3VBUC

Crystal structure of empty human enterovirus 71 particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
molecule keywords Genome Polyprotein, capsid protein VP1
total genus 38
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuC00
3ZFFC 1W39A 4NWVA 2DF7A 5DDJ3 5K0UC 4PDWB 3TN93 5GKAC 5ACA3 1QJY1 1RUJ1 1HX6A 1BEV2 4CDUA 1K5MB 1QJZA 1VBD1 2XBO3 1OOPB 1RUF2 2X5IC 1QJU2 5JZGA 2HWB2 1V9U1 1BEV1 4N53B 3DPRA 1VB4A 4FTSA 1EV11 5FMOS 1Z7S3 1ASJ3 3JBG1 5A33A 3JD73 4CDUB 2HWB3 1PGL2 4QPGC 1MEC2 2BFUS 1NCQC 5C9AB 1AR72 1AL22 1C8M1 1ZBA2 2RMU1 4CDXC 1R082 2RS52 3VBSA 4GH4A 5ABJB 4N53A 1K5MC 5C8CA 1FOD3 1M06G 4CEYB 1A6CA 1VBB2 2HWC2 1EAH2 1F8VA 1ASJ1 3TN92 4IV1C 1K5MA 1ZBE3 1ND3B 1FOD2 4SBVA 1ZBE1 1PVC3 1OHFA 1SMVA 3JBG2 1X33A 3VBHA 1VAKA 1TMF3 1NA1A 1VBC2 1BMV2 4YVSB 4GB33 1PVC2 1D4M1 1RUE2 1HXS2 1PGW2 1RUD2 4Q4X2 5ACA2 3LOBA 3IDEA 2BUKA 1E57A 2R043 3VBHB 2HWC3 3VDDC 4GMP0 1EV12 2TBVA 1R092 4CDQC 2ZZQA 1RUD1 4CDWC 5BNOC 2HWB1 1VRH3 2ZAHA 1CD3G 4CEYC 3J8F3 1RVF1 1EV13 1RUC3 5C4WC 5C8CB 1NCQB 1TME1 2GH8A 3ZFEA 5BNNC 5D8AB 1C8NA 1ND3C 2XBO2 1AR63 1VBA3 1RUF3 1C8M2 2RMU2 2RR11 1AR71 1HRV2 4Q4V1 1POV0 1RUD3 1D4M3 2XPJA 1RUC2 2ZTNA 1VBD3 1QQP3 2WZR1 2R041 5BNNA 1RUH2 3CJIA 3VBOB 2WZR3 1AUYA 2FZ1A 5K0UA 2VQ0A 3ZFGA 1BMV1 1NCRB 4JGYB 4GB31 3M8LA 4N43B 2WS93 4GMP3 2RS12 2RS31 5BNOB 1AYN2 1RVF3 5BNPC 1RHI3 3ZFGC 5CFCB 1RUG2 1CJDA 2WLPA 4NWWA 1PGW1 5LK7B 2HWF2 3VBFA 2RR13 2BPA2 3ZFGB 4WM7A 1AYM2 1RMU1 1NCQA 1F2NA 1AR73 1HRI2 2GSYA 1R083 1PVC1 4N53C 5CFDC 4BCUA 3J8F1 1PGL1 2WZR2 3JB8A 1VRH2 5BNNB 2HWD2 1PO11 5L7OC 1MQTC 2FZ2A 1FPN1 4IV3B 4JGZA 1ZBE2 1NCRA 4JGYA 2WFF2 4YVSC 1RHI1 1BBT2 1PO23 1AR62 4FTEA 1C8M3 2RMU3 1B35C 1R081 4CDXA 4AEDB 1NA1C 1TME3 1ZBA3 2HWC1 1ND2A 4WM8B 2MEV2 5L7OB 4PDWC 4IV1A 4FSJA 2HWD1 4RQPA 1VRH1 1DDLA 4CDQB 1ND2C 1IHMA 1Z7S2 1COV3 2IZWA 3DPRC 3JB4C 1OOPC 2X5IB 2QQPA 4Q4X1 3VBHC 3VDDB 5J96B 1RUG3 1D4M2 4GMP1 1HQNA 1RUF1 2WFF3 1COV2 1VBC1 4JGZC 1BBT3 4GB32 4AEDA 1NCRC 4JGYC 2MEV1 4QPIB 1VB2A 1B35A 2WS92 4Q4W1 3VDDA 2RS13 1FMD1 3VBUA 3JD72 3VBFC 4LLFA 4CDQA 4RR3A 3NAPB 2RS33 1VBB1 5BNOA 4IV1B 3CJIC 5C9AA 2HWE3 1FPN2 4GH4B 4RQPC 5ABJA 1RUC1 4CEWA 5CFDA 3ZXAC 4CDWA 3FBMA 4Q4X3 1AR82 1AR61 1WCDJ 1BBT1 4CEYA 1PO21 1NY72 4Q4V3 3ZFFA 1HRI1 3VBOC 2BFUL 5C4WA 3VBSB 2HWD3 5CFCA 1X36A 1QQP1 2R071 1PIV2 1ZBA1 1ND3A 4CDWB 1VBD2 1AR83 1OPOA 4EJRA 1PO13 3VBUB 1RUH3 5J98B 4WM7C 1RUG1 3HAGA 4Q4W3 3VBFB 1NA1B 1RB8G 1FMD3 5C4WB 4IV3C 4Y4YA 1EAH3 5AC92 3VBUC 1TME2 2RS32 1HXS1 1COV1 4WM8C 2PLV2 3NAPA 1PIV1 1AYN3 1RVF2 1NG0A 1B35B 3ZFEC 4QPGA 1MQTA 5FOJB 2HWE1 4IV3A 4JGZB 2RM23 4WM8A 1MEC3 2WFF1 5D8AA 1AL23 5C8CC 1VBC3 2RM21 5JZGC 1RMU3 1RUJ3 4RQPB 2RM22 4QPGB 2XBO1 4AEDC 1ND2B 3VBRB 4YVWB 1RUI2 1GFF2 2HWE2 1FPN3 2R042 1H8TB 1VBA2 1AR91 5A32A 3VBSC 1FMD2 5AC93 5JZGB 1R1A1 5AC91 5L7OA 2R073 4RFT0 4CDUC 1MEC1 2R061 1AR81 3ZFEB 3NAPC 1PIV3 1AYN1 1AYM3 3VBRA 4QPIC 2RS11 5K0UB 1QJU1 1HRI3 2R072 1ASJ2 3TN91 1EAH1 4FTBA 1QJY3 4RR3B 1R091 1RUI1 1QJX1 1R1A3 1HRV3 2WWSA 4Z92B 5CFCC 1VBE3 1RUH1 2RS53 4GH4C 4Y5Z0 1QJY2 4QPIA 4YVSA 1HXS3 3J8F2 4RS5C 1POV1 1AR93 5A32B 1RUE1 5C9AC 4WM7B 1V9U2 5CFDB 2MEV3 4RS5B 4YVWA 3S6PA 1NOVA 5BNPB 1H8TC 2HWF1 1QJX2 2BBVA 4PDWA 4RHV1 2HWF3 2PLV3 1RUI3 1BEV3 5D8AC 2PLV1 4N43A 1VBB3 1VBE1 1RUE3 4RR3C 1OOPA 4CEWB 1QJX3 1AL0G 2R063 1AYM1 1RMU2 3DPRB 4N43C 5DDJ1 2RS51 1NY71 5A33B 1AL21 3ZFFB 1Z7S1 3JBG3 1AR92 5ABJC 1VBA1 1QQP2 1R093 2R062 4RS5A 1HRV1 4Q4V2 2RR12 4RHV2 1PO22 1QJU3 1R1A2 2Y26A 1FOD1 1VBE2 3CJIB 3VBOA 4YVWC 3VBRC 1PO12 1H8TA 3JD71 1TMF1 4Q4Y2 1POV3 5ACA1 4RHV3 1RUJ2 4Q4W2 2WS91 1RHI2 5DDJ2 5FMOL 4CEWC 5BNPA 2X5IA 1MQTB 1TMF2 4Q4Y1 4CDXB 1V9U3 4Q4Y3
chains in the Genus database with same CATH superfamily
1SCSA 1ULPA 1GV9A 2WA3A 1UY2A 4QM8A 1W6OA 3ZFFC 4NWVA 1YLLA 5FZ0A 5IK4A 3EB7A 2WWJA 4QB2A 3UT0A 2ZKNA 5A70A 1CGPA 1HX6A 5FO7B 3H8UA 2Q8EA 4URTA 1OLQA 4CSWA 4Y1VA 4CDUA 1K5MB 1VBD1 2XBO3 4MGQA 2WZ8A 1OH4A 1QNWA 1WGPA 2X5IC 3TEWA 4AK3A 2HWB2 4IW3A 1V9U1 1ULGA 2DWRA 3ZKUA 4LIUA 5EFUA 1H1MA 3AYDA 2EIEA 1EV11 1ZZ9A 2W9XA 5GLVA 5FY7A 2HBUA 1XSRA 2A71A 3R4UA 5JIAA 2G4IA 4G9SB 3VKLA 4ZKTB 3HOBA 3J7MA 3P1IA 3FUQA 3PIJA 1WMFA 2EXKA 5FZEA 1PGL2 3SITA 2C6SA 1KDKA 1V6JA 3WUCA 1SFYA 4LHKA 4XQ4A 4CDXC 4Z82A 2RS52 5LW9A 5ABJB 1DF0A 1OQ1A 1K5MC 3AFGA 3K75B 4IE5A 3IDCB 1S55A 4AFCA 3GCWA 4AI9A 4KWKA 3JZVA 1M06G 3WR0A 1VBB2 4QX3A 1STMA 4N7IA 1OF3A 1UKGA 3VLBB 5E89A 2X8KA 2O8OA 1F8VA 3AJYA 4LIVA 1CJPA 1KFUL 3RZZA 3BPZA 3HN1A 4K1YA 5JSRA 2P3JA 1AZDA 2CGNA 4CU8A 1IS4A 2YFZA 1KS5A 4R8HA 4UFMA 2XONA 1CAUB 3LFMA 3O1TA 1JN2P 3IIAA 3MYXA 1ZBE1 4M3CF 1I6XA 1HN0A 1NLQA 4LQRA 1G86A 2HKXA 2Y0OA 3T30A 3MEPA 3DEMA 4ASLA 2J1UA 1VAKA 3N7LA 1TMF3 1NA1A 4ZU4A 2EXHA 3J9SA 1W8UA 4Y5SA 4MGKE 1UOFA 2ARBA 1LOFA 2VQUA 4ASKA 4LULA 3LFIA 1W2AX 3OUHA 1PVC2 1VMJA 3KT4A 4CXXA 4XUQA 4P9IA 2JIGA 3SEPA 3ME2A 2KM2A 3MGUA 2Y64A 4Q4X2 4YM0A 3T09A 2KR2A 5D2AA 4B3NA 1APNA 1N3QA 4HKLA 1YQ6A 4W6XA 1ENSA 5FZ3A 2A6XA 2PFWA 1ZREA 1O8PA 4IERA 3NV1A 4XILA 1W6NB 4C0BA 5EV7A 4XC9A 1ULEA 2JENA 3SKVA 3RFRA 1XXNA 4GIQA 1LHOA 5L19A 3UKNA 3R4SA 4M3CB 3RPQA 2Q8OA 1X82A 2GP3A 4Q8LA 2RDNA 1MVEA 2ZZQA 5IVCA 4CDWC 2WQZC 4I3GA 2B7YA 3K4AA 1VRH3 2A1XA 2PHWA 1Z78A 3NMBA 5FZCA 2AUYA 2QQLA 5H9QA 3RG0A 2YPJA 4BMBA 3J8F3 4XETA 3WP6A 4HVOA 1D4VB 5C4WC 4LKSA 4EN0A 1EPWA 3KMHA 1FAYA 3I3BA 2ADDA 2XJPA 4AEKA 4IGQA 4YRDA 1ND3C 4LJHA 5IATA 1AR63 1VBA3 1RUF3 3K51A 1H8VA 5FZFA 1PM4A 1POV0 4QDSA 5GLWA 1V6IA 2E6VA 3LSEA 1D4M3 2BW8A 4KMQA 4A7YA 3IPVB 5KXCA 1W3XA 2PMWB 5EHDA 1CONA 2ARXA 2R041 4P02B 4OHZA 4MGIE 5LRSA 4IEPA 4H7LA 1LESA 4UYBA 2FZ1A 2AR6A 4UW4A 4D6QA 3KCCA 1GLHA 1SLAA 4TLGA 4EZ4A 4F8AA 5IAVA 1TQ5A 1NCRB 2WN3A 4GJYA 1WBLA 4EYUA 4GB31 5B2GB 3BGAA 2D6LX 3M8LA 4TLFA 3WQ7A 4GMP3 3AMNA 4AL9A 1W6PB 2O14A 1O59A 4NMIA 4V2WA 5E88A 4B1LA 4CRQA 2I45A 5JI7A 4EZHA 3UJOA 2ZGPA 2VZTA 2GDFA 3C2UA 3AM2A 2Z42A 4AXOA 3I59B 3T2PA 4CA9A 1OT5A 1PK6B 4NWWA 3GHMA 2J1EA 1W90A 1WD3A 4J6GA 3R05A 2VJXA 2JG8C 3ZFGB 5FYCA 4E9KA 4WM7A 4AVTA 1F9KA 2BOIA 3I4IA 1RMU1 3AKPA 4Y1ZA 1H4GA 3B01A 4JKLA 5JAXA 5JOZA 4BQ3A 1ENRA 1PVC1 3UYJA 5DQ0A 1HB3A 2A73B 3P3PA 5CEHA 1EUTA 4DINB 4X6RB 3ON7A 1Q5OA 2HWD2 1PO11 1MS8A 4IEYA 4BISA 1JZ3A 1ZRDA 3PDQA 5L7OC 2FZ2A 4LMFA 5A3TA 3MLJA 1SBDA 4JGZA 4XUOA 2R30A 4PCRA 4W8JA 5FYYA 3VV1A 5HBAA 4IE6A 4D6SA 4LXLA 4XF0A 1ZBE2 1NCRA 4KGGA 3I2JA 4UBGA 2ORXA 4YVSC 4E27A 4Y22B 1EPZA 1GWKA 3WCSA 1SZBA 4I02A 2V09A 3S7IA 4FO9A 3VD7A 4AHWA 2WUHA 1KITA 3QD6A 5DUVA 5JOWA 1C8M3 1JOBA 2RMU3 1G9CA 3KV4A 3IPVA 5FZMA 5EJ1B 2YC0A 4P5HA 1TME3 4XTPA 5JI9A 1ZBA3 1DCSA 2IFRA 1K45A 2Y33A 1J3QA 3I3QA 1ND2A 2JECA 4ITCA 1W8NA 3LPGA 4FXKB 4WVVA 2BRTA 3NJVA 4AFDA 3UETA 5L7OB 1WUVA 2F4PA 1N1SA 2VM9A 3I2GA 4BU2A 4Z1VA 1JZ7A 1UIKA 1DQ4A 2TUNA 1ODMA 2HWD1 2ZX4A 5KHJA 4XAEA 2P3KA 5LBEA 5J7MA 1ND2C 1HB4A 4ES9A 2JDHA 2A6VA 3LA3A 3OCPA 3WNXA 1Z7S2 1COV3 2IZWA 1RB8G 2VMHA 1CAWA 3O0WA 4XZPA 2X5IB 3U0ZA 3VBHC 1RC6A 4LO5B 4L92A 4XF3A 5LA2A 4HKOA 1RXGA 4JX0A 5G05L 1RUG3 3SKJE 2XJUA 4NUBA 1SFPA 1UYPA 3ETPA 1GBGA 2G9ZA 2HEVF 5K8SA 4LOTA 1YIFA 3H8RA 1LHUA 3LA7A 4AQTA 3D5OA 1X9TA 2E7AA 4EWEA 1QHDA 4JGZC 1BBT3 5AVAA 5LWBA 4S2HA 4QDRA 5CISA 4KH9A 2Y6JA 3QLQA 3C8XA 4ZS2A 2VMFA 4UOJA 3H3UA 2W91A 1B35A 2WS92 4Y20B 2GNDA 4Q4W1 1LOBA 3HBZA 4CUAA 3VBUA 3WHTA 5J1XA 2YGLA 2ZZJA 2XJQA 4PI2A 4UW6A 4BM8A 2NZ9A 4H2AA 1Y4WA 3ZPOA 1OLME 1WCQA 2K0GA 4GWIA 3WF1A 5BNOA 3C3VA 1LAJA 4JVAA 4E4ZA 1JXNA 3FWEA 4E4DX 2VUAA 3B9IA 1LULA 1GANA 1QH6A 2JJ6A 2XUMA 1LOGA 4Y24A 5ABJA 4KBZA 5LEJA 2BU9A 5CFDA 2BQPA 4LHSA 1W6MB 5C7GA 4NO4A 1UY4A 4FPLA 5BNNC 4ARXA 2CGPA 3KT1A 1NY72 2LROA 1KJLA 1OPMA 3OY8A 2FD8A 3HNMA 4QX1A 2ZX3A 1NE6A 5LCWL 2FCUA 2R0HA 1PIV2 4FI9A 1S2EA 4NPLA 3C7FA 5DAXA 2J22A 1XNDA 1JS9A 4PHZA 2CTVA 1VBD2 3LA2A 3NNGA 1O5LA 4DS0A 2P4EA 5J98B 4XOGA 3KVAA 5HPOA 4WM7C 2YV8A 3VHPA 3HAGA 3Q8CA 4KG8A 2VGDA 1GNHA 4Q4W3 4QQHA 3UKTA 3V0AB 1LKNA 2C9KA 4OHVA 3T2TA 1DYOA 1EAH3 3MIBA 4XEZA 1BVP1 5KXDA 2YZ4A 4FPKA 4QXKA 1DLCA 4EWDA 4Q26A 1VMFA 2GMPA 2PLV2 2VNRA 3NAPA 5F6LB 2GC3A 3SH4A 1PIV1 4QM9A 1NG0A 4D0QA 3VZMA 3FLTA 2HH9A 3BYWA 4J1WA 4IV3A 3ZXFA 1NYWA 2ZMKA 1ONAA 4AAXA 2QKDA 4YG3A 5D8AA 5C8CC 1VBC3 4LPLA 3T2OA 1IG3A 2DVGA 1VAMA 2AZ5A 3L9JT 2OVUA 2HYXA 3N9PA 3OUJA 2DVFA 4DB5A 1J3PA 5L9BA 3WW4A 4JC1A 4A4AA 5KHKA 3RQ0A 2R6QA 1ND2B 4NHLA 2VH9A 3RMXA 4KQ7A 4YW5A 3NNMA 3M1HA 3ZSEA 4UXAA 1W8HA 1RUI2 2WC2A 2JG9C 1YI9A 4UW3A 4AI1A 1X50A 2VOKA 1JH5A 1VBA2 2VBPA 1AR91 4XZUG 2GALA 2G1MA 1S0DA 2B5HA 2W1WA 2YUEA 4ZONA 4LA3A 1QMJA 1FT9A 4XDOA 4IE0A 4CVUA 1R1A1 4G3YC 1OKQA 2P5BA 2YYOA 2LM3A 4Q8KA 5JR2A 4A7ZA 5ANQA 5T5OA 3P6BA 2TNFA 3OSDA 4LTAA 4RFT0 1MZ6A 1E5RA 1MEC1 4LBMA 2QVSB 1AR81 4QGMA 2Q1MA 3D4KA 4MVTA 4Q2FA 4QGLA 3E97A 3KB5A 3DGTA 4HK9A 4FFHA 5T5PA 1C57A 3S7EA 1HRI3 1FYUA 4M4PA 2P6HA 5KBFA 2K46A 5D21A 1ZA7A 3D82A 5C71A 4AFMA 2DU1A 1LTEA 3H3LA 3ZXLA 3T08A 1R091 5A7OA 1LOAA 2VUDA 5JXHA 2VMGA 1R1A3 1HRV3 1XPWA 2ZOEB 3AP6A 1MPXA 2A75A 2Z79A 3S0MA 2OQ6A 2W3JA 3NNJA 3DYOA 3FL7A 4XCBA 5A6YA 1IS3A 1DFQA 2ID4A 1NX9A 1O4TA 3WF3A 5HCHA 1OXCA 2WO2A 2XL7A 4XDQA 1OD3A 5FFOC 2XQRA 4QU2A 1BQPA 1HV0A 4YVSA 3ACGA 2A6YA 4N9IA 3AP7A 3USUB 1DIWA 3E5XA 3J8F2 2FBEA 4P9YA 2D6NA 3KHBA 4V1PA 1YFYA 1RUE1 2NPIA 2PN5A 3WQ0A 3W9AA 1IPJA 2DU0A 5CFDB 4TN7A 4Q27A 1CZTA 1Q8SA 2DCTA 2KD7A 2W87A 1NOVA 3ITQA 5FPVA 1IKQA 1JZ8A 4I2OA 4H3WA 1H8TC 2WNVC 2BVBA 3H1MA 3JQXA 1UF2C 3VHOA 2P34A 3KSCA 2QZ3A 4N7UA 4PDWA 1XNCA 1SPPB 5HI0A 1W06A 2JG8B 1ENQA 1UXZA 2A3XA 3ZN6A 1Y3TA 4INDA 1VBB3 3BOWA 3N3HA 2JDAA 2BEOA 2P37A 4RR3C 2QQKA 4GKYA 5FREA 3WDTA 3LD8A 4WVWA 4AOCA 4CP9A 1AL0G 1P8JA 2Y6LA 3QBQA 4QD2A 1KFXL 5BNQA 1Z0HA 1WLCA 2XQXA 3O12A 4DEVA 1S0CA 4LBJA 1AYM1 4ZHNA 1WLWA 1YYNA 3WCRA 3AL5A 4BIFA 4EN9B 3AYEA 1GZWB 1UW8A 2DVDA 4IXLA 1MR5A 4P08A 4XJUA 3ZFFB 5C3PA 4ZU5A 5L36A 1WWYA 5FPAA 5JR7B 3RJRA 3B93A 2AH2A 3T3YA 5GM0A 3ZLIA 5FYZA 5ABJC 4LKDA 1NQJA 1OURA 4ZY9A 1YQ8A 4U2AA 5EPAA 3ILRA 2PHLA 2BTVC 3AZWA 2VTXA 2A3WA 3INAA 1HRV1 1K5JA 1NQDA 2RR12 2Z69A 3I2KA 4Q4V2 3VDCA 1OA2A 1S0BA 2DTYA 1PO22 5IW0A 1JHNA 1QJU3 4PLOA 5KR7A 2Y26A 4S2GA 1DYPA 4FOQA 4JV4A 1FOD1 1YHFA 2XXZA 1W9SA 4DY5A 1YRZA 1GZCA 1VBE2 4COUA 4DFSA 4OI4A 4E2QA 5JWPA 1WMEA 3GJAA 2V4AA 4JQRA 1W6OB 1MZ5A 4GD4A 1POV3 4Q4Y2 5FYHA 5FYSA 5ACA1 4PF1A 4ZS3A 2AREA 5L9VA 1TG7A 3I2IA 3PMEA 4OI1A 1ULDA 1H9WA 3OGRA 2C5DA 4CPBA 3LDBA 3POYA 2BVVA 3TAYA 3POGA 2X5IA 1MQTB 4META 4BIOA 2WAOA 5FBJA 4CDXB 5ISLA 4XDPA 4NIHA 4QB6A 1O3QA 4AGGA 2DBIA 4GWMA 1UU5A 4P9GA 1W9YA 1TNRA 1TEIA 4BQ2A 1JW6A 5LATA 1MS0A 2JG8A 4H7MA 3BVCA 4FOVA 1ZZCA 4PDWB 2JDYA 1TNFA 2E51A 3TN93 3VHRA 3PU8A 1QJY1 3CQOA 2YG0A 3OEBA 3QH6A 1IS6A 4GAZA 4KGQA 1BEV2 3PIGA 3UV9A 4FFGA 1W04A 2B42B 3EO6A 1NXMA 2OW4A 4MX3A 1RUF2 3VKMA 3AZVA 1QJU2 3HVDA 2HYKA 3FHIB 3FLRA 1LEMA 5FYMA 5H9PA 2W2IA 1UL9A 4K7JA 3WNKA 5F9TA 1BEV1 3V0BB 2WNOA 3BODA 1LHVA 4QHOA 1UZVA 3DN7A 3B5LB 4XIKA 3JBG1 4MGTA 2E31A 4BQ1A 4AQ6A 1UMIA 2UURA 3OGSA 1CR7A 3POBA 1ZZ6A 2JE8A 3WNPA 2ET1A 5GZCA 2HWB3 2FCTA 3U4SA 3LQCA 4MV2A 2UY9A 4QPGC 2CNAA 1S0JA 4QXBA 2BFUS 1NCQC 1C8M1 1ZBA2 2RMU1 2YY1A 1R082 2WAAA 2ZGNA 3GGLA 3POWA 4GH4A 4S2DA 4N53A 3THCA 3ZYIB 5GZGA 4R4XA 5IT6A 4DMIA 1AF9A 4XF9A 2XDVA 4Z07A 4QMAA 2YC2A 3IAQA 3ZYPA 4GQ7A 1OI6A 1ASJ1 3N9QA 4WZFA 3AB0A 5FZ9A 3TN92 4CZSA 3NKGA 1US3A 1J83A 4IV1C 1EUUA 4TYSA 2YBSA 4Y4RA 1AXZA 5LBCA 3M2MA 4NHKA 3UK9A 5LA0A 4DXTA 5FZGA 4FAGA 1PVC3 5CB7A 1OHFA 5KXEA 4F3JA 4JRAA 2UWBA 2O0OA 3JBG2 2X09A 1VJ2A 1YJKA 4GJZA 4P9WA 5SV8A 3VBHA 2D6MA 2A7AA 1ZRIA 1XE8A 3IMMA 2VPVA 4NRQA 5DAVA 2IXCA 3POFA 2PQQA 4C1XA 3KT7A 5J36A 1AXKA 5A6ZA 2HBTA 1HXS2 4Q0SA 3V64A 4AYUA 4FQ4A 4FPGA 1RUD2 1US2A 3BPSA 4FVVA 4LUKA 2WNVB 4HT1T 4C91A 4IE7A 3ACHA 2XKOA 4C1WA 4AQSA 1E57A 1WCUA 3RZLA 4IEUA 4IDZA 5FMBA 3PVNA 5A7QA 2HWC3 1Q8QA 3IMNA 2WNUC 1IG0A 3UKVA 3IIIA 1UYYA 2Y38A 1GNZA 3NRUA 4CCKA 4YGBA 1CZVA 4CDQC 1WZXA 3TWIA 3IM0A 1RINA 3HQXA 2BGCA 1DZQA 2HWB1 3NL1A 2OUJA 2ZAHA 2QJVA 3M3CA 1O6UA 2G9FA 4CEYC 5FY1A 4LE3A 5AFEA 1RUOA 2E7TA 2WNEA 2YHJA 4AVBA 1UU6A 4WBBA 3RI9A 3PMSA 4Q0QA 1H9PA 3WHUA 3WINE 3B00A 5JCTA 5FJKA 3A4UA 4CCMA 1C8NA 4XQDA 4NIGA 3ZR6A 3ZYGA 3TEZA 1HN1A 3QH7A 3T4VA 2RR11 4NROA 1HRV2 4HSJA 4Q4V1 4FPFA 4AI3A 1AX1A 1DYKA 5HV4A 4BQ5A 2Y6KA 1RUC2 4IEWA 1VBD3 3A22A 1W9WA 3WT3A 4XVHA 3CJIA 4GKXA 4H55A 1HQLA 2YXSA 3VBOB 1LGCA 2OZJA 2WZR3 2UWCA 3HT2A 3AKTA 3UGGA 5F39A 3ILNA 1W2OA 3B7MA 3U4XA 2IC1A 2VC9A 4RA0A 4AQ2A 4MSVA 4MUVA 1BMV1 3NW4A 5FQ0A 4GXLA 3MLLA 4Y1XA 2H6CA 2VOWA 4RGGA 2UYAA 1GP5A 2WS93 2Y6GA 4O61A 2NLRA 4P00B 1CIYA 3Q9OA 1S4CA 1RVF3 4JDMA 4ATFA 4M01A 5BNOB 5FCCA 3AFKA 2XWJB 4Q1RA 4XPVA 5LASA 5C33A 1F5JA 4UBHA 3WNLA 3LEKA 5TSWA 4ZU7A 1AJKA 4XTMA 1RUG2 4JQTA 4AAPA 1CJDA 4YG0A 3VD5A 1NLRA 2WLPA 4QAWA 1LR5A 5K9YA 3OEAA 4HOOA 1TVGA 3KQRA 3KVBA 1KEXA 3TBDA 2GC1A 1QXJA 3PTRB 1G9BA 4FPHA 1WA6X 4E8DA 3S5AA 1DQ1A 2FQPA 5J3UA 1NCQA 3NSTA 4QKNA 3Q8AA 1F2NA 1H0BA 1HRI2 1SLBA 3NKTA 1R083 3E5QA 1VALA 2B46X 3VKOA 4E4SA 5FY5A 3VB9A 4XBLA 1O7FA 1GR3A 3JB8A 3E1F1 2ILMA 4PLNA 3NO8A 2VNGA 4OULA 3PUQA 4MZUA 1O5UA 1NLSA 4MGYE 4XUTA 3ASIA 3WNOA 2DYCA 4FPCA 1W0NA 1ACCA 2XKPA 2W92A 3ROUA 3RDIA 3AKRA 4NHXA 3MO4A 1CPNA 1VLNA 4NJ4A 4CCEA 2DCKA 5DAWA 1PO23 1AR62 3G7DA 3PUSA 4QPYA 2ZGRA 4GZ9A 1C5IA 4YWAA 4NR1A 3MHZA 3S30A 3ZVXA 1I1EA 5FPZA 2HWC1 2D97A 3VKNA 4DUXA 2WDBA 2X10A 3FFQA 3IT8A 1LJ7A 4HLTA 3MBWA 2MEV2 1FATA 4TWTA 3ZIXA 4D3WA 3VZOA 3ZXEA 3GZAA 4Y1YA 5JMCA 4XHXA 1UYXA 4IV1A 4FSJA 4YGEA 5BXXA 5DZFA 4RQPA 4KWLA 1VRH1 1DDLA 4KU8A 4CDQB 2OT7A 5C3SA 2F6BA 1HJGA 1DP0A 4QX7A 2VZVA 3IBMA 2VE1A 4PIXA 1JHJA 2W39A 2W47A 5A7SA 4NPRA 2QQPA 5GALA 2H0VA 2Q8CA 4QX0A 4LBKA 2IXLA 2ZX2A 2VBDA 2D7FA 3VD3A 1TE1B 3SH5A 4LBQA 2ZPXA 1HQNA 4DXZA 4FCAA 2ZACA 1OA3A 2WFF3 2WT1A 4QGNA 4AVVA 5FYBA 1OA4A 5L73A 1GMMA 4AEDA 3DECA 2CL2A 5LBFA 4BLJA 2HEYF 1NCRC 1A78A 2DCYA 1NE4A 2VZ1A 2MEV1 4LBOA 4QPIB 5GZDA 3AXEA 2JDKA 4FPYA 3RWNA 1ZNPA 1G6NA 2XL9A 2D5FA 4K9SA 3T1MA 1I3HA 3A0NA 1ULOA 2ZHNA 2QUOA 3ZSJA 3VDDA 4QKFA 4UAPA 2NQYA 4L11A 4UF0B 3I97A 1YIPA 1Y9QA 3NJXA 4FPEA 5K7PA 2Z4FA 2GAUA 2OS2A 2ZGKA 5CG9A 4N90A 1CX1A 3WUDA 4LLFA 2VUJA 2EA7A 3HR9A 4G4FA 3Q8FA 3CJXA 2YBPA 3NAPB 4Y33A 2UWAA 4IV1B 2DCZA 3CJIC 3RZKA 4TZDA 1LU1A 4ORFA 1FV3A 4MG2A 1FPN2 4GH4B 4A44A 5FXWA 1OSGA 1RUC1 4E2GA 1NUKA 2YDEA 2ARAA 3ZXAC 4NAMA 5FY9A 3WSOA 5C6CA 3A7QA 1UMZA 4GA9A 5F7UA 4MH0E 1IS5A 1VR3A 2VULA 1PO21 3KF3A 4XJWA 4CEYA 4AF9A 1F31A 4Q4V3 4NE9A 3ZFFA 1FX5A 4EQVA 4YM3A 3BI3A 2IWGB 1M4WA 1POQA 5LBBA 2HWD3 1H1IA 2W0XA 1C4RA 3ACIA 3GM8A 3H50A 1SLCA 2R071 5IHRA 2N7GA 3CKHA 1SLTA 1ND3A 4CDWB 5JIUA 3VZLA 3RYRA 1JZ4A 1RUH3 4IGOA 2FDGA 1H30A 3LAGA 1RUG1 1O8SA 3FUOA 2JX9A 3VBFB 1J3RA 1EYBA 1YNAA 3LIGA 5C4WB 5HV0A 1WMDA 4IV3C 2QTWB 4LORA 5FV3A 4FBFA 3WP5A 1NAEA 2VY0A 3AMMA 3VBUC 2RS32 1DGWX 1HXS1 1COV1 4WM8C 4COZA 5F37A 4YZ2A 3AP4A 5FZIA 4XABA 4BH9A 4OHXA 1AYN3 3HT1A 5BPXA 3DYPA 1B35B 2LRPA 3GZEA 4UFJA 1MQTA 3LZZA 4JTOA 4JGZB 4YZ5A 1DGRN 2J1AA 3MUY1 4OQ9A 2ZHMA 5C8WA 4CP2A 2ES3A 5A3NA 2YC4A 4KWUA 1AL23 2ERFA 4TSVA 3BUCA 5JZGC 3LKJA 1YCIA 1YQCA 4I0WB 4YW1A 5JXIA 1IOAA 5JOXA 5FYUA 4RQPB 4BLIA 4A2UA 4QPGB 2XBO1 1YQ5A 2ADEA 4AEDC 3HQUA 3I2OA 3NJZA 4WVZA 1RUNA 4NPMA 3W20A 2OXBA 5FWJA 4XJ9A 1PZ7A 1LEDA 2IXKA 4NIAA 4LNVA 2BOJA 3VDBA 4JDNA 2A70A 1XB9A 2A5ZA 5A32A 1U5XA 5A1FA 5FAXA 4LEJA 4ZXKA 4CCOA 1G8WA 1I5ZA 3AKSA 1C28A 5CKNA 5JZGB 2VZPA 5L7OA 3CL1A 5C3QA 2XOMA 1AX2A 4IE4A 1LHWA 4I30A 2OA2A 4AWDA 1ST8A 2R061 1WD4A 5EJZB 1JU3A 1AYN1 1AYM3 2V72A 1RIRA 1IQAA 3I2HA 4QPIC 3VBRA 5BY5A 3SH3A 1QJU1 2C0ZA 3T4HB 1YO8A 2VAUA 5G04L 1QGLA 1H2NA 1JUIA 3O7OA 5KXBA 1XE0A 2VECA 3AYAA 2GNMA 4AVSA 2XHKA 4FTBA 2JDUA 4P14A 4RR3B 2VNVA 1LGBA 4LBQB 2I2SA 5CVRA 3GZTB 1CAXA 4Z92B 2RJKA 5CFCC 1RUH1 3PTYA 4XFIA 1WMXA 4BDVB 1PGSA 2VMDA 2OPKA 2V5DA 1RL3A 3P5BA 4I0AA 4MHRA 4GH4C 3SHRA 3MUZ1 1GZTA 3WQ1A 4Y5Z0 1JYNA 1NXD1 2XLGA 3KLSA 1HXS3 1HDKA 4QU1A 4RGAA 4CXYA 5GJ6A 2LALA 1GNYA 1JTZX 1SPPA 2I74A 5A32B 3KCXA 2ZS6B 3AL6A 3PVBB 4I0BA 4IETA 3LWCA 4K8FA 5IYYA 3SC7X 5JVVA 1BJQA 1UKRA 5FO8B 1S1AA 3K3NA 1W8FA 5IK7A 2EF6A 3S6PA 5BNPB 2R32A 4MO3M 1BVVA 3I3EA 2WWUA 2WR9A 5I0RA 5CKQA 2HWF1 1MS4A 4FFFA 4XCAA 1QJX2 2D3SA 3HWJA 1O4ZA 4QKDA 3WG1A 5IFPA 4IEVA 1U5ZA 4M3CE 2PLV3 4R9BA 1A8MA 4D7TA 2FDFA 2XGXA 5D8AC 4N9HA 3RRDA 5DAQA 2ARCA 3F2ZA 2PLV1 5J48A 1JU4A 5FZBA 1VBE1 1RUE3 4COYA 2QNKA 2OPWA 1W6PA 3HIFA 5EXOA 5LA9A 1OOPA 4CEWB 4TXWA 5IVFA 3ZSLA 1W0PA 1XYNA 2R063 1RJ7A 3NV4A 4WZCA 4W6WA 5DDJ1 4XAAA 3FMGA 2P3IA 1JODA 1NY71 3ORJA 3RWKX 5JSOA 5FZOB 1Z7S1 2UU8A 3RS6A 5DG1A 4AI2A 2VCBA 3APBA 5F3EA 1KJRA 1R093 1ZYBA 4RS5A 2AENA 2PHUA 4BQWA 1CWPA 5LK5A 4PLMA 3BU7A 1S0IA 3TOJA 1K12A 1QOTA 2FHRA 3H9AA 3IWZA 4YGDA 4AVAA 4LHLA 1R1A2 2DBNA 1YFWA 4BOWA 3BKZA 3WG3A 4MHUA 3VBRC 3V0BA 1PO12 1H8TA 2WIIB 3CMGA 3JD71 4I01A 2ZEXA 5CBLA 1TMF1 1W0OA 2GC0A 5T54A 1YC61 1RUJ2 2GN7A 2WS91 4HVQA 1RHI2 4LK7A 4V2VA 1Q3EA 2GP5A 2QCSB 2E63A 2Y60A 3E5UA 4HBNA 4Q4Y1 3OYWA 4FXGB 3T0AA 1GYKA 4B29A 1CAVB 3MIFA 4Q4Y3 3HNBM 2J1VA 4CP1A 4D69A 4NVPA 5I0SA 1REDA 2D5HA 1W8TA 1W39A 3BTYA 3OPWA 4CU9A 1CIWA 2BZDA 1W28A 4AGRA 3W58A 4CU6A 1U0AA 5DZEA 5HCAA 2PYTA 2ZGMA 5I8TA 5FR3A 2JICA 4OUSA 4C90A 1SG3A 1G9FA 5IAXA 4QPWA 1HV1A 1DU3D 1QJZA 2D93A 4HONA 4W4ZA 3PU3A 1OOPB 2WSVA 2YU1A 1MS1A 1N3OA 4PIZA 4XUPA 1H6YA 5JLVA 5JZGA 1UX7A 3SCHA 1PK6A 5FLIA 2CDPA 4JHZA 4YPJA 1GZWA 4N53B 5FUPA 3FHAA 3KGZA 1VB4A 1UU4A 3LPFA 3BIEA 1UCXA 1RXFA 2VOXA 5IJRA 1G7YA 5A33A 3VD4A 3M3IA 2WKKA 3CBNA 5H9SA 3UL2A 4L9BA 3FLPA 5FK8A 3JD73 3J7HA 1YEWA 1GQGA 5DUWA 5JOYA 1X8EA 3MV11 3WF2A 4CCDA 3IAPA 1MEC2 5C9AB 2DVAA 4FT8A 2GN3A 1GUIA 1SEFA 1PHMA 1SHWB 4HPKA 3N35A 1WW6A 1UX6A 1F5FA 5LY2A 4BHPA 5C8CA 1GICA 1FOD3 2J1RA 2ZX0A 2QDRA 1ZRRA 1A6CA 1TZOA 3CO2A 3PJQA 3LEMA 4XIOA 1W2TA 5FWEA 3IB3A 4URAA 2D40A 4DY3A 1ULFA 2KA3A 2F4LA 2XR4A 1ZBE3 1ND3B 4JTNA 1KXGA 1CPMA 3AP9A 3KGLA 3RYKA 4KL1A 1DGRA 5FDBA 3SLIA 5IK5A 2VCMA 1SMVA 2VOVA 3WW3A 1X33A 4UW5A 2WQ8A 1W6NA 4F83A 1SACA 3HMYA 4CXWA 1AJOA 3FC0A 5EQUA 2D98A 4X8NA 5A7NA 1KS4A 2R7EB 4O7XA 1HJFA 2J1SA 4FPJA 4UWDA 1J84A 5IWFA 4YVSB 3RZJA 1BMV2 2EICA 3URFA 1E5HA 3FX3A 4W65A 4F7ZA 3OBAA 3UJQA 3X29B 1RUE2 1V6LA 3ZYFA 4Z2AA 1BK1A 2ZHKA 2ZGUA 5FZAA 3GZUC 5ACA2 3OPZA 4BXFA 4YW2A 3H8OA 4XMIA 1X7NA 2Q4SA 1AVBA 1OD5A 2K9ZA 5CADA 5LY1A 4NIDA 4XXAA 3IDEA 3ZDVA 3WXPA 3T1LA 4D7SA 3WZ1A 1W05A 3VDDC 1DGWA 1U12A 2OQ7A 5AVPA 2CY6A 2XJSA 4K3UA 1MS3A 3EXUA 4GMP0 4IEZA 3K4ZA 4IUGA 1UOJA 1W8ZA 2DFBA 4MXWA 2ET7A 3ZPYA 1R092 5J37A 4CTEA 2B4KA 1QF3A 3ZMOA 4QX8A 5BNOC 4RSUA 5I91A 1W2NA 3GHNA 4PF5A 4QQ2A 4GWJA 2IXIA 1BXHA 1OVSA 3DUIA 4HK8A 3PUHA 2RJLA 4D7YA 4OHWA 2DUOA 2WJSA 3H3ZA 1EV13 1CAVA 2DUQA 4ZZ8A 1RUC3 2LS6A 2QQOA 3BIWE 3U75A 5C8CB 1IPKA 4JKMA 3ZXJA 1U5YA 1BZWA 1NCQB 1TME1 2GH8A 2CDOA 5FPLA 5FP8A 1Q56A 1OLMA 3RYPA 5A3WA 3ECQA 4Q0UA 5FQ0B 2VTXJ 4XJ8A 3PL0A 1DQ6A 3WLUA 5AFBA 5C3OA 2ZTNA 1QQP3 4AR2A 1GU3A 3FBYA 3V56A 1ALYA 1RUH2 2DUPA 4RN5A 3RVHA 1IQDC 2E33A 2XJVA 3I3MA 1AUYA 5FBZA 3GBFA 1R1ZA 2ZA9A 2ZEWA 2JD4A 3ZFGA 1SQ4A 4YW3A 4JGYB 2FDJA 2FCVA 1GP4A 3AVRA 1V6MA 4FP3A 4AI8A 4AW7A 1D2SA 3LF7A 4N43B 1SBFA 5FP7A 2YMZA 3T0DA 1AYN2 2X05A 1ZX5A 1QDOA 1XNBA 2C1FA 2RDSA 2PHRA 3A21A 3U78A 3O1RA 4YG6A 5CFCB 4KG0A 1WLDA 5DG2A 1Q8OA 1Y9GA 5LK7B 2XVLA 2L9LA 3SISA 2HWF2 5IVVA 1L7QA 1MVQA 2EIGA 2QQVA 1JBCA 2CWSA 2D3PA 3E6BA 2RR13 4B4QA 4BQXA 2BPA2 3WG4A 3MDPA 5LEKA 3B69A 1GZ9A 4IQPA 2OIIA 4R9AA 4AEMA 2RVAA 4QWNA 3W59A 1G9DA 1AYM2 2ORZA 3WDXA 3JU9A 2VMEA 3POEA 2ZAAA 2SLIA 3Q8EA 4K20A 5CIRA 4N53C 4HXCA 3MPBA 5DUXA 4BCUA 3DL3A 3S5QA 4YARA 4XFBA 1DZTA 2C26A 1QJEA 2Q30A 2A3YA 4LHNA 5CA6A 4XBQA 3RZHA 2VNOA 1IKPA 1MQTC 4GWNA 4JCKA 1PZ9A 2H0BA 1OKOA 4L0PA 5IVEA 1N1TA 2QFEA 2IVJA 3WP4A 4YZ1A 4JGYA 2X29A 1RJ8A 2BJSA 2WBKA 1RHI1 1D0HA 5I8YA 3LOIA 1BBT2 4UFHA 4FTEA 1JYIA 3J7NA 2YB7A 4L97A 5A3PA 4CDXA 4HETA 4AEDB 1XU2A 2CAVA 1PX4A 1VE0A 4BK4A 1NA1C 3ZO0B 2ZXQA 5I0DA 2WO7A 1ULCA 1N1YA 5T55A 4BA6A 4WM8B 3N4MA 2XVKA 3FJSA 2IXJA 2UY8A 3TB0A 2RDQA 4EE2A 3GYDA 2ZGLA 4LO6B 2G19A 4LITA 5T50A 2WLQA 1E5SA 5E1RA 1A34A 1AXYA 3N36A 2QQMA 4CUBA 3OG2A 1IHMA 1A3KA 3HEIA 3AKQA 3N9OA 2VQTA 4AFAA 3JB4C 3OJBA 1PMHX 1OOPC 2FDIA 1QY4A 2WL1A 4Q4X1 4YZ3A 2QZ2A 5FRAA 4PIYA 5J96B 4XFAA 1Q8PA 5DPNA 4CCCA 1OBNA 3AXDA 1OF4A 2W68A 3AMHA 4M0NA 2VR4A 1HB2A 2VW2A 1WCSA 5A3UA 3AMQA 4YM2A 4GB32 4XUNA 1WW5A 2IFWA 2XG3A 1U5IA 3N9NA 1E5IA 1YWKA 1GKBA 2VW0A 5F5IA 1F4AA 2GU9A 2R1BA 1VB2A 2Z5WA 3I2FA 3BB6A 3PVOA 5JXJA 3MV01 5A1AA 4LKEA 4WVMB 2RS13 3WW1A 1FMD1 3WP3A 5LB6A 3JD72 1XJAA 1D7PM 3SEEA 4A6OA 3VBFC 4A7KA 1C3HA 4EN8B 3OUIA 3ZR5A 1CZSA 4KNCA 1H2LA 4CCLA 1XRUA 4RR3A 2BWAA 1T6BX 1VBB1 2J7MA 4KI5M 5FZ4A 1XU1A 5F8PA 3I49A 3PNAA 4YYOA 3ZYJB 2JDNA 5C9AA 5FZ8A 4BQYA 2VXRA 4TTGA 1L3JA 3TEXA 3OGJA 4LOSA 5DZGA 3WEZA 3AX4A 3VUOA 4CDWA 1RYYA 3FBMA 2PAMA 4XF4A 4AE2A 2VQAA 2JKBA 2OX0A 3DXUA 1XE7A 1AHSA 3ZN6B 4N8MA 1WCDJ 5ERLA 1BBT1 4MYEA 1FNZA 2JG9B 2C24A 3KZ4C 3U14A 5FO9B 3NJYA 3PUAA 5T5LA 1GOHA 3J26N 5C4WA 1H2MA 1O4YA 2JE7A 3QOPA 2X53S 3HJRA 3I3DA 1QXRA 3E6CC 3U37A 3LGRA 3LIHA 4RL7A 1AR83 1G9AA 4EJRA 2R16A 3C7HA 1PO13 1C1FA 3VBUB 4BE3A 3UGHA 3R0RA 4YFWA 2VG9A 4IL7A 5L9RA 2JDMA 1UIJA 5EWSA 3D0SA 3J7LA 4K8RB 1FMD3 4W50A 2YFUA 1H4HA 5AC92 5FZLA 4BZ4A 4KU7A 3H42B 2WRAA 3IN9A 4ZPIA 5JXGA 3AVSA 4XFGA 1RVF2 2RV9A 1URXA 3ZFEC 4QPGA 1JYTA 4XFFA 4A6SA 2RM23 4WM8A 1MEC3 2WFF1 3T2QA 1QDCA 1W6QA 1GWLA 2YU2A 2ZHLA 4Q1PA 3UESA 1N1VA 4YFZA 4KWJA 2O1QA 2RM21 4QX2A 3OY8B 3MW2A 1REEA 1WLTA 2R1DA 4QT6A 2P1BA 5GZEA 2JG9A 2XLFA 3SQOA 4XBNA 2CYFA 3K3OA 5C3RA 3POSA 2WYFA 4FQZA 4X6QB 1JI6A 2Q1FA 2ZBJA 2HJIA 3ZXGA 5KHIA 3J4UH 2CV6A 2CHHA 1QEXA 2FMYA 1B09A 4QB1A 4DUVA 3AK0A 1IPSA 3EBRA 1GFF2 2HWE2 3EQEA 1FPN3 2R042 3WX5A 1H8TB 1S0GA 1GWMA 4JZRA 2ZGQA 5DABA 2WO3A 3WDYA 1C1LA 3JCIA 1FMD2 3ZXKA 3ZYBA 2QQJA 2NYYA 4R9CA 2JKXA 4XF1A 2PA7A 3ZIWA 5AC93 1OUSA 3USUA 2E26A 3LB9A 5CG8A 2JWPA 2ZCWA 2JXAA 4O65A 1KDMA 5F5AA 4YM1A 3TEYA 1H6XA 3AP5A 4CDUC 1JZ6A 3EMRA 1SCRA 3GBGA 2HEWF 3K77A 3LE0A 3NAPC 4HKWA 4X8PA 1W99A 2GMMA 3GF6A 4AEJA 2W1SA 4B4PA 2RS11 2CAUA 3B9CA 1D0GA 3RI8A 4E4HA 5K0UB 5LZ6A 2D3RA 1NKGA 3HD8B 5APAA 4EV0A 3U10A 4ONUA 4XJAA 4E8CA 2R072 1ASJ2 3C7OA 3TN91 3G6JB 1EAH1 4MOAA 2ETEA 3BCWA 1QJY3 1Y43B 3NQHA 1J59A 5BUVA 1QJX1 1V6KA 2SBAA 1GOFA 2XWBB 2JIJA 3CHXA 4IESA 4UT5A 4NIIA 1F4HA 2ZGOA 4DOUA 3LEIA 1CAWB 2DVBA 3F95A 4HN0A 2GNTA 4R52A 5FZ6A 3FFZA 2PHTA 4QPIA 3ATGA 3I59A 3CIHA 2RG4A 1GQPA 4RS5C 1CX4A 2FMDA 3HNYM 4UF0A 1PM7A 1WKYA 1CAUA 1LCLA 1QJFA 3SNMA 4AFBA 1YFXA 2VZRA 3OYWB 5IVJA 1JYCA 3QACA 5A7PA 1CAXB 2WINB 2MEV3 5F6KA 4CCJA 1Y9MA 3ACLA 1WBFA 3I8TA 4B7EA 3R6SA 2J42A 3H1WA 3MICA 3CF6E 3OF1A 2DFCA 4QXCA 2NMOA 5GLUA 3LDKA 3WVJA 4OI2A 1UMHA 2P6CA 2E9QA 4BJ0A 2PHXA 4HMZA 1UPSA 1YQ2A 5CNAA 1OQEA 2ENRA 4P9LA 4GULA 4Z8BA 3O1VA 3KHCA 2WNVA 1OH3A 3VN4A 2BGOA 2BDRA 1H2KA 4S2FA 1OQDA 1QJX3 1ZZ8A 3DKQA 1A8DA 5D1IA 1VRBA 1QU0A 3BN6A 1DZRA 4L2NA 4Y1UA 3V65A 3RMYA 1RMU2 1S0FA 4N43C 5JUVA 1W9TA 2RS51 2W46A 2DTWA 4FP2A 5A33B 3I2DA 2RDRA 1X8MA 3AC0A 4IGPA 1XSQA 1QKQA 1HKDA 1FNYA 1RTVA 1JYVA 3ZMNA 2VU9A 1QQP2 4ARYA 2UYBA 3TRSB 3ZYRA 2R062 3LDRA 4HL0A 4M3CA 2V73A 3JQWA 5JDBA 5A3MA 3MF9A 2MPFA 4RHV2 1H1AA 3WNNA 5KC6A 3O1MA 3CJIB 3VBOA 3ZKYA 4QDQA 3ZX7A 4OUMA 4BWOA 2BNOA 5IFTA 1OFSA 4WV8A 4K6BA 2VZ3A 2JD9A 4H14A 3OGVA 3ZYHA 3VL9A 4U36A 5BNPA 1UZWA 1XNKA 4CEWC 4LUMA 4QXHA 1TMF2 1RITA 1UO9A 2XB6C 4UI9L 3K4DA 4PQQA 3ZN5A 3KV9A 1HW5A 3LSDA 1AX0A 1V9U3 5DXDA 5T3NA 5FY4A 3D3AA 3H1YA 3MIGA 2DF7A 1D2QA 4RYDA 1SBEA 3ZDSA 1XOYA 2AEYA 2BERA 4LK6A 5DDJ3 5K0UC 4OZOA 5GKAC 1LRHA 5ACA3 4B8EA 1RUJ1 4DXSA 2GNBA 3VKFC 1JOPA 4LR4A 2VBBA 3DF0A 2KXLA 5F5CA 1W2UA 3Q8BA 3ILFA 4R9DA 1W03A 1I9RA 1NZIA 3PLQA 1S2BA 5FK7A 1OLRA 3ALQA 3DPRA 3O5SA 3SXWA 4HFSA 4AHZA 4DNYA 4OLLA 4FTSA 1LU2A 3AMPA 1Z7S3 1ASJ3 2Q5TA 4O9EA 4OMCA 5FMOS 3H7JA 3TYJA 4AZZA 3O1UA 2WT0A 5GLZA 2B8MA 1UWWA 2BNNA 3GXUA 4CDUB 3D8CA 2E7QA 1UOGA 3CZJA 3FZ3A 1UY3A 4EROA 3B3QE 4JHTA 5ANNA 4BYYA 1AR72 1AL22 1QOOA 3VBSA 3PURA 5FKCA 1HQWA 3ZXDA 3PVEA 4LKFA 2A6ZA 4CE8A 3M70A 3CZUA 5IUQA 4XW3A 2NP0A 1ZM1A 2QQNA 2HWC2 4CEYB 1XNAA 2BNMA 2AACA 3FN9A 1EAH2 5DAPA 3BTZA 1FI2A 2EVXA 3ES4A 3VHNA 4BMEA 5EJ3A 5FYVA 2YGMA 1MZFA 3A0KA 4L8QA 2B9UA 2VMIA 1K5MA 4OFGA 1SLLA 4DPNA 4C0HA 5M0TA 3H8XA 1FOD2 4SBVA 4CU7A 2R0FA 1O3SA 2PXJA 5CKMA 1WCKA 3I54A 4A3XA 2VTFA 3GJBA 4OQ8A 3N9LA 3U1XA 3MIEA 3GNEA 1VBC2 1UN1A 2K2SA 3HBKA 2DCJA 3DXTA 3HN3A 3L2YA 2B9VA 3MIHA 1W6MA 3B94A 2WSUA 4XFHA 4Z2WA 3UNPA 4BXSV 3SCFA 3OOXA 4CYDA 1Y7BA 4GB33 1QOSA 2EIBA 3BALA 1D4M1 3LCPA 4PT6A 5A3LA 1PGW2 3FHQA 3MI8A 5BYNA 2O8QA 2WABA 3VDAA 1ZZBA 2EIDA 3LOBA 1BKZA 2ZEYA 1MS9A 5B4NA 1YI7A 2PHDA 5F3IA 2BUKA 3MIDA 4ASMB 3POIA 1PMIA 2R043 3VBHB 2WYSA 3WQBA 5FZHA 4B7KA 2J1TA 2LTNA 5JSPA 1KD7A 2QQUA 3D0JA 5B4XA 4IEXA 1JOJA 5HXVA 3UGFA 1SDWA 1EV12 4WVMA 4C8DA 4XURA 4IEQA 4XQWA 2TBVA 3JXSA 3K48A 1RUD1 2YBKA 4XFCA 2YROA 2Z2SB 1GP6A 1UY0A 2QBXA 2ZGTA 1NZCA 2ZX1A 3I7DA 4FOWA 2D6KA 1FXZA 4B1MA 5F2WA 1CD3G 4QHBA 2BP6A 2VZOA 1RVF1 1LECA 4E2SA 1ZRFA 4BPZA 1LOEA 2JE9A 3DV8A 1QH7A 3ELNA 5IK8A 3E6DA 1L7LA 2CWMA 1PK6C 4UFLA 4NRMA 1XYPA 3ZFEA 4P9XA 1ODNA 1YXWA 2ATFA 4UFKA 5D8AB 5T5JA 4CCNA 2XBO2 2VCCA 3EYPA 4MXWB 1OFNA 4ATEA 1C8M2 2RMU2 1JYWA 1AR71 1O3TA 4I3PA 1RUD3 5FTTC 2BYVE 5C70A 1I5PA 2JEMA 4K21A 2XPJA 2MHFA 2WZR1 5BNNA 3OBZA 2W08A 4LA2A 3MW4A 3MFCA 5A3OA 2AEZA 1YFUA 3AZZA 1ZRCA 5FJHA 5F2SA 3C7GA 5K0UA 4P9JA 1CESA 2VQ0A 2W1QA 2TEPA 5FPBA 1J1TA 3NVCA 3T0BA 3V0AA 3PUIA 4Y26A 2MNGA 4OYUA 2WQ4A 3USSA 4LT5A 3VZKA 3O1SA 1SFNA 2XVGA 3O0XA 1XC6A 2RS12 4DRRA 5BV6A 2RS31 4CP9B 5KWRA 2XHNA 3U07A 3MPPG 1MZEA 3N7MA 5BNPC 1RHI3 2OYZA 4HZFA 5FMCA 1CN1A 1JUHA 2CU5A 5CYYA 5GLTA 3ZFGC 1K42A 3KV5A 2ZGSA 1KRIA 2H6BA 2ZEZA 3D6EA 4K40A 2W94A 4ISQA 1NT0A 1VPHA 1PGW1 5A6XA 5JMOA 2CGOA 3VBFA 4YGCA 2IUWA 2FDHA 1LB2A 2WZPP 4QQOA 2A6WA 2DDUA 4D6RA 4HANA 4LE4A 2XJTA 3RJ2X 5LA1A 2C4XA 1T6GC 1LENA 4Y5TA 4BQ4A 1PMJX 4CPBD 1AR73 3K46A 3WD5A 2GSYA 4AI0A 5FPXA 2PTMA 1LODA 1XBFA 5IVYA 5CFDC 1J1LA 3J8F1 5FXXA 2QE3A 2C9AA 1PGL1 2F17A 2OZ6A 2WZR2 5FP3A 1VRH2 5BNNB 1PVXA 3A23A 1IZ3A 2D43A 2XLAA 1GSLA 4LO8A 3MW3A 5I0TA 3ZSMA 3WW2A 4NN0A 1FPN1 2GMEA 2JDPA 3M3EA 1OMIA 4IV3B 3NNFA 4XXPA 2D6PA 4LBLA 4MLOA 2I07B 1UPIA 2WFF2 1KQRA 3BTAA 1BLZA 5FKBA 1C5HA 2GZWA 4JKKA 3GDBA 4JAAA 4FPOB 1B35C 1R081 3AZYA 1T2XA 2RE9A 3RGBA 1QNYA 5A80A 2B45X 3ETQA 5H9RA 4MXVA 3BTXA 4OVEA 1HB1A 1WA4A 1JZ5A 1V6OA 3OB8A 3RZGA 1W3VA 1GQHA 1UNBA 1J58A 4DRVA 4PI0A 1OC1A 3B02A 5C5TA 4XMAA 4HVRA 3WDVA 4AGVA 1EP0A 1QWRA 1BHGA 1N47A 1OUXA 3CLPA 1W9FA 4PDWC 5HXMA 3DYMA 2QQIA 3O1PA 3VL8A 4GALA 2JB4A 3RNSA 1DQ5A 4COWA 4W6YA 3DPRC 2VW1A 3MLKA 5FXZA 3SCGA 2PAEA 2WT2A 5LRRA 3VDDB 3VZNA 2Q1ZB 3ZN4A 2Y8KA 1S0EA 1XQNA 5E16A 3W21A 4OHYA 3HPNA 3JUUA 1D4M2 4GMP1 5A7WA 5A6QA 1RUF1 1LNSA 1R64A 4LBQD 5HCBA 1COV2 2AYHA 3KV6A 3NWKA 1VBC1 2VXJA 1VIWB 2ZKLA 4NHYA 2HLEA 3OGGA 5FLJA 4JGYC 4I09A 3OD0A 4PJYA 3RZMA 2OUHA 4XE9A 5DN2A 2VCAA 2VMCA 4Y22A 3MF6A 3EHKA 3N9MA 2EXJA 1PNGA 4QKBA 3NV3A 5K4LA 1UYZA 4CDQA 2RS33 4DUWA 2GC2A 1Q8VA 2R49A 2W95A 3GALA 5F3CA 3S57A 3PJYA 5FY8A 4QHZA 4J25A 1LGNA 2HWE3 2YPDA 2Y6HA 4NOTA 4AVCA 4RQPC 4PQ9A 4CEWA 1LOFC 4D8MA 2P3YA 4LO7A 2VL4A 4XJZA 4XHBA 5T52A 4D94A 5FXVA 3O1OA 2VZSA 4Q4X3 1V00A 4A45A 1ZZ7A 5CU1A 4A42A 4J1XA 2WO1A 5EP9A 1AR82 1AR61 1QXPA 1V6NA 5FIXA 5FPUA 4Q0PA 1OVPA 4CUCA 3KWVA 3KCYA 1LHNA 4EWAA 1HRI1 1UOBA 5C5UA 1N3PA 5FY0A 3KF5A 3WOGA 3VBOC 2BFUL 4A3ZA 4YW7A 3VBSB 5CFCA 2EXIA 1X36A 1QQP1 1IGOA 5FP4A 5FZ7A 5FUIA 1ZBA1 1UAIA 4ES8A 4M0HA 1UQXA 3EJKA 5EYYA 4AHXA 2IVIB 1OPOA 1LOCA 2V5YA 4QQPA 4JRLA 1PZ8A 3WY6A 3WDUA 1L7RA 1VMHA 3M3OA 4QX5A 5J09A 1EY2A 2NMNA 4DQAA 4DEQA 2ZMNA 1F15A 2WNUB 4ET7A 1NA1B 2PQSA 4Q29A 1V0AA 3CU7A 3BOPA 4Y4YA 3DCQA 1TME2 1W8WA 2VZUA 3H0OA 4YNIA 4K1ZA 4SLIA 3KM5A 3ACFA 1O3RA 5CAZA 2BV4A 2VVFA 1X9PA 3IKWA 3ABZA 5FYIA 4CP0A 5FOJB 2HWE1 3ENRA 1VP6A 3THDA 2RHPA 3O14A 2VZQA 4B4RA 4Y20A 1MS5A 2AGSA 3VD9A 2P2KA 2WA4A 1YJLA 5F32A 1UY1A 1RMU3 1BK0A 1DBNA 3AJZA 3SMHA 4RFRB 1RUJ3 4FAHA 2W52A 1MACA 3AZXA 5A1LA 5IVBA 3CEWA 2RM22 2VVEA 2NM1A 3W5NA 4BK5A 1O91A 2RJ2A 3OBTA 4YVWB 3VBRB 2XMLA 2XH6A 2BBAA 2CSGA 2E53A 1SDDB 4OUEA 3WF4A 2QDNA 3OBRA 1ENXA 3VBSC 2VVDA 3WDWA 2E32A 4COVA 2NN8A 2QQWA 5JPNB 4MGZE 5E6HA 5EZWA 1YUDA 2JB8A 4XACA 5AC91 4QQLA 2Y6FA 3W5MA 2R073 1HLCA 4OCTA 3TNQA 5I93A 2WN2A 5FUNA 3OD4A 4ZZ5A 5EIYB 4YSFA 5DMYA 3L2HA 2BWCA 3ZFEB 4Y3OA 1PIV3 4O9GA 3FE5A 2D6OX 1XNTA 1PNFA 2DURA 3TNPB 3VGIA 5F1RA 1PX3A 4DO0A 2LW8A 3P3NA 2LUWA 1BYHA 2WNUA 3NNLA 1RUI1 1DG6A 1RGSA 5FOBB 5A7WB 4M00A 4Q0VA 2WWSA 3MFAA 3ZM8A 1VBE3 3KQ4B 2PAKA 2W5FA 3PHMA 1UZYA 2Y0IA 3M4FA 4FOYA 2RS53 4EN7B 3MZHA 3POJA 4L99A 2Q8DA 3QCWA 5JPMB 1QJY2 2JDZA 2ZABA 4LBNA 3KD4A 4MGSA 2EALA 1BCXA 1VAVA 2VOTA 1POV1 3KS7A 4NHMA 4RD7A 3WV6A 4OZXA 4PBPA 5FZDA 1QIQA 1AR93 2WFPA 5FMDA 5KHHA 4DXRA 1V70A 2XJRA 5FLHA 4AHYA 3RSJA 5C9AC 4ZXEA 4WM7B 1REFA 1V9U2 4NRPA 5EYXA 1KGYA 3OTFA 4MADA 4RS5B 4YVWA 5I0UA 5FP9A 2B39A 1ZVFA 2WZEA 1SLIA 4YZ4A 1JMUB 3ZOIA 1S2KA 2VD7A 2BBVA 3N7KA 5FZOA 3THPA 4IEOA 4Q5OA 4M4RA 4RHV1 2GH2A 2HWF3 1RUI3 1BEV3 4DIQA 1JZ2A 2D44A 2VO5A 2Y34A 3GBWA 5DUUA 4A41A 1WW7A 4DZGA 3WG2A 4LLOA 1K3IA 4N43A 5KHGA 1DGLA 3M3QA 3HQRA 1UXXX 5F3GA 1DLLA 2AC1A 5CZKA 1HIXA 4KBBA 4R4ZA 2Q0AA 1DQ2A 5FZKA 1XYOA 1CVNA 3IDBB 3R4DB 3DPRB 2DV9A 3U11A 3VZJA 3WNMA 3GCXA 1ZA4A 4CUGA 1AL21 4YW6A 3JBG3 4FFIA 2ZJCA 4PBOA 4UFIA 5SV5A 1AR92 4AG4A 3M7AA 1VBA1 5GZFA 2W1UA 3IDAA 1JYXA 3ST7A 2P17A 3ES1A 5HCFA 2EAKA 4LO4B 3ZSKA 5KC5A 2FDKA 2BGPA 1DHKB 1Q43A 3CDZB 3AYCA 2XUEA 5I8SA 1W8OA 3WF0A 4BB3A 1CQ9A 4YW4A 5FYTA 4OI0A 1GOGA 4YLZA 4OMDA 2VUCA 2ZMLA 4YVWC 1WW4A 3NV2A 2EAAA 4HG6B 1FV2A 4HN1A 4RGKA 1UD1A 2IXHA 3H7YA 1W6QB 4EN6B 1F35A 3OPTA 4JDOA 4NAOA 1UZZA 3N7JA 1UZ0A 4HPKB 4P5YA 4RHV3 2OKXA 4HSLA 4Q4W2 3THTA 3DKWA 3C7EA 5FZ1A 4XYXA 3K2OA 3IZOA 5DDJ2 5FMOL 4ISRA 1DQ0A 2PHFA 5E8AA 5F5QA 3BU0A 3O0VA 2PELA 2V4VA 3LEGA 2G9GA 3CNAA
chains in the Genus database with same CATH topology
1SCSA 2WA3A 1GV9A 4QM8A 1W6OA 3ZFFC 4NWVA 1YLLA 5IK4A 2ZKNA 1CGPA 1HX6A 5FO7B 3H8UA 4URTA 1OLQA 4Y1VA 4CDUA 1K5MB 1VBD1 2XBO3 1QNWA 1WGPA 2X5IC 4AK3A 2HWB2 1V9U1 1ULGA 2DWRA 5EFUA 1H1MA 3AYDA 1EV11 1ZZ9A 5GLVA 2A71A 3R4UA 5JIAA 2G4IA 4G9SB 3VKLA 4ZKTB 3FUQA 1WMFA 2EXKA 1PGL2 3SITA 1KDKA 1V6JA 3WUCA 1SFYA 4LHKA 4XQ4A 4CDXC 4Z82A 2RS52 5ABJB 1DF0A 1OQ1A 1K5MC 3AFGA 4AFCA 3IDCB 1S55A 3JZVA 1M06G 3WR0A 1VBB2 4N7IA 1UKGA 3VLBB 5E89A 2X8KA 2O8OA 1F8VA 3AJYA 1CJPA 1KFUL 3RZZA 3BPZA 3HN1A 4K1YA 5JSRA 2P3JA 1AZDA 2CGNA 1IS4A 4R8HA 1KS5A 1CAUB 1JN2P 3IIAA 3MYXA 1ZBE1 4M3CF 1I6XA 1G86A 2HKXA 2Y0OA 3MEPA 4ASLA 1VAKA 3N7LA 1TMF3 1NA1A 4ZU4A 2EXHA 3J9SA 4MGKE 2ARBA 1LOFA 4LULA 1PVC2 3KT4A 4P9IA 3ME2A 2KM2A 3MGUA 4Q4X2 4YM0A 4B3NA 1APNA 1N3QA 4HKLA 4W6XA 1ENSA 2A6XA 2PFWA 1ZREA 4IERA 3NV1A 4XILA 1W6NB 4C0BA 5EV7A 1ULEA 2JENA 1XXNA 4GIQA 1LHOA 5L19A 3UKNA 3R4SA 4M3CB 3RPQA 2Q8OA 1X82A 4Q8LA 1MVEA 2ZZQA 4CDWC 2WQZC 4I3GA 2B7YA 1VRH3 2PHWA 1Z78A 2AUYA 5H9QA 3RG0A 2YPJA 4BMBA 3J8F3 4XETA 3WP6A 4HVOA 1D4VB 5C4WC 4EN0A 1EPWA 3KMHA 1FAYA 2XJPA 4AEKA 4YRDA 1ND3C 1AR63 1VBA3 1RUF3 3K51A 1H8VA 1POV0 5GLWA 1V6IA 2E6VA 3LSEA 1D4M3 2BW8A 4A7YA 3IPVB 5KXCA 1CONA 2ARXA 2R041 4OHZA 4MGIE 5LRSA 4IEPA 4H7LA 1LESA 2FZ1A 2AR6A 4UW4A 3KCCA 1GLHA 1SLAA 4F8AA 1TQ5A 1NCRB 1WBLA 4GB31 5B2GB 2D6LX 3M8LA 4TLFA 3WQ7A 4GMP3 3AMNA 1W6PB 5E88A 4CRQA 2I45A 5JI7A 2ZGPA 2GDFA 3C2UA 3AM2A 2Z42A 4AXOA 3I59B 1PK6B 4NWWA 3GHMA 1WD3A 4J6GA 3R05A 2JG8C 3ZFGB 4E9KA 4WM7A 4AVTA 1F9KA 3I4IA 1RMU1 3AKPA 4Y1ZA 1H4GA 3B01A 5JAXA 5JOZA 1ENRA 1PVC1 2A73B 3P3PA 4DINB 4X6RB 4IEYA 1Q5OA 2HWD2 1PO11 1MS8A 1ZRDA 5L7OC 2FZ2A 3MLJA 1SBDA 4JGZA 5HBAA 2R30A 4PCRA 3VV1A 4XF0A 1ZBE2 1NCRA 4KGGA 4UBGA 4YVSC 4E27A 4Y22B 1EPZA 3WCSA 4I02A 2V09A 3S7IA 4FO9A 5JOWA 4AHWA 1KITA 3QD6A 5DUVA 1C8M3 2RMU3 1G9CA 3IPVA 2YC0A 4P5HA 1TME3 4XTPA 5JI9A 1ZBA3 2IFRA 4L97A 1J3QA 1ND2A 2JECA 4ITCA 4FXKB 4WVVA 4AFDA 5L7OB 1WUVA 2F4PA 1N1SA 4Z1VA 1UIKA 1DQ4A 2TUNA 2ZX4A 2HWD1 5KHJA 2P3KA 5J7MA 1ND2C 4ES9A 2A6VA 3LA3A 3OCPA 3WNXA 1Z7S2 1COV3 2IZWA 2VMHA 1CAWA 3O0WA 4XZPA 2X5IB 3U0ZA 3VBHC 1RC6A 4LO5B 4L92A 4XF3A 4HKOA 1RUG3 2XJUA 1GBGA 5K8SA 2HEVF 1YIFA 1LHUA 3LA7A 4AQTA 3D5OA 2E7AA 4EWEA 1QHDA 4JGZC 1BBT3 5AVAA 4S2HA 4KH9A 3QLQA 3H3UA 1B35A 2WS92 4Y20B 2GNDA 4Q4W1 1LOBA 3HBZA 3VBUA 3WHTA 2YGLA 2ZZJA 2XJQA 4UW6A 4BM8A 2NZ9A 2K0GA 5BNOA 3C3VA 4JVAA 4E4ZA 1JXNA 3FWEA 4E4DX 2VUAA 3B9IA 1LULA 1GANA 1QH6A 2JJ6A 2XUMA 1LOGA 4Y24A 5ABJA 5LEJA 5CFDA 2BQPA 1W6MB 4NO4A 4FPLA 2CGPA 3KT1A 1NY72 1KJLA 1OPMA 3OY8A 2ZX3A 1NE6A 2R0HA 1PIV2 1XNDA 2CTVA 1VBD2 3LA2A 1O5LA 4DS0A 5J98B 4XOGA 4WM7C 2YV8A 3VHPA 3HAGA 4KG8A 4QQHA 2VGDA 1GNHA 4Q4W3 3UKTA 3V0AB 1LKNA 4OHVA 3T2TA 4XEZA 1EAH3 3MIBA 1BVP1 5KXDA 2YZ4A 4FPKA 4QXKA 4EWDA 4Q26A 2GMPA 2PLV2 3NAPA 2VNRA 5F6LB 2GC3A 3SH4A 1PIV1 4QM9A 1NG0A 3VZMA 3FLTA 4J1WA 4IV3A 3ZXFA 1NYWA 2ZMKA 1ONAA 2QKDA 4YG3A 5D8AA 5C8CC 1VBC3 2DVGA 1VAMA 2AZ5A 3L9JT 2OVUA 2DVFA 4DB5A 1J3PA 3WW4A 4JC1A 5KHKA 3RQ0A 2R6QA 1ND2B 4NHLA 2VH9A 3RMXA 4KQ7A 4YW5A 3M1HA 3ZSEA 4UXAA 1RUI2 2WC2A 2JG9C 1YI9A 4UW3A 4AI1A 1X50A 2VOKA 1JH5A 1VBA2 1AR91 2GALA 1S0DA 2B5HA 2YUEA 4LA3A 1QMJA 1FT9A 1R1A1 4G3YC 1OKQA 2YYOA 2LM3A 4Q8KA 4A7ZA 5T5OA 2TNFA 4LTAA 4RFT0 1MZ6A 4LBMA 1MEC1 4QGMA 2QVSB 1AR81 2Q1MA 3D4KA 4MVTA 4Q2FA 4QGLA 3E97A 3KB5A 3DGTA 4HK9A 5T5PA 3S7EA 1C57A 5JOXA 1HRI3 1FYUA 5KBFA 3D82A 4AFMA 2DU1A 1LTEA 3ZXLA 1R091 1LOAA 2VMGA 1R1A3 1HRV3 2ZOEB 3AP6A 2A75A 2Z79A 3S0MA 1IS3A 1DFQA 1O4TA 2XL7A 4XDQA 5FFOC 4QU2A 1BQPA 1HV0A 4YVSA 2A6YA 4N9IA 3AP7A 3USUB 1DIWA 3E5XA 3J8F2 2FBEA 4P9YA 2D6NA 4V1PA 1YFYA 1RUE1 2NPIA 2PN5A 3WQ0A 3W9AA 1IPJA 2DU0A 5CFDB 4Q27A 1Q8SA 2DCTA 1NOVA 1IKQA 4I2OA 4H3WA 1H8TC 2WNVC 2BVBA 3H1MA 3JQXA 1UF2C 3VHOA 2P34A 3KSCA 2QZ3A 4N7UA 4PDWA 1XNCA 5HI0A 2JG8B 1ENQA 2A3XA 3ZN6A 1Y3TA 4INDA 1VBB3 3BOWA 3N3HA 4RR3C 2BEOA 2P37A 4GKYA 5FREA 3WDTA 4WVWA 1AL0G 4QD2A 3QBQA 5BNQA 1KFXL 1Z0HA 1WLCA 3O12A 1S0CA 4LBJA 1AYM1 1WLWA 1YYNA 3WCRA 4BIFA 4EN9B 3AYEA 1GZWB 1UW8A 2DVDA 4IXLA 1MR5A 4XJUA 5L36A 3ZFFB 4ZU5A 5JR7B 3RJRA 3B93A 2AH2A 5GM0A 5ABJC 1NQJA 4U2AA 3ILRA 2PHLA 3AZWA 2BTVC 2A3WA 3INAA 1HRV1 1NQDA 4Q4V2 2RR12 2Z69A 1OA2A 1S0BA 2DTYA 1PO22 1JHNA 1QJU3 4PLOA 2Y26A 4S2GA 1DYPA 4FOQA 4JV4A 1FOD1 1YHFA 4DY5A 1YRZA 1GZCA 1VBE2 4COUA 4DFSA 4OI4A 4E2QA 5JWPA 1WMEA 4JQRA 1W6OB 1MZ5A 4Q4Y2 1POV3 5ACA1 2AREA 3PMEA 4OI1A 1ULDA 1H9WA 2C5DA 3POYA 2BVVA 3TAYA 2X5IA 1MQTB 4META 4BIOA 4CDXB 1O3QA 4AGGA 4GWMA 1UU5A 4P9GA 1TNRA 1TEIA 1JW6A 1MS0A 2JG8A 4H7MA 4FOVA 1ZZCA 4PDWB 1TNFA 2E51A 3TN93 3VHRA 1QJY1 3QH6A 1IS6A 4KGQA 1BEV2 3UV9A 2B42B 3EO6A 1NXMA 2OW4A 4MX3A 1RUF2 3VKMA 3AZVA 1QJU2 2HYKA 3FHIB 3FLRA 1LEMA 5H9PA 3V0BB 1UL9A 4K7JA 5F9TA 1BEV1 3BODA 1LHVA 3DN7A 3B5LB 4XIKA 3JBG1 4BQ1A 4AQ6A 2UURA 1CR7A 1ZZ6A 2ET1A 5GZCA 2HWB3 4MV2A 2UY9A 4QPGC 2CNAA 1S0JA 2BFUS 1NCQC 1C8M1 1ZBA2 2RMU1 2YY1A 1R082 2ZGNA 3POWA 5GZGA 4GH4A 4S2DA 4N53A 3ZYIB 4R4XA 5IT6A 4DMIA 1AF9A 4XF9A 4Z07A 4QMAA 3ZYPA 4GQ7A 1OI6A 1ASJ1 3TN92 4WZFA 3AB0A 4CZSA 3NKGA 4IV1C 4TYSA 1AXZA 3M2MA 4NHKA 3UK9A 4FAGA 1PVC3 5CB7A 1OHFA 5KXEA 4JRAA 2UWBA 2O0OA 3JBG2 1VJ2A 1YJKA 4P9WA 5SV8A 3VBHA 2D6MA 2A7AA 1XE8A 2VPVA 2IXCA 2PQQA 4C1XA 3KT7A 5J36A 1AXKA 1HXS2 4Q0SA 3V64A 4AYUA 4FQ4A 4FPGA 1RUD2 4FVVA 4LUKA 2WNVB 4HT1T 4C91A 2XKOA 4C1WA 4AQSA 1E57A 4IEUA 3PVNA 2HWC3 1Q8QA 3IMNA 2WNUC 3UKVA 2Y38A 1GNZA 4YGBA 4CDQC 3TWIA 3IM0A 1RINA 3HQXA 2BGCA 1DZQA 2HWB1 3NL1A 2OUJA 2ZAHA 2QJVA 3M3CA 2G9FA 4CEYC 4LE3A 5AFEA 1RUOA 2E7TA 2WNEA 2YHJA 4AVBA 1UU6A 4WBBA 3RI9A 3PMSA 4Q0QA 1H9PA 3WHUA 3WINE 3B00A 5JCTA 3A4UA 1C8NA 4XQDA 3ZYGA 3QH7A 2RR11 1HRV2 4HSJA 4Q4V1 4FPFA 4AI3A 1AX1A 1DYKA 1RUC2 4IEWA 1VBD3 3WT3A 3CJIA 4GKXA 4H55A 1HQLA 2YXSA 3VBOB 1LGCA 2OZJA 2WZR3 2UWCA 3HT2A 3AKTA 3ILNA 3U4XA 3B7MA 2IC1A 4RA0A 4AQ2A 4MSVA 4MUVA 1BMV1 3NW4A 5FQ0A 4GXLA 3MLLA 4Y1XA 2H6CA 2VOWA 4RGGA 2UYAA 2WS93 2NLRA 3Q9OA 5BNOB 1RVF3 4JDMA 4ATFA 4M01A 5FCCA 3AFKA 2XWJB 4Q1RA 4XPVA 5C33A 1F5JA 4UBHA 5TSWA 4ZU7A 1AJKA 4XTMA 1RUG2 1CJDA 4YG0A 1NLRA 2WLPA 1LR5A 5K9YA 3KQRA 3TBDA 2GC1A 1QXJA 1G9BA 4FPHA 1DQ1A 2FQPA 5J3UA 1NCQA 3NSTA 1F2NA 1H0BA 1HRI2 1SLBA 3NKTA 1R083 3E5QA 1VALA 2B46X 3VKOA 4E4SA 4XBLA 1O7FA 1GR3A 3JB8A 2ILMA 4PLNA 3NO8A 2VNGA 4OULA 4MZUA 1O5UA 1NLSA 4MGYE 3ASIA 2DYCA 4FPCA 2XKPA 3ROUA 3RDIA 3AKRA 1CPNA 1VLNA 2DCKA 1PO23 1AR62 3G7DA 4QPYA 2ZGRA 1C5IA 4NR1A 3S30A 3ZVXA 1I1EA 5FPZA 2HWC1 2D97A 3VKNA 3IT8A 3FFQA 1LJ7A 4HLTA 2MEV2 1FATA 4TWTA 3ZIXA 4D3WA 3VZOA 3ZXEA 3GZAA 4Y1YA 5JMCA 4XHXA 4IV1A 4FSJA 4YGEA 5BXXA 5DZFA 4RQPA 4KWLA 1VRH1 1DDLA 4KU8A 4CDQB 2F6BA 3IBMA 4PIXA 2W39A 4NPRA 2QQPA 5GALA 2H0VA 4LBKA 2IXLA 2ZX2A 2D7FA 1TE1B 3SH5A 4LBQA 2ZPXA 1HQNA 4DXZA 4FCAA 2ZACA 1OA3A 2WFF3 2WT1A 4QGNA 4AVVA 1OA4A 5L73A 4BLJA 4AEDA 2CL2A 2HEYF 1NCRC 1A78A 2DCYA 1NE4A 2MEV1 4LBOA 4QPIB 5GZDA 3AXEA 4FPYA 3RWNA 1ZNPA 1G6NA 2XL9A 2D5FA 4K9SA 3T1MA 1I3HA 3A0NA 2ZHNA 2QUOA 3ZSJA 3VDDA 2NQYA 4L11A 5K7PA 1YIPA 1Y9QA 4FPEA 2GAUA 2ZGKA 5CG9A 4N90A 3WUDA 4LLFA 2VUJA 2EA7A 3HR9A 4G4FA 3CJXA 3NAPB 2UWAA 4IV1B 2DCZA 3CJIC 4TZDA 1LU1A 4ORFA 1FV3A 1FPN2 4GH4B 1OSGA 1RUC1 4E2GA 3ZXAC 2YDEA 5C6CA 1UMZA 4GA9A 4MH0E 1IS5A 1VR3A 2VULA 1PO21 4XJWA 4CEYA 4AF9A 1F31A 4Q4V3 3ZFFA 1FX5A 4YM3A 2IWGB 1M4WA 2HWD3 1H1IA 2W0XA 1C4RA 3H50A 1SLCA 2R071 2N7GA 1SLTA 1ND3A 4CDWB 5JIUA 3VZLA 3RYRA 1RUH3 1H30A 3LAGA 1RUG1 3FUOA 2JX9A 3VBFB 1J3RA 1EYBA 1YNAA 1RB8G 5C4WB 1WMDA 4IV3C 4FBFA 3WP5A 2VY0A 3AMMA 3VBUC 2RS32 1DGWX 1HXS1 1COV1 4WM8C 4COZA 4YZ2A 3AP4A 4BH9A 4OHXA 1AYN3 3HT1A 5BPXA 1B35B 4YZ5A 1MQTA 3LZZA 4JTOA 4JGZB 1DGRN 2ZHMA 5C8WA 4CP2A 2ES3A 4TSVA 1AL23 2ERFA 5JZGC 3LKJA 1YCIA 4I0WB 4YW1A 1IOAA 4RQPB 4BLIA 4A2UA 4QPGB 2XBO1 4AEDC 3NJZA 4WVZA 1RUNA 4XJ9A 1PZ7A 1LEDA 2IXKA 4LNVA 4JDNA 2A70A 2A5ZA 5A32A 1U5XA 5FAXA 4LEJA 4ZXKA 1G8WA 1I5ZA 3AKSA 1C28A 5JZGB 5L7OA 3CL1A 1AX2A 1LHWA 4I30A 2OA2A 4AWDA 2R061 1WD4A 1AYN1 1AYM3 3VBRA 1RIRA 1IQAA 4QPIC 5BY5A 3SH3A 1QJU1 2C0ZA 1YO8A 1QGLA 1H2NA 1JUIA 3O7OA 5KXBA 2VECA 3AYAA 2GNMA 4AVSA 2XHKA 4FTBA 4P14A 4RR3B 1LGBA 4LBQB 2I2SA 5CVRA 3GZTB 1CAXA 4Z92B 2RJKA 5CFCC 1RUH1 3PTYA 4XFIA 1PGSA 2OPKA 1RL3A 4I0AA 4GH4C 3SHRA 3WQ1A 4Y5Z0 1NXD1 2XLGA 3KLSA 1HXS3 1HDKA 4RGAA 5GJ6A 2LALA 1JTZX 2I74A 5A32B 3KCXA 2ZS6B 3PVBB 4I0BA 4K8FA 4IETA 3LWCA 5JVVA 1BJQA 1UKRA 5FO8B 1S1AA 5IK7A 2EF6A 3S6PA 5BNPB 2R32A 1BVVA 5I0RA 2HWF1 1MS4A 1QJX2 2D3SA 3HWJA 1O4ZA 3WG1A 4IEVA 1U5ZA 4M3CE 2PLV3 4R9BA 1A8MA 4D7TA 2XGXA 5D8AC 4N9HA 3RRDA 5J48A 2PLV1 1VBE1 1RUE3 4COYA 2QNKA 1W6PA 3HIFA 5EXOA 1OOPA 4CEWB 3ZSLA 1W0PA 1XYNA 2R063 1RJ7A 3NV4A 4WZCA 4W6WA 5DDJ1 3FMGA 2P3IA 1NY71 5JSOA 1Z7S1 2UU8A 3RS6A 5DG1A 4AI2A 3APBA 1KJRA 1R093 1ZYBA 4RS5A 2AENA 2PHUA 5LK5A 4PLMA 3BU7A 1S0IA 3TOJA 4YGDA 1QOTA 2FHRA 3H9AA 3IWZA 4AVAA 4LHLA 1R1A2 1YFWA 4BOWA 3WG3A 3VBRC 3V0BA 1PO12 1H8TA 2WIIB 3JD71 4I01A 5CBLA 1TMF1 1W0OA 2GC0A 5T54A 1RUJ2 2GN7A 2WS91 4HVQA 1RHI2 1Q3EA 2QCSB 2E63A 3E5UA 4HBNA 4Q4Y1 3OYWA 4FXGB 1GYKA 4B29A 1CAVB 3MIFA 4Q4Y3 4CP1A 4D69A 4NVPA 5I0SA 1REDA 2D5HA 1W39A 1CIWA 4AGRA 3W58A 1U0AA 5DZEA 5HCAA 2PYTA 2ZGMA 5I8TA 2JICA 4OUSA 4C90A 1G9FA 1HV1A 1DU3D 1QJZA 2D93A 5JLVA 1OOPB 2WSVA 4PIZA 1MS1A 1N3OA 5JZGA 3SCHA 1PK6A 5FLIA 1GZWA 4N53B 3KGZA 1VB4A 1UU4A 1UCXA 2VOXA 1G7YA 5A33A 3M3IA 2WKKA 5H9SA 3UL2A 4L9BA 3FLPA 3JD73 1GQGA 5DUWA 5JOYA 1X8EA 1MEC2 5C9AB 2DVAA 4FT8A 2GN3A 1SEFA 1PHMA 4HPKA 3N35A 1WW6A 1UX6A 1F5FA 4BHPA 5C8CA 1GICA 1FOD3 2ZX0A 2QDRA 1ZRRA 1A6CA 3CO2A 3PJQA 4XIOA 2D40A 4DY3A 1ULFA 2KA3A 1ZBE3 1ND3B 4JTNA 1KXGA 1CPMA 3AP9A 3KGLA 3RYKA 4KL1A 1DGRA 5FDBA 3SLIA 5IK5A 1SMVA 2VOVA 3WW3A 1X33A 4UW5A 1W6NA 4F83A 1SACA 3HMYA 1AJOA 3FC0A 2D98A 4X8NA 1KS4A 4FPJA 1BMV2 4YVSB 3URFA 3FX3A 4W65A 4F7ZA 3UJQA 3X29B 1RUE2 1V6LA 1BK1A 2ZHKA 2ZGUA 3GZUC 5ACA2 3OPZA 4YW2A 4XMIA 1X7NA 2Q4SA 1AVBA 1OD5A 2K9ZA 5CADA 4XXAA 3IDEA 3WXPA 3T1LA 4D7SA 3WZ1A 3VDDC 1DGWA 1U12A 5AVPA 2CY6A 2XJSA 4K3UA 1MS3A 3EXUA 4GMP0 4IEZA 4MXWA 3UJOA 2DFBA 2ET7A 3ZPYA 1R092 5J37A 4CTEA 1QF3A 3ZMOA 5BNOC 4RSUA 5I91A 3GHNA 4PF5A 4QQ2A 2IXIA 1BXHA 3DUIA 4HK8A 4D7YA 2RJLA 4OHWA 2DUOA 2WJSA 3H3ZA 1EV13 1CAVA 2DUQA 1RUC3 3BIWE 5C8CB 1IPKA 3ZXJA 1U5YA 1BZWA 1NCQB 1TME1 2GH8A 1Q56A 3RYPA 3ECQA 4Q0UA 5FQ0B 4XJ8A 1DQ6A 3WLUA 5AFBA 2ZTNA 1QQP3 3FBYA 3V56A 1ALYA 1RUH2 2DUPA 2XJVA 1AUYA 5FBZA 3GBFA 1R1ZA 2ZA9A 2JD4A 3ZFGA 1SQ4A 4YW3A