3VBUC

Crystal structure of empty human enterovirus 71 particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuC00
4CEYB 5C8CB 1HRV1 1RUC3 1RUC2 3JBG1 4IV1B 1K5MB 2X5IB 3ZFFA 1RMU3 1RVF2 1VBA3 1FMD3 1VBA2 1FMD2 3J8F3 1AL0G 3J8F2 5K0UC 1RUJ1 2WS93 4N43B 2WS92 3TN93 4GB31 2WZR3 1D4M1 1RMU1 1VBB1 1R1A1 1ZBE3 2WZR2 3CJIB 3TN92 1ZBE2 4QPGB 5A33B 4Q4W3 3J8F1 1OOPC 1TMF2 4CDWA 4Q4W1 2HWB3 2HWB2 3IDEA 2MEV1 2WLPA 5C4WC 5J96B 3NAPA 3ZFFB 4RS5A 1VRH3 1ASJ3 1VRH2 1MQTA 3VBFA 5ACA1 5BNOB 1TME2 1ASJ1 2RMU1 4CDXA 1ND3C 1RUE1 1QJX1 2HWE1 1RUH3 1POV0 1RUH2 4CDWB 5CFDA 4RFT0 1NCQA 2BBVA 1FPN2 1HXS3 4Q4Y3 1FOD1 3M8LA 4Q4Y2 3NAPB 1AYM1 4RS5B 1IHMA 1HRI1 1PIV3 1PIV2 4WM8A 1MQTB 4CEWA 2R061 5BNNC 5JZGC 2RS53 1HXS1 3VBFB 2BUKA 2RS52 2IZWA 1PIV1 4CDXB 3VBUA 1RUD3 1SMVA 1RUD2 5L7OA 1PO21 2R041 5CFDB 5AC93 1QQP3 1X36A 1QQP2 1NCQB 1RUD1 4Q4V3 5ABJA 1BMV2 1H8TA 5CFCA 1W39A 3VDDC 5AC91 1QQP1 5D8AC 4CDQC 4WM8B 4CEWB 1V9U3 4YVWA 4Q4V1 1V9U2 5C9AC 2WFF3 2WFF2 4QPIB 1QJU3 3VBUB 1NY72 2XPJA 2RS33 5L7OB 4FTBA 2RS32 1RUG1 3JB8A 1BEV3 1QJU1 1BEV2 1AL23 3ZFEA 5ABJB 3VBRA 1AR62 1H8TB 5CFCB 4GMP3 1AL21 2R071 4YVWB 1PGL2 2PLV3 4GMP0 2PLV2 3FBMA 4AEDA 4GMP1 4FSJA 1PGW1 1VB2A 3ZXAC 4CDUA 3DPRA 2HWF3 2FZ1A 2HWF2 3ZFEB 3VBRB 4RQPC 1RVF3 1ZBA3 1ZBA2 1EAH3 1AR73 1Z7S3 1RUC1 4AEDB 2WWSA 1EAH2 1AR72 1Z7S2 4IV3C 3VBOA 1B35C 1RVF1 4GH4A 4YVSA 1VBA1 1RUF3 1FMD1 4CDUB 1RUF2 1TMF3 1VBC3 2WS91 3DPRB 4N53C 1VBC2 4RR3A 3TN91 2WZR1 4JGZA 1ZBE1 1PVC3 4WM7C 1PVC2 5LK7B 1TMF1 1RHI3 1MEC3 1RHI2 2XBO2 1MEC2 1VBC1 4JGYC 3ZFGA 2BFUL 2HWB1 1ND2A 1CD3G 3VBOB 1NCRC 4RHV3 1TME3 4RHV2 1HX6A 1VRH1 4GH4B 4YVSB 4CEYC 1POV3 1C8M3 5C8CC 5DDJ3 1C8M2 5DDJ2 4PDWA 4RR3B 1TME1 4IV1C 1K5MC 2X5IC 4JGZB 1C8NA 2ZAHA 1FPN3 1POV1 1COV2 5BNPA 1RUH1 3ZFGB 4N43C 1VBE3 1VBE2 3CJIC 3VBSA 1FPN1 4QPGC 1VBD2 1ND2B 3VBHA 4Q4Y1 4Q4X3 4Q4X2 1VBE1 2ZZQA 1OHFA 2RS51 4Q4X1 4PDWB 3ZFFC 5GKAC 4Z92B 5BNPB 5BNOC 3VBSB 1R083 1R082 1BMV1 3VBHB 1DDLA 4BCUA 2RR12 4CDWC 1R081 1V9U1 5K0UA 2WFF1 3NAPC 4RS5C 1F2NA 2RS13 4Y5Z0 2RS12 1NY71 3JB4C 1M06G 1MQTC 1OOPA 1QJZA 1AR63 2BFUS 1RUI2 2RS31 3VBFC 1OPOA 1BEV1 2RS11 2HWD3 2HWD2 1WCDJ 4CDXC 1AR61 1AYN2 5C4WA 2DF7A 1VB4A 5CFDC 1PO13 1PO12 1NCQC 1PGL1 5K0UB 2PLV1 1BBT3 1BBT2 1CJDA 2RM23 1ND3A 4WM8C 1OOPB 4CEWC 2FZ2A 2RM22 1QJY3 1QJY2 2VQ0A 4QPIC 1AR83 1BBT1 1AR82 2HWF1 1AR92 3VBUC 3JD73 2HWC3 5C4WB 1QJY1 3JD72 2HWC2 5L7OC 5BNNA 5JZGA 1ZBA1 1HRV3 3JD71 1HRV2 5ABJC 1H8TC 5CFCC 1EAH1 1AR71 1VAKA 1Z7S1 3JBG3 3JBG2 4SBVA 1ND3B 4YVWC 1RUF1 1NA1C 1RUJ3 1GFF2 1RUJ2 2XBO3 4GB33 1D4M3 1VBB3 1R1A3 4GB32 1D4M2 1RMU2 1VBB2 1R1A2 1PVC1 1RHI1 2XBO1 5BNOA 1MEC1 3VDDA 5D8AA 4CDQA 5BNNB 5JZGB 4Q4W2 4FTEA 3ZFEC 5A32A 5C9AA 3VBRC 2MEV3 2MEV2 4RHV1 2ZTNA 5ACA3 1COV3 1C8M1 5ACA2 4LLFA 5DDJ1 4AEDC 4FTSA 2RMU3 1ASJ2 2RMU2 1RUE3 1QJX3 1RUE2 1QJX2 1VBD3 1NOVA 2HWE3 4CDUC 2HWE2 1COV1 5FMOS 3VDDB 1R093 1R092 5D8AB 4EJRA 3DPRC 4CDQB 5C9AB 5A32B 1VBD1 1FOD3 1AYM3 1FOD2 1R091 1AYM2 1HRI3 1HRI2 2R063 5J98B 2R062 1HXS2 1AUYA 3VBOC 4GH4C 4RQPA 4YVSC 1RB8G 1PO23 4QPIA 1A6CA 1PO22 1NG0A 2R043 2R042 2RR13 1X33A 4RR3C 4JGZC 1E57A 2TBVA 4IV3A 2RR11 5AC92 3ZFGC 1B35A 4Q4V2 2BPA2 3LOBA 1RUI3 1ND2C 4N53A 2GSYA 4WM7A 4RQPB 1NA1A 1RUI1 3S6PA 1AYN3 1RUG3 4JGYA 1RUG2 4NWVA 1QJU2 4PDWC 2HWD1 5FMOL 5FOJB 1AYN1 4IV3B 1NCRA 2Y26A 5BNPC 1B35B 1HQNA 2R073 1PO11 4CEYA 1AL22 2R072 2GH8A 3VBSC 2QQPA 5C8CA 4N53B 3VBHC 4IV1A 1EV13 1K5MA 2X5IA 1EV12 4WM7B 1NA1B 4Y4YA 1AR93 2RM21 1PGW2 4JGYB 4N43A 1F8VA 3HAGA 1EV11 1AR81 3CJIA 4QPGA 5A33A 1AR91 4NWWA 2HWC1 1NCRB
chains in the Genus database with same CATH superfamily
3AL5A 5IK5A 1XC6A 5F8PA 1Y9GA 2BV4A 4I2OA 5CKQA 3KT1A 4P9JA 2XJRA 2JE8A 4FAGA 3POWA 4Y3OA 1S2EA 1U5XA 1W6OA 4FP2A 3WNMA 1RMU3 2O8OA 4ARYA 5DUVA 3OJBA 2WLQA 1UF2C 1ENRA 3WF1A 2HBUA 3GBFA 2Z79A 2NZ9A 1FMD2 3KGLA 1LR5A 5K0UC 3K77A 4AEMA 4P08A 3RYPA 3TN93 4GB31 2A6ZA 3CJIB 4XF4A 4E8DA 4QPGB 3VLBB 4Q4W3 5JMCA 1J84A 3J8F1 2Y0OA 1TMF2 4LNVA 4O61A 5A3LA 2J7MA 1OMIA 1DU3D 2QQNA 3PLQA 3GNEA 3SH3A 1WA6X 1DGWA 5CISA 4IEZA 2BBAA 1H8VA 1ZRFA 1UW8A 1UU4A 3MIGA 5FZEA 2VW2A 2XR4A 3T0DA 3DUIA 2XJSA 1W6OB 1VLNA 2VJXA 4UFMA 4RS5A 2XJQA 2HYXA 1J3QA 1VRH2 2E6VA 1C3HA 4QX5A 2ZMLA 3TEZA 3AKSA 4QGMA 4O9EA 3VKLA 1IKQA 4FFGA 5BNOB 1Y4WA 2YFZA 2RMU1 5EJZB 3AC0A 4IERA 4JKMA 4YPJA 4YM3A 4CDXA 5F39A 2P6HA 3TB0A 3B9IA 3RI8A 2XH6A 1RUE1 1QJX1 3WW1A 5AFBA 3SC7X 1RUH3 1F5FA 2QQWA 3OGVA 4H14A 5FZ7A 3HN1A 1UQXA 2BVBA 4DXTA 1ZREA 3W9AA 1OA3A 1MVEA 1BVVA 4P9WA 1E5RA 2XLAA 2BBVA 4YRDA 1GOHA 1W6MA 1MS8A 4RYDA 1OD3A 4BISA 4ITCA 4AYUA 1FOD1 4RS5B 2WR9A 2ZBJA 3FFZA 3LA3A 3U1XA 4CRQA 1PIV2 3NNFA 4WM8A 2R061 5JZGC 3P3NA 2QCSB 2RS53 1OT5A 2ADDA 2BUKA 2W2IA 4HN0A 4XABA 4A41A 5JXIA 1OVSA 2EALA 3FX3A 3OBTA 5F3CA 1DQ6A 3ZSEA 1U5ZA 4CDXB 3IWZA 5DZFA 1JS9A 1W9FA 3KM5A 1NKGA 1RUD2 2V73A 4YM0A 1ZRIA 3WNLA 1SHWB 5L7OA 1ZA4A 4NJ4A 3LEIA 5AC93 3VGIA 4D7TA 3NWKA 4R9AA 1HQWA 4BZ4A 1W6MB 3URFA 2D3RA 1H30A 4URTA 5ABJA 4MGKE 1BMV2 3RS6A 3DN7A 3WF3A 3BIWE 3DECA 2XL7A 2Q5TA 1DQ0A 2D40A 1TNFA 1W0NA 1YCIA 2UURA 3B94A 2P1BA 2VR4A 5F5CA 1F31A 5D8AC 4FOQA 4WM8B 2EICA 5C5TA 5LWBA 1QDOA 4Q4V1 1V9U2 2F4LA 2DFCA 1YI7A 1CN1A 4AE2A 3VD7A 1QJU3 2PN5A 3ILFA 1H4GA 2RS33 1W0PA 3WHTA 5L7OB 4QHOA 5GM0A 5LBCA 1FAYA 2IC1A 1UOGA 5EJ3A 1V00A 1YHFA 1RXFA 2VULA 1AL23 4W8JA 5ABJB 3VBRA 3EMRA 3POYA 2ATFA 1D7PM 3VZMA 4NIDA 4I30A 5CKMA 4XILA 5KHHA 2FBEA 4JTNA 2ZGQA 4RN5A 3NW4A 4XF1A 2EA7A 4M3CF 2PLV3 2Y0IA 3WINE 3H50A 1ULDA 3NJXA 4AI0A 1LHNA 1CAVB 3AX4A 5HCHA 4GMP1 1E5IA 3ZYHA 4XHBA 5FY9A 1ACCA 2ZHMA 3ZOIA 4FSJA 1XB9A 1NLSA 1YEWA 5E16A 4LO5B 1O3TA 1V0AA 4CSWA 3THCA 2IWGB 4NPRA 3A0NA 2JE7A 5IWFA 1NE4A 2WZ8A 3FHAA 1CPMA 3I2DA 2YV8A 3VBRB 1W99A 4CCEA 2JDPA 1O5LA 3CDZB 2YPDA 1AF9A 3KGZA 4QX2A 3LEGA 3K3NA 1ZBA3 4NAOA 5M0TA 3GGLA 5JI9A 1Z7S3 1HDKA 5JPMB 4V2WA 4Q27A 4LITA 3FZ3A 1O91A 5FPZA 4XACA 4HBNA 4S2DA 1TMF3 2VE1A 4FT8A 4LIVA 2ZGNA 3KQRA 4UAPA 4N53C 5HCAA 4RR3A 5GZEA 1LGNA 3TN91 1O4ZA 2BRTA 3ILNA 1EYBA 4Q29A 4H2AA 2FCUA 1QXJA 1CWPA 1PVC2 4FCAA 3NJVA 5ERLA 1RHI2 4OCTA 3GM8A 2A6WA 4Y1ZA 4ASLA 1H0BA 5IJRA 4CP1A 4HVOA 4BB3A 3I54A 3RZKA 3M3CA 3O1SA 4FO9A 1CD3G 3HBKA 3ACGA 1AHSA 4BOWA 4B7KA 5LRRA 1YQ5A 3AP5A 1IG3A 4NIAA 5K9YA 3WDXA 2BTVC 1H1AA 2ZJCA 3IIAA 4CZSA 1JXNA 4R4ZA 4EWAA 4Q2FA 4HONA 4RR3B 3AMPA 4IV1C 1K5MC 2J1EA 3N9LA 5FZBA 2QQIA 2VOVA 2WJSA 4CCJA 1LB2A 3VKMA 5J37A 1GP4A 1J58A 1RUH1 3DYOA 4XCBA 2JG8A 2DVBA 5FPLA 5FZ4A 1SLBA 1VBE2 4QQ2A 4QQPA 5JOZA 2N7GA 4UW6A 3THTA 1VBD2 2BOIA 3FHIB 3PMEA 2DV9A 5AVPA 2P3JA 4FAHA 5JOWA 1ULCA 3RMYA 2ZZQA 3X29B 5JSOA 3GALA 3GHNA 1JU4A 4FFHA 5JIUA 4LLOA 4O9GA 3I2FA 2RS51 5FREA 3SXWA 5LEJA 3UT0A 2W5FA 3ZFFC 2Z4FA 3I3EA 1LU1A 5KC5A 3ROUA 1GICA 4PLOA 1XE8A 1OUXA 5GKAC 4CU6A 2VOTA 1FXZA 4MG2A 3WXPA 3BYWA 3R4DB 5FWJA 4NMIA 3RPQA 1OKOA 1V6KA 2JG8B 2LALA 2PHTA 2OW4A 1L7QA 1V6NA 3POSA 4WVVA 2WQZC 3PIGA 4XUNA 4YM1A 4HZFA 4AL9A 1NZCA 1XE7A 2WNEA 1KFXL 2OPWA 5C33A 2UWAA 4FPYA 5JPNB 5FO9B 3H7YA 3LIGA 4QB6A 4AGRA 1W8OA 2JX9A 2XGXA 3PDQA 3Q8BA 5DAWA 4E2QA 2D44A 1R081 3LD8A 2JB8A 3IIIA 5IVBA 5H9QA 2DTYA 1WMEA 3NAPC 1YFXA 4QPWA 3RYRA 1F2NA 2MNGA 1XNCA 3OBZA 5CKNA 2Y34A 2RS31 1HIXA 2QZ2A 3ACFA 5F37A 4QU1A 4J6GA 4KQ7A 5A7WA 2PXJA 2HWD3 2OZJA 2VH9A 3ZM8A 1AXKA 2PA7A 1YXWA 4DS0A 4CTEA 4HLTA 2DF7A 4LO6B 2WO7A 1A8DA 2VMGA 1LGCA 3IAQA 5L19A 1YI9A 3EJKA 5HCFA 3D5OA 4C1WA 3H0OA 1PO12 5LA9A 2A3WA 1PGL1 3IMMA 2C9KA 4XJUA 3J7NA 3RG0A 2E31A 3WDVA 2PLV1 3IZOA 4A3ZA 4ZZ8A 4GULA 2DVGA 2ZS6B 3FC0A 2WNOA 1SFYA 2ORXA 3BB6A 5A3OA 1BK1A 1BBT2 1OKQA 2VL4A 1BZWA 4CEWC 3ZIXA 2ADEA 4PLMA 1QJY3 5CG8A 5EP9A 4AEJA 5I8YA 2D5FA 2VQ0A 3MIHA 1V70A 4WZFA 5A7WB 1JBCA 1U12A 1XYOA 4I0AA 1AR82 2OQ7A 5FP7A 3VBUC 1HB2A 4Q0SA 3AYAA 4F83A 3A23A 4BDVB 5A7SA 2WYFA 4I02A 4LBOA 4M00A 3NV3A 4LQRA 4L97A 1GNZA 1ZBA1 1HRV3 3OSDA 4CXYA 1G6NA 5CU1A 3J7HA 3JBG3 1Z7S1 4YZ4A 1OQEA 4ISQA 1Y3TA 4PIXA 3WHUA 3K3OA 1DF0A 3WNKA 4YVWC 1C5IA 4K20A 3USSA 5C3OA 4YNIA 2WSVA 5T52A 4GB32 3D8CA 3FJSA 1MVQA 3MFCA 4G4FA 4YW3A 2VBBA 4Q0VA 4ASMB 2WO3A 3K51A 1OA2A 4COYA 3ZSJA 3H8XA 4Q0QA 5F2WA 5B4NA 2TNFA 3NMBA 2R30A 4PQ9A 4QM8A 4XUPA 5A32A 5C9AA 5J48A 5JIAA 4Y33A 1Y9QA 1VAMA 2JKXA 2XQXA 1IS5A 3GBGA 5IYYA 1FT9A 4AW7A 1DFQA 3SEEA 2UU8A 2WZEA 2XJUA 2R7EB 2ZTNA 3O1VA 5IK4A 2BWAA 4NOTA 4J1XA 5F3GA 3OEAA 4BQ4A 1AZDA 4JCKA 4I3GA 1A8MA 3HNBM 4HKLA 4N7IA 4D6QA 5JWPA 3OD0A 2RMU2 3NVCA 4FXGB 2QDNA 4JQRA 4P5YA 1WUVA 4CE8A 1HJFA 5JSRA 1LOAA 1W8HA 4I3PA 1UYPA 1RUE2 1QJX2 1VBD3 3CKHA 2IVIB 3U11A 1COV1 1YNAA 3O1PA 1O3SA 3RZJA 4QWNA 3AVRA 3DPRC 4FFIA 4HANA 4AGGA 4NPMA 1IS6A 2XWJB 4H7LA 3A21A 2C24A 5A32B 5C9AB 4MH0E 1DQ5A 1U0AA 2BEOA 2D93A 2V72A 2DTWA 3H3UA 1EPWA 1FOD2 1R091 2OYZA 3WDYA 1HRI3 2ZX2A 3T3YA 4D8MA 3BTZA 1W6PA 4Q0UA 5LY2A 3DGTA 4MZUA 5A7PA 2R062 2PHXA 2WA4A 4PT6A 5FLHA 3ZXJA 1SCSA 5A3WA 2ERFA 3LQCA 3S0MA 5FYMA 4HT1T 2GNBA 3VBOC 1LODA 3WNOA 3E1F1 4B3NA 2VNRA 1F9KA 3H1MA 5JI7A 4GH4C 5T55A 3WX5A 4OHXA 1UYXA 4FP3A 5HXMA 5EV7A 1PO23 3SH5A 3POFA 1A6CA 1VPHA 4TSVA 1QF3A 2Z2SB 5FXVA 2GN7A 2VGDA 5FUNA 3Q8EA 2A6VA 2PMWB 3HNYM 5LB6A 3U4SA 4AXOA 4UFJA 5A3MA 1UOJA 3RDIA 4JGZC 3FFQA 5ANNA 4I09A 4MSVA 4XF0A 1H1MA 4XE9A 2TBVA 5EXOA 3O14A 2EXHA 1YC61 1W6PB 3IM0A 3ZFGC 1VAVA 4NO4A 3ZXLA 1ZZBA 3DKQA 2ZX4A 4DEQA 3O1RA 3FE5A 1UZZA 1UZ0A 4Q4V2 2ZX1A 4Z82A 3VD3A 4ZZ5A 3LOBA 2DBIA 1ND2C 5L9VA 3V56A 4IEVA 4ZU5A 3SKJE 2CDOA 4KGGA 4B4PA 4KG8A 1V6OA 3D3AA 3T4HB 4YGDA 3VHOA 1DHKB 4JRAA 1H2MA 3WG3A 3W20A 1HN1A 1VALA 4JGYA 2A3YA 4IEOA 4CUCA 2NMOA 3PUQA 4CCNA 5T54A 4PDWC 3S7EA 2RJ2A 2B7YA 2RE9A 1QJFA 2XDVA 2HWD1 3N9QA 1XU1A 3PUAA 4TWTA 1OBNA 2DU1A 5GALA 1WLTA 4E4ZA 1EUUA 2XVLA 1KS4A 3W21A 4E4HA 1HQNA 3PTRB 4EN0A 1BXHA 4E9KA 1UKGA 1J3RA 2BQPA 2G9ZA 1W06A 3WF2A 1AXZA 4PI0A 5F5QA 3TYJA 5DMYA 2X5IA 3J7LA 5FYHA 3O0XA 2B5HA 1OF4A 5BXXA 4QXBA 3LGRA 2AR6A 4P02B 3I59A 3QACA 1MS1A 4XJ9A 4D6SA 4JGYB 1QNYA 4GQ7A 1F4AA 4N43A 4LBKA 1EV11 1OPMA 2WQ8A 3BTYA 1CAXA 2JG9A 1O3RA 1AR91 3NKGA 2WFPA 2Q1FA 5FZLA 3SISA 4PIYA 1F35A 3QLQA 4C90A 4BU2A 1US2A 2E33A 4KWKA 2VNVA 3F95A 2MHFA 2W0XA 3FHQA 3H1WA 4QDSA 4KMQA 4CCDA 2Y6LA 1HRV1 2AEYA 2QTWB 1MPXA 1GMMA 3JBG1 3MF9A 2E63A 2W95A 2X5IB 3ZYRA 1UO9A 5BPXA 1VBA3 3M4FA 1VMHA 5KBFA 3I59B 1RUNA 2YBPA 1BVP1 3J8F3 4LR4A 5FIXA 3WDWA 3K46A 2WS93 1SLIA 3DKWA 1QJEA 4N43B 1BHGA 2A5ZA 3RSJA 1CAXB 2JG9B 1ZBE3 3TN92 1ULGA 3RVHA 1X50A 4Z2AA 5BV6A 2IUWA 3KS7A 4XAAA 4LXLA 4EQVA 5KXBA 1W2TA 2CL2A 4CDWA 1QKQA 2JD4A 4FOWA 3AMHA 5ANQA 1SLLA 4DQAA 2OS2A 2VNGA 3BTAA 2WNUC 3IDEA 5J36A 1JZ4A 1LKNA 3NNJA 3FBYA 4OHYA 1ONAA 1ZVFA 3WF0A 5J09A 4BQWA 1C28A 4KGQA 5FZHA 3WQ1A 4W65A 3MLKA 1MQTA 5F7UA 1MZFA 3BIEA 3FUOA 3WQ0A 3WD5A 1KITA 2RG4A 4QD2A 3S5QA 4L9BA 1PNGA 3N3HA 2NYYA 5A3NA 4FPHA 2CDPA 4URAA 2B39A 1UOBA 4JHZA 4LKFA 3N7KA 4A6OA 2UY8A 2WO2A 4LE3A 3SCHA 3G7DA 4AQ6A 1ENSA 5F32A 1RUH2 1YIFA 2VUCA 4CDWB 5CBLA 2FDGA 5CFDA 4OQ8A 1JN2P 1S0EA 1UPSA 1NCQA 2D97A 1LU2A 4RFT0 4XUOA 2GC0A 5FKBA 1SLCA 3CLPA 3IBMA 4CYDA 3GXUA 3IPVA 1M4WA 1XNDA 3HMYA 4Q4Y3 4WVWA 2FDIA 4W6XA 5FZOA 1W6QA 3MYXA 1IHMA 5C70A 1HRI1 4TZDA 4CVUA 1MQTB 4HKOA 1W8WA 5GLVA 5BNNC 3POEA 1DG6A 1HXS1 1UCXA 2YC4A 2RS52 3EQEA 4BK4A 3OUJA 1L7RA 2OUJA 3FWEA 3Q8AA 4J1WA 3N9MA 3BUCA 5IW0A 4WV8A 4DIQA 2VC9A 4XIKA 3ZSLA 4P9LA 3MV01 1SMVA 4OULA 3OGJA 1ZRRA 1BQPA 1XSQA 2PELA 4RL7A 4AOCA 1PO21 5JR2A 5IVFA 3O5SA 1S4CA 1QY4A 3AFKA 4G9SB 1XSRA 4P00B 4QKDA 4XETA 5CFDB 2PHFA 1NCQB 3VDCA 5IVCA 4JV4A 1REFA 3I3BA 3ZKYA 1PM7A 5FY5A 1ST8A 4Q4V3 1YFUA 3NV1A 3VD5A 3IPVB 4YGBA 5A6ZA 5CFCA 1NAEA 4AHWA 4NIHA 5FZOB 1W6QB 1XPWA 5T5LA 3VDDC 1QQP1 1SPPA 1ENQA 4M3CE 3HQUA 4X8PA 2HH9A 4KWJA 4EE2A 3EO6A 2E26A 3HPNA 5JXGA 3LF7A 4C0BA 2CV6A 3VHRA 1LHOA 1LHWA 2OXBA 3APBA 4DINB 3UESA 4QQOA 4DRVA 4PF1A 4HVRA 1UN1A 1RL3A 4FTBA 2RS32 1FYUA 2WT0A 3WUCA 4OUSA 2EIGA 1GWLA 4V1PA 1BEV3 4XXAA 1TVGA 2X8KA 4GKYA 4BWOA 5IATA 3RRDA 4XFHA 4KWUA 3PJYA 5CFCB 4EZ4A 1NXMA 3AMMA 4EWDA 4AFDA 1GQGA 1SPPB 5E6HA 1UMIA 4GMP3 5L9BA 3MLJA 3ZN4A 1PGL2 3FLRA 2VBPA 1MZEA 2PLV2 2H6CA 1NE6A 5FYVA 4D6RA 5K7PA 3WP4A 2ZHKA 3WUDA 3OG2A 3P1IA 4AEDA 1DGRA 1EPZA 5HPOA 5CG9A 3E5QA 1HV1A 2QKDA 1PGW1 4CDUA 4BMEA 4DXRA 5LEKA 4Y26A 1OLMA 1Q3EA 5EFUA 2H0BA 4DB5A 5LA0A 2Y33A 4BA6A 3KLSA 2EIEA 5JOYA 2HWF3 1LOBA 2YMZA 2DCZA 3FLTA 1MZ6A 1G9FA 2CGPA 1GR3A 1GYKA 4BMBA 4CA9A 2GC2A 1QH6A 1PZ8A 4F7ZA 2E53A 4DXSA 1CGPA 1XQNA 2ARBA 2W94A 4ASKA 1ZBA2 3A22A 3C7OA 1EP0A 5FYZA 5FQ0A 1IGOA 4UT5A 4OQ9A 4ES8A 1AR73 4AEDB 5I91A 3LPGA 4IV3C 1Z7S2 4BQ2A 4FPKA 2BZDA 5IVVA 4YVSA 2DYCA 3NKTA 4DFSA 1VBA1 4CDUB 5IAVA 2D6PA 1YO8A 2V09A 4Y1VA 5LZ6A 1OFNA 3HJRA 1FNYA 5IFPA 3J7MA 2WS91 3B7MA 3PHMA 2GNMA 4ET7A 5FO8B 1ZBE1 4XXPA 5I93A 5AFEA 5FP9A 4JDMA 5LK5A 2D43A 1WWYA 1MEC3 2R6QA 2ZZJA 5G05L 1VBC1 2CAVA 1S0GA 2BU9A 4IEQA 4KU8A 3RNSA 4NHXA 2VBDA 4XUQA 5FQ0B 3NSTA 2HEWF 3GZEA 3OD4A 2WN3A 1TEIA 2F6BA 1NCRC 4RHV3 5LY1A 4YVSB 1LOFC 2Y6KA 1S2BA 3ZIWA 2CGOA 2GDFA 1Z78A 3I7DA 4META 3Q8FA 4CEYC 4NUBA 1APNA 3BOWA 5C8CC 1MR5A 1Y43B 4IGOA 1HJGA 5FUIA 1TME1 4FQ4A 2XKPA 3ITQA 1GQPA 3W5MA 1POV1 4K21A 3RFRA 2GMEA 1COV2 1IPJA 2LRPA 3O0WA 5KHGA 1VMJA 1UX6A 3WR0A 4XDPA 3ZMOA 3LSEA 4UYBA 5FZKA 3S30A 3VBHA 4Q4Y1 5FY8A 1I1EA 1O8SA 3CJXA 4B4QA 1OHFA 1UOFA 2P5BA 2P3YA 2W39A 2JDMA 3LAGA 1UZWA 3OGRA 4FPOB 4PJYA 5FMCA 3MIFA 3JQWA 2PAMA 3OY8A 3GHMA 4BQ1A 5AVAA 4Q4X1 3HIFA 2P6CA 2X53S 3MFAA 4XUTA 4HKWA 4AWDA 3SEPA 1IZ3A 1NQDA 4XFCA 3SH4A 2WAAA 4Z92B 4YZ2A 5H9SA 1OI6A 2Q8DA 5EQUA 5FCCA 1N3OA 2VTFA 2EXIA 2A71A 2VZRA 3BODA 2EAKA 1W9YA 4GAZA 4COZA 4EN7B 5F1RA 1RTVA 3R6SA 2VVEA 2GMMA 1R083 4JQTA 4NRQA 2ZAAA 4JC1A 4K3UA 5KC6A 5JUVA 3VBHB 1DDLA 2C9AA 4EYUA 2VAUA 1OSGA 4XMAA 3VD4A 4AVCA 4LHKA 3CMGA 5CAZA 2AENA 4GKXA 2OIIA 3OY8B 1WW5A 4LKSA 5K0UA 3TEXA 3KV9A 1WW4A 1WZXA 1H2NA 4QXHA 5F3EA 3W5NA 3GZAA 3KSCA 2X05A 2C4XA 2VVDA 4V2VA 1NY71 3JB4C 4GA9A 2W1UA 4GZ9A 1IPKA 5C3SA 4R4XA 4W4ZA 2FDFA 2XVKA 2VVFA 3FMGA 3P6BA 3T09A 3VBFC 5I8TA 4DO0A 2BNNA 3KB5A 3EBRA 3OPTA 2AYHA 2BP6A 5FUPA 1BEV1 2RS11 5FXWA 3MLLA 5JAXA 2O0OA 2HWD2 1WCDJ 1AR61 3ZX7A 4AI2A 1KEXA 1QOSA 1XRUA 1Y7BA 3KV6A 4Q1RA 3HN3A 5K0UB 4QT6A 3AP7A 2EXKA 3ZYBA 4OMCA 2PQSA 1CX4A 1X8MA 1NQJA 1Q5OA 2QE3A 4NAMA 4XOGA 4U2AA 4E4DX 5FDBA 4AI1A 2FMDA 3OCPA 5DUUA 4NIIA 4LHNA 1QH7A 2RM23 2WNVC 4QX7A 4XTPA 4XJWA 1KXGA 3SHRA 3VZJA 3HR9A 2A1XA 1QJY2 2QQJA 3JZVA 4MO3M 3AZWA 4QPIC 2ZOEB 4AR2A 4Y5SA 4DPNA 4Q5OA 4WVMA 1GP6A 2HWF1 1AR92 2Q0AA 2UYAA 1ZZ7A 3ZSKA 1PVXA 2HWC3 4GWNA 5CA6A 3AZYA 3VD9A 2ZEXA 5JZGA 3NL1A 4A4AA 4BH9A 3ZMNA 1IKPA 3JD71 1HRV2 3OPWA 3ZXDA 4AVVA 3NV2A 1H8TC 4MXVA 3BVCA 1AR71 2QBXA 1GZCA 3JBG2 4MHRA 4SBVA 2R1BA 2XHKA 3VV1A 4NRPA 1EUTA 2VW0A 3OYWA 5HXVA 2ZGPA 1W04A 1RUJ3 2C6SA 2OPKA 3H1YA 2DUQA 3PU8A 4ZONA 4DUXA 3O1MA 4YZ3A 3KQ4B 1D4M3 1VBB3 3PVBB 1R1A3 4HETA 2CWMA 4Z2WA 4OFGA 2RJKA 4WVMB 1W9WA 3SCGA 2JJ6A 1DLLA 4H3WA 3KD4A 4YG6A 5D1IA 2BDRA 2XBO1 1OUSA 4E27A 1MEC1 4E4SA 1JHJA 1LESA 2RDQA 2G9FA 3VKOA 4AAPA 4A7YA 5D8AA 4UXAA 5HCBA 2EAAA 1W2OA 5JZGB 4DEVA 4FTEA 4Y4RA 3PU3A 1CJPA 5FPBA 3ZFEC 2MEV3 2B9UA 4CU9A 4FXKB 1WGPA 1DZTA 1MS3A 5T5OA 1DBNA 2XQRA 3N7JA 4RHV1 5FKCA 4BPZA 2QQKA 3RYKA 3V0BA 1SDWA 3OYWB 4PHZA 1QDCA 3WP6A 3P3PA 4YLZA 1XNKA 4IEYA 4YGEA 1BCXA 2V4AA 2ZGUA 5DPNA 5FXXA 4CP2A 1COV3 4MYEA 4LLFA 2YU2A 5CNAA 4ATEA 1L3JA 1ZZ6A 3AMNA 2XLFA 2G19A 4K7JA 5C8WA 2HWE3 3HD8B 3PNAA 2VMDA 1XNAA 1ZX5A 1Q8QA 1R093 4XZUG 3NV4A 1UZVA 3E97A 4MHUA 5D8AB 4EJRA 3LFMA 2Y6GA 3CHXA 4LO4B 3WCRA 3S7IA 1UIJA 3V64A 4Z8BA 4Q26A 2OZ6A 5EJ1B 4QAWA 1AJKA 1HRI2 1WMDA 4RGGA 4K8RB 4R52A 5C6CA 3POIA 4LOTA 3V0BB 5J98B 1CAWA 2EVXA 3UGFA 1HXS2 4IEUA 2EIDA 4ZKTB 4NVPA 1RIRA 2YXSA 3PL0A 2VOWA 3HBZA 4QKFA 1GZ9A 1OQ1A 2VZ1A 3ZXGA 5EHDA 1NLRA 4BE3A 2E7QA 4JKKA 1W6NA 2PHDA 3WSOA 4QPIA 1O6UA 1PO22 2R043 4B29A 1AX1A 4UFIA 4B8EA 5FY1A 1X33A 4QHZA 4LBLA 4LUKA 1GZTA 1K42A 3WY6A 3NRUA 3PUIA 2EXJA 5FYCA 3ETQA 2L9LA 3D6EA 1W2AX 3GJAA 1CAWB 1GOFA 4XW3A 2BPA2 4Y1XA 3JU9A 4IEWA 2FMYA 3N9NA 3ABZA 2V5DA 4N53A 3SMHA 2VMFA 2VUAA 4LBMA 2K0GA 5CIRA 5H9PA 3UETA 4DUVA 3MV11 4YW5A 1JOBA 3ILRA 1BYHA 3MUZ1 4YW7A 1W6NB 3HWJA 1QOTA 3JCIA 1MZ5A 4OI0A 2XL9A 2IXJA 5FZDA 4Y22A 3EXUA 3N36A 2D6LX 2VZ3A 5A7OA 1GUIA 5JCTA 3POJA 1AYN1 4P9GA 2I45A 2Y26A 5BNPC 2OX0A 2R073 2BWCA 4IW3A 3LCPA 4ZY9A 5GJ6A 2LM3A 3VBSC 4HXCA 2W3JA 3OEBA 5FY0A 4BLJA 1W8UA 4LTAA 2WWJA 1UY2A 4N53B 1W2UA 3KV4A 1UWWA 4FPEA 1F5JA 1HW5A 4IV1A 1EV13 1K5MA 2BGCA 4K1ZA 1WD4A 4LBJA 3KF5A 3AKTA 3AP9A 1AR93 2RM21 1ZNPA 1PGW2 1B09A 2AC1A 2VO5A 1IS3A 1ZZ8A 2ZMKA 4QX3A 4XBLA 4AQ2A 1F15A 2YPJA 3DYMA 3GCXA 4R9BA 2IXHA 4RD7A 2VUJA 4Y22B 5JLVA 2ZEYA 1VIWB 1YQ8A 5EYXA 1XU2A 5FP4A 2YUEA 1JODA 1YWKA 1A34A 2RDSA 3ATGA 4NWWA 4XTMA 5I0DA 1PM4A 2JENA 3H8RA 2HWC1 2ARXA 2KR2A 3IN9A 1O5UA 4EZHA 4S2HA 1WBLA 1JYTA 2CAUA 2ZPXA 2BVVA 1RUC3 4A6SA 5JOXA 2X09A 3VKNA 1S0CA 2WAOA 1JUIA 4YWAA 1N1SA 1K5MB 4IV1B 3ZFFA 1FX5A 1OVPA 1LAJA 4HK8A 3EHKA 1D0HA 1VBA2 2PQQA 2RHPA 1HV0A 3GDBA 3MIDA 4A7ZA 1AL0G 3GBWA 3J8F2 3NJYA 1RUJ1 2WS92 2WUHA 3PVNA 3VDBA 3N4MA 5FZIA 2WZR3 1D4M1 1SBDA 1N1TA 1R1A1 1VBB1 2G9GA 2YYOA 4JZRA 1ZBE2 4LA3A 3E6DA 3WV6A 4EN8B 1OF3A 1HQLA 5C3PA 1OOPC 5J7MA 4N7UA 4INDA 1REEA 2YBKA 4BHPA 3O1OA 2VMEA 4TXWA 3ZXEA 1CIWA 4QB1A 5DN2A 2ENRA 2HWB3 3EB7A 2K9ZA 4CUAA 2HKXA 2ZACA 5D2AA 2OA2A 4X8NA 2MEV1 5J96B 5C4WC 5F9TA 3T30A 3NAPA 3ZFFB 5C71A 5FV3A 1X9PA 5DG2A 4BQ5A 2A6XA 2FDJA 2W1WA 2JXAA 3K4AA 1U5IA 2ZHLA 5FZGA 3LKJA 3T1MA 3VZLA 3ZYFA 2TUNA 4RFRB 2WABA 4HOOA 1TME2 1X9TA 2YFUA 1ASJ1 1QEXA 4P14A 5I0RA 3M2MA 1H9WA 1RINA 2W91A 4OUEA 1YUDA 1ND3C 2J42A 3M70A 5ISLA 1RXGA 2HWE1 5FYIA 4DUWA 4AVSA 1ZZCA 2P4EA 1XNBA 3MHZA 5FJKA 4XBNA 5J3UA 2BOJA 4K6BA 3SNMA 1SG3A 2LUWA 1HXS3 1AXYA 2B42B 4XFBA 1ODMA 2XMLA 3OTFA 3NAPB 4Q4Y2 4QDQA 4XC9A 3BPZA 1YJKA 2PHWA 3WQBA 1QOOA 3SQOA 1JH5A 4CEWA 1OXCA 1J83A 2C1FA 2ZGMA 3B69A 4TLFA 4YW4A 3ACIA 4NE9A 4YGCA 2OVUA 3WT3A 2ZEWA 3UGGA 2GC3A 4KI5M 4C91A 4ZXEA 4C8DA 1PIV1 3PVEA 5IVEA 5FP8A 3VBUA 4N8MA 1JMUB 4DY3A 2YB7A 4LUMA 4JKLA 4BK5A 4Y24A 2R041 3WW3A 5A3UA 1T6GC 1JTZX 1QQP3 3H3LA 1YFYA 2DFBA 4IGPA 5FAXA 2GP5A 3V0AA 1RUD1 2ET1A 2VXJA 3QH7A 2VTXA 1W39A 1F4HA 1TQ5A 2FHRA 1SZBA 4IETA 4TYSA 4N9HA 2NQYA 4CDQC 4CEWB 3RWNA 1DQ1A 1LENA 5FOBB 4YVWA 4ZU4A 4QHBA 4FVVA 5LA1A 2WFF3 1C4RA 3MPBA 3BI3A 4IGQA 3MIBA 4M0HA 2AACA 3PUHA 1YIPA 1S55A 2QQOA 5FK7A 3VBUB 5A70A 1LOGA 4MX3A 1NY72 4AVBA 2XPJA 4AFBA 2JD9A 4KWLA 2Y6JA 4YW2A 5KWRA 1WMFA 3JB8A 1WA4A 4CCCA 1VE0A 2XWBB 1BEV2 4Q8LA 5A1FA 3WW2A 2MPFA 3B93A 3V0AB 5FYUA 3WDUA 1AR62 4HL0A 1DP0A 1NT0A 1IOAA 1X82A 1YFWA 4A44A 5L9RA 3QOPA 3M1HA 1JZ2A 2QQVA 1RJ8A 1H2KA 3GZUC 2PHLA 1NX9A 2R071 4SLIA 4YVWB 2ZKLA 3VHPA 1D0GA 2JIGA 3WP3A 1Z0HA 4AI9A 1ZRDA 5FYBA 1LULA 3FBMA 5SV5A 4ISRA 2PTMA 5D21A 4W6YA 2YC0A 3AB0A 4Z1VA 3RZGA 5FZMA 2VQTA 4QGLA 2D6MA 4YM2A 3S57A 5DZEA 3ZXAC 1OLQA 2LW8A 3R0RA 1DCSA 3DPRA 3IAPA 1MS0A 1PK6C 2W47A 3AXEA 2FZ1A 4HK9A 2HWF2 2R32A 4D7SA 3LPFA 4RQPC 2P17A 3O1TA 2ZGSA 4Y5TA 2ZHNA 3A4UA 4LORA 4FFFA 2XG3A 3LWCA 4D7YA 3ZVXA 2C0ZA 2VZUA 2D7FA 2ZEZA 4X6QB 2GZWA 1V6MA 1EAH3 5DQ0A 1RUC1 3VBOA 1AR72 4D0QA 4O7XA 4R9DA 2DVAA 1B35C 1RVF1 1UY4A 4GH4A 4DRRA 4LPLA 3J4UH 1RUF3 3EYPA 1EY2A 1PZ7A 3ES4A 4HPKA 4XJ8A 2DUPA 1VBC3 3DPRB 1WMXA 4R8HA 4WVZA 4GIQA 3SKVA 3WZ1A 1QXPA 2VMHA 2W68A 2WZR1 4JGZA 4FBFA 3U10A 3UYJA 4H7MA 5IT6A 2J1UA 3VZNA 4WM7C 1XNTA 3I3QA 1CAUA 4QGNA 2XBO2 3JUUA 3KCCA 1MEC2 1XBFA 3WLUA 3ZFGA 5IK7A 3T2QA 3BU7A 2BFUL 3N7LA 1PX3A 2ZGOA 3K4DA 5IHRA 1UZYA 1CQ9A 2HWB1 4LBQA 5APAA 3WG4A 1ND2A 3ES1A 2JWPA 3VBOB 3ENRA 1UNBA 2VG9A 3ZYIB 1GANA 1TME3 4BXFA 4RHV2 1HX6A 2YBSA 4GH4B 5KHKA 3I2HA 5FLJA 1POV3 3ACLA 4HPKB 3ZR5A 1C8M3 3J26N 2XB6C 4LBNA 5DDJ3 1Y9MA 3WOGA 4PDWA 1PHMA 1RITA 3R4SA 1LCLA 4NROA 4JGZB 1YQ2A 1OC1A 4ZS2A 3POGA 1C8NA 4ORFA 2ID4A 2ZAHA 4G3YC 4K9SA 5FPXA 3E6CC 3Q9OA 1UD1A 4E8CA 1OD5A 4QX8A 2K46A 3RWKX 3ZFGB 1JYVA 3MO4A 5CADA 2NPIA 3MICA 3T4VA 1XXNA 4JRLA 3CJIC 4EWEA 4LBQB 1FPN1 4QPGC 3BU0A 4DMIA 4OI1A 1ND2B 1CZSA 1H9PA 2WYSA 3IDBB 5DAVA 4DOUA 5I0SA 5EZWA 1CPNA 4Q4X3 4B4RA 3AYEA 3LB9A 1GLHA 1VBE1 3MW4A 3LFIA 3N9OA 4LHLA 1JZ7A 2XJPA 4OI4A 2CY6A 4KG0A 4QM9A 3IKWA 1O3QA 2VQAA 2ETEA 5DUXA 3KHCA 4YW1A 3KWVA 4OHVA 3N9PA 3I2GA 3ZO0B 2WT1A 1YJLA 4PDWB 2YG0A 3LA2A 5HV4A 2R16A 2W87A 2WL1A 4B7EA 4IUGA 4UI9L 3M3QA 4YW6A 1O4TA 5FZFA 1PMIA 1Q43A 1UYYA 4Y1UA 5GLUA 2DWRA 2XUEA 4UFLA 4B1MA 2CU5A 5GZDA 5BNOC 3L2YA 1E5HA 4GXLA 2P34A 1LEMA 3K2OA 3OBAA 1D2QA 1WCKA 4LKDA 1LJ7A 1RJ7A 2I2SA 1NUKA 1W90A 1R082 2VZOA 5IUQA 2BNOA 3ECQA 4BCUA 2P3KA 2AGSA 3NO8A 3ZDSA 1JZ6A 4IQPA 3J9SA 4QXCA 4LKEA 4WBBA 5DG1A 1LRHA 2WFF1 3THDA 2WRAA 2ZX0A 4RS5C 4CPBD 1WCUA 3OBRA 2W92A 2RS13 2XHNA 3MI8A 3AMQA 1PZ9A 3LDBA 5FPVA 2FDHA 1M06G 3OPZA 5JXHA 1AR63 2BFUS 4I0BA 4FQZA 5DAXA 5FJHA 3KT4A 5LCWL 5FZCA 1OPOA 4IESA 4CUGA 4UW4A 2W9XA 4O65A 2D5HA 1LHVA 5E1RA 4CDXC 1GU3A 2WNUA 4QU2A 1SBFA 3KZ4C 2JDHA 1AYN2 3JXSA 3WEZA 4AK3A 3DCQA 1ODNA 5L73A 5C7GA 2VCCA 5T5JA 1UXXX 4HN1A 3KVBA 2PAKA 1SCRA 1LECA 1Q8VA 2PAEA 2Q8OA 3UKNA 2YU1A 4L0PA 3WDTA 2FD8A 1WD3A 2W52A 1VMFA 2BGOA 2A75A 4FOVA 4S2GA 1S0FA 3IDAA 5F5IA 5FPUA 3AVSA 3M3OA 5BUVA 1CJDA 2R0FA 4WM8C 5GLWA 5LW9A 1HLCA 2FZ2A 2RM22 4LEJA 2GN3A 1ZM1A 4CU7A 1Q8PA 4JDOA 4L11A 2WQ4A 1BBT1 4MUVA 3K75B 5H9RA 2GALA 4XJAA 4MADA 2WNUB 5JR7B 1BKZA 3JD73 1N1YA 2HWC2 5L7OC 1JYWA 5IAXA 2NP0A 1OURA 2HJIA 4GD4A 1YQCA 4YG0A 1AVBA 1J1TA 1UY0A 3WP5A 5BNNA 1KDMA 3I3MA 2QVSB 5BYNA 2BGPA 3MW2A 5ABJC 1KD7A 1TNRA 4HSLA 1EAH1 4QX0A 1VAKA 2DBNA 4JTOA 5LRSA 2EF6A 2ZGKA 3FLPA 3ZN5A 2P3IA 1L7LA 1UPIA 4H55A 3AYDA 4HFSA 1RUF1 4ONUA 4TLGA 1RUJ2 2XBO3 4UFHA 4YG3A 5A1AA 4IE5A 1D4M2 1VBB2 2BNMA 1R1A2 2JE9A 2VZSA 3WNXA 3ZN6A 4XURA 3AYCA 2P2KA 2KD7A 5LASA 1N3QA 4Y1YA 4XYXA 1WCSA 3VDDA 5BNOA 2ZGRA 1CZVA 3B3QE 4BJ0A 2A6YA 4AZZA 2SBAA 5I0UA 5BNNB 4HVQA 4M4PA 3VBRC 2FQPA 1WBFA 3I2IA 5E88A 3U75A 2MEV2 2AREA 4QQHA 1DZQA 2DVDA 2GMPA 4K40A 5LBEA 3WG2A 4Y20A 3DXTA 3AJYA 4RA0A 1HB4A 2CSGA 2B4KA 2W08A 4KBZA 3FUQA 4QX1A 2ZMNA 3TNPB 5ACA3 1C8M1 2XJVA 3CIHA 5DDJ1 4F8AA 5T3NA 4FTSA 3ZN6B 4JAAA 1PMJX 1UKRA 1YQ6A 1ASJ2 4MGSA 3G6JB 1WKYA 2Q30A 2Y38A 5B4XA 1K5JA 3T2TA 4DZGA 3WVJA 3WNNA 5EPAA 4OMDA 2HWE2 5FMOS 3VDDB 2BERA 1R092 4N90A 4PLNA 4XHXA 2VMCA 2VZQA 4XQDA 2VTXJ 1REDA 4MGZE 2PYTA 2WZPP 5GZCA 3VZKA 4A45A 3GYDA 1U5YA 3PJQA 4YZ1A 1AYM3 1XE0A 1W2NA 1UU6A 3D82A 4L8QA 3W58A 2R0HA 2B46X 4GJYA 3B02A 4S2FA 4Y20B 1RUOA 2K2SA 3MGUA 5JSPA 1JZ3A 3CO2A 1HKDA 1AUYA 2ZGLA 3AL6A 3ZLIA 4CP0A 3RZLA 1MACA 2DVFA 4HMZA 2IXKA 2QNKA 1RB8G 1H6XA 3UJQA 1GV9A 2VUDA 3MDPA 1FATA 1NG0A 5IVYA 4IE6A 1A3KA 2HEVF 2R042 3QCWA 1R1ZA 5DAPA 1H4HA 1ZZ9A 4RR3C 4CXWA 2HYKA 4UFKA 1E57A 2RJLA 5A80A 4KNCA 3R4UA 1H1IA 3ASIA 1C5HA 2GAUA 2NLRA 4IV3A 5KXDA 3RI9A 2CHHA 4W6WA 4EV0A 2RR11 2Q1ZB 1MS4A 2WSUA 5A3PA 5JMOA 3VUOA 5KXCA 2XVGA 5FMBA 2QDRA 1GNHA 5F6KA 4IDZA 1K3IA 1CR7A 1QGLA 1QNWA 3B5LB 1T6BX 1DYKA 1T2XA 2GSYA 2TEPA 4P9YA 2Z5WA 4B1LA 2DURA 2PHRA 1XJAA 5GZGA 2D6NA 3NNLA 1RUI1 1AYN3 1RUG3 1CAVA 3HQRA 3SCFA 1ZRCA 3GCWA 2VMIA 3I2OA 3U14A 1I5ZA 1MS9A 3D4KA 3OGSA 3VB9A 4CUBA 3ZSMA 5LATA 2DU0A 3ON7A 4IV3B 1O4YA 1IG0A 1NCRA 2NM1A 1LOFA 2JDZA 1JYCA 2JG8C 2Y64A 4LA2A 4MGQA 4CEYA 2R072 2ZCWA 5I0TA 4NHLA 5C8CA 3O1UA 1W3XA 4BIFA 3MBWA 1IQAA 5E89A 2Q8CA 1GBGA 1UMHA 5FTTC 2FCTA 3DYPA 1UIKA 4GJZA 3KF3A 1EV12 2VM9A 3GJBA 4CPBA 4QB2A 4Y4YA 1YLLA 4KU7A 5CYYA 2DUOA 3ACHA 4P9IA 3TRSB 3HT2A 3CZJA 1F8VA 3HAGA 1SDDB 2V5YA 2W1QA 5A6XA 5GZFA 3U07A 5A33A 2NMNA 1WW7A 1US3A 1S0BA 4AFMA 2YGMA 1GP5A 1NCRB 4BM8A 1QXRA 1BLZA 3JQXA 5C5UA 1KRIA 1SFPA 4AVAA 4TTGA 2DCJA 1VP6A 4CEYB 3NQHA 3LOIA 1CIYA 1QU0A 4CU8A 2JDAA 5C3QA 5C8CB 2JECA 5FZ8A 5JDBA 4M4RA 1RUC2 4AGVA 2VD7A 3F2ZA 1GWMA 4XAEA 3T0BA 2VNOA 1O7FA 1RVF2 3U4XA 1FMD3 3AJZA 2J1TA 3ZPYA 3U78A 1WW6A 5FZ3A 5IVJA 2JKBA 4Q1PA 4NHKA 5FYYA 3ZDVA 1J3PA 1RMU1 1RC6A 1OH4A 2WZR2 3AZVA 3DEMA 4CP9A 5A33B 4CCLA 3MUY1 1W9SA 2UY9A 1XYNA 2OQ6A 3A0KA 4AEKA 1POQA 1AJOA 3P5BA 5FBZA 2YZ4A 2DCKA 4Q4W1 1ALYA 1GKBA 2HWB2 3USUA 2CYFA 2QQLA 2WT2A 3AZZA 3MIEA 4QMAA 3VL8A 2WLPA 3ZYJB 1KJRA 3POBA 1GWKA 1VRH3 3RMXA 4DY5A 4BYYA 1ASJ3 2ZKNA 3UGHA 5EIYB 3AKRA 1JOPA 1STMA 3VBFA 5ACA1 4PF5A 1G8WA 1V6IA 2VOXA 2J1RA 2XONA 3L9JT 4CP9B 4XFIA 2RV9A 5FYSA 4DXZA 5A3TA 5IFTA 4OZXA 4C0HA 4OVEA 5HI0A 1X8EA 2E9QA 4AI3A 5CZKA 1POV0 3I97A 1IPSA 3O12A 1DYPA 3OB8A 4FPLA 1W0OA 1W8NA 3PMSA 3RGBA 4X6RB 5FLIA 4LT5A 3H8OA 2Q4SA 3UNPA 5FYTA 1FPN2 3USUB 3BOPA 3W59A 4YYOA 1V6JA 3M8LA 1AYM1 3I8TA 4COUA 5CVRA 5K8SA 3R05A 1PIV3 3RQ0A 1CESA 3BGAA 2WNVA 3NNMA 2VOKA 3E5UA 4XF3A 4ZPIA 4A7KA 3AKPA 1I3HA 4XMIA 3VBFB 1XOYA 5LBBA 3ZYPA 1FV3A 1OLME 2IVJA 2IZWA 2KXLA 2SLIA 1CZTA 4FI9A 3GF6A 2WN2A 3OGGA 2I74A 2XUMA 3IDCB 3WCSA 2ILMA 2ORZA 2IXCA 1RUD3 4BLIA 1DGRN 4I0WB 3TNQA 3TEYA 2FDKA 3DXUA 3LIHA 1W05A 4AVTA 4Q8KA 4LIUA 2J1VA 2UWBA 3T2PA 1KFUL 1X36A 1QQP2 5FRAA 3KT7A 1H2LA 1H8TA 4RGAA 1NZIA 2F4PA 4AAXA 4JVAA 5AC91 3SITA 1PMHX 3RZHA 4ZU7A 2CGNA 2UWCA 2WNVB 3C8XA 4MGYE 5DAQA 1V9U3 4CCKA 4MVTA 1GNYA 3B9CA 2WDBA 5C9AC 4OLLA 4A42A 2WFF2 4QPIB 4XF9A 2GC1A 2H6BA 3THPA 1GZWA 4RSUA 1Q8OA 1C1FA 1UL9A 3S5AA 3KCXA 3A7QA 5BY5A 4IE4A 3ALQA 2QFEA 1IQDC 1WLCA 2G4IA 5FZ0A 1KGYA 1OH3A 2D3PA 3LE0A 1RUG1 4L99A 5I8SA 2WWUA 5EWSA 4PBPA 1QJU1 3VN4A 1UAIA 4Z07A 4JX0A 1NXD1 2CNAA 2DDUA 3ZFEA 2C26A 2QUOA 1H8TB 3PUSA 4IL7A 3AK0A 1J59A 4AFCA 4IEPA 3TEWA 3AZXA 3H9AA 4OUMA 1JYXA 2YDEA 1AL21 4YFZA 4MLOA 4XQWA 5BNQA 1XYPA 1P8JA 4GMP0 3LA7A 2YROA 1KDKA 3VDAA 5CEHA 5E8AA 4K8FA 3AFGA 1HN0A 1GZWB 1JW6A 5EYYA 5FFOC 1A78A 4XJZA 4AFAA 3BN6A 3ZXKA 1JYNA 1VB2A 4AQTA 4LK7A 3C3VA 1ULOA 1TE1B 4XVHA 3UV9A 2OKXA 2IFWA 4AHYA 1JYIA 4UF0A 3ZYGA 3ZFEB 1D4VB 2ZABA 4XPVA 3D0JA 5DZGA 4LBQD 3IT8A 1KJLA 4QKBA 5DXDA 1S0JA 1BJQA 2A7AA 2EIBA 4FPFA 4D94A 5CB7A 1W03A 4XIOA 4XQ4A 1KQRA 1QHDA 1RVF3 1JZ5A 1PX4A 2GH2A 4CXXA 1DQ2A 3PURA 5JVVA 2WWSA 1EAH2 4ARXA 4BIOA 4M3CA 5FZ6A 1O59A 4L92A 5G04L 2W1SA 1Q8SA 1AX0A 4ZXKA 5KHIA 2VECA 4OZOA 1DYOA 1FMD1 2Q1MA 1RUF2 1DZRA 1LHUA 1ZYBA 4XEZA 2GNDA 3PTYA 5JXJA 1PGSA 1VBC2 4XDOA 1D2SA 4OYUA 3NNGA 4UF0B 1PVC3 1S2KA 1TMF1 1RHI3 5LK7B 3O0VA 3QH6A 1GSLA 4JGYC 2HLEA 5FWEA 4LO7A 4MV2A 4AHZA 1NLQA 4FPJA 4CCOA 5A7QA 3U0ZA 1OFSA 3B01A 1UX7A 1WCQA 2A3XA 3C7HA 5DUWA 3TBDA 3TAYA 4M3CB 1SACA 1VR3A 4GWMA 1VRH1 1CX1A 1GOGA 4C1XA 3H42B 4QDRA 3ETPA 3MW3A 3ZR6A 1W9TA 1UYZA 1G86A 5FZ1A 1C8M2 5A1LA 3HT1A 5DDJ2 4UOJA 1W8ZA 2X5IC 2UYBA 3GZTB 2JEMA 1OLRA 2V4VA 1W3VA 2Z42A 4P5HA 1FPN3 2E51A 3M7AA 5FZ9A 2WO1A 2RDRA 1V6LA 1K12A 1C1LA 1ULFA 5BNPA 1UXZA 2ZA9A 4N43C 1VBE3 2YY1A 5FO7B 2JG9C 4GALA 4XDQA 5F6LB 3T08A 2F17A 3VBSA 4K1YA 3BKZA 2OT7A 3I2JA 2AZ5A 4Q4X2 4MGIE 3NJZA 5LA2A 4QQLA 4QKNA 3AM2A 1QIQA 4J25A 1K45A 5HV0A 1RGSA 4WZCA 4JDNA 5SV8A 1RYYA 4ZS3A 4D69A 3B00A 3MPPG 2YHJA 3FL7A 3KMHA 3OOXA 2ES3A 5F2SA 2HEYF 3I2KA 4HG6B 3ELNA 5FPAA 3C7FA 3CEWA 2ARCA 2WKKA 4IEXA 5BNPB 2XOMA 2JIJA 2VXRA 5T5PA 3ZKUA 2Y60A 5FY7A 1KS5A 4XFAA 1PNFA 3QBQA 2IXIA 3VBSB 5KHJA 2X29A 2B9VA 1UY1A 1YRZA 2J1SA 4IXLA 1N47A 3WF4A 1DGWX 1BMV1 3CZUA 1YYNA 4YARA 2LROA 2RR12 2E7AA 2I07B 2A73B 4CDWC 4BXSV 2VU9A 2WINB 5FBJA 3MZHA 1V9U1 1VRBA 2BW8A 2LS6A 2ZXQA 1ENXA 3CQOA 4NPLA 1G9CA 3BTXA 1ZA7A 2YC2A 5FP3A 4L2NA 4Y5Z0 2RS12 1URXA 4OHZA 1MQTC 1OOPA 1QJZA 1X7NA 1I9RA 3CBNA 2JDNA 1RUI2 2J22A 2JDYA 4PBOA 2R1DA 4R9CA 1SFNA 2QJVA 4PI2A 3U37A 5C3RA 1FV2A 3UK9A 4AI8A 1LOEA 2D98A 3RJRA 4NHMA 4ES9A 1DLCA 3M3IA 4BQ3A 3BALA 4KL1A 3T1LA 5C4WA 2D6KA 1TZOA 1VB4A 2JDUA 3T0AA 5B2GB 1LTEA 5CFDC 1PO13 1G9DA 4P9XA 4YSFA 1NCQC 4LMFA 3AP4A 2WIIB 4UWDA 3HEIA 2VPVA 5A6YA 2YGLA 1G7YA 4TN7A 3INAA 1AX2A 1BBT3 4KBBA 2DCTA 3VZOA 1SQ4A 1ND3A 1W8TA 1OOPB 2XLGA 2RDNA 3IB3A 3RZMA 1O8PA 2CWSA 4NHYA 3BPSA 1AR83 1LOCA 2VCBA 1J1LA 2GU9A 3H3ZA 3HOBA 3KVAA 2O14A 1W28A 3K4ZA 5C4WB 1QJY1 3JD72 4ZHNA 4LOSA 3WQ7A 2QQUA 3OUHA 2D6OX 4MOAA 3AP6A 2ET7A 1I6XA 5HBAA 5F3IA 3I49A 3TOJA 1IS4A 4IE0A 4U36A 5F5AA 5CFCC 3PIJA 4UBHA 4UW3A 5FZAA 4XBQA 5A7NA 3M3EA 2OUHA 3KCYA 4HSJA 4UBGA 2ZX3A 4FPGA 1SLAA 1G9BA 1UMZA 1LNSA 1ND3B 1N1VA 2ARAA 3C7EA 3L2HA 4A2UA 2GP3A 1NA1C 4GWJA 1GFF2 3C2UA 3LZZA 4GB33 3LDKA 3LDRA 3V65A 1RMU2 2DCYA 2KM2A 2AH2A 1SBEA 2PFWA 5GLTA 3HQXA 1N3PA 1PVC1 1S0DA 1Q56A 4MGTA 3KHBA 1RHI1 1GQHA 2GNTA 1CONA 3O7OA 2E7TA 3HNMA 4M0NA 4QXKA 3RZZA 4CDQA 1OA4A 1DGLA 5FK8A 4Q4W2 2R49A 3WW4A 3E5XA 4NIGA 1QWRA 3IMNA 2HBTA 4AF9A 5A6QA 4ATFA 3SLIA 4LE4A 1VJ2A 3AKQA 3I3DA 4KH9A 2PHUA 1JUHA 2E32A 5FR3A 3AXDA 3Q8CA 3CU7A 1CAUB 2A70A 4MXWA 1E5SA 5ACA2 4AEDC 1ULPA 5KXEA 2RMU3 5FY4A 3ORJA 3ZXFA 1LEDA 2FCVA 1RUE3 1HB1A 1QJX3 1SLTA 2Y6HA 1NOVA 2NN8A 2VW1A 3VHNA 4CDUC 1OQDA 3LEKA 1DQ4A 3CNAA 1NYWA 1SEFA 4CDQB 4BQYA 5T50A 3LEMA 2RVAA 2Z69A 5K4LA 1VBD1 2AUYA 1LGBA 1FOD3 3OF1A 4CCMA 5IK8A 3DF0A 2IXLA 3E6BA 1AYM2 3KV5A 4AHXA 5J1XA 4XCAA 3WNPA 1JU3A 3ZPOA 2R063 3LSDA 4COWA 4LHSA 2AEZA 3MEPA 1JOJA 4LJHA 2O1QA 2QZ3A 3CL1A 1W8FA 2Y6FA 1MS5A 4JHTA 4MXWB 1JHNA 2KA3A 4M01A 3N35A 2BYVE 4I01A 1PK6A 3T2OA 4Q0PA 2ZGTA 4RQPA 4YVSC 1CVNA 2WA3A 2CTVA 4E2GA 2H0VA 4YZ5A 2Q8EA 2VCMA 1C57A 2RR13 2VQUA 2JDKA 4XZPA 1G9AA 2P37A 3DV8A 1UY3A 4W50A 2D3SA 1R64A 3BCWA 4EN9B 3H8UA 1ULEA 3QD6A 1QMJA 2QQMA 5AC92 3PVOA 1B35A 5FMDA 2XJTA 3H7JA 3K48A 4NR1A 3ME2A 4EN6B 5KR7A 2W46A 2BJSA 3TWIA 1JI6A 1RUI3 2VCAA 2XKOA 2O8QA 2IFRA 1TG7A 1PK6B 2WC2A 3UKVA 5TSWA 3RJ2X 4GWIA 2B8MA 3N7MA 3DL3A 4FOYA 3C7GA 1NA1A 4LO8A 2VZVA 1FI2A 4RQPB 4WM7A 2XXZA 4AG4A 4NRMA 4YFWA 4DNYA 3S6PA 5DABA 3HVDA 1WLWA 1RUG2 1UU5A 4A3XA 3ST7A 4XFFA 2WBKA 1BK0A 4NWVA 2J1AA 1QJU2 4PIZA 3I4IA 3VL9A 4E2SA 3MF6A 5FMOL 4OI2A 5FOJB 1DIWA 1S1AA 4N9IA 4QPYA 4RGKA 4F3JA 2Y8KA 1B35B 2VZTA 2VY0A 3D0SA 5LBFA 3VKFC 1PO11 1AL22 1FNZA 2GH8A 5GLZA 2QQPA 3WG1A 4XFGA 1HB3A 2JICA 2B45X 3OUIA 5FXZA 4FPCA 3VBHC 4D3WA 2VZPA 2G1MA 4WM7B 3UJOA 1NA1B 3UL2A 2C5DA 2LTNA 3UKTA 4BQXA 4NN0A 4UW5A 4COVA 1I5PA 4LK6A 4EROA 3CF6E 5L36A 1S0IA 4AQSA 1AR81 3CJIA 4LULA 4PQQA 4QPGA 1WLDA 4OHWA 2JB4A 2X10A 3FN9A 4IE7A 1JZ8A 1H6YA 4PCRA
chains in the Genus database with same CATH topology
5IK5A 4I2OA 3KT1A 4P9JA 2XJRA 4FAGA 3POWA 1U5XA 1W6OA 4FP2A 1RMU3 2O8OA 5DUVA 3OJBA 2WLQA 1UF2C 1ENRA 3GBFA 2Z79A 2NZ9A 1FMD2 3KGLA 1LR5A 5K0UC 4AEMA 3RYPA 3TN93 4GB31 2A6ZA 3CJIB 4XF4A 4QPGB 3VLBB 4Q4W3 5JMCA 3J8F1 2Y0OA 1TMF2 4LNVA 5A3LA 1OMIA 1DU3D 3PLQA 3GNEA 3SH3A 1DGWA 4IEZA 1H8VA 1ZRFA 1UW8A 1UU4A 3MIGA 2VW2A 3DUIA 2XJSA 1W6OB 1VLNA 4RS5A 2XJQA 1J3QA 1VRH2 2E6VA 1C3HA 4QX5A 2ZMLA 3AKSA 4QGMA 4O9EA 3VKLA 1IKQA 5BNOB 2RMU1 4IERA 4YM3A 4CDXA 3TB0A 3B9IA 3RI8A 2XH6A 1RUE1 1QJX1 3WW1A 5AFBA 1RUH3 1F5FA 4H14A 3HN1A 2BVBA 1ZREA 3W9AA 1OA3A 1MVEA 1BVVA 4P9WA 2XLAA 2BBVA 4YRDA 1W6MA 1MS8A 4ITCA 4AYUA 1FOD1 4RS5B 2ZBJA 3FFZA 3LA3A 4CRQA 1PIV2 4WM8A 2R061 5JZGC 3P3NA 2QCSB 2RS53 4HN0A 2BUKA 2EALA 3FX3A 3OBTA 1DQ6A 3ZSEA 1U5ZA 4CDXB 3IWZA 5DZFA 3KM5A 1RUD2 2V73A 4YM0A 5L7OA 1ZA4A 5AC93 3VGIA 4D7TA 3NWKA 4R9AA 1HQWA 4BZ4A 1W6MB 3URFA 2D3RA 1H30A 4URTA 5ABJA 4MGKE 1BMV2 3RS6A 3DN7A 3BIWE 2XL7A 2Q5TA 1DQ0A 1TNFA 2D40A 3B94A 1YCIA 2UURA 1F31A 5D8AC 4FOQA 4WM8B 1QDOA 4Q4V1 1V9U2 2DFCA 1YI7A 1CN1A 4AE2A 1QJU3 2PN5A 3ILFA 1H4GA 2RS33 1W0PA 3WHTA 5L7OB 5GM0A 1FAYA 2IC1A 5EJ3A 1V00A 1YHFA 2VULA 1AL23 5ABJB 3VBRA 3POYA 2ATFA 3VZMA 4I30A 4XILA 5KHHA 2FBEA 4JTNA 2ZGQA 3NW4A 4XF1A 2EA7A 4M3CF 2PLV3 2Y0IA 3WINE 3H50A 1ULDA 4AI0A 1LHNA 1CAVB 3AX4A 4GMP1 4XHBA 2ZHMA 4FSJA 1NLSA 1O3TA 5E16A 4LO5B 2IWGB 4NPRA 3A0NA 2JE7A 1NE4A 3I2DA 1CPMA 2YV8A 3VBRB 1O5LA 1AF9A 3KGZA 1ZBA3 5JI9A 1Z7S3 1HDKA 5JPMB 4Q27A 3FZ3A 1O91A 5FPZA 4HBNA 4S2DA 1TMF3 4FT8A 2ZGNA 3KQRA 4N53C 5HCAA 4RR3A 5GZEA 1LGNA 3TN91 1O4ZA 3ILNA 1EYBA 4Q29A 1QXJA 1PVC2 4FCAA 1RHI2 4Y1ZA 2A6WA 4ASLA 1H0BA 4CP1A 4HVOA 3I54A 3M3CA 4FO9A 1CD3G 1AHSA 4BOWA 4B7KA 5LRRA 3AP5A 5K9YA 3WDXA 2BTVC 1H1AA 2ZJCA 3IIAA 4CZSA 1JXNA 4R4ZA 4EWAA 4Q2FA 4RR3B 3AMPA 4IV1C 1K5MC 2VOVA 1LB2A 2WJSA 3VKMA 5J37A 1J58A 1RUH1 2JG8A 2DVBA 1SLBA 1VBE2 4QQ2A 4QQPA 5JOZA 2N7GA 4UW6A 3THTA 1VBD2 3FHIB 3PMEA 2DV9A 5AVPA 2P3JA 4FAHA 5JOWA 1ULCA 3RMYA 2ZZQA 3X29B 5JSOA 3GALA 3GHNA 5JIUA 4LLOA 4O9GA 2RS51 5FREA 3SXWA 5LEJA 3ZFFC 1LU1A 5KC5A 3ROUA 1GICA 4PLOA 1XE8A 5GKAC 1FXZA 3WXPA 3R4DB 3RPQA 1V6KA 2JG8B 2LALA 2PHTA 2OW4A 4WVVA 1V6NA 3POSA 2WQZC 4YM1A 4HZFA 1NZCA 1XE7A 2WNEA 1KFXL 5C33A 2UWAA 4FPYA 5JPNB 5FO9B 3H7YA 4AGRA 2JX9A 2XGXA 4E2QA 2D44A 1R081 5H9QA 2DTYA 1WMEA 3NAPC 1YFXA 3RYRA 1F2NA 2MNGA 1XNCA 2RS31 1HIXA 2QZ2A 4J6GA 4KQ7A 2HWD3 2OZJA 2VH9A 1AXKA 2PA7A 1YXWA 4DS0A 4CTEA 4HLTA 2DF7A 4LO6B 1A8DA 2VMGA 1LGCA 5L19A 1YI9A 3EJKA 5HCFA 3D5OA 4C1WA 3H0OA 1PO12 2A3WA 1PGL1 4XJUA 3WDVA 3RG0A 2PLV1 4GULA 2DVGA 2ZS6B 3FC0A 1SFYA 3BB6A 1BK1A 1BBT2 1OKQA 1BZWA 4CEWC 3ZIXA 4PLMA 1QJY3 5CG8A 4AEJA 5I8YA 2D5FA 2VQ0A 3MIHA 1V70A 4WZFA 1JBCA 1U12A 1XYOA 4I0AA 1AR82 3VBUC 4Q0SA 3AYAA 4F83A 4I02A 4LBOA 4M00A 3NV3A 4L97A 1GNZA 1ZBA1 1HRV3 1G6NA 5CU1A 3JBG3 1Z7S1 4YZ4A 1OQEA 4ISQA 1Y3TA 4PIXA 3WHUA 1DF0A 4YVWC 1C5IA 4K20A 3USSA 4YNIA 2WSVA 5T52A 4GB32 3D8CA 3FJSA 1MVQA 3MFCA 4G4FA 4YW3A 4Q0VA 4ASMB 3K51A 1OA2A 4COYA 3ZSJA 4Q0QA 2TNFA 2R30A 4PQ9A 4QM8A 5C9AA 5A32A 5J48A 5JIAA 1Y9QA 1VAMA 3GBGA 1IS5A 1FT9A 4AW7A 1DFQA 2UU8A 2XJUA 2ZTNA 5IK4A 2BWAA 4NOTA 4J1XA 1AZDA 4JCKA 4I3GA 1A8MA 4HKLA 4N7IA 5JWPA 3OD0A 2RMU2 3NVCA 4FXGB 2QDNA 4JQRA 5JSRA 1WUVA 1LOAA 4I3PA 1RUE2 1QJX2 1VBD3 3U11A 1COV1 1YNAA 1O3SA 3DPRC 4HANA 4AGGA 1IS6A 2XWJB 4H7LA 5C9AB 5A32B 4MH0E 1DQ5A 1U0AA 2BEOA 2D93A 3H3UA 2DTWA 1EPWA 1FOD2 1R091 2OYZA 3WDYA 1HRI3 2ZX2A 1W6PA 4Q0UA 3DGTA 4MZUA 2R062 2PHXA 2WA4A 5FLHA 3ZXJA 1SCSA 2ERFA 3S0MA 3VBOC 4HT1T 2GNBA 1LODA 4B3NA 2VNRA 1F9KA 3H1MA 5JI7A 4GH4C 5T55A 3WX5A 4OHXA 4FP3A 5EV7A 1PO23 3SH5A 4TSVA 1A6CA 1QF3A 2Z2SB 2VGDA 2GN7A 2A6VA 4AXOA 5A3MA 3RDIA 4JGZC 3FFQA 4I09A 4MSVA 4XF0A 1H1MA 4XE9A 2TBVA 5EXOA 3O14A 2EXHA 3IM0A 1W6PB 3ZFGC 1VAVA 4NO4A 3ZXLA 1ZZBA 2ZX4A 3FE5A 1UZZA 4Q4V2 2ZX1A 4Z82A 3LOBA 1ND2C 3V56A 4IEVA 4ZU5A 4KGGA 4B4PA 4KG8A 1V6OA 4YGDA 3VHOA 1DHKB 4JRAA 1H2MA 3WG3A 1VALA 4JGYA 2A3YA 4IEOA 2NMOA 4PDWC 3S7EA 2B7YA 2RE9A 2HWD1 1XU1A 4TWTA 5GALA 2DU1A 1WLTA 4E4ZA 2XVLA 1KS4A 1HQNA 4EN0A 1BXHA 4E9KA 1UKGA 1J3RA 2BQPA 1AXZA 5F5QA 3TYJA 2X5IA 3O0XA 2B5HA 5BXXA 3LGRA 2AR6A 3I59A 3QACA 1MS1A 4XJ9A 4JGYB 1QNYA 4GQ7A 4N43A 4LBKA 1EV11 1OPMA 1CAXA 2JG9A 1O3RA 1AR91 3NKGA 2WFPA 3SISA 4PIYA 3QLQA 4C90A 4KWKA 3H1WA 2MHFA 2W0XA 1HRV1 3MF9A 3JBG1 2E63A 2X5IB 3ZYRA 5BPXA 1VBA3 3M4FA 5KBFA 3I59B 1RUNA 3J8F3 1BVP1 4LR4A 3WDWA 2WS93 1SLIA 3DKWA 4N43B 2A5ZA 3RSJA 1CAXB 2JG9B 1ZBE3 3TN92 1ULGA 5BV6A 1X50A 3KS7A 5KXBA 2CL2A 4CDWA 1QKQA 2JD4A 4FOWA 3AMHA 1SLLA 4DQAA 2VNGA 3BTAA 2WNUC 3IDEA 5J36A 1LKNA 4OHYA 3FBYA 1ONAA 1ZVFA 5J09A 1C28A 4KGQA 3WQ1A 4W65A 3MLKA 1MQTA 1MZFA 3FUOA 3WQ0A 3WD5A 1KITA 4QD2A 4L9BA 1PNGA 3N3HA 2NYYA 4FPHA 2B39A 3N7KA 2UY8A 4LE3A 3SCHA 3G7DA 4AQ6A 1ENSA 1RUH2 1YIFA 4CDWB 5CBLA 5CFDA 1JN2P 1S0EA 1UPSA 1NCQA 2D97A 1LU2A 4RFT0 2GC0A 1SLCA 3CLPA 3IBMA 4CYDA 3IPVA 1M4WA 1XNDA 3HMYA 4Q4Y3 4WVWA 4W6XA 1W6QA 3MYXA 1IHMA 1HRI1 4TZDA 1MQTB 4HKOA 5GLVA 5BNNC 1DG6A 1HXS1 1UCXA 2RS52 3EQEA 4J1WA 2OUJA 3FWEA 4WV8A 4XIKA 3ZSLA 4P9LA 1SMVA 4OULA 3OGJA 1ZRRA 1BQPA 4RL7A 2PELA 1PO21 3O5SA 1QY4A 3AFKA 4G9SB 5CFDB 4XETA 2PHFA 1NCQB 4JV4A 1REFA 1PM7A 4Q4V3 1YFUA 3NV1A 3IPVB 4YGBA 5CFCA 4AHWA 5T5LA 1W6QB 3VDDC 1QQP1 1ENQA 4M3CE 4X8PA 4KWJA 3EO6A 4C0BA 2CV6A 3VHRA 1LHOA 1LHWA 3APBA 4DINB 4DRVA 4QQOA 4HVRA 1UN1A 1RL3A 4FTBA 2RS32 1FYUA 2WT0A 3WUCA 4OUSA 2EIGA 4V1PA 1BEV3 4XXAA 2X8KA 4GKYA 4BWOA 3RRDA 4XFHA 3PJYA 5CFCB 1NXMA 3AMMA 4EWDA 4AFDA 1GQGA 4GMP3 3MLJA 3ZN4A 1PGL2 3FLRA 1MZEA 2PLV2 2H6CA 1NE6A 5K7PA 3WP4A 2ZHKA 3WUDA 4AEDA 5CG9A 1DGRA 1EPZA 3E5QA 1HV1A 2QKDA 1PGW1 4CDUA 4BMEA 5LEKA 4Y26A 5EFUA 1Q3EA 2H0BA 4DB5A 4BA6A 3KLSA 5JOYA 2HWF3 1LOBA 2YMZA 2DCZA 3FLTA 1MZ6A 1G9FA 2CGPA 1GR3A 1GYKA 4BMBA 2GC2A 1QH6A 1PZ8A 4F7ZA 2E53A 1CGPA 1XQNA 2ARBA 1ZBA2 5FQ0A 1EP0A 1IGOA 4ES8A 1AR73 4AEDB 5I91A 4IV3C 1Z7S2 4FPKA 4YVSA 2DYCA 3NKTA 4DFSA 1VBA1 4CDUB 2D6PA 2V09A 1YO8A 4Y1VA 1OFNA 1FNYA 2WS91 3B7MA 3PHMA 2GNMA 5FO8B 1ZBE1 4XXPA 5I93A 5AFEA 4JDMA 5LK5A 2D43A 2R6QA 1MEC3 2ZZJA 1VBC1 2CAVA 1S0GA 4IEQA 4KU8A 3RNSA 5FQ0B 3NSTA 2HEWF 3OD4A 1TEIA 2F6BA 1NCRC 4RHV3 4YVSB 1LOFC 3ZIWA 1S2BA 2CGOA 2GDFA 1Z78A 3I7DA 4META 4CEYC 1APNA 3BOWA 5C8CC 1MR5A 1Y43B 1TME1 4FQ4A 2XKPA 1POV1 4K21A 2GMEA 1COV2 1IPJA 3O0WA 5KHGA 3WR0A 1UX6A 3ZMOA 3LSEA 3S30A 3VBHA 4Q4Y1 1I1EA 3CJXA 4B4QA 1OHFA 4PJYA 2W39A 4FPOB 3MIFA 3JQWA 2PAMA 3OY8A 3GHMA 4BQ1A 5AVAA 4Q4X1 3HIFA 2X53S 3MFAA 4AWDA 4HKWA 1IZ3A 1NQDA 4XFCA 3SH4A 4Z92B 4YZ2A 5H9SA 1OI6A 5FCCA 1N3OA 2EXIA 2A71A 3BODA 2EAKA 4COZA 4EN7B 5F1RA 1RTVA 3R6SA 2VVEA 2GMMA 1R083 2ZAAA 4JC1A 4K3UA 5KC6A 3VBHB 1DDLA 2C9AA 1OSGA 4XMAA 4AVCA 4LHKA 5CAZA 2AENA 4GKXA 2OIIA 3OY8B 1WW5A 5K0UA 1WW4A 1H2NA 3GZAA 3KSCA 3U4XA 2VVDA 1NY71 3JB4C 4GA9A 1IPKA 4R4XA 2XVKA 2VVFA 3FMGA 3VBFC 5I8TA 2BNNA 3KB5A 3EBRA 2AYHA 1BEV1 2RS11 3MLLA 2O0OA 2HWD2 1WCDJ 1AR61 3ZX7A 4AI2A 1QOSA 1XRUA 1Y7BA 4Q1RA 5K0UB 4QT6A 3AP7A 2EXKA 1CX4A 1X8MA 1NQJA 1Q5OA 2QE3A 4XOGA 4E4DX 4U2AA 5FDBA 4AI1A 2FMDA 3OCPA 5DUUA 4LHNA 1QH7A 2RM23 2WNVC 4XTPA 4XJWA 3SHRA 1KXGA 3VZJA 3HR9A 1QJY2 3JZVA 4QPIC 3AZWA 2ZOEB 4DPNA 4WVMA 2HWF1 1AR92 2Q0AA 2UYAA 1ZZ7A 3ZSKA 1PVXA 2HWC3 4GWNA 5CA6A 3AZYA 5JZGA 3NL1A 4BH9A 3ZMNA 1IKPA 3JD71 1HRV2 3ZXDA 4AVVA 3NV2A 1H8TC 4MXVA 1AR71 1GZCA 3JBG2 4SBVA 2R1BA 2XHKA 3VV1A 2VW0A 3OYWA 5HXVA 2ZGPA 1RUJ3 2OPKA 3H1YA 2DUQA 4YZ3A 1D4M3 1VBB3 3PVBB 1R1A3 4HETA 2CWMA 4Z2WA 4OFGA 2RJKA 4WVMB 3SCGA 2JJ6A 1DLLA 4H3WA 3KD4A 4YG6A 5D1IA 2XBO1 4E27A 4E4SA 1MEC1 1LESA 3VKOA 2G9FA 4A7YA 5D8AA 4UXAA 5HCBA 2EAAA 5JZGB 4FTEA 1CJPA 3ZFEC 2MEV3 2B9UA 4FXKB 1WGPA 1DZTA 1MS3A 5T5OA 1DBNA 3N7JA 4RHV1 4BPZA 3RYKA 3V0BA 1SDWA 3OYWB 3WP6A 1QDCA 3P3PA 4YLZA 1XNKA 4IEYA 4YGEA 1BCXA 2ZGUA 4CP2A 1COV3 4MYEA 4LLFA 5CNAA 4ATEA 1L3JA 1ZZ6A 3AMNA 2XLFA 4K7JA 5C8WA 2HWE3 3HD8B 3PNAA 1ZX5A 1Q8QA 1R093 3NV4A 3E97A 5D8AB 4EJRA 3WCRA 4LO4B 3S7IA 1UIJA 3V64A 4Z8BA 4Q26A 2OZ6A 4RGGA 1AJKA 1HRI2 1WMDA 4R52A 5C6CA 3V0BB 5J98B 1CAWA 2EVXA 1HXS2 4IEUA 4ZKTB 4NVPA 1RIRA 2YXSA 2VOWA 3HBZA 1GZ9A 1OQ1A 3ZXGA 1NLRA 4BE3A 2E7QA 1W6NA 2PHDA 4QPIA 1PO22 2R043 4B29A 1AX1A 4B8EA 1X33A 4LBLA 4LUKA 3WY6A 2EXJA 3ETQA 3D6EA 1CAWB 4XW3A 2BPA2 4Y1XA 3JU9A 4IEWA 2FMYA 4N53A 3SMHA 4LBMA 2VUAA 2K0GA 5CIRA 5H9PA 4YW5A 3ILRA 1BYHA 1W6NB 3HWJA 1QOTA 3JCIA 1MZ5A 4OI0A 2XL9A 2IXJA 4Y22A 3EXUA 3N36A 2D6LX 5JCTA 1AYN1 4P9GA 2I45A 2Y26A 5BNPC 2R073 2BWCA 3LCPA 5GJ6A 2LM3A 3VBSC 4BLJA 4LTAA 4N53B 1W2UA 4FPEA 1F5JA 1HW5A 4IV1A 1EV13 1K5MA 2BGCA 4K1ZA 1WD4A 4LBJA 3AKTA 3AP9A 1AR93 2RM21 1ZNPA 1PGW2 1B09A 2ZMKA 1IS3A 1ZZ8A 4XBLA 4AQ2A 2YPJA 4R9BA 4RD7A 2IXHA 2VUJA 4Y22B 5JLVA 1VIWB 5EYXA 1XU2A 2YUEA 1YWKA 4NWWA 3ATGA 4XTMA 2JENA 2HWC1 2ARXA 3IN9A 1O5UA 4S2HA 1WBLA 2CAUA 2ZPXA 2BVVA 1RUC3 5JOXA 3VKNA 1S0CA 1JUIA 1N1SA 1K5MB 4IV1B 3ZFFA 1FX5A 4HK8A 3EHKA 1D0HA 1VBA2 2PQQA 2RHPA 1HV0A 3MIDA 4A7ZA 1AL0G 3GBWA 3J8F2 1RUJ1 2WS92 3PVNA 3N4MA 2WZR3 1D4M1 1SBDA 1N1TA 1R1A1 1VBB1 2G9GA 2YYOA 4LA3A 1ZBE2 5T54A 3E6DA 3WV6A 4EN8B 1HQLA 1OOPC 5J7MA 4N7UA 4INDA 1REEA 4BHPA 3ZXEA 1CIWA 2ENRA 2HWB3 2K9ZA 2HKXA 2ZACA 2OA2A 4X8NA 2MEV1 5J96B 5C4WC 5F9TA 3NAPA 3ZFFB 5DG2A 2A6XA 2JXAA 1U5IA 2ZHLA 3LKJA 3T1MA 3VZLA 2TUNA 1TME2 1ASJ1 4P14A 5I0RA 3M2MA 1H9WA 1RINA 1YUDA 1ND3C 3M70A 2HWE1 4AVSA 1ZZCA 1XNBA 4XBNA 5J3UA 4K6BA 3SNMA 2LUWA 1HXS3 1AXYA 2B42B 4XFBA 3OTFA 3NAPB 4Q4Y2 3BPZA 1YJKA 2PHWA 1QOOA 1JH5A 4CEWA 3B69A 2C1FA 2ZGMA 4TLFA 4YW4A 4YGCA 2OVUA 3WT3A 2GC3A 4C91A 1PIV1 3PVEA 3VBUA 4DY3A 4LUMA 4Y24A 2R041 3WW3A 1T6GC 1JTZX 1QQP3 1YFYA 2DFBA 5FAXA 3V0AA 1RUD1 2ET1A 3QH7A 1W39A 1TQ5A 2FHRA 4IETA 4TYSA 4N9HA 2NQYA 4CDQC 4CEWB 3RWNA 1DQ1A 1LENA 5FOBB 4YVWA 4ZU4A 4QHBA 4FVVA 2WFF3 1C4RA 3MPBA 3MIBA 4M0HA 1YIPA 1S55A 3VBUB 1LOGA 4MX3A 1NY72 4AVBA 2XPJA 4AFBA 4KWLA 4YW2A 5KWRA 1WMFA 3JB8A 1WA4A 2XWBB 1BEV2 4Q8LA 3WW2A 2MPFA 3B93A 3V0AB 3WDUA 1AR62 4HL0A 1X82A 1IOAA 1YFWA 3QOPA 3M1HA 1RJ8A 1H2KA 3GZUC 2PHLA 2R071 4SLIA 4YVWB 2ZKLA 3VHPA 1D0GA 3WP3A 1Z0HA 1ZRDA 1LULA 3FBMA 5SV5A 4ISRA 2PTMA 4Z1VA 4W6YA 2YC0A 3AB0A 4QGLA 2D6MA 4YM2A 5DZEA 3ZXAC 1OLQA 3R0RA 3DPRA 1MS0A 1PK6C 3AXEA 2FZ1A 4HK9A 2HWF2 2R32A 4D7SA 4RQPC 2P17A 2ZGSA 2ZHNA 3A4UA 2XG3A 3LWCA 4D7YA 3ZVXA 2C0ZA 4X6QB 2D7FA 2GZWA 1V6MA 1EAH3 1RUC1 3VBOA 1AR72 4R9DA 2DVAA 1B35C 1RVF1 4GH4A 4DRRA 3J4UH 1RUF3 1EY2A 1PZ7A 3ES4A 4HPKA 4XJ8A 2DUPA 1VBC3 3DPRB