1 2CY6A 3T2TA 4B7KA 4CEWC 3I2DA 4ES9A 4FBFA 4Q4Y2 4LBMA 5ACA2 1RMU1 1AHSA 4JC1A 2WQ8A 3PIGA 1US2A 2R043 3WUCA 5FAXA 3IDBB 1CVNA 4IEZA 4Z07A 2ZKLA 1WBFA 1I5PA 4CA9A 2XUMA 3WW1A 1C57A 1UY1A 2A73B 2B45X 1DP0A 3BALA 1UXXX 2XQXA 4ZONA 1F5JA 4C90A 3AJZA 5FKCA 5FY0A 2P4EA 1S0EA 1FI2A 1POV0 3O0XA 2JDYA 2D44A 2R061 3RJ2X 5CZKA 5ABJB 3H3UA 3WOGA 3VD9A 3DUIA 3L2YA 3M70A 4BCUA 1JYIA 1GR3A 2G9ZA 2YFZA 5E8AA 5A32A 4PF5A 3WNOA 4JX0A 1RXGA 3BCWA 3AMHA 3E6DA 3VKFC 5FY4A 3NV3A 4ZPIA 2ZGNA 4JDOA 1KGYA 5FYBA 4AI2A 2ENRA 3KD4A 3UESA 5JMCA 5FXXA 3B5LB 5E88A 4UF0B 2JD4A 2AC1A 2OS2A 2Y60A 4Y5Z0 5C5TA 1C28A 2WNVB 3GF6A 1SFPA 4COYA 1RJ7A 4DS0A 4KG8A 1YJKA 1RB8G 3ZDVA 4D6SA 4KGGA 2DCJA 3G7DA 3ZXKA 1TZOA 1MS0A 1W99A 1DQ2A 1AR82 1B35C 1BVVA 2XL9A 2WFF1 1XE0A 5LATA 5FPXA 3GZAA 2J42A 4LBKA 2JDUA 1GICA 1UMZA 4YGEA 4YW3A 4P00B 5FWEA 3BIEA 5I0UA 2IXIA 4M3CE 1MZ6A 1Q43A 3VBFC 3I2OA 5JIUA 5LASA 1OQEA 4JAAA 3NVCA 4NHMA 3KT4A 5K8SA 3DYOA 5AVAA 5F2WA 4YZ3A 4FCAA 3QCWA 3LDBA 2BERA 3H3ZA 3VBRB 4N8MA 4MHUA 2EF6A 1OKOA 3OG2A 2HWC3 4INDA 1XJAA 4HKWA 3AJYA 1VAVA 4XIKA 5FMBA 3V0AA 5FYCA 2RMU2 1RUG3 4MO3M 3V0BA 1STMA 4K21A 4NHYA 2K9ZA 3OEAA 1VRH1 2BDRA 2ZMKA 1RTVA 1VJ2A 4ZU5A 4YZ2A 1X33A 3I4IA 4BLJA 3AXEA 5JUVA 1OFSA 3ZIWA 2R0HA 3J7NA 1V6KA 4A44A 4NRMA 2GU9A 4BIOA 4ZU7A 1IGOA 3QLQA 3KVAA 5C7GA 1BK0A 3HD8B 2VUDA 4AFAA 1LOBA 1W8ZA 2OZJA 1AR73 5JMOA 5IYYA 5K0UB 5EP9A 1OH4A 4IV1B 4JGZB 4LITA 1JHJA 4ARXA 3AZYA 4CE8A 5C3RA 3BODA 1AYM1 1A3KA 1KS5A 4NRQA 5I0SA 1OA4A 1SCSA 3H1WA 4XC9A 3RPQA 5JPMB 4FPFA 2MEV2 4Y20A 4DXZA 4YZ5A 5JOWA 1DHKB 2GAUA 3FLRA 3OF1A 5FZOB 4CDXA 5JXHA 3NNJA 1GZWB 2QQWA 3AP5A 1ASJ3 1BXHA 3LE0A 3B3QE 2DUOA 1AYN3 4XF4A 3VN4A 3ZDSA 1PGW1 4QD2A 4MHRA 1KFXL 2I45A 4OQ8A 1O3SA 2VBPA 1H1IA 3LAGA 2DVGA 1H4GA 2IXLA 3WNKA 1OUXA 3ZFFB 2XQRA 3PUAA 1S0GA 4EWAA 3W5MA 4O61A 2YGMA 4Q4W2 4YWAA 3JD71 2XPJA 3POJA 3DN7A 4CU6A 1TMF2 2GC2A 3IIIA 1H2MA 2DVDA 4DEVA 3I49A 1WD3A 2QE3A 3WQ1A 4XMIA 2GDFA 4UXAA 3SISA 3UL2A 4JHZA 1WCSA 1WZXA 2YXSA 5HXVA 2PHRA 1FPN2 4XBQA 1JOBA 4CCEA 2Z42A 3E5QA 2YY1A 4AVVA 1W3VA 3HBKA 2ZGPA 3VKOA 5J3UA 1CZTA 1UZYA 2IXHA 5FUPA 3RZMA 4CCNA 1JN2P 2WO1A 4W6WA 2WNOA 4DRVA 1U5ZA 1WKYA 1NQJA 1K5JA 1QNYA 1X9PA 1VMJA 3KV6A 3Q8EA 2EIGA 4ZXEA 3VL9A 1A6CA 2WFF2 2WZPP 5LEKA 2ZZQA 2NP0A 1JZ2A 4DEQA 2C4XA 3FLTA 4JGYB 1OQDA 3N7LA 3USSA 2J1RA 1HQNA 3PVOA 1Z78A 3KSCA 1FOD2 2QQLA 1VBE3 2R32A 2YZ4A 4AL9A 2FDFA 3PJQA 4DOUA 5F3GA 1TEIA 1OSGA 2EALA 3OPWA 5FO9B
chains in the Genus database with same CATH topology
3MZHA 5I0TA 4XW3A 2FZ2A 2AUYA 4P9LA 3CJIB 2OUHA 1G8WA 1LENA 5DXDA 3MLJA 4YGDA 3PVNA 3ZSMA 4QQOA 2JX9A 2W68A 3ASIA 1I3HA 5DUWA 4IESA 4AW7A 4YVSC 4XHBA 1YIPA 1GQGA 4FTBA 3SLIA 2R062 2XBO1 3USUB 4QT6A 4AI0A 4OULA 2HWC1 3CEWA 2ZTNA 2E51A 4BIFA 2JICA 5I8TA 1D2SA 2XJTA 1MS8A 4HSJA 4EWDA 1AXKA 5J37A 1ND3C 5BNPB 1BMV2 3ACLA 2GN7A 4Y1ZA 4AYUA 4CEYA 5JDBA 1POV3 4QPGB 1N3PA 4EN9B 1RVF1 2CV6A 1RMU2 1SDWA 1W0PA 4Q0SA 1YFXA 3HT2A 1WBLA 4LBOA 3T1MA 1NCRB 4BE3A 1BEV2 4LO6B 4GMP0 1H1AA 2XG3A 1PVC2 2IFRA 4S2DA 3ZFGB 3FE5A 1HW5A 3FUOA 4CTEA 5K9YA 5HCBA 1O91A 1R092 1ZRCA 1ND3B 4FXKB 2DCKA 1WA4A 1X36A 1J3PA 4PDWA 5FQ0B 4EWEA 3FFZA 4DMIA 1Q8OA 2Z69A 2FQPA 4GIQA 2GMMA 1LEMA 4GB32 1AL23 1MS1A 1RUH2 5C8CC 2XWJB 2ZHNA 1RUJ2 5A3LA 1ZBE3 4M3CB 4WM7B 1UX6A 1RUNA 2JG8C 1RUD2 1Q8SA 1HRI1 4XF3A 4AF9A 2YUEA 1AYN2 1OPMA 4GA9A 2ZMNA 3NV1A 4MX3A 1OA3A 4L99A 4OHVA 4FAGA 5EJ3A 2YC0A 2GALA 2XJVA 3R4SA 3WD5A 5KXCA 1V6LA 1NA1C 1PVXA 5KXDA 1I6XA 2WSUA 1CPNA 4WM7A 5CA6A 1BYHA 1V9U1 3BU7A 4UBHA 1VAMA 4PJYA 4AEKA 1XRUA 2PAEA 5F1RA 2A71A 3E6CC 4MZUA 4S2HA 4P9WA 1Q3EA 3TNQA 1YFUA 5GKAC 5L7OB 1FOD1 4XE9A 2D6MA 2BFUL 3IDCB 4R8HA 2BWAA 4XFHA 4YW2A 3ZN4A 2ES3A 2TNFA 4G3YC 3GBFA 3W59A 2CL2A 5H9RA 1CAXB 2ZHLA 3ZSEA 4AFCA 5KXEA 5DUVA 4AFDA 1D0GA 1DBNA 3N36A 1G9AA 3AYEA 2WNUC 5CIRA 3B01A 3B00A 2YYOA 2FHRA 4KBBA 1EV13 2QZ3A 2WL1A 1C8M2 4AVBA 1ZVFA 1CAVB 4CDXC 1FOD3 2ZCWA 2O1QA 3MPPG 2IXJA 2ZPXA 5EV7A 1DZRA 4LO8A 1MZEA 4M01A 4PIYA 3M3CA 1N1VA 4IEWA 5AFBA 4YVWA 4XFAA 3FFQA 2RJKA 3VBUB 1CIWA 2WLPA 3M4FA 2G9GA 1TME2 3S30A 2BNNA 4AI8A 4QGMA 4YVSB 4W65A 4Q8KA 1ZZ6A 2B5HA 4QPIB 2NYYA 2EXIA 1DIWA 1QDOA 2Y26A 3NWKA 4JQRA 4NHKA 4QU2A 4FPGA 2ZHMA 3OGJA 3WZ1A 1DGRA 3NL1A 5BNNC 3GHNA 3VDDA 4H3WA 4FOWA 4YGBA 4Q4V3 4AFBA 1B35B 5T5PA 2E7AA 3RSJA 3VUOA 1DQ6A 4CP2A 4Q4Y3 1VBB3 4KU8A 2IZWA 4Q4X1 4ASMB 4D69A 3BOWA 4J1WA 1HIXA 1NYWA 2BFUS 4KGQA 2WNVC 4QQHA 4BZ4A 2KM2A 5KHJA 3AKTA 3AMMA 1KITA 1ZZ7A 4I3GA 4LUKA 3RJRA 3TRSB 1C8NA 5JSRA 1EPWA 2Q0AA 1NE6A 1UKRA 4PBOA 1QJU3 4B3NA 4EROA 1RVF3 2BVBA 1C1LA 1CPMA 4Z82A 4R9CA 4TZDA 4OVEA 1X82A 4YG3A 2D40A 3VBHA 3THTA 1E57A 2ZJCA 2W52A 5JOZA 2VMGA 2R072 4XF1A 2X5IB 4LEJA 3MI8A 2WS93 1DGWA 5KWRA 4D94A 1G7YA 1LCLA 1ZX5A 2WT0A 4NOTA 3WNXA 1CAUB 4TWTA 1URXA 2DTYA 2CTVA 5SV5A 2ARXA 4I01A 5GLZA 4E2SA 3WP3A 1D4M3 4MXWA 1BVP1 4N90A 4AQ6A 2R16A 1HDKA 2VXRA 3APBA 2R1BA 4Y22B 2FMYA 5FO7B 1AR91 1N3OA 3VBRC 1APNA 3JBG1 5JOYA 4LHLA 1S0BA 4N43C 1CN1A 2BQPA 2HWE2 4WM8B 2DFCA 1WCKA 1OOPA 1X8MA 1UN1A 5H9SA 3M8LA 1PO23 1U0AA 1KXGA 1LOFC 4P9YA 2WNUB 1NLRA 1IPKA 1LESA 4XOGA 5A33A 1LHVA 1UD1A 4WM8A 1WW6A 1OLRA 2A7AA 2VPVA 3AFKA 2VQAA 2I07B 3QH7A 1RHI2 2XB6C 3A0NA 2XJSA 1VBB1 2ETEA 4YZ4A 1AYN1 4Q4X2 4KWJA 2DYCA 2WNUA 4Q8LA 2EXKA 1NXMA 3ELNA 1PO22 3SCHA 4RQPC 5L7OC 1CAWB 4IQPA 2OW4A 4M3CF 4LBJA 1WW5A 4LBQA 3VL8A 2QQPA 1DZTA 2XJUA 4ZU4A 4JTNA 4RR3C 1S0CA 3OGGA 1YJLA 5FMOS 3TN91 5ABJC 4R9DA 1XE7A 2JJ6A 1C5HA 3KCYA 1ZBA1 3LB9A 3R6SA 3H1MA 4Q0QA 4U36A 1QJX3 4LBQB 1H2KA 5BXXA 4AG4A 5FOBB 2WFPA 2DF7A 3IKWA 5LEJA 4O9GA 4PLMA 1IZ3A 3WG2A 3EXUA 1GBGA 1U5IA 1GZWA 1MQTB 3LSEA 1W2UA 1W6QB 1NY71 2ERFA 4AGRA 3ES1A 4YVWB 2Q1ZB 1SLLA 3D8CA 1XNDA 2JE7A 4K7JA 5C8CB 1QHDA 4HK9A 1OLQA 5GZDA 1Z7S3 4XBLA 5KBFA 3B02A 4IEVA 1YFWA 2JECA 4U2AA 4LLFA 2N7GA 2XJRA 5CB7A 1KDMA 4I3PA 1MACA 2AH2A 3J8F1 3VBUC 4XJ9A 4DQAA 5J7MA 2VNGA 2DUPA 4EN8B 3VZOA 1YWKA 2Y0IA 4I09A 3W9AA 4E4DX 4B8EA 1C5IA 1QJY2 2WT1A 2RR12 3MLLA 2XVLA 5ACA1 4N43A 1I9RA 1QXJA 1RL3A 2RS13 5E89A 4BMBA 3O14A 1HXS2 4FAHA 5ACA3 4IEXA 3QD6A 2H0BA 2PAKA 4O9EA 2AYHA 3UJOA 3C2UA 4P5HA 5KHHA 4LA2A 2WNVA 1R091 1F9KA 3NV4A 1Q5OA 1GNHA 4BYYA 2QFEA 4YW4A 2A5ZA 1A8DA 3D4KA 3LCPA 2ZS6B 1ASJ1 1D4M2 1EYBA 5J98B 3HQXA 1A8MA 3IPVA 4LBNA 3FC0A 5D8AB 3CL1A 3FBYA 1BEV1 4HLTA 1TQ5A 5JI9A 1IQAA 1LGBA 2RHPA 4XTPA 1ULEA 4AHXA 2BW8A 3DL3A 5KHGA 3P3NA 4QPYA 3WY6A 1KFUL 2JENA 2ZACA 4COWA 5CNAA 2PELA 5L73A 3N7MA 4BA6A 2HYKA 4XYXA 2R073 4CDWA 4LE4A 1QJX1 3ZXDA 4ATEA 1LR5A 3ZYIB 3OTFA 2XHKA 4AEJA 4CDUC 2P3JA 4EN0A 2XLFA 5J96B 4CDWB 4GH4A 1QMJA 1AF9A 3JUUA 1ND3A 4WM7C 4OHYA 4RQPA 5K0UA 3HN1A 4CEYC 1G9BA 1PO13 3HT1A 5BNNB 3ZFEB 3JZVA 4Z1VA 3JBG2 3TB0A 5C8WA 1PIV2 5DZGA 1LOGA 1CR7A 1CJPA 2QDRA 2GC0A 1RUJ3 3ZFFC 4CDQB 3HAGA 4QPIC 3U10A 2QDNA 1COV1 1IOAA 1JHNA 2A3WA 1HX6A 1S2KA 2VVEA 4SLIA 1H4HA 1S2BA 1UKGA 4LO5B 1QY4A 1LB2A 3OYWB 3V64A 1LGCA 1RUE3 2MNGA 3ZO0B 2CGOA 1WMDA 1PVC3 1EPZA 2OPKA 1KD7A 3WG1A 4JGZC 4DY5A 2D97A 3MYXA 5LRRA 4PBPA 4AFMA 5EYYA 1EV12 1YYNA 3S0MA 3IMNA 2HEWF 4Q26A 2SBAA 2A6VA 1PGW2 4BM8A 1KQRA 3WP4A 1RUI2 3V56A 2WT2A 4L11A 1JOJA 2Q4SA 2VOWA 4OHXA 4QMAA 2XBO3 1AZDA 5FLJA 5L7OA 1HQWA 3ZSJA 1MVQA 2NLRA 3H0OA 3VBSC 2ZMLA 3LOIA 1OFNA 3H9AA 2HWE1 2W39A 1AR63 1UF2C 3AMNA 3I8TA 3M7AA 4Z8BA 1NXD1 2D3PA 2PLV3 1QGLA 5IK7A 4Y4YA 1RUI1 4LHNA 2VY0A 3VBFB 1O5LA 1IHMA 5C4WA 4ONUA 3ZFEC 1Q8QA 1EV11 2RMU3 1W0OA 3V65A 2NQYA 3M3QA 4H7MA 1FPN3 1MQTA 2RJLA 3JD73 3LZZA 4WV8A 1H1MA 1YHFA 3TAYA 3B7MA 4CDWC 3IWZA 4RA0A 3LOBA 3MIFA 3S7IA 4DRRA 3AXDA 3VDDC 5JAXA 2B39A 2VULA 3N7JA 1AL22 2P34A 4K8FA 4NPRA 3VZNA 1VBA2 3J26N 4META 5J36A 4FPYA 1UCXA 2VH9A 1RUF3 4BQ1A 4F83A 4HPKB 1HRV1 1BKZA 5FPZA 4LTAA 4COUA 1CX4A 4WZCA 1S0FA 5FLHA 1MZ5A 4YLZA 2HWD3 2HWF3 2VUAA 2RS11 3ZSLA 4YYOA 1KJLA 1QOOA 2JDZA 3NV2A 1F31A 1MR5A 4R9AA 4DPNA 1T6GC 2OIIA 2JG8B 1WLWA 3ILRA 3JB8A 2V5YA 4LT5A 3G6JB 2DU1A 2DUQA 4KL1A 1WLDA 4MUVA 5CG8A 3VBOB 2D93A 5GZFA 2D6LX 3EJKA 4AEDB 4XFIA 3AM2A 2WZR1 4QPIA 2K2SA 3J8F3 1MZFA 1DFQA 3KM5A 3MLKA 4FPEA 5FQ0A 3AKQA 3KT1A 2DURA 2RM22 3DKWA 5GZCA 4Q0VA 2DVAA 4CP1A 4XBNA 3PNAA 5I8YA 1IS4A 3DGTA 4OI2A 3WDTA 1RUE2 4E4SA 3PJYA 4HANA 4HZFA 2DWRA 5FFOC 5K0UC 4QGLA 4B7EA 4IETA 2EAAA 5DUUA 3IPVB 1SMVA 3WW4A 3ZFGC 2ZKNA 3LKJA 1JH5A 1PO12 1CONA 1PZ9A 3VBRA 2PHWA 1PM7A 3L9JT 4I30A 3ME2A 4QPGC 3ZVXA 5GLWA 2ZAAA 2X8KA 1ULCA 3FJSA 5BNPC 1C8M3 4RSUA 4AHZA 1QXRA 2YROA 3POYA 2RS32 4GH4C 4IEOA 3B94A 1EAH3 1SBFA 5DDJ3 2AENA 4IV1A 4JGZA 3HBZA 5JLVA 2SLIA 4PIZA 4XQDA 5DDJ1 3WHTA 5JZGB 4Q1RA 1QNWA 4E27A 3TBDA 2P17A 3RMXA 5AVPA 4YGCA 4YVWC 2VOXA 1SLTA 2QZ2A 3CJIC 1XXNA 1ZA4A 2H6BA 1MQTC 4D7SA 4N7IA 3MIBA 4PIXA 1QOSA 1V6OA 4AI3A 1N1SA 3V0BB 3V0AB 2WKKA 1REEA 2VVFA 1BCXA 5JZGA 1R1ZA 1L3JA 4JDNA 2VMIA 4FTSA 1BBT1 5CG9A 4QGNA 4AEMA 2CWSA 4MXWB 4HVQA 1O4ZA 2ZX1A 1X50A 1QQP1 2JG9C 5DZFA 2C0ZA 4LO7A 4AGVA 1FV2A 3AP9A 2PLV1 4FPCA 3MIDA 4A7ZA 2R063 5BUVA 4XXPA 3EHKA 3TYJA 5C33A 2BEOA 2E63A 4K3UA 2ZGMA 1AX1A 2OUJA 3ES4A 2PAMA 4OI0A 4BH9A 5IK5A 1UPSA 3EBRA 3OCPA 1RMU3 3FMGA 4IERA 4MGKE 5GZGA 1LOEA 4PQ9A 4Y26A 4MV2A 3E5UA 4TSVA 4FT8A 1V9U2 3E6BA 2IXKA 1KRIA 5AFEA 3KQRA 3QH6A 4FOQA 3U11A 2NM1A 4NWWA 3J4UH 2ZOEB 2W08A 1GZCA 3AP7A 3WLUA 3OYWA 5CAZA 5EYXA 5T3NA 2AREA 1ULFA 3S6PA 3SCFA 3J8F2 3NAPB 1VLNA 2ET7A 2WSVA 3SNMA 1RUD1 2PHUA 4X6QB 1H2LA 1WD4A 4Q2FA 1S0IA 1KJRA 1NCQC 1PNGA 1RUJ1 3MW4A 1RGSA 2NMNA 1D2QA 4XJ8A 1RUH1 4I0AA 1ZZCA 3NAPA 2W0XA 3WDXA 4GB31 4NHLA 1ULGA 3AZWA 4B29A 5B2GB 4JDMA 1LGNA 3N7KA 4IXLA 4AK3A 4C0HA 4N53C 4KQ7A 1AR71 3E97A 3ETQA 4IEQA 1DF0A 3VZJA 1LOAA 4HPKA 5JCTA 2JE9A 1GFF2 2XWBB 4M0NA 2RR13 2IWGB 1PZ8A 1AJKA 4C0BA 1OA2A 2QJVA 4HVOA 1WW7A 4RHV3 3U07A 2X5IC 3CNAA 5C4WB 3ROUA 3AZVA 2BGCA 1BK1A 5BNPA 4JRAA 5JIAA 2HWB2 3NSTA 4FQ4A 3IM0A 4ISRA 5T5OA 3KMHA 3VHOA 3A0KA 4UW3A 3C3VA 4EN6B 3AZXA 3AFGA 2D6OX 5GJ6A 1BMV1 4YFZA 3K51A 1OMIA 4FPOB 1O3QA 3JD72 2HWC2 4ORFA 2P3IA 5IK8A 4XILA 1H9PA 2XBO2 1ENRA 2ZAHA 1K5MB 4L2NA 2G4IA 4AVSA 3UK9A 3POWA 2D6KA 4HN0A 1JBCA 2QKDA 1J3QA 3Q9OA 4IEPA 1COV3 4Y1UA 4WZFA 4H7LA 3ATGA 3JQXA 1SQ4A 4CEWA 4ISQA 1XU2A 1IS3A 1TNRA 1NE4A 2OYZA 4Q0PA 2GNMA 3DPRA 1Y3TA 5BNQA 1Z7S2 1DQ5A 4MGZE 1DG6A 2GNDA 1YI7A 4Y1XA 3ZIXA 4L9BA 2HWF1 1XQNA 5BYNA 4YARA 5D1IA 3WDUA 2YHJA 4M3CA 5BV6A 3WDWA 3KGLA 1ND2C 1Y9QA 4J1XA 2UYAA 1LECA 4XDQA 3LWCA 1RJ8A 3NO8A 5DZEA 3IN9A 1FPN1 2XH6A 3FZ3A 5JZGC 1ZREA 2R041 4IEUA 3I7DA 5KHKA 3JU9A 1LHWA 1AR83 2PYTA 2PHDA 4W6XA 1RINA 5FMOL 2CNAA 1MVEA 4AGGA 2EVXA 3ZMNA 5C6CA 4YNIA 1QQP3 3ZYPA 1J3RA 2DU0A 1GZ9A 4R4XA 4CEWC 4ATFA 4QXKA 2RS53 1SFYA 1UIJA 1YXWA 3T1LA 4CDXB 1S1AA 3MF9A 1WW4A 2MEV1 1VBE2 3LA7A 3VHRA 2BPA2 1CAXA 1YCIA 1N3QA 1ZM1A 2ATFA 3RI9A 2ZGSA 1SEFA 2A3XA 2JG9A 1RUF2 1ZBA3 4YM2A 1R093 3AP4A 3AX4A 3M1HA 2ARBA 1RIRA 2R1DA 2ZBJA 3VZMA 4GALA 4B4RA 4YSFA 1DLLA 4COZA 1GV9A 5E16A 1UW8A 4P9GA 2Y0OA 4YZ1A 1MEC3 1YO8A 1AR92 3MFCA 1VRH2 2EA7A 2UU8A 4M0HA 1G6NA 4WVWA 2XL7A 1DYKA 1AL21 2UURA 3OBRA 4TYSA 2E6VA 1HQLA 4HMZA 4FSJA 1GSLA 4N9HA 5E1RA 1YUDA 5C9AC 1PK6C 1F2NA 4K9SA 1W6PA 2LALA 3ZXEA 3VHPA 4AVAA 4PDWC 4LA3A 3VBOC 1NG0A 1VBD1 3VV1A 4FXGB 2H0VA 2B46X 4Q4Y1 4CRQA 4TLFA 1NA1B 4MH0E 1OI6A 2TBVA 4YVSA 1COV2 1R1A3 1UPIA 3EQEA 1N47A 3KGZA 3OJBA 1REDA 3UJQA 4RR3A 3BTAA 1SFNA 2R6QA 2QNKA 1POV1 1G9CA 3OD4A 5F9TA 1XYPA 1FV3A 1AR72 4BWOA 4I0BA 3KZ4C 5H9PA 5KHIA 3VDDB 3FHIB 1LJ7A 1JTZX 2I2SA 2P2KA 4ES8A 2CAUA 1ZYBA 1DDLA 3R0RA 2ZZJA 4RHV1 1V6IA 2H6CA 3RMYA 1JYCA 3D82A 1H2NA 2X5IA 3LA2A 2ZGOA 2RR11 4QQLA 3ZXAC 1B09A 3WR0A 3H7JA 3H7YA 4WVMA 1ENXA 1IKPA 4Z2WA 3WQ0A 1HXS3 4FOYA 5AC91 1W39A 2GSYA 4LO4B 4XJAA 3UV9A 4A7KA 2D6PA 1QJU2 1NCRA 1PGSA 4YW5A 1H8TC 2ZGRA 2DCTA 2HWD1 1U5XA 2UY9A 1SCRA 1FATA 4P9JA 4DY3A 3O7OA 1RHI3 5F6KA 1SACA 4IV3B 3ZPYA 5FOJB 5CFCA 2HWB1 1RUOA 4HKOA 1LU2A 1VP6A 4I2OA 1J1TA 3SCGA 1J1LA 1VIWB 2JG8A 1LODA 2E9QA 1J59A 2R30A 3RYRA 4JV4A 1C3HA 5HCAA 2TUNA 4AQSA 2HEVF 2Q1MA 2BNOA 2D3SA 4MVTA 2Z2SB 5GM0A 1OOPB 4XFCA 1ENQA 3MW3A 4XTMA 1H8TB 2A75A 2FBEA 4UW4A 3WG4A 1MEC2 1LRHA 1U5YA 4LHKA 4AXOA 4YFWA 1Q8PA 2ZGLA 5FREA 1QJX2 2JEMA 3WW3A 4G4FA 4UBGA 1EY2A 4HFSA 4MGIE 4EJRA 3P3PA 4Y24A 5K7PA 2UWAA 1DU3D 3SH4A 3GNEA 2EXHA 2VQ0A 1G9DA 1EAH2 1X7NA 2LUWA 3M3IA 2VOVA 2PTMA 5CBLA 3AK0A 4JGYC 3ILNA 1OQ1A 3BPZA 1M06G 5A3MA 2DVFA 3DV8A 1ZRRA 1K5MA 4Q29A 3MIGA 4C1XA 3SMHA 1G9FA 4R9BA 3WX5A 1PGL2 4HETA 5A32B 3CJXA 2D7FA 4XZPA 1AL0G 5L19A 3R4DB 4W6YA 2C1FA 3PHMA 5A33B 1I5ZA 2C9AA 4BLIA 3ZXFA 2RS31 4R4ZA 4XFFA 4RL7A 1VBD3 2PA7A 2NPIA 2WQ4A 3S7EA 1IPJA 1S0JA 3AYCA 1MS3A 1SLCA 2K0GA 1R083 5JR7B 1CGPA 3GALA 1OPOA 1SLBA 4NO4A 2D5FA 5C8CA 2KXLA 1PO11 5D8AC 4K1YA 2XVKA 2VUJA 2WFF3 4IV1C 4K20A 1FXZA 2GH8A 4HVRA 4X8NA 1QDCA 4IEYA 1SBDA 2CGPA 5LK7B 4CZSA 5BNOA 3EO6A 3UKVA 4WBBA 1UAIA 1RUD3 4XHXA 5L36A 1QJZA 3OBTA 2RE9A 2GZWA 2RS33 2OVUA 3U0ZA 4KU7A 4KWKA 3W58A 4OLLA 4UW5A 2BBVA 2A6WA 3JB4C 3LA3A 1W6MB 2A6ZA 3O12A 3CLPA 4JVAA 4Q4V1 1NZCA 3QOPA 2R071 1FNYA