3VBUC

Crystal structure of empty human enterovirus 71 particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuC00
1NCQC 3VBFB 5LK7B 1PO13 4YVWB 1VBE1 3TN91 2RMU2 1FMD2 2GSYA 1AYN2 2PLV3 5CFDC 1ND3B 2WZR1 4JGZA 2WFF2 1IHMA 5K0UA 1OOPA 1PO21 4CEYB 2XPJA 4YVWC 1TMF1 5ACA1 1RB8G 5L7OA 4RS5A 2RS12 4IV1C 4CDUA 1ND3C 4GH4A 1VBA3 4N53A 1RVF2 3DPRC 1C8M2 1VBB3 3VBHC 1POV1 2HWE2 1ASJ2 1NA1B 2HWF3 1DDLA 1VBD3 1AR72 1ZBA3 1PO11 1QQP1 1AR63 1RMU2 1RUH3 1BBT2 1AR82 5A33A 5C4WB 5BNOA 2R063 3CJIA 1PIV3 1Z7S2 2MEV2 4FTSA 2WWSA 4Q4W3 2HWB3 4CDWA 4Q4V3 2WFF1 1VRH2 1F8VA 2R043 1GFF2 1ND2B 1BEV2 5C4WC 4CDXA 4JGYB 1V9U2 1VBA1 5A32B 2RM23 3VBRA 1HRV3 1AL22 3NAPA 1RUD3 1RHI2 1VBB1 4WM7A 1ND2C 1C8M1 2GH8A 1R083 1D4M3 2XBO3 2HWF1 1COV1 1VBD1 1ASJ1 1ZBA1 4CEWA 5FMOS 1AR71 2BFUS 1TME2 3J8F2 4QPIC 1RUF2 1AR61 5BNPC 1VBE3 3TN93 2HWD2 1B35B 4PDWB 4CDQB 1NCRB 1BBT1 1SMVA 1RUG2 5FOJB 5C9AB 4NWWA 1PVC1 3S6PA 1MQTC 4WM8C 2WZR3 4RR3A 1W39A 4Q4V1 3ZFEB 5ABJC 4Q4X2 4N43A 4AEDA 4IV3A 1VRH1 1HRI2 1TMF3 2X5IB 1B35C 4PDWC 4CDQC 4RFT0 1NCRC 4CEWB 1NCQA 3M8LA 2RM21 3JBG2 5BNNC 4Y5Z0 1HRV1 1F2NA 1R1A1 1VBC2 1AL21 1M06G 2RS52 5CFDA 2ZAHA 2FZ1A 1QJX3 1RUC2 5DDJ2 3ZFFB 5C8CB 2DF7A 4IV3B 4Q4Y2 4GB32 3J8F1 4IV1A 3VBUC 5JZGA 1AYM2 1QQP3 3JD72 5D8AA 2RMU3 4GMP3 2WS92 1HXS2 1FMD3 1RUG1 4QPGB 3ZFFC 1QJU2 3VDDC 3DPRA 3VBFC 3VBHA 2WFF3 1H8TB 1RUE2 1AR92 1E57A 4YVSB 1RUJ1 4Q4X1 2ZZQA 2RS13 1QJY2 4QPGC 1K5MA 3HAGA 5JZGB 1RVF3 1VAKA 4CEYC 1VB4A 4EJRA 1BMV2 1RUI2 4YVSC 1FOD2 1QJX1 1C8M3 4JGZB 2BBVA 5K0UB 1COV3 1OOPB 1ASJ3 5L7OB 4RS5B 1AR73 2RS32 5CFCA 4GB31 1CJDA 4CDUB 2RMU1 4GMP1 3JD71 1BBT3 1AR83 1FMD1 4GH4B 4N53B 4FSJA 1PVC3 4JGZC 3VBOA 1AYN1 1NA1C 2TBVA 5K0UC 2WS91 1HXS1 4RHV2 1OOPC 1EV12 2MEV3 4RS5C 1VRH3 1OPOA 1RUE1 1AR91 1X33A 5FMOL 2RS11 1BEV3 2BFUL 2RR12 4N53C 2R062 1PIV2 5CFCB 5BNPA 5A33B 1QJZA 1RVF1 5BNOB 4Q4W2 3CJIB 1R1A3 1AL23 1MQTA 2IZWA 1RHI3 4WM8A 1RUI1 3VBSA 2R042 3ZFGA 4CDWB 1WCDJ 1ZBE2 2HWE1 2HWC2 4JGYC 4RQPA 4CDXB 3CJIC 1TME3 3J8F3 1RMU1 1AR81 2BPA2 2HWD3 1PGW2 5BNNA 3VBRB 1RUG3 1VB2A 1Z7S1 3NAPB 1D4M2 2MEV1 1EV11 4WM7B 4CDXC 2R072 1POV0 1RUJ3 3JB8A 4Q4X3 1BEV1 5C9AC 4RQPB 3JB4C 1FPN2 1V9U1 3NAPC 3VBUA 5AC92 1MEC2 2WZR2 5J96B 3ZFEC 1RHI1 1PO22 2X5IC 4RR3B 1X36A 3VDDA 5ACA2 4CEWC 3VBFA 2QQPA 1RUC3 1C8NA 1ZBE1 5DDJ3 4N43B 4YVWA 4AEDB 1TME1 4Q4Y3 1OHFA 1NCQB 4GB33 1RUF1 1AUYA 1ND3A 2HWD1 1R092 3JD73 4RR3C 1AYN3 5C8CC 2WS93 1HXS3 1EAH2 4CEYA 1QJU3 4AEDC 4IV3C 5CFDB 1PO12 1HRI1 1RUE3 1AR93 2R071 1QQP2 3ZXAC 2PLV2 4IV1B 3LOBA 1QJY3 1FPN1 3JBG1 5D8AB 5AC91 1MEC1 1H8TC 2FZ2A 1NA1A 1VBC1 2RS51 1CD3G 1RUI3 3DPRB 1FOD3 1RUC1 5DDJ1 2HWE3 3VBHB 2VQ0A 5JZGC 1VBA2 4NWVA 4Q4Y1 5C4WA 4Y4YA 5D8AC 2RS33 1AYM1 1RMU3 1K5MB 1PGL2 1VBB2 1AL0G 1R091 2Y26A 1HQNA 1Z7S3 4LLFA 1QJU1 2HWF2 1COV2 1EAH1 1VBD2 4RHV3 5L7OC 4FTEA 1ND2A 1EV13 1ZBA2 4CDUC 2WLPA 1NY72 4BCUA 4JGYA 1RUH2 1AR62 1K5MC 4GH4C 5A32A 4QPIA 1PVC2 2RR13 1QJY1 2PLV1 1V9U3 5GKAC 2ZTNA 2HWB2 4Q4V2 3VBOB 1BMV1 1FOD1 5ABJA 5CFCC 1ZBE3 2HWC3 1B35A 4PDWA 4CDQA 5BNOC 2RM22 1NCRA 2RS31 1NG0A 5C9AA 1HRV2 1RUF3 3VBOC 1R1A2 1RUD2 4QPIB 4Z92B 2BUKA 5BNPB 4CDWC 1PGL1 1R082 1A6CA 2XBO2 3ZFEA 4RHV1 1MQTB 4WM8B 2X5IA 3VBSB 3ZFGB 4FTBA 1VBE2 3IDEA 1HRI3 3TN92 1NY71 2R073 5ABJB 1RUH1 3VBRC 2RR11 2R061 1PIV1 1FPN3 3JBG3 4WM7C 5AC93 3VBSC 1MEC3 4Q4W1 2HWB1 5BNNB 4GMP0 3ZFGC 3ZFFA 1VBC3 2RS53 5C8CA 1TMF2 1PO23 2R041 1RUJ2 4RQPC 3FBMA 5ACA3 1HX6A 2HWC1 4SBVA 1NOVA 4QPGA 1AYM3 1RUD1 3VBUB 1PGW1 1QJX2 1R093 5J98B 1R081 1H8TA 4N43C 1D4M1 2XBO1 4YVSA 1EAH3 1POV3 3VDDB
chains in the Genus database with same CATH superfamily
2VZVA 2N7GA 3POWA 1NCQC 3OGSA 4HPKB 1VP6A 4PLNA 4W4ZA 3RMXA 4UW6A 1JBCA 4JKLA 4P08A 3SKJE 4A45A 2DCKA 1RJ7A 1LHWA 2WNUB 2Y33A 3Q8FA 4ZU4A 4IEVA 1ZREA 4Q8LA 4FAHA 3SH3A 1FMD2 4AAXA 1MVQA 1AYN2 1HDKA 4RD7A 5FLJA 2VZ3A 2OW4A 2YGMA 2UWCA 5CFDC 4BK4A 5IVJA 5C9AC 1WBFA 3S30A 3HPNA 4EV0A 2VULA 3ZXEA 1NYWA 5FY1A 1CGPA 3I2GA 5K0UA 5JSOA 1OOPA 1PO21 2QZ2A 2Q30A 1MZ5A 1KS5A 4XFIA 4YVWC 2QQWA 4OFGA 4K1YA 5A3PA 3VGIA 3POGA 5FO7B 2IXIA 2JJ6A 3PL0A 2DFCA 2YBPA 3O5SA 3R4SA 4XJAA 4LBNA 4YW5A 1EUTA 3VKMA 4C0BA 5FQ0A 5A1AA 3DPRC 3G6JB 4RGGA 5DZEA 1PMIA 5GZFA 4Y5TA 3I97A 2VMHA 4PI0A 4E8DA 2C9AA 1UPSA 5T5LA 3BI3A 5IUQA 3MPBA 4HN0A 1POV1 2Y6LA 1KQRA 1QH7A 3THDA 3SISA 3GXUA 4OQ9A 2VQTA 3HQUA 1X9TA 2LS6A 4I30A 5F3EA 1PO11 2BGCA 2IVIB 3SXWA 1UO9A 1UXXX 4E4SA 5FZ6A 1RMU2 1RUH3 1BBT2 3NV3A 5A3OA 1CIWA 1D4VB 3DCQA 4D6SA 3NJYA 1AXYA 3CJIA 1HJFA 3B3QE 2MPFA 5FK8A 1R1ZA 3RZKA 2LALA 3R0RA 4OYUA 2RDQA 2A6XA 3LA7A 4FOVA 5FAXA 2MEV2 3VHRA 1UOJA 2BOIA 5DUUA 3WP6A 2WWSA 4YM2A 3UETA 1LEDA 3POSA 4Q4V3 5EXOA 2YY1A 2WFF1 1VRH2 2F17A 2GU9A 4EYUA 2R043 4LNVA 3HMYA 1DU3D 1GFF2 2YGLA 3I3BA 2ZX2A 3RGBA 2CWMA 5FYIA 3VUOA 5FY7A 1HB3A 4AGRA 3ACHA 2P34A 1WA4A 1TZOA 3Q8CA 5FDBA 1M4WA 4Y3OA 1G7YA 3NQHA 4V1PA 1AL22 4ZY9A 1RUD3 2A3YA 4YW6A 1VBB1 4FVVA 1GWKA 3UYJA 1ND2C 4CSWA 1W05A 3VD7A 1ZRIA 1W8UA 2E32A 2HWF1 4W6XA 4Z1VA 5J48A 4CP2A 4YW1A 4CEWA 2AUYA 1AR71 1GZWA 2PHWA 4QPIC 1OA3A 1AR61 2R16A 3D0JA 3W20A 2OUJA 4AGVA 1W9TA 4YARA 4CDQB 3A0NA 2P3KA 4BA6A 4YM3A 1QDCA 1PM7A 1RUG2 3OYWB 1DZQA 4WM8C 4IERA 2W46A 2WO7A 5AFEA 3HEIA 5LA0A 2QTWB 4DPNA 3OPTA 1W39A 1GANA 1NAEA 3AMQA 3RQ0A 2W68A 5FO8B 4X8PA 3JQWA 4CUGA 4ES9A 1YFUA 4ZXEA 3ZPYA 5AVPA 2HEWF 4Q4X2 5C6CA 4C90A 3PJYA 4EWAA 3HR9A 2G19A 3LQCA 1L3JA 3IDBB 4EWEA 2XR4A 1NCQA 4J1XA 4CCOA 5IFTA 3WF2A 2XL9A 5HV4A 4GWMA 2ADEA 2P6HA 4LO8A 2XJPA 2RM21 5BNNC 4IEXA 2ZGQA 2QQNA 1SLLA 3WDWA 3BTAA 1PM4A 3CIHA 4YZ4A 2R6QA 4DXTA 2D43A 2DV9A 2RS52 3AKQA 5CFDA 2J1RA 2OPWA 4YFWA 2LTNA 2JG8C 4PBOA 5FOBB 2E6VA 2UU8A 3FFZA 5GLVA 1RUC2 2R7EB 3AZXA 3E6CC 3FFQA 1DLCA 4GWIA 4QB6A 1WMXA 3VDBA 4ZS3A 4S2HA 5EWSA 4F3JA 4CRQA 2WYFA 1WW4A 1VPHA 2P3YA 2ZACA 4Q4Y2 3WG2A 1SLCA 4Q5OA 1IPSA 1O8SA 3SITA 5KHIA 1DQ0A 5IFPA 3RWKX 5J3UA 4NIGA 1SFNA 1H2NA 1O59A 2J1EA 2ZABA 2WN2A 4AG4A 2X53S 3JQXA 4FPKA 3DPRA 3T4VA 5JSPA 1WLWA 2Q8DA 5FP4A 4IESA 1LOFA 2B46X 4TN7A 4CVUA 1LEMA 5LWBA 4YVSB 1E57A 2GC3A 4MADA 5JI7A 3FLPA 1ULEA 2VY0A 3VD4A 3HNMA 4FPEA 5A3LA 1C4RA 5FIXA 3I3QA 2Z69A 2RDRA 4ARYA 5FFOC 1N1TA 4LKFA 1TNRA 4QPGC 1K5MA 3WF1A 2CNAA 3HOBA 4BXFA 4YG0A 3KSCA 1LOAA 4H7LA 3SEPA 2NM1A 2WLQA 3ZMNA 1VAKA 2NZ9A 4MYEA 5JXHA 2VZ1A 2DFBA 1ALYA 2CWSA 1H2LA 4RA0A 4JRLA 2JXAA 3A4UA 3OBZA 1O3RA 3DGTA 3MW2A 3TEXA 5IAVA 4C1XA 1W6MA 1U5ZA 1ASJ3 2V5YA 3KCYA 5GZEA 3SLIA 4BQ2A 1KRIA 5A3MA 4D69A 2VE1A 5L7OB 3D4KA 1SBFA 5EV7A 4L97A 2ZGKA 5HXVA 2RS32 3PLQA 4BMBA 2VZRA 5LBCA 4DY3A 5CFCA 4LIUA 5FZMA 4MHRA 4QMAA 3ZYGA 4AYUA 4XFFA 4GMP1 3JD71 2VNRA 3NV4A 4QDSA 3PVNA 4FSJA 4AI9A 5FJHA 2TBVA 4LJHA 2WS91 4RHV2 2VVDA 1RJ8A 1EV12 1ULGA 2WSVA 2KR2A 3MLLA 3N9NA 3LA3A 4OI1A 2ZS6B 2VNOA 1H30A 3ILNA 5FMOL 4DO0A 4A6OA 1ZM1A 2YYOA 1H1AA 2Z5WA 2RR12 2VG9A 4N53C 1GOHA 1W8TA 1HN1A 1Q8SA 1OH3A 3L2HA 2J1VA 4QX8A 1OA4A 4Q0PA 5J37A 5FYTA 3O0WA 5BNOB 1SEFA 1WCUA 3AXDA 1R1A3 2V4AA 3L9JT 4FPYA 4QXKA 4BYYA 5FY5A 3SEEA 5F5IA 4WM8A 1PVXA 1RHI3 1RUI1 3HQXA 1RXFA 4O9GA 2KXLA 2YDEA 3ZFGA 3B00A 1OLRA 4CDWB 4MGIE 1ZBE2 2HWE1 4AQTA 1S0CA 1SBEA 4B8EA 4RQPA 1APNA 3DKQA 1WA6X 1QXRA 4OLLA 1JU4A 2GP5A 4MGKE 5I8YA 2DVBA 1W99A 1W3XA 1GV9A 4Y1ZA 1AR81 2HWD3 4QKDA 5BNNA 5JR2A 5E88A 3VBRB 1XNAA 1JODA 1LJ7A 4WM7B 1UOBA 4S2DA 4YM1A 4IE7A 5KR7A 3EYPA 3NKGA 4XE9A 4F8AA 4FBFA 5CAZA 4LO6B 3WOGA 3A7QA 4AI0A 3NNFA 2ZJCA 4QHBA 5C8WA 1ZRFA 5A6QA 2WA4A 4FPFA 2D98A 4LQRA 1O6UA 3UJOA 3ZDSA 2WKKA 4QXBA 2ZEXA 5J36A 5AC92 5LBBA 3I7DA 2VMFA 2AACA 1XNKA 5KXCA 1PZ8A 3RYRA 2W1QA 3W58A 1HN0A 3N9QA 3KGZA 4NR1A 1PO22 3MIFA 5BXXA 3URFA 1JZ4A 4RR3B 1X36A 3UV9A 5IK7A 5HCHA 3LOBA 4HPKA 3KF3A 1QXJA 3LIHA 1C8NA 1Q8QA 2V4VA 5I93A 2WNUA 4AEDB 2JWPA 2PTMA 4WZCA 3UKNA 2J1UA 1DYPA 4GWNA 3B94A 3NNLA 1JYWA 1HQWA 1JN2P 1UY0A 2XLAA 2JDUA 1YIPA 2QUOA 5FZ1A 2X09A 3MUZ1 4UAPA 4WVMB 2VMCA 5IWFA 3LAGA 2EXHA 1ZX5A 4FFFA 3VKFC 2W2IA 3CZJA 1DBNA 4IE6A 1PO12 2AZ5A 2HBUA 1CPMA 4B1MA 4FP3A 3RNSA 3WF0A 3AKSA 1XNCA 3KCCA 3ZXAC 1DGWX 5FPZA 4BJ0A 4QXCA 4UW3A 4QQ2A 4CE8A 3LF7A 4L99A 3I2KA 2EA7A 5JCTA 3V64A 3JBG1 3AZYA 2VW0A 5F3IA 2DCTA 2VTXA 3G7DA 2AR6A 3NKTA 1MEC1 5E8AA 4NE9A 2XJQA 3CO2A 3MI8A 1PMJX 2VC9A 3H3UA 3O7OA 3SMHA 2GALA 2IXLA 1VBC1 2VOTA 3N7MA 1FX5A 5JDBA 1LTEA 2IFRA 2RJKA 3WSOA 2IXCA 5F9TA 1OUSA 1CQ9A 2UURA 4CUAA 2XMLA 3S0MA 1DG6A 3VL9A 3ZR6A 3POYA 1DGLA 2W92A 4NWVA 2WJSA 3HNBM 4FCAA 3OGJA 1Q8VA 2GMPA 4O7XA 1XOYA 2LW8A 4XFBA 3NV1A 1VBB2 1J58A 3UGGA 1GNHA 1AL0G 1DGWA 2K9ZA 3H1YA 5F37A 1MS9A 1HQNA 5LEKA 2BOJA 2Q4SA 1Z7S3 4FP2A 1QJU1 3K3NA 2HWF2 3PU8A 1WLDA 3M7AA 5L7OC 3BIWE 1N3QA 4FTEA 3OBAA 2WLPA 1GP4A 1NY72 2XL7A 5FY4A 3ZYHA 2ORZA 1AR62 4DNYA 4HSLA 1V00A 3M1HA 4RYDA 5EFUA 4CUBA 4NMIA 4YW3A 1K3IA 4H2AA 3C2UA 5GZCA 5FY8A 1JZ8A 2MNGA 1QJY1 1V0AA 1MS4A 2HWB2 3H3LA 4IEWA 2OVUA 3VBOB 1BMV1 2VUJA 1QH6A 4Q29A 2DTYA 2GZWA 1D0GA 4P5HA 4DFSA 3FHIB 5FZFA 2DU1A 2C26A 5L9BA 3U75A 5DZGA 2XG3A 3ZOIA 5ABJA 1I1EA 5CISA 1DYOA 1XB9A 4ASMB 4M01A 1YYNA 2E7TA 4CDQA 3B01A 2EIBA 2RM22 3POBA 2Q1MA 3J7HA 4AL9A 2F6BA 4NPRA 1UYYA 4KL1A 4Z82A 4EN6B 1RUF3 3HT2A 2GC0A 2WO1A 4MGSA 2Z79A 3AK0A 4Z92B 2E26A 1W6NA 5BNPB 1P8JA 1JYNA 1C57A 1C3HA 2YFZA 3T2OA 4CDWC 3PUHA 5IATA 5K9YA 1A6CA 1LOEA 2BV4A 1OMIA 3K2OA 2K46A 5FMCA 2ZX0A 5FP8A 5FXVA 1G6NA 5KC5A 1VBE2 1HV0A 1IGOA 1W6PB 3IDEA 2R073 4OUMA 4OZXA 3C7EA 4B3NA 1RUH1 1IS6A 4R9CA 3T0BA 1CIYA 2W95A 3VZOA 3POEA 2WIIB 3VBRC 2W91A 1UY1A 5ERLA 3LKJA 4OHZA 2RG4A 2WA3A 1LRHA 4H14A 4AEKA 2I45A 4WM7C 4HT1T 1O4ZA 2XXZA 1FNYA 1H1MA 2VJXA 3N35A 4PIZA 4QGLA 5FY0A 3U78A 3AKRA 5BNOC 5FKCA 1Q8PA 2XVLA 5J7MA 3D3AA 1TMF2 5JUVA 4QKNA 3WR0A 2R041 4YYOA 2WAAA 2A5ZA 2VOWA 3O14A 5ACA3 3GCWA 1WWYA 2HWC1 3K46A 2HYKA 2WRAA 1TEIA 2WO3A 3M3OA 4PLOA 1NZCA 5IVEA 4SBVA 2YB7A 2VL4A 4COVA 4BM8A 1QJEA 2KA3A 1HB4A 1S4CA 1UY4A 3KWVA 2WSUA 3OJBA 3PURA 4A4AA 1FATA 1YFYA 2JG9C 2ZA9A 1AYM3 2A3WA 1RUD1 1K42A 3DV8A 4FPGA 5A7WB 3VBUB 5A6XA 3I59B 1R093 5H9PA 4YVSA 1YUDA 1EAH3 5FZDA 2VOVA 2A73B 4AAPA 2DU0A 2WUHA 5ANNA 3AX4A 1ZNPA 2P2KA 2XWBB 4QHOA 5HPOA 4A7KA 1GOGA 4BZ4A 5CKNA 5HXMA 1JZ2A 1Q43A 2NP0A 3ECQA 4YVWB 4AF9A 4BU2A 1FT9A 1W9WA 1Z78A 3HD8B 3E5QA 2GSYA 2VVEA 4IQPA 2W52A 3OSDA 4ASKA 2PLV3 2VECA 4XBQA 1S0GA 3VKNA 4BQ5A 2LROA 4ZKTB 5JMCA 5M0TA 1OFNA 2D6LX 3I2OA 1ULFA 1FNZA 2RJ2A 5FR3A 2JDAA 1OBNA 4MGQA 3KD4A 3MF9A 5GLUA 1OSGA 2ATFA 5FZ4A 1RB8G 2D44A 3SH4A 2VOKA 4CCLA 4CP1A 1YCIA 2YU2A 2I2SA 3MFAA 5L7OA 1Y7BA 1CZTA 3BPSA 4A7ZA 1CONA 2RE9A 4BH9A 1W6QB 1OKOA 1VBA3 5JOXA 1DHKB 5T5JA 2JD4A 5JPNB 4LR4A 3SC7X 2J1TA 1RYYA 5A7PA 5FP9A 1C8M2 2WFPA 4A44A 3ETPA 1J3QA 1G8WA 1Y9GA 2QQOA 3IIAA 3IZOA 4XFAA 4Y20B 4LKDA 5TSWA 1CN1A 1H2KA 2HWE2 5D2AA 1C5HA 1TE1B 4IL7A 4D7TA 3B69A 3WUCA 1JHNA 4D7SA 1VBD3 5BNQA 4LA2A 5A6ZA 3WUDA 1QJFA 3K4AA 3UKVA 4HFSA 3GBFA 5LK5A 5DG2A 3RZLA 4TWTA 1YNAA 4UI9L 2XHKA 2O1QA 4PT6A 1ZYBA 4DB5A 1AR82 1UZZA 3AMMA 3SHRA 1MR5A 3I2JA 3ZXLA 5BNOA 2RJLA 2R063 3E1F1 4G4FA 1PIV3 3VZJA 5HBAA 3OBTA 2BQPA 2WT0A 3I49A 2BNMA 3M2MA 1LESA 3M70A 4CDWA 1OF4A 4MO3M 3ZN5A 3ORJA 4ITCA 3WNKA 1F8VA 2C9KA 1ND2B 4Q1RA 5GLTA 5JVVA 4B4RA 5C4WC 2VQAA 4COZA 3PUQA 1Y9QA 1UU4A 1AF9A 4JGYB 2V09A 2B8MA 4LLOA 2EIDA 5EYXA 3VBRA 1WLTA 3ZN4A 3ASIA 2FCVA 5JMOA 1CAVB 5CG9A 5A7QA 4WM7A 3KV4A 2GH8A 3UJQA 1R083 5FZOB 2Q8CA 1O4YA 2LUWA 2O14A 4NHMA 3WLUA 5DQ0A 2C5DA 5FO9B 3MO4A 1URXA 1ASJ1 3KV6A 1ZBA1 1WMFA 3INAA 2MHFA 2J7MA 5FMOS 3ACFA 3J8F2 3LEIA 4HN1A 5EYYA 5BNPC 4XEZA 1LKNA 1CZVA 2ARBA 2ZHKA 1NT0A 1N1YA 1O5UA 3TN93 3ZYJB 1WLCA 2ZGNA 1D2SA 1OPMA 2ARAA 5FYYA 3T30A 4AEMA 4XQ4A 3S6PA 5FUNA 5T55A 2IVJA 4I0AA 4RR3A 3QCWA 2W1WA 1ULCA 4YGDA 3ZFEB 5FYVA 4AEDA 1LHNA 4IV3A 4XPVA 1L7RA 5FJKA 2JG8B 3FWEA 2X5IB 3ZYFA 1NCRC 5FWJA 3RG0A 3WP5A 4ES8A 5EHDA 4WVVA 5H9QA 5KXDA 2DWRA 2JEMA 3UKTA 3ZR5A 3JBG2 1HRV1 3LDKA 4BQ1A 2VVFA 1UMIA 2XWJB 1R1A1 1GNYA 3IDAA 3K4DA 3MEPA 4QX2A 3VD3A 2OZJA 1VBC2 3ELNA 4WVMA 4YPJA 3WW3A 3R4UA 3POFA 2VMGA 1X50A 3H9AA 2RDNA 3AVSA 1S55A 2EXKA 3A23A 3AFGA 4LHLA 3AJYA 3NJVA 3SCHA 3BPZA 4TXWA 3PMSA 4LHKA 1DLLA 5LA2A 4GB32 2H6BA 1EPWA 1SLIA 3H0OA 5A7OA 4A3XA 1HV1A 2FQPA 4E4HA 3VBUC 4BOWA 2VQUA 3OD4A 5JZGA 1V6KA 2CGPA 4LXLA 2F4PA 4BIFA 1NX9A 3D5OA 3USUB 1HXS2 3BCWA 1FMD3 1NQDA 4QPGB 3ZFFC 1QJU2 2V73A 1SDWA 3GF6A 3WDVA 3TOJA 3RI9A 2D3SA 1XRUA 2GN3A 3HQRA 4LE4A 5JAXA 2XJRA 3IKWA 4KWUA 1RGSA 1H8VA 2YXSA 1H8TB 2CV6A 1GNZA 4KQ7A 1RUE2 1AR92 1OQ1A 1XXNA 3L2YA 4HVRA 4XF3A 1US3A 2W3JA 5L73A 4NIIA 3IMNA 5DUVA 2ZX1A 1QJY2 4CCEA 2ZKNA 3HAGA 4LEJA 3NSTA 2A6VA 5T50A 2ILMA 1NLQA 1XPWA 1LU1A 3N7KA 4PBPA 3HNYM 1BQPA 1OQEA 4TSVA 3U4SA 3WF3A 3QD6A 1BMV2 4XZUG 1KDKA 4JQRA 1YRZA 1W28A 1QJX1 1X8EA 4YLZA 1I9RA 1CESA 4NRQA 1C1LA 4WVZA 4IEOA 4P9XA 5KC6A 5KWRA 1KITA 1W04A 1GMMA 1UZVA 1SDDB 3OCPA 3AMNA 1BJQA 1WCSA 3LSDA 3UT0A 4OHYA 1MACA 3VL8A 3BOWA 1NKGA 4W50A 2W08A 4L9BA 5KHGA 1F35A 4W6WA 4AXOA 1SFYA 4NOTA 2Q0AA 4CDUB 2W1SA 2XKOA 4YW4A 1KJLA 2RMU1 5A7SA 1BBT3 2H6CA 2JB8A 4GH4B 4N53B 4Y1YA 2RDSA 1PVC3 1UKGA 4JGZC 4OMDA 4MUVA 3VBOA 1MZ6A 3PVBB 1U5IA 4GIQA 3IPVB 5EQUA 3KHCA 5C3RA 2CTVA 2E7QA 2W0XA 2MEV3 2R30A 1GU3A 2QKDA 5CG8A 4RS5C 1GQGA 5T54A 5LW9A 1DQ5A 1OVSA 4HXCA 5DUXA 4XHBA 1VRH3 2WDBA 1OPOA 1U12A 3HN3A 3MHZA 2ZEZA 3PMEA 1ZZ6A 1XNDA 2RS11 4UFHA 5CKQA 2CSGA 1S0JA 1VMHA 3IT8A 2YC2A 1S2KA 2JIJA 5BNPA 4B29A 4FOYA 1QJZA 2PN5A 3AZZA 4LULA 3FL7A 1RVF1 2QNKA 3ZMOA 1AL23 4LTAA 2IZWA 2ZHLA 3I2HA 5I91A 2R042 2CDPA 2VGDA 2O8OA 4FT8A 1QOSA 3ZX7A 3VDCA 3N36A 2HWC2 4JGYC 1OD5A 3FZ3A 4AOCA 3WT3A 1GKBA 2VMDA 3N7LA 3POJA 3KT7A 2I07B 4QPWA 4YNIA 4NAOA 1DCSA 2QJVA 4MGTA 1UKRA 3CF6E 4HANA 4ZU7A 1RUG3 4AGGA 1Z7S1 3KV5A 1WW7A 2DUQA 2OUHA 3M3IA 3O1PA 3UGHA 2R1DA 5G05L 4EQVA 4PJYA 3J9SA 1F5FA 3PUIA 1E5SA 1V6IA 4JC1A 2VW1A 4XURA 2ZOEB 4AHYA 4CDXC 4EROA 2CL2A 2VZTA 3F95A 1YQ8A 3JUUA 3MIGA 1HB2A 4B7EA 5GLWA 4DQAA 1POV0 1GICA 4Q4X3 5A1LA 1AX2A 1BEV1 1RXGA 1XU2A 2WT1A 1RUOA 4A42A 3R05A 1FPN2 4XBNA 4A41A 1UMHA 3NAPC 5FXWA 2YBKA 5A7WA 3VBUA 3ZXDA 3I59A 1DP0A 2VTXJ 4JHTA 4R8HA 3ZKYA 3HT1A 1PHMA 1SCSA 2VNVA 4KBBA 2ZMNA 3RWNA 3ES1A 3ZFEC 5J96B 1UU5A 4XC9A 4W8JA 3ZSMA 3W5MA 1DQ2A 2X5IC 4LBKA 4Y26A 4K3UA 3ZLIA 1G9FA 5FZEA 3VHOA 4RSUA 1XJAA 2FCUA 1CWPA 1OXCA 2QQPA 1RUC3 3AC0A 4N43B 4YVWA 3ZYBA 4AE2A 2E33A 1WCKA 1PNGA 2UYBA 1VJ2A 1TME1 2FHRA 4Q4Y3 5JIUA 1BVP1 1RUF1 3LDBA 4N9HA 4YSFA 4CP0A 3H1MA 3LD8A 3QH6A 5F6KA 4GKXA 4XF9A 1XQNA 1J1TA 2NMOA 1JZ7A 4QM9A 4Z8BA 4JZRA 2K0GA 5DZFA 4CPBA 2ZXQA 4JX0A 4FPJA 4QQOA 4XVHA 4B1LA 1UY2A 2BVVA 1BK1A 4QB2A 5E89A 4GXLA 3ALQA 1Q5OA 3B9IA 3GZEA 3MIHA 1REEA 1XYOA 1O8PA 1VMJA 2OYZA 5JOYA 1QMJA 5IVFA 5LRRA 3OBRA 1SACA 2R071 2IXJA 1W6QA 4ZPIA 1J3PA 3W5NA 1JS9A 3KMHA 5FYCA 4FAGA 1AJKA 3VV1A 4NIHA 1EYBA 1HJGA 1TG7A 3GZTB 3C7GA 4P00B 3IN9A 2V72A 4YZ3A 4KGQA 2WO2A 4AVBA 2WT2A 1H8TC 4Y20A 4BHPA 2W39A 4RFRB 1Z0HA 1V6JA 4FQZA 4TLFA 1KFXL 1LU2A 3OPWA 4XJ9A 1JHJA 2C0ZA 4XQDA 4K8RB 2AEZA 2OX0A 4XILA 3RZZA 5BV6A 5BY5A 4PQQA 3V0BB 2CAVA 5DDJ1 3KGLA 5FYZA 2ZZJA 1OC1A 4LO5B 1PX4A 1QDOA 2P3IA 2RV9A 3AYEA 4BQXA 4D7YA 4UBHA 3DXUA 3HBZA 3UESA 3KVAA 5D8AC 5J09A 4FXKB 2RS33 4ZXKA 4IEPA 1AYM1 2D3RA 4LBQD 5T5PA 2XJSA 2JE7A 2ZGTA 4QX7A 1GWMA 3KS7A 1R091 2BWCA 2Y26A 4LE3A 2OIIA 2D97A 4INDA 4CA9A 3FX3A 1EAH1 4RHV3 3RI8A 5JXGA 1ND2A 1EV13 1LHUA 1WMEA 1ZBA2 3BN6A 3K75B 4DXZA 4KNCA 4IE4A 2ERFA 4XDOA 3EHKA 4XF0A 5FXZA 4CDUC 3Q8EA 4BCUA 3B93A 3WDTA 4JGYA 3ZSEA 1BHGA 1V6LA 4MGYE 1LENA 1W0NA 4GH4C 2VH9A 4QPIA 1UX6A 4Q0QA 2D5HA 2RR13 5LRSA 1CAWB 2VZQA 4OVEA 2PLV1 1V9U3 1CAVA 2WZEA 4M3CF 4AZZA 1NE4A 4AVVA 4K1ZA 1F5JA 1VRBA 4BQ3A 1W2OA 4UFLA 3WP4A 5FZOA 4HOOA 2PHTA 2BBAA 2GDFA 1FOD1 2VM9A 4P02B 1YFXA 1YI9A 3FMGA 2XJTA 2Q8EA 3CKHA 4AHXA 2XJVA 1JW6A 4GWJA 2VOXA 4K6BA 1MZFA 3PJQA 1JTZX 1FV3A 2E63A 4JCKA 1ZBE3 3MGUA 2YG0A 3AVRA 3LFIA 3NL1A 5IVBA 5F8PA 2CYFA 5CBLA 1HRV2 3E6BA 3V0AB 1SZBA 2YHJA 2DCYA 3QLQA 1WUVA 1R1A2 4QPYA 2ARXA 3BTXA 4AQ2A 4JDNA 2BUKA 5KHHA 4YG3A 1W06A 3GDBA 1W90A 2WWJA 3B9CA 4I2OA 1NUKA 2O8QA 3GHNA 4UWDA 4Q27A 2XBO2 2B9UA 3H1WA 5G04L 3VD5A 3ZFEA 3M3CA 4FPHA 1MQTB 2JG8A 2WBKA 1OD3A 2X5IA 4GD4A 3RMYA 4URAA 2JE9A 1TQ5A 4Q1PA 1AVBA 1X82A 1PZ7A 4QDQA 2YC0A 3JU9A 2WQ8A 1ENXA 1HRI3 3N4MA 4UW5A 4CCJA 4LBMA 1RUNA 2R061 5KBFA 1PIV1 3MW3A 4OI4A 4XXAA 5AC93 2XUEA 3VBSC 2JDHA 4GMP0 2JG9B 2VD7A 5A6YA 4AFBA 1TNFA 1PO23 4LO7A 2SLIA 5DUWA 2BU9A 3H3ZA 1HX6A 3D0SA 4Z07A 3EB7A 3HIFA 2ZGMA 4JAAA 5FMDA 1XU1A 3CBNA 1LODA 4BIOA 3TYJA 3JZVA 4MH0E 3USUA 4QPGA 3H8UA 5IK8A 3ZN6B 2HJIA 1H2MA 2W94A 4NHXA 3MDPA 5J98B 1QJX2 2ENRA 4FPOB 4LITA 4OUSA 4J1WA 2VMIA 5I0SA 1R081 1HKDA 1H8TA 2ARCA 4N43C 3HBKA 4QKBA 3W59A 1Q8OA 1KGYA 1POV3 2I74A 5C71A 1K5JA 5IT6A 1O3SA 4COYA 5FK7A 4NUBA 5LK7B 4EZHA 1PO13 3ZXFA 2B7YA 3ZPOA 2E53A 5F2SA 1G9BA 4B7KA 3O1VA 1KJRA 3CQOA 5DG1A 3TN91 3GHMA 1BYHA 2RMU2 4OZOA 4UT5A 2A70A 4AVAA 5DXDA 4FFHA 3WNPA 1SLTA 2VBDA 3PNAA 4AEJA 2Y6FA 2A7AA 1C5IA 3VKLA 5I0TA 4HVOA 4Q0UA 2WFF2 4XACA 1B09A 1IHMA 3LFMA 1S0BA 3UGFA 3TB0A 1KFUL 1BCXA 2QBXA 4FOQA 2XPJA 2QZ3A 3AFKA 3FBYA 1U5YA 4UFKA 4CYDA 5FWEA 5H9RA 3UNPA 2VZUA 2RS12 4XQWA 2GP3A 4KI5M 2Y0OA 4CDUA 4ZS2A 2PELA 1AX1A 3J7MA 1ND3C 3VD9A 3P1IA 1CR7A 1UOFA 3H8RA 1MVEA 1VALA 4GH4A 1ONAA 1LGCA 4N53A 1RVF2 3MYXA 4D0QA 3W21A 3ZIXA 2C24A 4O61A 4XBLA 3O0XA 4QGMA 2P6CA 2XGXA 4F83A 2FDGA 1VBB3 4EZ4A 2R0FA 1SBDA 1BVVA 2K2SA 2PXJA 4Z2AA 1O4TA 4HG6B 1NA1B 2PHUA 4PLMA 2FDIA 3DYMA 2DYCA 5LATA 1YEWA 2HWF3 5FZKA 1DDLA 1NLRA 1AR72 3O1OA 4LA3A 4MOAA 4XTMA 3U1XA 4DEVA 4OMCA 4F7ZA 4QX3A 2XLFA 3AP4A 4JDOA 1ULDA 4KWLA 5BUVA 5IVCA 5C5UA 1DF0A 1ULPA 3THCA 3FHAA 1AR63 2ZEYA 3ZYRA 2Y34A 3FUQA 3THTA 5C4WB 2JD9A 1UW8A 1OH4A 1GP5A 2D7FA 1F15A 1H4HA 2E7AA 5CA6A 5FRAA 1Z7S2 3T2QA 1BKZA 2ZGUA 4RGAA 1VAMA 4EN8B 1PK6B 2EXIA 4IEZA 4Q4W3 2HWB3 4JKKA 3NRUA 1QEXA 1S0DA 3KT1A 5F6LB 3ZVXA 1A8DA 1I5ZA 3AYDA 4NRMA 1CAXB 1J84A 4AI1A 1JZ3A 1V6MA 4P5YA 5FPBA 3HN1A 3M3EA 1O3QA 1BEV2 2F4LA 2NN8A 3PTYA 4JV4A 1QF3A 1IPJA 3X29B 3OYWA 3PIJA 3AB0A 4XYXA 2PYTA 2RM23 4QX0A 5ANQA 2Y60A 5AVAA 5F7UA 2X05A 5T3NA 4LBOA 1OURA 3P6BA 3OY8B 2G1MA 3E5UA 2DUOA 3I3EA 4Y22B 1D4M3 4M3CB 2ZMLA 4HONA 2CAUA 3OPZA 1UIJA 5A1FA 5DAQA 2AYHA 3KQ4B 3SQOA 1EP0A 3CHXA 1QHDA 1TME2 1XYPA 3NV2A 5FYSA 4BB3A 1JU3A 1RUF2 2H0VA 5B4XA 1OLQA 2XB6C 1VBE3 3LA2A 3RVHA 2SBAA 3FLRA 4HZFA 4C91A 1NCRB 1W6OB 1BBT1 4PHZA 1ULOA 5A3NA 1CPNA 2GAUA 5SV8A 1PVC1 5C9AB 5FOJB 2DURA 1POQA 1MQTC 3I8TA 2P5BA 2WZR3 3C7FA 4QKFA 4H55A 1SFPA 4Q4V1 5JIAA 1XC6A 5I8SA 3WHTA 3MZHA 1JOJA 4P9WA 4AFAA 4N43A 1VRH1 3WG1A 3CEWA 1TMF3 2HEYF 1B35C 4PDWC 5FMBA 4CEWB 2R32A 3EJKA 2VCBA 3GM8A 4QQLA 1WZXA 2VUDA 2DVAA 4RN5A 1VLNA 2UYAA 3VN4A 4IGOA 4BISA 2JKXA 1CAUB 1F2NA 1O5LA 1IG0A 4WZFA 5DAPA 5FYMA 2JB4A 2PQSA 1TVGA 1AL21 3BUCA 2Z42A 1DIWA 1IZ3A 1UX7A 5DDJ2 3ZFFB 2J1SA 1S0EA 2WINB 2ET7A 4Y1XA 4EWDA 1W8NA 3RZGA 4CU7A 1LHOA 3BIEA 1HLCA 1REDA 3VZLA 1JUHA 2WWUA 4MZUA 4CXXA 1AYM2 1QQP3 3ILFA 4FPCA 1H1IA 1D2QA 3JD72 3SCGA 4NRPA 3BTYA 4CZSA 1G9CA 3FHQA 2VCMA 4GMP3 2ZKLA 2WS92 3LEKA 5T52A 1RUG1 3H8XA 1H9WA 5DAXA 5GLZA 2D40A 4MXWB 3CMGA 4HBNA 5FBZA 3V0BA 1XE0A 1A34A 2AEYA 3VHPA 2CY6A 1BZWA 3LCPA 4N7IA 1QWRA 4O9EA 4E27A 4LK7A 3WEZA 2FBEA 4Q4X1 2R49A 5IYYA 2J1AA 4Y24A 2YMZA 2XHNA 1ZZCA 3C7OA 1W3VA 3IAQA 1OLMA 2OA2A 2ZZQA 4QAWA 4B4QA 2FD8A 2VUAA 3NVCA 4E8CA 4H3WA 1JOBA 4N90A 2BNOA 3EMRA 5LASA 1YWKA 1IQDC 2FCTA 2XUMA 4KGGA 3ABZA 3PTRB 1NQJA 4BLIA 5LA1A 4DUVA 2WNVC 1VB4A 3U0ZA 4CU9A 1RUI2 5FZ3A 4CCKA 1FOD2 4XABA 5FZGA 3WQ7A 1C8M3 1RTVA 4JGZB 2BBVA 4META 2TNFA 4LOTA 1W0OA 1COV3 1ENRA 3MFCA 2DBIA 1GSLA 1YIFA 2L9LA 4I09A 1Y43B 1J59A 1OQDA 2A6YA 2GNDA 4RS5B 1UZYA 4YGEA 1BXHA 1CAWA 2GNMA 2ZEWA 4HMZA 4LK6A 1GUIA 2AENA 1NLSA 4DEQA 1OKQA 4QXHA 5JOWA 4CTEA 2Y8KA 2EIEA 2ETEA 4XHXA 4JTOA 1AR83 2YBSA 1XSRA 4XJ8A 2B5HA 1OLME 2WNOA 3WNNA 1NA1C 4D6RA 3WW1A 5K0UC 4XOGA 3BOPA 5AFBA 1OOPC 4UFJA 1PNFA 5L36A 5D1IA 2D5FA 5FXXA 3S5QA 3T08A 3AMPA 1WW5A 4QX1A 4BMEA 1LOGA 5CEHA 3OUJA 3S7IA 1DGRN 3CU7A 1J83A 1X7NA 4UF0B 1LNSA 1UQXA 4K21A 2BFUL 1W2NA 4Y33A 3V0AA 2R062 3LPGA 1PIV2 2NMNA 2XVGA 5CFCB 1PK6C 3RJRA 5A33B 4IGQA 2VZPA 1DQ6A 3PIGA 4LORA 1YHFA 2QQUA 1MQTA 2EALA 4IXLA 5FPXA 1O3TA 4LHSA 1ZRDA 3CNAA 1WCDJ 1XE8A 3FC0A 5ISLA 1Q56A 5FYUA 4XFCA 1N3OA 3OB8A 1LGNA 4R4ZA 4R9BA 5I0UA 3FUOA 4CDXB 2KM2A 1ZZ8A 3CJIC 3SH5A 1IPKA 3J8F3 3O1MA 2BNNA 4LUKA 3BTZA 3KCXA 3N3HA 3T09A 1X8MA 4YZ5A 4ORFA 4U2AA 1VR3A 3AP9A 1KS4A 1RINA 4PF1A 2JG9A 4M00A 4E2GA 1Y3TA 1DZRA 3NAPB 1W9SA 1I5PA 1UOGA 4QB1A 3WVJA 4YW2A 5F3CA 2JDKA 1EV11 2FDHA 3KHBA 2CGOA 2A71A 3I3DA 5JLVA 2GC2A 2HLEA 2TUNA 3KLSA 2XQXA 3B02A 4QWNA 3TAYA 1RUJ3 3JB8A 4QDRA 4HKLA 5FZ8A 4ZU5A 5C33A 1UCXA 2YFUA 3C3VA 4JTNA 4RQPB 3JB4C 5A7NA 2ADDA 3P3PA 5DPNA 1PGL2 3LE0A 3ZN6A 1V9U1 4KG8A 3KVBA 5GZGA 1MEC2 2BERA 5DAWA 5FP7A 1E5IA 5EPAA 1IKPA 1W8FA 3NJXA 4ATFA 2IXKA 2IUWA 1YQ6A 1XBFA 3ZSKA 1QOOA 1RHI1 4X6RB 3RPQA 2X8KA 3EQEA 2R0HA 1U5XA 4CEWC 4NJ4A 1W8HA 3LSEA 4XCAA 5FP3A 4CUCA 3ACIA 4AI2A 1QY4A 5FPUA 2B9VA 3AYCA 1ZBE1 3GGLA 2YPDA 1PGSA 3T1MA 1JZ5A 4PI2A 4M4PA 1OHFA 2DCJA 4GB33 1AUYA 2BP6A 3GCXA 2BGPA 4GALA 5CNAA 2HWD1 4BDVB 4L92A 1MS1A 4AQ6A 5EJ3A 3W9AA 1L7QA 1AYN3 3PVOA 4HVQA 3WG3A 4P9JA 5K8SA 3S5AA 1HXS3 2Q5TA 4K40A 2BWAA 2QQIA 4XXPA 1S0FA 2H0BA 3R4DB 1QJU3 2VNGA 4XTPA 3H7JA 2FMDA 3V65A 1CX1A 1GQPA 2ZGLA 3K4ZA 1F4HA 1BK0A 1Y9MA 3KF5A 1HRI1 1RUE3 3ZM8A 1AR93 5T5OA 3WP3A 2PA7A 3T4HB 2GN7A 3H8OA 4XDQA 5IVVA 1JYXA 2Q8OA 4AWDA 2E51A 3LDRA 1SPPB 1LOBA 1OF3A 1WGPA 2XH6A 4IEUA 4IV1B 1YJKA 1LHVA 1NXMA 3GNEA 1QJY3 2JE8A 3ME2A 4LKSA 4NO4A 4X8NA 2X10A 5D8AB 2AH2A 4FPLA 4XAEA 5AC91 2VCAA 4GKYA 2FZ2A 5FPVA 1YFWA 4ATEA 1NA1A 4KH9A 5JXJA 3TEYA 2OPKA 2C6SA 3BKZA 1EPZA 3MIBA 4I0BA 2VXJA 2AC1A 3VBHB 2VQ0A 2JDZA 3ETQA 2C1FA 5DAVA 5BYNA 5C3QA 3KM5A 2JIGA 1GR3A 5FLHA 3CJXA 5C4WA 1DQ1A 3VDAA 4QD2A 4L8QA 4OCTA 2OZ6A 5IAXA 4G9SB 3T2PA 4URTA 1WD4A 4E4ZA 1RMU3 1PK6A 3NJZA 4DXRA 2VZSA 2VXRA 3O1RA 3B7MA 2BGOA 1EUUA 4CXWA 3M4FA 1YXWA 1LOFC 4LLFA 3WNOA 3JXSA 5IVYA 3ZYPA 1CAXA 1YC61 2D6OX 4UXAA 4XUPA 1AXKA 2EIGA 3D6EA 3M3QA 3VLBB 2QCSB 1JI6A 1KDMA 4QQPA 4XIOA 4BPZA 1RUH2 4LOSA 3ACGA 1K5MC 1UZ0A 2G9GA 4DRVA 3PU3A 4CCCA 5L9RA 4BQYA 1PVC2 1W0PA 1X9PA 4Y1UA 3I2IA 2QQJA 1A78A 4FOWA 4Z2WA 2ZTNA 3WHUA 4LBQB 2A1XA 2JDNA 3A22A 3OY8A 3MF6A 4M0HA 4Q4V2 2YROA 5K7PA 4Y22A 3QBQA 4M3CA 1GBGA 1V70A 2NYYA 4EN7B 4KU7A 2A3XA 3ZXGA 1F31A 1UPIA 2C4XA 4KBZA 2WN3A 4N7UA 1W6PA 5CFCC 2LRPA 2HWC3 2EICA 4ZZ5A 4XUTA 3N9PA 1NCRA 1W6OA 1UU6A 3LEMA 5C9AA 4QQHA 1RUD2 5FCCA 4BWOA 4K8FA 4U36A 4AQSA 4DIQA 4QM8A 3MW4A 1PGL1 3NNJA 3ZO0B 5C7GA 2QDNA 3TWIA 1T6BX 2JECA 1W2UA 2HBTA 4K9SA 3DYOA 3ST7A 1AX0A 5JWPA 2A6WA 5C5TA 3VBSB 4DY5A 2BW8A 3WINE 4HLTA 4FTBA 3K77A 1E5RA 5F5QA 4M3CE 2WZPP 4LIVA 5HCAA 1GZCA 1NY71 3DUIA 3MV11 4QX5A 5CZKA 5ABJB 5HCFA 2Y6GA 4UYBA 3T3YA 1QNYA 3MIDA 3AMHA 4FXGB 1CAUA 4XJZA 4I3PA 2NLRA 2W5FA 2CHHA 2Y6JA 3RYPA 1FPN3 1R64A 3P3NA 3THPA 3RZJA 4XMIA 4C1WA 2W87A 3RSJA 1W6NB 4Q4W1 2HWB1 5LB6A 3K48A 4RGKA 3WW4A 2BVBA 3ZFGC 5EIYB 5I8TA 3ZFFA 2QQVA 5I0RA 2RS53 4FQ4A 2HYXA 1W03A 4RQPC 1H6YA 4JKMA 3GALA 5CB7A 4AW7A 2D6NA 3OEAA 1G86A 3FN9A 3DYPA 2YV8A 4Y4RA 2JX9A 4ISQA 3AYAA 3GBWA 3ZDVA 2VZOA 3N9OA 1GQHA 5FUPA 4LBLA 3VZNA 2HH9A 3NWKA 4MXWA 5K4LA 4P9LA 1PGW1 4A6SA 3T1LA 3AP6A 2VTFA 1ENSA 1UIKA 4KMQA 1D4M1 2HEVF 1H9PA 2PHDA 1F4AA 1LGBA 4G3YC 1WMDA 5FZHA 4YRDA 3VDDB 4D3WA 1JZ6A 4XDPA 2VUCA 1J3RA 3VBFB 5L19A 2Z4FA 4GJYA 1JH5A 4LPLA 4BQWA 2ZGRA 1UYZA 1VBE1 1LAJA 5C70A 1G9DA 4OQ8A 3EBRA 4IUGA 4I3GA 1US2A 2YC4A 4XJUA 4AI3A 2B42B 2XOMA 3OEBA 4QU2A 1ND3B 5FYBA 4CXYA 3MLJA 3VZKA 2WZR1 3AM2A 1RITA 4JGZA 4D94A 2B45X 2CU5A 4MX3A 4N8MA 3T0DA 1MZEA 1YO8A 4BLJA 1H0BA 2OXBA 4CEYB 3OOXA 1MS8A 3FE5A 2WNUC 4IEYA 1TMF1 2B39A 3I2DA 4Q0VA 5GJ6A 5GZDA 5ACA1 4RS5A 3KZ4C 4IV1C 2X29A 3UL2A 2ZGOA 3Q8AA 5JPMB 4GAZA 5L9VA 4XUQA 5EJ1B 4CU6A 1AZDA 1JUIA 2WAOA 3LGRA 1UF2C 3WCRA 2QVSB 1BLZA 1ZZBA 1C28A 3O12A 3TEZA 5F3GA 3NO8A 1UAIA 2TEPA 4W65A 5E16A 2EXJA 5FPAA 3WF4A 3WQBA 4RL7A 2XKPA 3VBHC 3ZXKA 2PAMA 4S2FA 4XMAA 1ASJ2 4GZ9A 3N7JA 1JMUB 2W1UA 4J25A 3IB3A 3TNQA 4UF0A 1D7PM 3ZKUA 4IETA 1ZBA3 3OGRA 1MS3A 4I0WB 1S0IA 1WCQA 4XF1A 3WG4A 4CU8A 4YW7A 1QQP1 2VW2A 2YUEA 2CGNA 5IHRA 5A33A 2Q1FA 2PQQA 3GYDA 3J26N 1HB1A 1S2BA 5A80A 1OUXA 1SLAA 1W9FA 4LKEA 4CCDA 2ZPXA 2ES3A 4FTSA 5F5AA 1PZ9A 3DECA 2FMYA 1UZWA 2UY8A 4FFIA 1UXZA 2VCCA 4KU8A 1UNBA 4AHZA 3RJ2X 4YZ2A 2D6KA 2NPIA 3WD5A 3ZSJA 3ZYIB 1U0AA 1CJPA 4C0HA 4CDXA 1OA2A 2G9FA 2ZCWA 4IE5A 2DVGA 3FJSA 4GULA 2ORXA 1V9U2 4LHNA 1VBA1 3EO6A 4E2QA 5A32B 4AVSA 1H6XA 3LWCA 1WW6A 1VE0A 1HRV3 3NAPA 3POIA 3RRDA 2Y6KA 1RHI2 3CL1A 3VHNA 2G9ZA 1A8MA 3O1TA 4L0PA 1YJLA 1C8M1 2XBO3 4XFHA 1COV1 1VBD1 2ZGPA 3MV01 5A70A 5LY1A 3A0KA 3DL3A 2BRTA 2QQLA 4XW3A 3TEWA 2BFUS 3AKPA 4I02A 4NROA 3U37A 2Q1ZB 2B4KA 1N1VA 5FZ0A 4AHWA 2PHLA 2HWD2 4PIXA 1B35B 3IBMA 4PDWB 4Q0SA 1SMVA 3OUHA 1KXGA 4NWWA 4KG0A 1LR5A 3KT4A 1FXZA 4KWKA 1L7LA 1SQ4A 4NPMA 3IIIA 3AZVA 4Q2FA 5FTTC 2BJSA 3ON7A 3PVEA 1YQCA 2WZ8A 4XETA 5FUIA 4COWA 1ODMA 3T0AA 3WZ1A 4A7YA 4AFDA 4UFMA 4MSVA 4H7MA 1IS3A 2WR9A 4OHWA 1WKYA 1SHWB 5JR7B 4DS0A 2J22A 5ABJC 5LZ6A 1HRI2 4R9DA 4RFT0 3TRSB 4CDQC 1XSQA 5CYYA 2PHFA 3M8LA 5JI9A 1C1FA 3C8XA 3WNMA 2IXHA 2ZBJA 3MIEA 3PDQA 3I2FA 3ATGA 3NW4A 2DBNA 4OI0A 3H50A 2OQ6A 3VB9A 2Y64A 3S7EA 3RFRA 2BDRA 3ACLA 2NQYA 4Y5Z0 2FDFA 4S2GA 2ZHMA 2RVAA 4LO4B 1CX4A 5FZ7A 1M06G 4XJWA 2R1BA 1T6GC 2ZAHA 2D6MA 2D3PA 4OHXA 1UL9A 2FZ1A 3BODA 3H42B 1QJX3 1ZZ9A 2VBBA 4GQ7A 4MHUA 3CLPA 5GM0A 4AK3A 1H4GA 5C8CB 4Y1VA 2DF7A 2BZDA 3J4UH 4IV3B 3WX5A 2JDYA 4CP9B 1FI2A 2V5DA 4M0NA 4P14A 1SPPA 4D6QA 3J8F1 4IV1A 1PX3A 5KXEA 2JKBA 4DZGA 4L2NA 5D8AA 1FV2A 3B5LB 4N9IA 1AXZA 2OKXA 2RMU3 1GZ9A 2DDUA 3BGAA 4ZHNA 3DEMA 3DF0A 3QACA 5CU1A 4YM0A 1O91A 1WBLA 4WBBA 3VDDC 4AR2A 4DUWA 4DOUA 2ZMKA 3O0VA 3V56A 2BYVE 3VBFC 1IKQA 1GZTA 2DTWA 2WNVB 5FYHA 3VBHA 4W6YA 2WFF3 4C8DA 1JXNA 1IOAA 5H9SA 1GYKA 3VZMA 1IS5A 1RUJ1 5SV5A 3MBWA 1K12A 3IWZA 2KD7A 2P4EA 3RDIA 2RS13 3PUAA 3LOIA 5F2WA 5IJRA 1UMZA 3GZAA 4EN9B 3BYWA 4ISRA 1G9AA 2D6PA 2WABA 1I6XA 1KD7A 2OQ7A 5JZGB 1YQ2A 2WL1A 4BXSV 2XJUA 3AXEA 3GBGA 1SLBA 1RVF3 3IPVA 4MXVA 1ZA7A 3WCSA 2FDJA 4A3ZA 4CEYC 4EJRA 5HV0A 1HIXA 4DINB 4JQTA 4PF5A 4YVSC 3T2TA 4TTGA 4DRRA 3DKWA 3OF1A 3AKTA 5A3WA 5B2GB 1FYUA 4MV2A 3WNLA 3PUSA 5K0UB 4BQ4A 1OOPB 1XNTA 2EVXA 3PHMA 5FPLA 3IMMA 4OI2A 4EE2A 4PIYA 1Q3EA 1STMA 3I3MA 1AR73 2RHPA 1UY3A 2VPVA 4B4PA 1NE6A 1WD3A 3AP5A 3J7NA 1CJDA 2P3JA 4GB31 5JOZA 4R4XA 5LBFA 1AHSA 4LBQA 4M4RA 2QDRA 4CCMA 1FMD1 5B4NA 2E9QA 1VAVA 2DCZA 4NIDA 1AYN1 3AP7A 1ENQA 2IFWA 2WNEA 4OHVA 5F39A 1HXS1 5FQ0B 3ZIWA 5APAA 3WQ0A 1NZIA 5F5CA 4ASLA 4GJZA 1CVNA 4JRAA 1JYIA 3GZUC 1YI7A 1GP6A 1RUE1 2QE3A 1AR91 4BK5A 1X33A 3N9MA 1BEV3 4IDZA 4LUMA 2ET1A 2PAKA 5EP9A 1N3PA 2DVFA 1DQ4A 3CZUA 1EY2A 4J6GA 3WQ1A 3VKOA 3Q9OA 4Q4W2 3CJIB 4ARXA 1JYTA 2ZX4A 3ZXJA 1RL3A 4O65A 1IQAA 4TLGA 3WV6A 4K7JA 2AGSA 4MVTA 1ST8A 3VBSA 4QHZA 3U14A 3MICA 4FI9A 4IEQA 5A3UA 4Q8KA 4MLOA 4YGCA 3WY6A 2ZAAA 3JCIA 5JXIA 3KV9A 3LPFA 3S57A 1XE7A 2YPJA 3QH7A 3SKVA 3DN7A 3BALA 1ZVFA 5FREA 1TME3 5C3OA 1UYPA 1GOFA 1RMU1 3MUY1 4PCRA 2BPA2 5FZAA 1PGW2 3SCFA 2JENA 3HWJA 4ZONA 4KWJA 2XQRA 3D8CA 1VB2A 3OD0A 2A75A 1D4M2 2MEV1 2JICA 3KQRA 1IS4A 5DABA 4HL0A 4NVPA 5FV3A 1LB2A 1N1SA 3C7HA 1REFA 1VMFA 2R072 5I0DA 3TBDA 2D93A 1J1LA 1ODNA 1GZWB 4DMIA 1QGLA 2Y0IA 4NAMA 4V2WA 1UYXA 1D0HA 2W47A 2XVKA 2WZR2 5J1XA 2A6ZA 1DFQA 4XFGA 4XUNA 3OGGA 2W9XA 3K51A 5DN2A 2VMEA 3F2ZA 3VDDA 2JDPA 2OS2A 5ACA2 2VU9A 2YZ4A 3VBFA 4R52A 3A21A 4NN0A 5FZLA 2J42A 2EF6A 5BPXA 5DDJ3 5FY9A 2O0OA 1W9YA 1W8OA 2YU1A 4P9YA 4IW3A 1MS0A 1NCQB 1A3KA 1YLLA 4YZ1A 4AVCA 4P9GA 2FDKA 2EAAA 1ND3A 4HSJA 4ONUA 2PHXA 3MPPG 1R092 3R6SA 3JD73 4RR3C 3ILRA 4LBJA 3BU0A 4I01A 2P1BA 2WS93 4NHLA 1EAH2 5CKMA 5C8CC 1DZTA 4CEYA 1SG3A 3O1UA 3ROUA 4AEDC 4IV3C 5CFDB 1XNBA 3ES4A 5KHKA 1DGRA 3LZZA 3OUIA 1N47A 3AJZA 2G4IA 1LOCA 4K20A 4QGNA 1QQP2 5FLIA 4E4DX 5GALA 4XF4A 1FAYA 3N9LA 1LCLA 3CDZB 4WVWA 4A2UA 2CDOA 3O1SA 3IDCB 2PLV2 4UBGA 3OG2A 1OT5A 2P37A 1FPN1 1OI6A 3KB5A 1W8WA 4TYSA 3RYKA 4YFZA 5FZ9A 3AZWA 2GNBA 2VO5A 3BVCA 4DUXA 3P5BA 5LCWL 4NIAA 3DXTA 3U07A 5LBEA 2RS51 1CD3G 2JDMA 3FLTA 4ZZ8A 1RUI3 3DPRB 4HKOA 3SNMA 1FOD3 3WDXA 4ET7A 1JYVA 1RUC1 4NHKA 1VIWB 2VAUA 2HWE3 1O7FA 2PMWB 4UW4A 4TZDA 5HI0A 1IG3A 2LM3A 5JZGC 3H7YA 1VBA2 4Q4Y1 3WW2A 2Y6HA 1QIQA 4Y4YA 5IK5A 4MG2A 5C3PA 5KXBA 3BB6A 4OUEA 1W2TA 1K5MB 1QXPA 1UN1A 2EAKA 1T2XA 2AREA 4BE3A 2BTVC 4JDMA 4YWAA 4CCNA 3I54A 1UWWA 4FO9A 1COV2 3APBA 3AL5A 1VBD2 5CIRA 1W2AX 1PMHX 3IM0A 5LY2A 4D8MA 4XUOA 3RZHA 4LMFA 2WQZC 3GJAA 1HW5A 4AFCA 1W6MB 4AVTA 1RIRA 1V6NA 5FBJA 1S2EA 2QQKA 4PQ9A 5CVRA 3BU7A 4HKWA 4QU1A 5EJZB 5EZWA 5A32A 5FZBA 5JSRA 3MLKA 4E9KA 3E97A 2VR4A 2DVDA 2DUPA 5GKAC 3LEGA 4L11A 4P9IA 4X6QB 1F9KA 5HCBA 4EN0A 2E31A 1QU0A 1XYNA 2UY9A 1I3HA 2XLGA 5F1RA 1ACCA 2ZHNA 3HVDA 1ZRCA 2GH2A 3RS6A 1ZRRA 4WV8A 4JHZA 5CADA 2WQ4A 3U4XA 1B35A 4PDWA 5KHJA 1AJOA 2XONA 2GC1A 3WDYA 2GMEA 5F32A 2RS31 1NG0A 3ENRA 3OGVA 5FZIA 4DXSA 5LEJA 1JOPA 3VBOC 2IWGB 2QQMA 4QPIB 1QNWA 4HK8A 1K45A 4XIKA 2UWAA 3U11A 1R082 2ID4A 2HKXA 2WC2A 3Q8BA 4MGZE 4RHV1 2XDVA 1HQLA 1OVPA 4IGPA 4WM8B 1UD1A 2BEOA 4HK9A 3E5XA 1LULA 4YGBA 3TNPB 3ZFGB 3WNXA 1E5HA 3J7LA 3U10A 5C3SA 4XZPA 3TN92 2QFEA 4JVAA 4XCBA 3UK9A 3USSA 3IAPA 2RR11 3GJBA 3NNGA 3ITQA 4GA9A 5FZCA 2PAEA 4FFGA 3I4IA 4UFIA 4HETA 1GWLA 4OULA 4Q26A 5D21A 3JBG3 3WXPA 1S1AA 3HJRA 1QKQA 3LB9A 1MEC3 4NPLA 1GLHA 5BNNB 1YQ5A 1MS5A 4UOJA 1ZA4A 3LIGA 1Y4WA 1DYKA 1VBC3 2GNTA 3NNMA 5C8CA 2PHRA 2P17A 3AL6A 3NMBA 3OTFA 5FKBA 5IK4A 3K3OA 1RUJ2 1KEXA 2PFWA 4R9AA 4XAAA 4CP9A 3FBMA 5IW0A 2VBPA 5LA9A 4E2SA 5DMYA 4SLIA 3RZMA 3QOPA 4V2VA 1QOTA 2WYSA 3WDUA 2GMMA 4QT6A 1MPXA 3D82A 5E6HA 1JYCA 1NOVA 1V6OA 2OT7A 4YG6A 4AFMA 1NXD1 4AI8A 1LECA 1ZZ7A 2ZGSA 2Y38A 2Z2SB 3E6DA 3EXUA 4CPBD 5A3TA 1CZSA 2WNVA 4Y5SA 3ZSLA 4LT5A 4NHYA 1OFSA 2IC1A 2XBO1 1SCRA 2ZX3A 1W8ZA 1RC6A 5E1RA 4COUA 2UWBA 4IE0A
chains in the Genus database with same CATH topology
3POWA 2N7GA 4PLNA 1NCQC 4HPKB 5CA6A 1VP6A 3RMXA 4UW6A 1JBCA 2DCKA 1RJ7A 1LHWA 2WNUB 4ZU4A 4IEVA 1ZREA 4Q8LA 4FAHA 3SH3A 1FMD2 1MVQA 1AYN2 1HDKA 4RD7A 5FLJA 2YGMA 2OW4A 5CFDC 2UWCA 1WBFA 3S30A 4EV0A 2VULA 3ZXEA 1NYWA 1CGPA 5K0UA 5JSOA 1OOPA 1PO21 2QZ2A 2Q30A 1MZ5A 1KS5A 4XFIA 4YVWC 4OFGA 4K1YA 3VGIA 5FO7B 2IXIA 2JJ6A 2DFCA 4XJAA 3O5SA 3R4SA 4YW5A 4LBNA 3VKMA 4C0BA 5FQ0A 3DPRC 3G6JB 4RGGA 5DZEA 1PMIA 5GZFA 2VMHA 2C9AA 1UPSA 5T5LA 5IUQA 3MPBA 4HN0A 1POV1 1KQRA 1QH7A 3SISA 4I30A 1PO11 2BGCA 3SXWA 4E4SA 1RMU2 1RUH3 1BBT2 3NV3A 1CIWA 1D4VB 1AXYA 3CJIA 3B3QE 2MPFA 1R1ZA 2LALA 3R0RA 3VHRA 2A6XA 3LA7A 4FOVA 5FAXA 2MEV2 5DUUA 3WP6A 2WWSA 4YM2A 1LEDA 3POSA 4Q4V3 5EXOA 2YY1A 2WFF1 1VRH2 2GU9A 2R043 4LNVA 3HMYA 1DU3D 1GFF2 2YGLA 2ZX2A 2CWMA 3VUOA 4AGRA 2P34A 1WA4A 5FDBA 1M4WA 1G7YA 4V1PA 1AL22 1RUD3 2A3YA 1VBB1 4FVVA 1ND2C 2HWF1 4W6XA 4Z1VA 5J48A 4CP2A 4YW1A 4CEWA 2AUYA 1AR71 1GZWA 2PHWA 4QPIC 1OA3A 1AR61 2R16A 3D0JA 2OUJA 4AGVA 4YARA 4CDQB 3A0NA 2P3KA 4BA6A 4YM3A 1QDCA 1PM7A 1RUG2 3OYWB 1DZQA 4WM8C 4IERA 5AFEA 4DPNA 1W39A 1GANA 3AMQA 3RQ0A 2W68A 5FO8B 4X8PA 3JQWA 4ES9A 1YFUA 3ZPYA 5AVPA 2HEWF 4Q4X2 5C6CA 4C90A 3PJYA 4EWAA 3HR9A 1L3JA 3IDBB 4EWEA 1NCQA 4J1XA 2XL9A 4GWMA 4LO8A 2XJPA 2RM21 5BNNC 4IEXA 2ZGQA 1SLLA 3WDWA 3BTAA 4YZ4A 2R6QA 2D43A 2DV9A 2RS52 3AKQA 5CFDA 4YFWA 2LTNA 2JG8C 4PBOA 5FOBB 2E6VA 2UU8A 3FFZA 5GLVA 1RUC2 3AZXA 3E6CC 3FFQA 4S2HA 5EWSA 4F3JA 4CRQA 4Q4Y2 1WW4A 2ZACA 3WG2A 1SLCA 3SITA 5KHIA 1DQ0A 5J3UA 1SFNA 1H2NA 2ZABA 4AG4A 2X53S 3JQXA 4FPKA 3DPRA 5JSPA 1WLWA 4IESA 1LOFA 2B46X 1LEMA 4YVSB 1E57A 2GC3A 5JI7A 3FLPA 1ULEA 2VY0A 4FPEA 5A3LA 1C4RA 2Z69A 5FFOC 1N1TA 1TNRA 4QPGC 1K5MA 2CNAA 4YG0A 3KSCA 1LOAA 4H7LA 2NM1A 2WLQA 3ZMNA 1VAKA 2NZ9A 4MYEA 2DFBA 1ALYA 2CWSA 1H2LA 4RA0A 4JRLA 2JXAA 3A4UA 1O3RA 3DGTA 3MW2A 4C1XA 1W6MA 1U5ZA 1ASJ3 2V5YA 3KCYA 5GZEA 3SLIA 1KRIA 5A3MA 4D69A 5L7OB 3D4KA 1SBFA 5EV7A 4L97A 2ZGKA 5HXVA 2RS32 3PLQA 4BMBA 4DY3A 5CFCA 4QMAA 3ZYGA 4AYUA 4XFFA 4GMP1 3JD71 2VNRA 3NV4A 4FSJA 3PVNA 2TBVA 2WS91 4RHV2 2VVDA 1RJ8A 1EV12 1ULGA 2WSVA 3MLLA 3LA3A 4OI1A 2ZS6B 2VNOA 1H30A 3ILNA 5FMOL 1ZM1A 2YYOA 1H1AA 2Z5WA 2RR12 2VG9A 4N53C 1Q8SA 3L2HA 1OA4A 4Q0PA 5J37A 3O0WA 5BNOB 1SEFA 3L9JT 3AXDA 1R1A3 4FPYA 4BYYA 4QXKA 4WM8A 1PVXA 1RHI3 1RUI1 3HQXA 4O9GA 2KXLA 2YDEA 3ZFGA 3B00A 1OLRA 4CDWB 4MGIE 1ZBE2 2HWE1 4AQTA 1S0CA 1SBEA 4B8EA 4RQPA 1APNA 1QXRA 4OLLA 4MGKE 5I8YA 2DVBA 1GV9A 4Y1ZA 1AR81 2HWD3 5BNNA 5E88A 3VBRB 1LJ7A 4WM7B 4S2DA 4YM1A 3NKGA 4XE9A 4F8AA 4FBFA 5CAZA 4LO6B 3WOGA 4AI0A 2ZJCA 4QHBA 5C8WA 1ZRFA 2WA4A 4FPFA 2D98A 3UJOA 3ZDSA 2WKKA 5J36A 5AC92 3I7DA 1XNKA 5KXCA 1PZ8A 3RYRA 3W58A 3KGZA 4NR1A 1PO22 3MIFA 5BXXA 3URFA 4RR3B 1X36A 3UV9A 5IK7A 4HPKA 1QXJA 1C8NA 1Q8QA 5I93A 2WNUA 4AEDB 2PTMA 4WZCA 3UKNA 1DYPA 4GWNA 3B94A 1HQWA 1JN2P 2XLAA 1YIPA 2QUOA 4WVMB 3LAGA 2EXHA 1ZX5A 3VKFC 1DBNA 1PO12 2AZ5A 1CPMA 4FP3A 3RNSA 3AKSA 1XNCA 3KCCA 3ZXAC 1DGWX 5FPZA 4UW3A 4QQ2A 4L99A 2EA7A 5JCTA 3V64A 3JBG1 3AZYA 2VW0A 2DCTA 3G7DA 5E8AA 2AR6A 3NKTA 1MEC1 2XJQA 3CO2A 3MI8A 3H3UA 3O7OA 3SMHA 2GALA 2IXLA 1VBC1 3N7MA 1FX5A 5JDBA 1LTEA 2IFRA 2RJKA 2IXCA 5F9TA 1CQ9A 2UURA 3S0MA 1DG6A 3VL9A 3POYA 1DGLA 4NWVA 2WJSA 4FCAA 3OGJA 1Q8VA 2GMPA 1PGL2 4XFBA 3NV1A 1VBB2 1J58A 1GNHA 1AL0G 1DGWA 2K9ZA 3H1YA 1MS9A 1HQNA 5LEKA 2Q4SA 1Z7S3 4FP2A 1QJU1 2HWF2 1WLDA 3M7AA 5L7OC 3BIWE 1N3QA 4FTEA 2WLPA 1NY72 2XL7A 1AR62 4DNYA 4HSLA 1V00A 3M1HA 5EFUA 4YW3A 3C2UA 5GZCA 2MNGA 1QJY1 1MS4A 2HWB2 4IEWA 2OVUA 3VBOB 1BMV1 2VUJA 1QH6A 4Q29A 2DTYA 2GZWA 1D0GA 4P5HA 4DFSA 3FHIB 2DU1A 5DZGA 2XG3A 5ABJA 1I1EA 4ASMB 4M01A 1YYNA 2E7TA 4CDQA 3B01A 5BNOC 2RM22 2Q1MA 2F6BA 4NPRA 4KL1A 4Z82A 4EN6B 1RUF3 3HT2A 2GC0A 2Z79A 3AK0A 4Z92B 1W6NA 5BNPB 1C57A 1C3HA 4CDWC 5K9YA 1A6CA 1LOEA 1OMIA 2ZX0A 1G6NA 5KC5A 1VBE2 1HV0A 1IGOA 1W6PB 3IDEA 2R073 4OUMA 4OZXA 4B3NA 1RUH1 1IS6A 4R9CA 3VZOA 3VBRC 2WIIB 3LKJA 4OHZA 2WA3A 1LRHA 4H14A 4AEKA 2I45A 4WM7C 4HT1T 1O4ZA 1FNYA 1H1MA 3N35A 4PIZA 4QGLA 3AKRA 1Q8PA 2XVLA 5J7MA 1TMF2 3WR0A 2R041 4YYOA 2A5ZA 2VOWA 3O14A 5ACA3 2HWC1 2HYKA 1TEIA 3M3OA 4PLOA 1NZCA 4SBVA 4COVA 4BM8A 2KA3A 3OJBA 2WSUA 1FATA 1YFYA 2JG9C 2ZA9A 1AYM3 2A3WA 1RUD1 3DV8A 4FPGA 3VBUB 3I59B 1R093 5H9PA 4YVSA 1YUDA 1EAH3 2VOVA 2A73B 2DU0A 3AX4A 1ZNPA 2P2KA 2XWBB 4A7KA 4BZ4A 1Q43A 2NP0A 3ECQA 4YVWB 4AF9A 1FT9A 1Z78A 3HD8B 3E5QA 2GSYA 2VVEA 4IQPA 2W52A 2PLV3 2VECA 4XBQA 1S0GA 3VKNA 5JMCA 4ZKTB 1OFNA 2D6LX 1ULFA 1FNZA 3KD4A 3MF9A 5GLUA 1OSGA 2ATFA 1RB8G 2D44A 3SH4A 2VOKA 4CP1A 5L7OA 1YCIA 2I2SA 3MFAA 1Y7BA 4A7ZA 1CONA 2RE9A 4BH9A 1W6QB 1VBA3 5JOXA 1DHKB 5T5JA 2JD4A 5JPNB 4LR4A 1C8M2 2WFPA 1J3QA 1G8WA 4XFAA 5TSWA 3IIAA 4Y20B 1CN1A 1H2KA 2HWE2 1C5HA 1TE1B 4IL7A 4D7TA 3B69A 3WUCA 1JHNA 1VBD3 5BNQA 4LA2A 3WUDA 3UKVA 4HFSA 3GBFA 5LK5A 5DG2A 4TWTA 1YNAA 2XHKA 2O1QA 1ZYBA 4DB5A 1AR82 1UZZA 3AMMA 3SHRA 1MR5A 3ZXLA 5BNOA 2RJLA 2R063 4G4FA 1PIV3 3VZJA 5HBAA 3OBTA 2BQPA 2WT0A 2BNMA 3M2MA 1LESA 3M70A 4CDWA 3ZN5A 4ITCA 1F8VA 1ND2B 4Q1RA 5GLTA 5JVVA 4B4RA 5C4WC 2VQAA 4COZA 1Y9QA 1UU4A 1AF9A 4JGYB 2V09A 2B8MA 4LLOA 3VBRA 5EYXA 3ZN4A 1WLTA 3ASIA 1CAVB 5CG9A 4WM7A 2GH8A 3UJQA 1R083 1O4YA 2LUWA 4NHMA 3WLUA 2C5DA 5FO9B 1URXA 1ASJ1 1ZBA1 1WMFA 3INAA 2MHFA 5FMOS 3J8F2 4HN1A 5EYYA 5BNPC 4XEZA 1LKNA 2ARBA 2ZHKA 3TN93 1O5UA 1N1YA 3ZYJB 1WLCA 2ZGNA 1D2SA 1OPMA 4AEMA 4XQ4A 3S6PA 5T55A 4I0AA 4RR3A 3QCWA 1ULCA 4YGDA 3ZFEB 4AEDA 1LHNA 4IV3A 4XPVA 2JG8B 3FWEA 2X5IB 1NCRC 3RG0A 3WP5A 4ES8A 4WVVA 5H9QA 5KXDA 2DWRA 2JEMA 3UKTA 3JBG2 1HRV1 4BQ1A 2VVFA 2XWJB 3MEPA 1R1A1 1O3SA 2OZJA 1VBC2 3ELNA 4WVMA 3WW3A 3R4UA 2VMGA 1X50A 3H9AA 1S55A 2EXKA 3AFGA 4LHLA 3AJYA 3SCHA 3BPZA 3PMSA 4LHKA 1DLLA 4GB32 2H6BA 1EPWA 1SLIA 3H0OA 4A3XA 1HV1A 2FQPA 3VBUC 4BOWA 3OD4A 5JZGA 1V6KA 2CGPA 2F4PA 4BIFA 3D5OA 3USUB 1HXS2 3BCWA 1FMD3 1NQDA 4QPGB 3ZFFC 1QJU2 2V73A 1SDWA 3GF6A 3WDVA 3TOJA 3RI9A 2D3SA 1XRUA 2GN3A 4LE4A 5JAXA 2XJRA 3IKWA 1RGSA 1H8VA 2YXSA 1H8TB 2CV6A 1GNZA 4KQ7A 1RUE2 1AR92 1OQ1A 1XXNA 3L2YA 4HVRA 4XF3A 5L73A 3IMNA 5DUVA 2ZX1A 1QJY2 2ZKNA 3HAGA 4LEJA 3NSTA 2A6VA 5T50A 2ILMA 4PBPA 3N7KA 1LU1A 1BQPA 1OQEA 4TSVA 3QD6A 1BMV2 1KDKA 4JQRA 1YRZA 1QJX1 1X8EA 4YLZA 1I9RA 1CESA 4WVZA 1C1LA 5KC6A 4IEOA 4P9XA 5KWRA 1KITA 3OCPA 3AMNA 1BJQA 1WCSA 3LSDA 4OHYA 1MACA 3VL8A 3BOWA 2W08A 4L9BA 5KHGA 4W6WA 4CDUB 1SFYA 4NOTA 2Q0AA 2XKOA 4YW4A 1KJLA 2RMU1 1BBT3 2H6CA 4GH4B 4N53B 4Y1YA 1PVC3 1UKGA 4JGZC 3VBOA 4MUVA 1MZ6A 3PVBB 1U5IA 4GIQA 3IPVB 2CTVA 2E7QA 2W0XA 2MEV3 2R30A 2QKDA 5CG8A 4RS5C 1GQGA 5T54A 1DQ5A 5DUXA 4XHBA 1VRH3 1OPOA 1U12A 3PMEA 1ZZ6A 1XNDA 2RS11 1S0JA 3IT8A 1S2KA 5BNPA 4B29A 4FOYA 1QJZA 2PN5A 3AZZA 4LULA 1RVF1 2QNKA 3ZMOA 1AL23 4LTAA 2IZWA 2ZHLA 5I91A 2R042 2VGDA 2O8OA 4FT8A 1QOSA 3ZX7A 3N36A 2HWC2 4JGYC 1OD5A 3FZ3A 3WT3A 1GKBA 3N7LA 3KT7A 2I07B 4YNIA 2QJVA 1UKRA 3CF6E 4HANA 4ZU7A 1RUG3 4AGGA 1Z7S1 1WW7A 2DUQA 2OUHA 3M3IA 2R1DA 4PJYA 3J9SA 1F5FA 1V6IA 4JC1A 2VW1A 2ZOEB 4AHYA 4CDXC 4EROA 2CL2A 3JUUA 3MIGA 4B7EA 4DQAA 5GLWA 1POV0 1GICA 4Q4X3 1AX2A 1BEV1 1XU2A 2WT1A 1RUOA 3R05A 1FPN2 4XBNA 3NAPC 3ZXDA 3VBUA 3I59A 4R8HA 3HT1A 1PHMA 1SCSA 4KBBA 3ZFEC 2ZMNA 3RWNA 3ES1A 5J96B 1UU5A 3ZSMA 1DQ2A 2X5IC 4LBKA 4Y26A 4K3UA 1G9FA 3VHOA 4RSUA 2QQPA 1RUC3 4N43B 4YVWA 4AE2A 1WCKA 1PNGA 2UYBA 1VJ2A 1TME1 2FHRA 4Q4Y3 5JIUA 1BVP1 1RUF1 4N9HA 4YSFA 4CP0A 3H1MA 3QH6A 5F6KA 4GKXA 4XF9A 1XQNA 1J1TA 2NMOA 4QM9A 4Z8BA 2K0GA 5DZFA 4FPJA 4QQOA 2BVVA 1BK1A 5E89A 4GXLA 3ALQA 1Q5OA 3B9IA 3MIHA 1REEA 1XYOA 2OYZA 5JOYA 1QMJA 5LRRA 3OBRA 1SACA 2R071 2IXJA 1W6QA 1J3PA 3KMHA 4FAGA 1AJKA 3VV1A 1EYBA 3GZTB 3IN9A 4YZ3A 4KGQA 4AVBA 2WT2A 1H8TC 4Y20A 4BHPA 2W39A 1Z0HA 1V6JA 4FQZA 4TLFA 1KFXL 1LU2A 4XQDA 4XJ9A 2C0ZA 3V0BB 3RZZA 4XILA 5BV6A 5BY5A 2CAVA 5DDJ1 3KGLA 2ZZJA 4LO5B 1QDOA 2P3IA 3AYEA 4D7YA 4UBHA 3HBZA 5J09A 5D8AC 4FXKB 2RS33 4ZXKA 4IEPA 1AYM1 2D3RA 4LBQD 5T5PA 2XJSA 2JE7A 2ZGTA 3KS7A 1R091 2BWCA 2Y26A 4LE3A 2OIIA 2D97A 4INDA 3FX3A 1EAH1 4RHV3 3RI8A 1ND2A 1EV13 1LHUA 1WMEA 1ZBA2 4DXZA 4KNCA 4XF0A 2ERFA 3EHKA 4CDUC 4BCUA 3B93A 3WDTA 4JGYA 3ZSEA 1V6LA 4MGYE 1LENA 4GH4C 2VH9A 4QPIA 1UX6A 4Q0QA 2D5HA 2RR13 5LRSA 1CAWB 4OVEA 2PLV1 1V9U3 1CAVA 4M3CF 1NE4A 4AVVA 4K1ZA 1F5JA 3WP4A 2PHTA 2GDFA 1FOD1 1YFXA 1YI9A 3FMGA 2XJTA 4AHXA 2XJVA 1JW6A 4K6BA 2VOXA 1MZFA 3PJQA 1JTZX 1FV3A 2E63A 4JCKA 1ZBE3 3MGUA 3NL1A 5CBLA 2CYFA 1HRV2 3E6BA 3V0AB 2YHJA 3QLQA 2DCYA 1WUVA 1R1A2 4QPYA 2ARXA 4AQ2A 4JDNA 2BUKA 5KHHA 4YG3A 4I2OA 3B9CA 2O8QA 3GHNA 4Q27A 2XBO2 2B9UA 3H1WA 3ZFEA 3M3CA 4FPHA 1MQTB 2JG8A 2X5IA 2JE9A 1TQ5A 4Q1PA 1AVBA 1X82A 1PZ7A 2YC0A 3JU9A 1ENXA 1HRI3 3N4MA 4UW5A 4LBMA 1RUNA 2R061 5KBFA 1PIV1 3MW3A 4OI4A 4XXAA 5AC93 3VBSC 4GMP0 2JG9B 4AFBA 1TNFA 1PO23 4LO7A 2SLIA 5DUWA 3H3ZA 1HX6A 3D0SA 4Z07A 3HIFA 2ZGMA 4JAAA 1XU1A 1LODA 4BIOA 3TYJA 3JZVA 4MH0E 3USUA 4QPGA 3H8UA 5IK8A 3ZN6B 2HJIA 1H2MA 3MDPA 5J98B 1QJX2 2ENRA 4FPOB 4OUSA 4J1WA 2VMIA 5I0SA 1R081 1HKDA 1H8TA 3W59A 4N43C 1Q8OA 1POV3 2I74A 5IT6A 4COYA 5LK7B 1PO13 3ZXFA 2B7YA 2E53A 1G9BA 4B7KA 1KJRA 5DG1A 3TN91 3GHMA 1BYHA 2RMU2 2A70A 4AVAA 5DXDA 1SLTA 4AEJA 3PNAA 2A7AA 1C5IA 3VKLA 5I0TA 4HVOA 4Q0UA 2WFF2 1B09A 1IHMA 1S0BA 3TB0A 1KFUL 1BCXA 4FOQA 2XPJA 2QZ3A 3AFKA 3FBYA 1U5YA 4CYDA 5H9RA 2RS12 4XQWA 2Y0OA 4CDUA 2PELA 1AX1A 1ND3C 1CR7A 1MVEA 1VALA 4GH4A 1ONAA 1LGCA 4N53A 1RVF2 3MYXA 3ZIXA 4XBLA 3O0XA 4QGMA 2XGXA 4F83A 1VBB3 2R0FA 1SBDA 1BVVA 2K2SA 1O4TA 4PLMA 1NA1B 2PHUA 2DYCA 2HWF3 1DDLA 1NLRA 1AR72 4LA3A 4XTMA 4F7ZA 2XLFA 3AP4A 4JDOA 1ULDA 4KWLA 5BUVA 1DF0A 1AR63 3ZYRA 3FUQA 3THTA 5C4WB 1UW8A 2D7FA 1H4HA 2E7AA 5FRAA 1Z7S2 1BKZA 2ZGUA 4RGAA 1VAMA 4EN8B 1PK6B 2EXIA 4IEZA 4Q4W3 2HWB3 3KT1A 1S0DA 5F6LB 3ZVXA 1A8DA 1I5ZA 3AYDA 1CAXB 4AI1A 1V6MA 3HN1A 3M3EA 1O3QA 1BEV2 2NN8A 3PTYA 4JV4A 1QF3A 1IPJA 3X29B 3OYWA 3AB0A 4XYXA 2PYTA 2RM23 5AVAA 5T3NA 4LBOA 3OY8B 3E5UA 2DUOA 4Y22B 1D4M3 4M3CB 2ZMLA 2CAUA 3OPZA 1UIJA 2AYHA 1EP0A 3NV2A 1QHDA 1TME2 1XYPA 1RUF2 2H0VA 1OLQA 2XB6C 1VBE3 3LA2A 2SBAA 3FLRA 4HZFA 4C91A 1NCRB 1W6OB 1BBT1 5FOJB 1CPNA 2GAUA 5SV8A 1PVC1 5C9AB 2DURA 1MQTC 3I8TA 2WZR3 4H55A 4Q4V1 5JIAA 5I8SA 3WHTA 3MZHA 1JOJA 4P9WA 4AFAA 4N43A 1VRH1 3WG1A 3CEWA 1TMF3 2HEYF 1B35C 4PDWC 4CEWB 2R32A 3EJKA 4QQLA 2DVAA 1VLNA 2UYAA 3VN4A 1CAUB 1F2NA 1O5LA 4WZFA 1AL21 2Z42A 1DIWA 1IZ3A 5DDJ2 3ZFFB 1S0EA 2WINB 2ET7A 4Y1XA 4EWDA 1LHOA 1HLCA 1REDA 3VZLA 1JUHA 4MZUA 1AYM2 1QQP3 3ILFA 4FPCA 1H1IA 1D2QA 3JD72 3SCGA 4CZS