3VBUC

Crystal structure of empty human enterovirus 71 particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
molecule keywords Genome Polyprotein, capsid protein VP1
total genus 38
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuC00
4RR3B 4IV1B 4GB32 4GB31 4Q4Y2 2WWSA 1C8M1 4QPIC 1R081 4PDWB 2MEV1 5DDJ1 3JD73 1NCRA 5DDJ2 4Z92B 1AR73 4CEYC 4RS5C 1HX6A 3JBG2 5L7OC 2RR13 2XPJA 3CJIC 1AR61 4GMP3 4Q4X3 2RS11 1TME1 2RS33 1C8M3 3IDEA 5K0UA 1RUJ1 1W39A 2R043 3JD71 2WFF3 2GSYA 1MEC3 1AYM1 4CEWC 1COV2 4RQPA 1NCQB 1VRH1 1ZBA2 1NOVA 1EV12 3VBOB 2ZTNA 1ASJ1 1R083 1NY72 1TME3 5C9AB 4CDQB 4FTSA 2ZZQA 4CEYB 1BEV2 1OPOA 5CFCA 5J98B 4BCUA 2HWC2 1RUG3 3VBOC 1QQP1 1VBE3 4RFT0 1NCQC 3VBSB 4CDUC 2PLV1 4Q4X1 4RR3A 1PIV3 1CD3G 1QJY2 4PDWA 4YVWB 4CEWA 1BBT1 4JGZA 1NCRB 1RUD2 5CFCC 3VBUB 4YVSC 1TMF3 1RUF3 4Q4V1 5L7OB 4CDWA 2PLV3 5BNPA 3S6PA 3CJIA 1HRI3 4WM8A 2RS53 1FOD3 1PVC2 2HWC3 4PDWC 2R061 4RS5A 1QJU1 1VBD2 3VBUC 1RB8G 1RUC2 1PO22 1VBA1 5GKAC 4YVWC 4CDXC 3VBRC 1D4M2 1VBB3 2WZR3 1X36A 5C9AA 1HRV1 4CDUB 3DPRA 1AR82 1RMU1 1ZBA1 4WM7A 2BFUL 1R1A1 1HXS3 4QPGA 3NAPB 2ZAHA 1ND3B 3VBSA 1RUH1 3VBFA 4FTEA 3JB8A 1AYN3 2HWE1 1PVC3 3ZFFB 1RHI3 2BFUS 1HRI2 1VBE2 4YVWA 4CEWB 1QJZA 3M8LA 1BMV2 4JGZB 4FTBA 4QPIA 2Y26A 1R1A3 5BNNA 4YVSA 1AR92 1AL21 4IV3A 3ZFGB 2R063 4Y5Z0 2RMU3 1VBC3 5BNPB 2WZR2 4Q4Y1 3CJIB 5A32B 2WS91 4Q4V2 2RS31 2WS92 1ASJ3 1HXS1 1VB2A 4RS5B 1AR93 2FZ2A 1ZBE3 2WFF1 4GH4A 5C8CA 5BNOC 1FMD3 1FOD2 5C4WC 1PVC1 1VBD1 1QQP3 1SMVA 1MQTB 3J8F1 4IV1C 4RR3C 1TME2 3FBMA 5ACA2 2WS93 5LK7B 3HAGA 3DPRB 2FZ1A 1PGL2 4WM7B 4QPGB 2RMU1 1POV3 3VBHC 5K0UB 2RMU2 2X5IB 4Q4W3 1AR83 1RUF2 1R1A2 1EV11 4GB33 5JZGC 4RQPB 1C8M2 5D8AC 2MEV2 4Y4YA 1B35A 4N53C 1HQNA 1QJY3 4Q4W2 3ZXAC 2XBO1 1PO11 5FMOS 2HWD3 4RHV1 2HWC1 4CEYA 1VBD3 1QQP2 4IV3B 3ZFGA 1AR72 1CJDA 2DF7A 5DDJ3 5ACA3 1OOPC 1WCDJ 3VDDB 1FMD2 5CFDA 4AEDA 1ZBE2 1FMD1 1BEV3 4N43C 2HWD2 1RUD1 1BBT2 1K5MA 1POV1 1MEC1 4GH4B 5C8CB 3ZFEC 1FPN3 1POV0 4EJRA 3VBUA 1ASJ2 3LOBA 5L7OA 2WFF2 1MQTA 4CDWB 4WM8C 1D4M3 5AC92 1PGW2 4JGYC 5ABJA 2R062 1C8NA 5BNOA 4NWVA 1RUG1 2PLV2 2X5IA 5BNNC 5ACA1 5FOJB 1AYN1 1AYN2 1QJX1 5A33B 4Q4Y3 1B35B 1RUF1 1FPN1 1VB4A 4CDUA 4Q4V3 1FPN2 1R082 1Z7S2 4FSJA 1VBB2 1BBT3 1VBC1 3VDDA 4JGYA 1RUI1 1HRI1 3VBFB 2RM22 1ND2C 2RM21 2VQ0A 4N53A 4NWWA 4GMP0 1K5MB 1PO21 4AEDC 5CFDC 4QPGC 1V9U2 1ZBE1 3JD72 1H8TC 2RS52 5BNNB 1MEC2 1TMF2 1COV1 1ND2B 1MQTC 2MEV3 2RS13 2RS32 2HWF2 3VBRA 5ABJB 5JZGA 2BUKA 5BNOB 2R041 1PGW1 2R042 4LLFA 2XBO3 1AR63 4Q4W1 1QJU2 3VBHA 3TN93 1RHI1 1E57A 1RVF2 1RHI2 1PIV2 5D8AA 1VBE1 1PO23 2HWF3 4N43B 1EAH3 1PO13 1AYM2 1QJX2 1HRV3 3VDDC 4JGZC 1RMU3 4IV3C 3JB4C 1Z7S1 4JGYB 4CDWC 1AL23 4N53B 2HWE3 1VBC2 5ABJC 1ND3C 1EAH1 5C4WA 4RQPC 1RUC3 3ZFEB 2BBVA 3TN92 1RUE2 1VBA2 1H8TB 1AR91 4WM7C 1RUJ2 1NG0A 5J96B 1D4M1 2RR12 1NCQA 1OOPB 4AEDB 3VBRB 1K5MC 5CFDB 3VBOA 2WZR1 2RS51 1QJX3 2IZWA 4CDQA 3VBFC 2HWF1 1HXS2 1VBA3 1RUE3 1EV13 1NY71 1RUJ3 1FOD1 2HWB1 5D8AB 1V9U3 2HWB2 1A6CA 1QJU3 4SBVA 1AR62 2XBO2 3J8F2 2HWE2 4GMP1 1B35C 1RUC1 4N43A 1RUI2 1VAKA 4RHV3 1M06G 1DDLA 1RUG2 5K0UC 5BNPC 1NCRC 1PGL1 3ZFGC 1RUH3 1QJY1 3DPRC 3JBG3 2TBVA 2HWD1 1HRV2 1AYM3 1R091 1IHMA 1R092 1VRH3 1ZBA3 5FMOL 1NA1A 3VBSC 1COV3 4CDXA 5A33A 1OHFA 5C4WB 4WM8B 3ZFEA 4IV1A 1BEV1 1X33A 1RUD3 4CDQC 1F8VA 5C9AC 1H8TA 3JBG1 3NAPC 1RVF3 4Q4X2 4GH4C 5C8CC 3TN91 1BMV1 1RUE1 1OOPA 3J8F3 2RS12 1PIV1 5AC93 2HWB3 1V9U1 2BPA2 2QQPA 1TMF1 3NAPA 1RMU2 1ND3A 1VRH2 1AR81 3ZFFC 1ND2A 2R071 1RUH2 2R072 3ZFFA 1AL0G 2WLPA 5AC91 1VBB1 1R093 5JZGB 1PO12 1EAH2 4QPIB 4RHV2 1RVF1 1RUI3 2X5IC 4YVSB 1Z7S3 2RM23 3VBHB 5CFCB 2GH8A 1AR71 1F2NA 1NA1B 2R073 1NA1C 1AL22 1AUYA 4CDXB 5A32A 2RR11 1GFF2
chains in the Genus database with same CATH superfamily
4RR3B 5FZKA 4IV1B 4GB32 5HCHA 3AKTA 3VZJA 3MW2A 4XAAA 2OUJA 2BDRA 3SXWA 3ILRA 5CIRA 3WNPA 1DGLA 1R081 1Y9MA 5AVPA 5GLWA 4DY5A 4UFKA 2V5YA 4FPOB 4YFZA 4EV0A 1TNRA 3K4DA 1H0BA 1UWWA 3AP6A 3CHXA 5GLUA 1NZIA 3BIWE 3THTA 3S5AA 2GDFA 3ZMOA 4RSUA 4BMBA 3UK9A 1C3HA 1YWKA 1W6OB 4WVZA 3K46A 3WDYA 4LUMA 2F6BA 3W58A 3FUOA 5A1FA 4HL0A 4Q4X3 3NRUA 5DUVA 5A6ZA 1MVQA 2RS11 1TME1 3BB6A 4JV4A 1GR3A 1W3VA 2VNRA 3HQRA 4CSWA 1RYYA 3UJQA 4FPLA 2CU5A 4XFCA 1JYTA 3HD8B 5K0UA 2QZ2A 1W39A 2RVAA 3Q8EA 2XHKA 3HNBM 2WFF3 4KGGA 3MIHA 3VD9A 1WMXA 1XYNA 1AYM1 3LIHA 4YW5A 1W8ZA 1COV2 3WZ1A 4RQPA 5K8SA 1DG6A 5FZCA 3LA2A 2VQTA 5IW0A 2FDJA 3CIHA 1DP0A 3M3QA 1R083 1AX1A 1XOYA 2JDZA 1WZXA 4CDQB 2XR4A 5FK7A 2VD7A 4O7XA 3UT0A 3PHMA 2A7AA 5FZHA 1BEV2 3PUAA 2DYCA 2FQPA 1OPOA 2VMCA 5CFCA 5J98B 2DU0A 1PMJX 4LO4B 2WLQA 3QD6A 3D82A 4HVRA 3IMMA 5C8WA 1Y7BA 2Q0AA 3VKLA 2XQRA 5FLHA 2PLV1 4FFIA 4CDUC 1PVXA 2AYHA 2HEYF 4MGKE 5EPAA 3OGGA 4KWKA 3IIAA 5TSWA 2P3YA 5FWEA 3M3CA 1CD3G 3ILNA 4QB2A 3KHCA 5H9PA 1S0EA 2GNTA 3ZSEA 1E5RA 4ET7A 3MF9A 2ZGSA 4ONUA 4OVEA 2UWBA 2WSVA 5KR7A 5CFCC 5IAXA 3AL5A 4E4ZA 4ATEA 2PHWA 3UNPA 1TMF3 4I0AA 1RUF3 4Q1PA 2VBDA 4MGZE 2JD4A 2YY1A 2G1MA 1JYNA 1WMDA 3BTAA 4HXCA 3I3MA 4AHZA 3TNPB 1W9FA 2HEWF 2EIGA 4HPKB 4B7KA 4ES9A 3U4XA 5CISA 1GP6A 4XEZA 1X9TA 2JJ6A 2RS53 1PVC2 2XJUA 4A6SA 2R061 3A23A 4M4RA 1YQ6A 3ZDVA 4LBMA 1WCSA 3B69A 4UXAA 3GBGA 1RUC2 1PO22 4XETA 3K51A 4BQ1A 2AGSA 2W95A 3SH3A 5B4NA 4K8RB 2UU8A 1W28A 2GZWA 1UQXA 4YVWC 4K1ZA 2XJQA 3PIGA 1N3QA 5GM0A 3N7JA 1AHSA 1VBB3 4XAEA 3B00A 3U4SA 4O61A 1SACA 3N7KA 3I2GA 2AREA 3BGAA 1AR82 2DDUA 4B4QA 1GMMA 2BERA 2CL2A 3H1YA 4YGCA 2WO7A 4QPGA 3NAPB 3M7AA 1LODA 4LT5A 2VECA 1G9FA 2VOVA 1IG3A 1TEIA 1W8UA 4N7UA 4UW4A 1HLCA 2DVGA 1QGLA 4P9LA 4D3WA 3RZLA 3BPZA 3U07A 3WUCA 4P02B 3OGRA 4AL9A 1HRI2 4CA9A 3BVCA 5FMDA 1DGRA 1I6XA 4DZGA 3QOPA 4CEWB 1QJZA 3M8LA 3FBYA 1W99A 3MEPA 2HBUA 3NNGA 2UYAA 2QJVA 3HIFA 3PTYA 5IWFA 2GP3A 1AL21 1XU2A 4S2FA 1QHDA 1D2SA 1ACCA 1SFNA 3H8UA 2GH2A 4IDZA 2RMU3 4IV3A 4KQ7A 4MUVA 3POGA 4Y5Z0 3ZSKA 3PVEA 4E4HA 5JIUA 5FYUA 4M3CA 4Y20B 2RDRA 2VC9A 2VBPA 2WZR2 1SBEA 5FREA 5A32B 3POYA 4YW3A 2J1UA 2B39A 3ZYBA 4LBNA 1H2MA 1XB9A 2RS31 3CZUA 3MIDA 1ASJ3 1OT5A 1UU6A 1UPSA 2D7FA 4LBLA 4OMDA 5L19A 2YDEA 1XPWA 4UW5A 4YSFA 3AZWA 2FZ2A 4GH4A 1ZREA 3POSA 2E51A 4NHKA 4YGEA 1X50A 4AVVA 1FOD2 4L2NA 4OULA 5LA1A 4NR1A 3PUSA 2V09A 1VBD1 3IAPA 1X8EA 1JODA 3J8F1 3MIFA 4EQVA 2GC3A 3POBA 2V72A 4KMQA 1IZ3A 2GNDA 3RG0A 3WSOA 4JVAA 3B93A 4R9DA 5FKBA 3WEZA 1Y4WA 4A44A 1S0IA 2NM1A 4WM7B 1OBNA 3JXSA 5I93A 2DVAA 3OGJA 5F5QA 3T4HB 2BWAA 2RMU1 5IVVA 1GZCA 2X5IB 5HCBA 1WD4A 5JSPA 3RZJA 4B4PA 2BNNA 2O8OA 4GB33 3H7YA 5CBLA 1C8M2 4EN9B 5FXVA 3P1IA 2JDAA 5T3NA 1OPMA 4I3PA 5EFUA 3CDZB 1KD7A 1W6MB 3K4ZA 1HQNA 4JHZA 1ZRDA 2XBO1 4JDMA 5IK5A 3H3UA 1PMIA 1O4YA 2EAAA 2HWD3 4RHV1 3ZSLA 1TVGA 4AQSA 1W03A 1KITA 3E1F1 4CEYA 1QQP2 5A3OA 5K9YA 5LZ6A 4YGDA 4PLMA 2JG8C 2RDNA 4Y1VA 1OLME 4QXKA 4AFMA 3AMMA 1JZ8A 1OOPC 1ODNA 4LLOA 4QPWA 3I54A 4XFIA 3VDDB 1YHFA 4DB5A 1FMD1 2VZVA 1QH6A 1OLQA 3P5BA 4XJ8A 1UZYA 2WJSA 1ULGA 2YG0A 3GCXA 2XG3A 2RV9A 2XLAA 3O0WA 2XGXA 2P37A 2OPWA 4COZA 3VBUA 4KI5M 3I4IA 4OI1A 4Q8KA 3KS7A 1ASJ2 1OA2A 1QMJA 4PBOA 5FTTC 1YQ2A 1NLSA 1WCQA 2PHRA 3ZPYA 4Q8LA 4Y22B 3T2QA 2L9LA 4LHNA 4MV2A 1D4M3 2C26A 2HKXA 5B4XA 2WKKA 3WQ0A 4ZZ5A 3FWEA 4HN1A 3GZTB 4NHYA 2EAKA 3BOWA 4XXAA 5GZFA 3RGBA 3C7EA 3TEXA 5BNOA 4FPHA 4NWVA 3ZFGB 3C3VA 4B4RA 3M3IA 1MS8A 4A4AA 5BNNC 1SEFA 2Z69A 2QFEA 1O6UA 4PIXA 3FC0A 3O14A 1UNBA 2W1QA 2VCBA 5DAWA 4R4XA 4BZ4A 4LPLA 4QX2A 4XUTA 2WT1A 4S2HA 5FV3A 1QJX1 3AFGA 5A33B 2JB8A 4GKXA 1Y9GA 4Q4Y3 1WMFA 1B35B 4PF1A 3WG4A 3WUDA 4AF9A 5JPNB 1RUF1 4EWAA 4FCAA 5CA6A 3MPPG 1LB2A 1FPN2 1Z7S2 1TZOA 4QQOA 4C91A 1JYIA 4I02A 4AEKA 3VV1A 1LOFC 3WLUA 2VMHA 2VULA 3N9PA 3D6EA 3AYEA 5DPNA 4YZ5A 3LF7A 4N9IA 3I2KA 4CCNA 2B45X 4I3GA 1RUI1 4YLZA 2VQAA 3Q8BA 4EYUA 1W0PA 1IS6A 1CAVB 1GNYA 1LR5A 1AVBA 1NKGA 2RM21 3QLQA 3ZLIA 2PHUA 3IDAA 3KGZA 3OYWB 2ET7A 4M0HA 4K1YA 1V9U2 3MIEA 2JIJA 2A5ZA 1RC6A 2LUWA 3H42B 1XBFA 3N9NA 4DXTA 5JUVA 2RS52 5CU1A 3EBRA 3N4MA 1VMFA 4FFGA 3MW3A 4IGPA 3C7OA 5FPVA 4NIGA 1OUSA 4CXYA 3N9QA 2IXHA 2RS13 2CNAA 3VBRA 1KFXL 5DUWA 1C5HA 2PQSA 2BUKA 5CYYA 1BHGA 5FBJA 4NIAA 2R042 4LHLA 1HB2A 4IEQA 5FY9A 1EP0A 1W05A 1ZZ9A 2HBTA 3KCYA 2WA4A 3OF1A 3ZXGA 1XQNA 1OF3A 4LO5B 1NX9A 1VBE1 3IAQA 3M4FA 3IM0A 3U14A 2G19A 2D97A 5JR2A 3MLJA 1FV3A 2HWF3 1X82A 4MOAA 4N43B 2D43A 5JOWA 1PO13 4CU8A 1HRV3 3HVDA 2GNBA 1GYKA 4IERA 4JGZC 5K4LA 2C1FA 3OBTA 1HN1A 4IV3C 4CUAA 1BKZA 4AI9A 2IC1A 4Y26A 2JKBA 3PVBB 4YRDA 5E89A 3B01A 2E9QA 3NJXA 4JGYB 2A71A 1UU5A 2XJTA 1CONA 1OA4A 5I0UA 1O3TA 4GD4A 3S0MA 4XQWA 4N53B 3WVJA 3ALQA 5BYNA 3LD8A 5HPOA 5L9BA 3WR0A 2HWE3 3OEAA 2DBNA 4WZFA 3O0XA 2FDKA 1ND3C 2BQPA 4TLGA 2XDVA 3GXUA 1OURA 4YW1A 2NQYA 1RUC3 2IFRA 2CGPA 5IVCA 4D0QA 2BBVA 4TWTA 4CPBA 2GNMA 4WV8A 1SHWB 1W6NA 2GC1A 1RUE2 2Y6JA 4XUNA 2AH2A 1FT9A 5EYYA 1QIQA 3MLKA 5L73A 3S30A 4MGSA 3T30A 2P34A 1L7LA 3I3QA 4WM7C 1KDKA 4ZXKA 3ST7A 1RUJ2 1NG0A 2CY6A 3R0RA 2TUNA 4HLTA 5J96B 4E9KA 3HOBA 4AEDB 1K5MC 2EICA 4HK8A 1NE6A 3PJQA 5FQ0B 4AOCA 5A3PA 4IEYA 3W20A 1YQCA 2VG9A 1F4AA 3T2TA 2VY0A 4UFHA 3VBFC 5HV4A 2HEVF 3ABZA 4XQDA 1W06A 2Q1ZB 2ZPXA 3KCXA 3NV2A 4Q0UA 3BKZA 1J59A 2X53S 5T5OA 1NY71 1RUJ3 3LKJA 3ZXJA 1J58A 2B9UA 1XXNA 5FY4A 4W6WA 2AZ5A 2HWB2 2XQXA 5FMCA 4E2SA 4QGLA 1Q56A 1QJU3 4F83A 3RI8A 1UZVA 4PBPA 1X7NA 3I49A 4QU2A 5JMOA 2PELA 5F9TA 1TE1B 4FBFA 2P3IA 4RHV3 3R6SA 1DDLA 2YFUA 5LBEA 1ZRCA 5FYHA 1HN0A 4FFFA 1I5PA 2ZABA 3FLPA 3GCWA 4GWMA 4NPMA 4XFHA 1YRZA 4EN0A 1OFNA 2E7QA 5LATA 1MS9A 1F5FA 3WT3A 4C90A 2X05A 2D3RA 4BH9A 1Q8PA 3KM5A 4DUVA 5JAXA 3MZHA 1SLIA 1ALYA 2F17A 3FN9A 5JOZA 2ZHNA 1S0BA 2XH6A 1DQ4A 3VBSC 1COV3 2BBAA 3UGHA 4L9BA 5FIXA 3WQ7A 4WM8B 1SFPA 3T2OA 3AKRA 3DYOA 1SG3A 1UZZA 1WLTA 3JBG1 4HT1T 3NAPC 4BOWA 1RUOA 4LIVA 4W6YA 1CGPA 4Q4X2 4GH4C 2J1RA 2VOXA 2D6OX 2FBEA 1C1LA 5F3GA 5F39A 4MG2A 1OOPA 5JXHA 5JXIA 3ZYRA 3MPBA 3S7EA 3SHRA 4P00B 2PHXA 3SMHA 1ZNPA 3FHQA 2OZJA 2OKXA 5SV8A 2EF6A 3SQOA 3APBA 4UW6A 3SC7X 1U5IA 1HQWA 3UV9A 2XVLA 4LXLA 5KXDA 4BLJA 4A7ZA 3PIJA 1MPXA 5DMYA 2CDPA 3KF5A 2JG8B 4TTGA 2Y60A 1TMF1 2VBBA 3V56A 3NAPA 1JOPA 1TNFA 5FO8B 5JMCA 2F4LA 2AEYA 2R7EB 4AQTA 1W3XA 4KL1A 2E32A 5LBCA 3V0AA 2IUWA 4XF9A 4LNVA 4UFIA 2VZ1A 1ND2A 1B09A 4QAWA 4XABA 3ZFFA 4BK5A 3O1VA 1AL0G 5FPBA 5AC91 2Q8DA 5L9VA 2FMYA 1SLBA 1ZZ6A 5I0RA 5C3QA 3IPVA 1PO12 3U10A 1GBGA 1HB3A 3BN6A 3E6BA 5DABA 5J3UA 3E6CC 2JDUA 2RM23 4Z07A 4WZCA 5FZEA 5LB6A 1ZRIA 2D5HA 1T6GC 1ODMA 1URXA 1UYZA 1AUYA 2BGOA 5A32A 4FPGA 5L36A 1NQDA 1NXMA 1O4TA 2WAOA 4DEQA 2PYTA 1W9SA 1DYKA 1GQHA 3RNSA 1C8M1 3M1HA 4PDWB 3GBWA 2MEV1 2DVFA 4UI9L 2EXHA 4RGGA 3VKMA 3VKNA 1CX4A 2QQLA 3OPWA 1V6JA 2D3SA 5FYCA 2PFWA 3J7HA 3LGRA 1R1ZA 1JMUB 2DTYA 3INAA 1A34A 2ES3A 4BXSV 1W6PB 3U1XA 1S2EA 2WNUA 3ZOIA 5GLVA 5L7OC 4FPKA 2XPJA 3N7LA 4HPKA 4DUWA 2VZRA 4XFGA 4J1WA 3RJRA 2W94A 2D6KA 1BJQA 3FJSA 3IDEA 3TEWA 5DUUA 2JICA 1W9YA 5GZGA 4XBNA 3VZKA 4CUCA 4JHTA 5FZ3A 5A7PA 2CAUA 2GSYA 5C71A 4XIOA 2R49A 3U0ZA 1LGNA 3D8CA 4QDQA 4B1MA 5CB7A 1NCQB 2ZGRA 1LHOA 1UAIA 4NIIA 1ZBA2 3ZXDA 1WA4A 3VBOB 4ZY9A 3TOJA 1ASJ1 1NAEA 1VJ2A 2YGLA 4LBQA 4DIQA 1NY72 1TME3 1Q8QA 4XF0A 5C9AB 3OPTA 3ACIA 3LQCA 3ZXEA 4FTSA 4CEYB 3TNQA 2CAVA 4NE9A 4JX0A 3RWNA 1REDA 4MXWA 1RL3A 3PU3A 4RL7A 4UW3A 4BCUA 4FXGB 4JKKA 3CZJA 2E26A 2J22A 4COVA 4I2OA 3OSDA 4OYUA 1VBE3 1NCQC 3VD5A 3T1LA 3LDRA 3TB0A 1DGWA 4L11A 1XE0A 3VD4A 1GZWA 4LEJA 4RR3A 1XSQA 2PAKA 2QQKA 3E97A 5FMBA 1YC61 5CG8A 4P9YA 4KBBA 1F4HA 1RITA 3BODA 5FFOC 2LRPA 1K5JA 4N7IA 1EY2A 1FNZA 2EIBA 1LU2A 2PHLA 4X6QB 4YWAA 1BBT1 2D44A 1F15A 1NCRB 3D0SA 5FZDA 3VBUB 1C57A 4KH9A 4AFAA 1RUNA 3VGIA 3RMYA 1E5IA 1OD5A 5F5CA 5L7OB 4Y22A 2TEPA 3NJZA 5FKCA 1HJFA 4E8CA 2PLV3 3PUHA 5JVVA 4ORFA 5BNPA 2D40A 2DCJA 2IWGB 3BCWA 2R0FA 1AXYA 3KT1A 1CAXA 2JECA 4JRLA 4PHZA 2JDYA 1K42A 2QTWB 2VGDA 4FAGA 5CZKA 3TEZA 3ZYPA 1XNBA 3HT2A 2VMFA 1BLZA 3NNJA 1RB8G 5FY5A 2QBXA 1QH7A 5GKAC 3MO4A 4DXRA 4HVQA 2VAUA 5FY8A 1LOAA 3ZXLA 4B8EA 4CDXC 3VZNA 2RDSA 1D4M2 4AGRA 1LEDA 2CHHA 4IE7A 1GNZA 4MSVA 1FYUA 1X36A 4GJZA 1V00A 3WXPA 3ZX7A 2P3JA 2UY8A 5F2WA 3I59A 1JBCA 4W6XA 5J7MA 2DUOA 3CJXA 1H4HA 4AHXA 1L3JA 1RMU1 2DU1A 4K20A 1UY2A 4A45A 1R1A1 2QZ3A 4E8DA 3K48A 1MZEA 1ND3B 4QMAA 3C8XA 4QX0A 4XBQA 3RJ2X 3I2OA 1QWRA 1ST8A 3ZR6A 2VU9A 4Y1YA 1CAVA 4HKLA 4FTEA 5A3TA 1AYN3 4A3XA 1YI9A 4CU6A 2JDPA 1PZ8A 2FDFA 2ZGQA 1O59A 1W6MA 1VBE2 4OUSA 4UYBA 1A8MA 4YVWA 1BMV2 4EWEA 5LWBA 1CZSA 4KWLA 4QQPA 2JWPA 3KV9A 3KVAA 3LDKA 2W2IA 3ZVXA 1ZA7A 4XPVA 4YVSA 4YZ4A 4Y4RA 3E5UA 5JR7B 2XKPA 4IEPA 5I8TA 3WNXA 1DHKB 4Q0VA 4LK6A 1VBC3 2YPJA 5AVAA 4FOWA 5GZCA 4YM1A 5FZ1A 1GU3A 3POWA 1SZBA 4KGQA 2WS91 2CYFA 2VVFA 4IE0A 2BWCA 2WS92 4BA6A 2WT0A 1OF4A 3L2YA 3BTXA 1UYPA 5LCWL 2ZS6B 1VB2A 4RS5B 2NMOA 3TRSB 1N3PA 2O1QA 2OZ6A 3VB9A 5C5UA 5KXBA 2KXLA 5C8CA 1A3KA 5G05L 1DCSA 2JDHA 3DXTA 3WP4A 1Q3EA 2QQVA 4YG0A 5F6LB 1BVP1 2DCTA 2CTVA 3I3BA 1IQDC 5KC5A 2ETEA 3CF6E 2W39A 3SEPA 1SMVA 1MQTB 5DAVA 4ARXA 1VP6A 4HKOA 4RR3C 1PNFA 3FLRA 2P3KA 3UESA 1JZ2A 1TME2 1W2UA 3FBMA 2O14A 3THDA 3ZKYA 2TNFA 4XZPA 5J09A 3H0OA 1AX2A 1VAMA 2P6HA 3B02A 5D21A 2FZ1A 4INDA 4IXLA 1OLRA 4CP1A 5A3UA 1POQA 1T2XA 1UY3A 1W2TA 2WNVC 1V6IA 2A73B 3RFRA 3VBHC 5K0UB 2QVSB 1H2LA 2NN8A 4ZKTB 3NMBA 5KWRA 1AR83 1WUVA 4XUPA 2DV9A 4OQ8A 1IS3A 1GUIA 4QGNA 1RUF2 1OKOA 1R1A2 2JG9B 3SH4A 3SISA 4LA3A 2DFCA 2ZEYA 5JZGC 4LIUA 3PMSA 2OIIA 3GYDA 3N9MA 2MEV2 2PN5A 5D8AC 5FYZA 4Y4YA 4COWA 2EXJA 2Q8OA 5A6XA 5E16A 3WP5A 1S1AA 4Y24A 2PA7A 1LNSA 4Q4W2 3W59A 3ZXAC 5E8AA 2Q8EA 3KV5A 1LGBA 5GZEA 3N36A 1CN1A 4WBBA 2NMNA 1APNA 2YHJA 2WN3A 3HNYM 1H1IA 5IATA 4YYOA 2XLFA 5DDJ3 5ACA3 5IK8A 1FMD2 4AEDA 5HI0A 1GANA 1LTEA 2ZX2A 1VRBA 3UKNA 1JUHA 4YG3A 5J36A 1K5MA 1JYXA 3T0BA 5G04L 1CQ9A 1CVNA 1MEC1 1J3QA 3LEMA 3I2FA 3C7FA 2ZMLA 1FPN3 1DZRA 1HIXA 4RN5A 5AFEA 1LHNA 4DRVA 3LOBA 4QU1A 1KFUL 2VZ3A 1MZ6A 2WFF2 2B46X 3KV6A 4V1PA 1PX4A 4WM8C 4TLFA 1G86A 4JZRA 4LHSA 5C7GA 2Y34A 3ASIA 3MIGA 5ABJA 1DLCA 2J7MA 5DAPA 3AJZA 1UW8A 4M01A 5C6CA 1I9RA 3K4AA 5LY2A 1RUG1 4CZSA 4OHVA 1LOGA 4LOTA 4IE5A 4X8PA 3H9AA 4BB3A 2A6ZA 4MVTA 5ACA1 2JX9A 1N1YA 1UY1A 3FX3A 3K75B 2D93A 3OJBA 2YV8A 5LRRA 1W8FA 3AM2A 4QQ2A 1CIYA 3CL1A 3ZN5A 4O9GA 5IVJA 1ENXA 3RZKA 5IVEA 2XWBB 3IT8A 3NJVA 1FPN1 1TG7A 2HLEA 4Q4V3 4YZ3A 1R082 3LE0A 5EJ3A 4FAHA 4TN7A 4QGMA 2A1XA 4FSJA 2ZACA 4EE2A 3AFKA 1LRHA 2WFPA 1SBFA 2A6VA 4KU8A 4XHBA 1VBC1 1DGRN 2DCYA 3I7DA 4JGYA 3VDDA 2RM22 1ND2C 4LO6B 5HV0A 4N53A 3GM8A 4AVCA 4EN6B 2YB7A 2WWJA 2ZOEB 4LKSA 1DU3D 4J6GA 5JLVA 1PM4A 1JU3A 4AEDC 2G9FA 2YC4A 2K2SA 3AJYA 4Q2FA 2R6QA 3M2MA 3RQ0A 5DAQA 3LB9A 3AXEA 2VCAA 5DXDA 2KD7A 2VCMA 4XCBA 1CAUA 1F31A 3M3EA 4MO3M 3G7DA 4AVSA 5BNNB 2AUYA 1TQ5A 2AACA 3ZYFA 4D94A 3LEKA 1ND2B 1MQTC 4BQ3A 2ZGLA 2R1DA 2RS32 3IMNA 1IGOA 4RYDA 3MFCA 2GAUA 2ATFA 3VHPA 2BOJA 4PQQA 4AVAA 3MHZA 3QH6A 3D0JA 2W1UA 4LULA 4QKNA 5BNOB 1AZDA 1KEXA 1PGW1 3ZYJB 2VUJA 2VTFA 1U12A 1QU0A 1SDWA 4QKBA 4Q4W1 2PHDA 3F95A 2QDNA 1GQGA 3AMNA 5FYMA 3CQOA 1RVF2 2I07B 3U37A 3ECQA 1XYOA 1U5ZA 2KR2A 3I3DA 1JOJA 1D2QA 3P3NA 4AEJA 5F3CA 3RZHA 3LA3A 5FO7B 2ZZJA 2XUEA 2Y0OA 4QX8A 2RDQA 2XLGA 5FPAA 1NT0A 4BE3A 1UZ0A 3RWKX 3BIEA 1H8VA 1S55A 4NMIA 3SEEA 2OXBA 5FRAA 5FPLA 2J1TA 1OA3A 3WQBA 4OZXA 1UOBA 3SH5A 1QOTA 2VR4A 1LAJA 5FYSA 4ZONA 4ZS3A 3RVHA 2VNOA 1Z7S1 5K7PA 2NYYA 5KHIA 1G9CA 4P14A 3RZZA 2D5FA 3PUIA 3MFAA 2QQWA 3BOPA 2WNUB 4YPJA 2HJIA 5KC6A 1JZ6A 3KZ4C 2VVDA 3FE5A 4RQPC 1ENSA 5C4WA 1GZTA 2ZCWA 3GJBA 4COYA 2JG9C 3W9AA 2C4XA 3JU9A 3LCPA 2HYXA 3TN92 4LBOA 1ZX5A 1JHJA 2DVBA 4D6RA 2VH9A 4DMIA 5FP7A 2WNVB 5M0TA 3V0BA 2ADDA 3AKQA 4RGAA 4GWIA 4XILA 3U75A 2RR12 1NCQA 5D2AA 1KQRA 3KF3A 1OOPB 4A7YA 5HCFA 2VNGA 2ZGKA 1QJX3 2VMGA 3WNOA 5KXEA 4LBQB 1JXNA 4D8MA 5FR3A 3NKGA 1O8PA 2YZ4A 4DNYA 4MLOA 1GP5A 3EO6A 1RUE3 1EV13 4OHZA 1KJRA 1AX0A 2BU9A 1BYHA 3BALA 4PCRA 4ZS2A 1CX1A 3DV8A 4FT8A 4AZZA 4Q0SA 4LA2A 1QDOA 2DCKA 2QE3A 3J9SA 1FX5A 4XVHA 1QJEA 3J8F2 2HWE2 1B35C 4CE8A 4N43A 1RUG2 2BTVC 2NLRA 3Q8FA 3B3QE 3CU7A 4XURA 2A6WA 1NCRC 5F32A 1N47A 3TAYA 3WW1A 1Q43A 1PGL1 3ZFGC 3DPRC 1QJY1 4OUEA 4D6SA 2VZSA 2HWD1 1HRV2 3O1PA 3ZPOA 4QXCA 3SCFA 4XUQA 1O3QA 3LDBA 1WLWA 4DPNA 1OSGA 1YFUA 5A33A 1OHFA 1KGYA 1VR3A 2YXSA 3OOXA 2ZGNA 4UWDA 2VTXJ 2DURA 4FQZA 4QX1A 1SCRA 3NV4A 2PMWB 3I8TA 4NHXA 3LEIA 4DS0A 1Y43B 1RUD3 1HDKA 2Z2SB 1ENRA 4CDQC 4K21A 5C9AC 3EHKA 2E63A 1JW6A 4I30A 3AVSA 1WD3A 3WCRA 1PK6C 2K0GA 1BMV1 5T50A 3VL8A 1ZA4A 1RUE1 2ZGOA 4PLOA 3RRDA 3KGLA 1JTZX 2RS12 3PL0A 3FMGA 1W8HA 1PIV1 1YI7A 2A75A 2B5HA 4Z1VA 1WW6A 3OYWA 2QQIA 2XHNA 3F2ZA 3EYPA 2B7YA 1X8MA 4PF5A 4XF4A 1DYPA 1K3IA 3QH7A 2QQPA 3VD3A 3LOIA 3O1TA 5E88A 1I5ZA 1LOFA 1ZVFA 2XWJB 3AP5A 4CCKA 1RMU2 1K45A 4CP9B 5BNQA 1QEXA 2OW4A 4BQXA 5I91A 3WDXA 1RTVA 3WF2A 2GMPA 3ZFFC 4E4DX 4ASKA 4K9SA 1H1MA 2YBPA 3LPGA 5FXXA 3ZKUA 2YMZA 3ELNA 2BZDA 2R072 3BI3A 3SITA 1VBB1 1R093 1W90A 2A6XA 3DKQA 1AF9A 4LKFA 2E33A 1J83A 4CUBA 1AXKA 1XNDA 4LITA 1IS4A 3VHOA 2QQNA 4FP2A 3THCA 1Q5OA 2X5IC 5LA2A 1E5HA 1Z7S3 3RDIA 5DUXA 3SCGA 4AEMA 5F3IA 2QNKA 3USUB 3RPQA 2WO1A 3H8XA 3BU0A 4CDXB 3JZVA 5B2GB 3OTFA 2RR11 3N7MA 2CSGA 1GP4A 1XE7A 2W92A 4GB31 4URTA 4YW7A 2OYZA 2QQUA 4XACA 5FZ6A 2J1EA 4F3JA 1HKDA 1REEA 4QPIC 1H9WA 5APAA 4EWDA 4XIKA 5DDJ1 1YEWA 4D7TA 3R05A 1NCRA 4PI2A 2EA7A 2OQ6A 1F9KA 4HSLA 1AR73 2VVEA 4OMCA 2QCSB 4CEYC 4IL7A 1YFWA 5FYIA 3FFZA 2G4IA 1EUUA 3A22A 1HX6A 1Z78A 2PQQA 2P6CA 3AP7A 5JXGA 4K3UA 4QHOA 2H0VA 4QD2A 4GMP3 3GDBA 1D4VB 3WNNA 4PJYA 4AR2A 5FP8A 2RS33 2EIEA 1CPNA 1C8M3 3C7HA 1WWYA 3I97A 4FQ4A 1UKRA 2R16A 3JD71 1CAWA 4A41A 4E2QA 3NSTA 1UX6A 2OUHA 3RZGA 3ROUA 1PMHX 3KT4A 2UY9A 4CEWC 4HETA 3PNAA 4YG6A 3HBZA 2B8MA 3RS6A 2ZTNA 5IHRA 1FV2A 4XMIA 4EZ4A 1MZ5A 2H0BA 4OFGA 5C3OA 1U5YA 3CKHA 1GZ9A 4WVMB 3IB3A 5H9RA 3THPA 2ZZQA 2EXIA 1ULEA 1WW7A 4ZU5A 3VBOC 3A21A 1VMJA 1CIWA 3WP6A 4XJUA 4OHXA 1LOCA 3NNMA 4LJHA 3VBSB 1YQ8A 2JIGA 4Q4X1 5F7UA 1QNWA 4P08A 1DF0A 3E5XA 3LWCA 3KWVA 3A7QA 5GLTA 4AI1A 3UKVA 1QJY2 1P8JA 1UXZA 4R9AA 1DQ0A 1ZRRA 4L92A 3ZIWA 3PJYA 4CCDA 4DQAA 1SDDB 4PDWA 4YVWB 1GQPA 2W1WA 3J7MA 1RUD2 4ITCA 4CP2A 5JSRA 2B42B 4YVSC 3T2PA 4XDPA 2BGCA 2JD9A 1LOEA 2J1VA 1C4RA 1DYOA 4Y5SA 4AFDA 1SCSA 5DN2A 4IEWA 3VLBB 2ZHLA 3TEYA 1CR7A 1UY4A 1ZZ8A 4CDWA 3S6PA 4CRQA 2XB6C 3DGTA 5FUNA 3KVBA 3CJIA 1HRI3 4WM8A 2RE9A 4BMEA 1S0GA 4R9CA 1FOD3 4PDWC 2HWC3 4P9JA 4UFJA 5KHKA 2E6VA 3GF6A 4TYSA 2OA2A 4RS5A 1UPIA 2PAEA 3IN9A 3AX4A 4AVTA 3WNLA 1PGSA 1QXRA 3VDBA 2VCCA 1BVVA 5FZGA 1G7YA 3OY8A 3VBRC 2NP0A 4D7YA 3IDBB 2WZR3 2Y0IA 1LENA 3FZ3A 4O9EA 3NL1A 5C9AA 1HRV1 4CDUB 4IUGA 3DPRA 3ZXFA 4HFSA 3V64A 1IPSA 5KBFA 4Z82A 1ZBA1 4MXWB 1OH4A 3LAGA 1HXS3 2ZAHA 1JOBA 1WW5A 5BY5A 5KXCA 1QOOA 1WGPA 4H2AA 4IEXA 3CO2A 1RUH1 4Q1RA 3VBFA 2PHTA 3W21A 4C0BA 3J7LA 1YO8A 2JG9A 1XRUA 2P2KA 3POFA 5BXXA 4AVBA 3JB8A 4HZFA 4UBGA 5LY1A 2HWE1 1PVC3 3ZFFB 3HEIA 2ZX1A 2BVBA 1HV0A 4QKDA 2ZBJA 1SPPA 1W0NA 3T0DA 3IPVB 4JGZB 4NRPA 1S2BA 4FTBA 5C70A 2H6BA 4DXZA 1EYBA 1LULA 4LE3A 5E1RA 1R1A3 4ATFA 1O91A 4GZ9A 5A1AA 3SKJE 5BNNA 5EIYB 3MF6A 1AR92 5FZ4A 3AZVA 4MADA 4JTNA 3VZLA 1RJ8A 2R063 1QKQA 2ZGPA 5T52A 4AGGA 2ZEWA 4DRRA 4FI9A 3MICA 5BNPB 4L0PA 3EB7A 3MYXA 1ULPA 5JXJA 1CAXB 5LK5A 1M4WA 4OLLA 2GN7A 5IUQA 1GKBA 4K8FA 3ON7A 3ZDSA 4Y5TA 2Q5TA 1HXS1 1W8WA 1LKNA 4Q0QA 1QXPA 3WX5A 3FFQA 4HANA 1ZBE3 2WFF1 3U78A 3PUQA 2SBAA 1FMD3 1XJAA 2LW8A 4MXVA 2XUMA 4CXWA 1PVC1 2BOIA 1PHMA 1W8OA 2BV4A 1QQP3 1ZM1A 1JYCA 3ETPA 4I01A 1DQ1A 3AMPA 3DECA 2GMMA 1W6PA 3WW3A 4AG4A 1C5IA 3ES4A 2WS93 5F1RA 3HAGA 3WDVA 1Q8SA 5JPMB 1S4CA 1FI2A 2IFWA 2JDMA 1J84A 2JE8A 4HOOA 1E5SA 1W2OA 5JSOA 1JYWA 1C1FA 3KSCA 3O12A 4NAOA 4HONA 4C1WA 5IVFA 1ZZBA 3O1MA 4YM0A 1VPHA 5GJ6A 1WCUA 4FPCA 3NV1A 3PVNA 4GAZA 2E7AA 5IAVA 4QQHA 3T3YA 3OD4A 1L7RA 5EZWA 5JCTA 1H4GA 5FK8A 4QDRA 4N53C 1NUKA 1QJY3 1PO11 5FMOS 1H2KA 2IVIB 3H1WA 4G3YC 4XE9A 2OS2A 4PQ9A 1VBD3 3AP4A 3V0BB 4OI4A 3T1MA 4XFAA 1AR72 5F5IA 5LA9A 1CJDA 2DF7A 3S57A 1JYVA 2ZMNA 1WCDJ 3KV4A 5ERLA 3O5SA 4QM9A 1ZBE2 3QCWA 2GP5A 2XVKA 1BEV3 5FZOA 3VD7A 4N43C 5T5PA 1GZWB 2HWD2 1PZ7A 2JENA 2R0HA 2WDBA 1LCLA 1RUD1 3ACGA 1XNAA 3O0VA 5FPZA 4A2UA 4Y1ZA 2XMLA 4V2WA 1N1SA 2AR6A 2WZEA 5C8CB 4Y1UA 3AKPA 3ZFEC 3AXDA 1POV0 4EN7B 1MS0A 3U11A 4CTEA 2WINB 1CAUB 4XTPA 2WNUC 2Y6LA 3T09A 5L7OA 1MQTA 3C7GA 4XDOA 5JI7A 5FO9B 1JZ3A 1HB4A 5C3RA 3WNKA 4DY3A 1PGW2 5AC92 4FPYA 4CP0A 4P9WA 2Y8KA 1LOBA 2WL1A 5FZFA 2R062 2W0XA 5CNAA 5IT6A 1RXGA 4BU2A 3OUHA 1C8NA 5FY7A 4OUMA 2JB4A 1UMHA 2PLV2 1J1LA 3URFA 4X6RB 2VXJA 3FLTA 2ZKNA 1NLQA 5ANQA 5J1XA 2VZTA 5FBZA 5FUIA 5FOJB 5KHHA 4R8HA 4H55A 4KG8A 3AZYA 3NW4A 1V6MA 2JKXA 3W5NA 1UXXX 3AC0A 4JCKA 2VO5A 2G9ZA 3QBQA 4WVVA 3I59B 2AC1A 2ERFA 2VE1A 1G6NA 3IBMA 5IK4A 1WLDA 5C5TA 4XJZA 1MR5A 4OZOA 5EYXA 4JC1A 3DYMA 3Q9OA 1BBT3 2WQ4A 1HRI1 4LBKA 1HQLA 4YW6A 1GICA 4NWWA 3T4VA 2Z79A 2ZMKA 1JN2P 3L2HA 1K5MB 1PO21 2WZ8A 5E6HA 2YROA 3ZM8A 4QPGC 2ADEA 2E7TA 4Q5OA 4Z2AA 1MS1A 1ZBE1 4HBNA 2BEOA 3DXUA 4PT6A 2P17A 2Z4FA 3JD72 1H8TC 4GIQA 1MEC2 1S0JA 2WNVA 3RYKA 4BWOA 4META 1TMF2 4I0BA 2MEV3 2QQJA 2FDGA 3KMHA 4AFBA 3VZMA 1WBLA 1DLLA 3L9JT 1Z0HA 5FJKA 3MUY1 2HWF2 2E53A 3LIGA 5ABJB 1EPZA 5LBBA 4ZPIA 5JZGA 3AVRA 4BQWA 2RJLA 4NVPA 3WNMA 4LLFA 4ZXEA 2MNGA 3GZEA 3ZSJA 1AR63 1GNHA 1W9TA 2KM2A 1KRIA 3HWJA 3VBHA 1XC6A 5CKMA 1O5LA 3TN93 1GWLA 1OVSA 3O1RA 2ZEZA 1E57A 3USUA 1ZZCA 3UGGA 1QF3A 1PO23 3HBKA 1UIKA 3ZN4A 3OB8A 3TBDA 3IZOA 1OI6A 1C28A 4RA0A 1DQ6A 1YJLA 2VZQA 3KCCA 2ZA9A 1QJX2 3R4SA 4QKFA 4Y1XA 5JOYA 4HKWA 4EZHA 1PZ9A 4JAAA 4P9XA 5BPXA 1YIPA 1R64A 4JKMA 3K3OA 4M00A 5J48A 1VIWB 2X10A 2WO3A 3JB4C 5LW9A 2RJ2A 4BDVB 1KXGA 3FHIB 5J37A 2XJPA 1LJ7A 1W6OA 2ZHMA 4LQRA 2VUAA 2IXLA 4O65A 2WABA 1VBC2 5IJRA 2A6YA 5EP9A 1MZFA 3B9CA 1UY0A 3NV3A 1EAH1 2DWRA 1OMIA 1UMIA 1YFXA 2W1SA 3OGVA 3BTYA 4NPRA 3VL9A 4L99A 5DZFA 2C5DA 1STMA 4LTAA 4KU7A 1VBA2 1H8TB 1OD3A 1FATA 2ZX3A 1AR91 4QX5A 4OHWA 1D4M1 5EJZB 4BIFA 2E31A 2VTXA 2Y6KA 3H7JA 3UETA 5CFDB 2EALA 3TWIA 4BLIA 1DBNA 4YM3A 1I1EA 4COUA 3WF0A 2RS51 5F37A 1OC1A 3WOGA 2IZWA 4LK7A 2AEZA 3I2IA 2P5BA 5DAXA 4CDQA 1ULCA 1JZ5A 5I8SA 1BXHA 2HWF1 3B94A 3CBNA 4QM8A 5EWSA 3S5QA 1V6OA 2DFBA 5FUPA 5H9SA 4YNIA 3RYRA 3GJAA 4CCMA 1L7QA 4CP9A 2HWB1 5FDBA 4GQ7A 5D8AB 2LTNA 4XMAA 1EPWA 3DYPA 2X09A 4SBVA 1IKQA 4I09A 2XBO2 3BYWA 1ULDA 3LZZA 3N35A 4GMP1 1RUC1 1RUI2 4FO9A 2XOMA 5L9RA 1GV9A 1RIRA 1YIFA 2X29A 5A7WA 3JQXA 2ARCA 4BHPA 2WN2A 4N90A 5K0UC 5BNPC 2ZXQA 2V73A 5FP9A 2V4VA 3DEMA 1RUH3 2IVJA 3VHRA 2WNEA 4IEOA 1RXFA 4DXSA 2WNOA 2Z42A 4NUBA 1AYM3 3EJKA 4QQLA 1J3PA 1IHMA 1R092 2PHFA 3POIA 3GHNA 4BM8A 1N1TA 2SLIA 1DIWA 1NA1A 1VMHA 3ATGA 1YYNA 3B5LB 3KQ4B 4K40A 4CXXA 4CDXA 1UF2C 4H14A 4AAPA 5C4WB 4CUGA 2FCTA 4M3CE 4BQYA 3ZFEA 1XE8A 2W47A 2WO2A 4IV1A 1X33A 4UF0B 2IXCA 3H1MA 3FHAA 1H6XA 4XF1A 1F8VA 2VOKA 2VXRA 3OBZA 4MHUA 3WF1A 1ULOA 3WHUA 2R30A 5FZAA 2J1AA 4BPZA 4H7LA 1RINA 3B7MA 4NPLA 2DVDA 1UCXA 3DN7A 4XOGA 4NN0A 2HWB3 2FCVA 2NPIA 3FUQA 2ARXA 2Y64A 4NHLA 1G9AA 2YPDA 4FOQA 3E6DA 3ZYHA 1O3RA 5EHDA 1VAVA 3MGUA 4DOUA 5A7SA 4XCAA 1AR81 4CCCA 3HN3A 1JU4A 2OT7A 3POJA 3WW2A 5F5AA 2QQOA 4PLNA 5F2SA 1PX3A 4QB6A 1RUH2 3ACFA 3NVCA 4QPYA 4AFCA 4P5HA 4MGQA 1UOFA 2RHPA 4Q29A 4AXOA 3BTZA 5CG9A 5FYYA 4RHV2 1RUI3 3HN1A 1O7FA 4UT5A 3VDCA 4XZUG 3EXUA 4P9GA 3KHBA 3WQ1A 5CFCB 3OCPA 4L97A 1AR71 3KLSA 5A3NA 2XONA 3AL6A 2EXKA 1AJKA 2GU9A 2R073 4G4FA 5EXOA 1ZYBA 3LSEA 4LMFA 2UYBA 3EQEA 1BK0A 1NQJA 1OLMA 4U2AA 5IVYA 2P4EA 4C1XA 4Z2WA 1W8NA 1UMZA 5I0TA 1XNKA 1O4ZA 5JI9A 4IEZA 1JS9A 4Q4Y2 2WWSA 5GLZA 3H8OA 4R52A 4M0NA 3IKWA 4LKDA 3JD73 4DO0A 5I8YA 5DDJ2 4AI3A 2CV6A 4Z92B 4RS5C 3BU7A 3DUIA 2WT2A 4QX3A 3UJOA 4XFFA 1H2NA 2Y6GA 4XW3A 1H30A 5KHJA 4IE6A 5IK7A 3JBG2 3BPSA 1OQDA 5CEHA 2RR13 3CJIC 1AR61 1VLNA 1QDCA 3I3EA 3ORJA 3UL2A 3GHMA 1S0CA 3AYCA 4W50A 3VHNA 2RG4A 4JKLA 2YC0A 3E5QA 4MX3A 4LOSA 1DZQA 1J3RA 1Q8VA 1RUJ1 4HSJA 4QHZA 2R043 4UFMA 4XBLA 5ANNA 2WAAA 5FXZA 3ZR5A 4F7ZA 5LEJA 4ISRA 4Y33A 1MEC3 4IETA 2R32A 2VQUA 2VW1A 4LBQD 4B29A 3O1UA 2CGNA 5DG2A 2JEMA 5FZBA 4EN8B 4A42A 3A0KA 4KWUA 5GALA 3I2DA 1VRH1 5HCAA 1IPJA 5LA0A 2W5FA 1UU4A 4GULA 1NOVA 1EV12 4XQ4A 2Z5WA 3TYJA 4IEUA 4BQ5A 2V4AA 3H50A 4NROA 3ZN6A 1QJFA 3SCHA 2DTWA 4LORA 3K2OA 4CCOA 5FLJA 1SBDA 4CPBD 1GSLA 3MDPA 3VZOA 1LHUA 5A80A 2WWUA 2C9KA 2HWC2 1RUG3 3ACLA 2JE7A 1QQP1 2JE9A 2NZ9A 2Y38A 2A3YA 1UL9A 2XVGA 1NZCA 4RFT0 1D0HA 4W65A 4Z8BA 4XJWA 1UO9A 5EV7A 2RJKA 5FZOB 5HBAA 4HK9A 1PIV3 4M4PA 3ZYIB 1SQ4A 2WR9A 4J25A 4XJAA 2I2SA 3MBWA 4LR4A 4Y3OA 1SPPB 1ONAA 3WP3A 4CEWA 3WG2A 1Y3TA 4HVOA 4TXWA 4JGZA 4X8NA 3SNMA 1JZ7A 1KS5A 1S0DA 3NNFA 1D0GA 2R1BA 4IW3A 5AFBA 4XXPA 3KT7A 4NIHA 3VN4A 3O7OA 1QXJA 4Q4V1 3JCIA 3K77A 4NRQA 4AI2A 4NAMA 4KNCA 1OH3A 3HNMA 2D6LX 4MYEA 5FYVA 2WYSA 2FDHA 5JDBA 1IG0A 1N1VA 5C3PA 5IVBA 2W9XA 5H9QA 3T0AA 2DUPA 4QHBA 2VM9A 3OPZA 1SLCA 2LROA 1O5UA 4S2DA 2ARAA 1QJU1 1VBD2 2Q1MA 3ZSMA 1WW4A 3VBUC 1JHNA 5I0DA 2BGPA 1MACA 1VBA1 4W8JA 1ULFA 3S7IA 1K12A 2W68A 3DCQA 1O3SA 3JUUA 3MLLA 4ISQA 4YARA 2C6SA 1UD1A 1N3OA 5FP4A 1LHVA 1FAYA 2ZX0A 4WVMA 1IOAA 5LEKA 1W6QA 2JDNA 4EROA 3NO8A 3WHTA 2B4KA 1OQ1A 3WF3A 4F8AA 4WM7A 2N7GA 4MGTA 2BFUL 3A0NA 3ITQA 2GMEA 4LUKA 4AW7A 4YFWA 2BP6A 2YU1A 3VBSA 4YW2A 2ENRA 3PMEA 4Q26A 3LFMA 4ZZ8A 2VMDA 2FD8A 5CADA 1US2A 1YQ5A 1W04A 4AI0A 3VUOA 1RHI3 2KA3A 2BFUS 3ME2A 2FDIA 4B1LA 4AQ2A 2BNOA 2W46A 5F8PA 3AMHA 2BRTA 4QPIA 1H9PA 2Y26A 4GXLA 5IYYA 1V0AA 1UZWA 3LEGA 4LE4A 3VKFC 4I0WB 5A7NA 5FZ9A 5FJHA 3CLPA 3KD4A 4QXHA 1PNGA 2WA3A 2FHRA 4KBZA 1J1TA 4FPJA 4Q0PA 4J1XA 4UAPA 1BZWA 2XJSA 3WCSA 2VZPA 2YC2A 3N9LA 4AHYA 4Q4Y1 4MH0E 1UN1A 3CJIB 4C8DA 4FPEA 2EVXA 1PK6B 4Q4V2 2CWSA 3ZMNA 3JQWA 4TZDA 5LASA 4QDSA 1LECA 2VPVA 5HXMA 3MI8A 3AMQA 5FZMA 4AYUA 1AR93 3AP9A 1FNYA 4IGQA 3V65A 5IFTA 3H3ZA 5BNOC 1LEMA 2WIIB 5FWJA 5A6YA 1DFQA 2C0ZA 4XFBA 3D5OA 5C4WC 1YFYA 2MHFA 1QOSA 3J26N 4N9HA 1WBFA 2ET1A 3MIBA 4IGOA 4IV1C 4TSVA 4UBHA 3X29B 4XC9A 2UWAA 3NKTA 5ACA2 5LK7B 2Y6HA 1XSRA 3OGSA 4P5YA 3DPRB 1BCXA 1I3HA 4RD7A 4NHMA 2ZGUA 1PGL2 4UFLA 2W87A 2Q8CA 1QNYA 2XKOA 4Q27A 5FLIA 5BUVA 4QPGB 4DINB 1POV3 1US3A 5FY1A 4WVWA 1MVEA 2RMU2 1CAWB 4HN0A 4Q4W3 3QACA 2D6MA 3RI9A 1HW5A 3AZXA 1RJ7A 2IXJA 4LBJA 5FY0A 1UX7A 4NJ4A 1EV11 1O8SA 2D6PA 3AB0A 4RQPB 1NE4A 1U5XA 5FZ7A 2FMDA 4G9SB 4XF3A 2I74A 3MUZ1 1FXZA 3ILFA 1B35A 3PU8A 5EQUA 4YZ1A 2JXAA 4ZHNA 5FZ8A 2QUOA 3T08A 1Q8OA 1V6NA 2HWC1 2YFZA 2WRAA 2Y6FA 1ENQA 3O1OA 1KJLA 4XHXA 5A6QA 4IV3B 3ZFGA 1KDMA 1RGSA 2WUHA 4H7MA 5CFDA 3WY6A 3PLQA 5FQ0A 1CESA 2OQ7A 4N8MA 5FYBA 1DZTA 5JWPA 3C2UA 5DZGA 3GGLA 1BBT2 3WG3A 1POV1 3VKOA 1OVPA 3R4UA 5DG1A 2P1BA 3G6JB 4GH4B 4E2GA 2ZGTA 4XUOA 4CYDA 4XJ9A 2QDRA 1OQEA 1IKPA 1W8TA 4EJRA 2YGMA 3Q8AA 4ASLA 2XL7A 1W2AX 2K9ZA 3OEBA 1BK1A 4ES8A 2LS6A 5FPXA 4KG0A 3ZO0B 4CDWB 2VL4A 2ORXA 5T55A 4DFSA 4JGYC 3GNEA 3OUJA 5FP3A 3DF0A 5D1IA 1UIJA 3AYAA 2D3PA 1WA6X 2D98A 3UKTA 2I45A 3DKWA 2WZPP 2WYFA 1PM7A 2B9VA 5CKQA 3WDUA 2X5IA 3MV01 2XJRA 4OQ9A 4NRMA 1AJOA 1X9PA 1CWPA 4GJYA 2VOTA 5A3MA 3WG1A 4CCEA 4OI0A 1QY4A 4K6BA 2C9AA 4IQPA 3OY8B 1AYN1 2PXJA 4IESA 1ZZ7A 1AYN2 2C24A 1WKYA 2ZEXA 2DBIA 3EMRA 3I2HA 3OD0A 4OI2A 3N9OA 3Q8CA 4AE2A 4HG6B 5T54A 2ZJCA 3SKVA 1CZVA 2VOWA 3AZZA 4H3WA 4UF0A 1YCIA 1NXD1 5CVRA 1VB4A 2VUDA 3IIIA 4PI0A 1DQ5A 1F35A 2D6NA 3KB5A 4R9BA 2MPFA 4CDUA 2BJSA 5A3LA 1CZTA 1W2NA 1OKQA 2W52A 4D69A 1VBB2 3OBRA 3HMYA 3J4UH 1LHWA 3GALA 4JTOA 4QWNA 4V2VA 3PTRB 5FZLA 3B9IA 3RMXA 5FYTA 3ETQA 2O0OA 4QB1A 3RYPA 2WQ8A 3VBFB 2OVUA 4YZ2A 2CGOA 3AK0A 3WF4A 1MS4A 1GWMA 2HH9A 2VQ0A 3ACHA 4FPFA 2YYOA 5A1LA 1XU1A 4GMP0 5A7OA 4R4ZA 4E4SA 4CU9A 2ORZA 3A4UA 5CFDC 5SV5A 4K7JA 5A70A 1IPKA 4ASMB 3H3LA 4JQRA 2JG8A 2IXKA 5FMOL 3SLIA 4BISA 3NQHA 2VZUA 1A8DA 3O1SA 1WLCA 2A70A 1NYWA 3V0AB 2PTMA 1SLLA 2VMEA 2VUCA 4KWJA 4QT6A 5FAXA 1ZRFA 3HR9A 1COV1 2O8QA 5FPUA 4A3ZA 1NLRA 4DEVA 3HJRA 4AHWA 4M3CB 4Y20A 4AQ6A 3I2JA 1CPMA 2G9GA 4JDOA 2PAMA 3IDCB 4FP3A 1MS3A 4CCLA 3RZMA 4NIDA 2R041 4B7EA 2J1SA 4GALA 2XBO3 2A3XA 1WMEA 3AYDA 1QJU2 3HQUA 4JDNA 4L8QA 1UOJA 2BW8A 4LHKA 1EUTA 3IWZA 1YUDA 1RHI1 3K3NA 5CAZA 3WV6A 3GBFA 1RHI2 2Q4SA 1PIV2 5D8AA 5DZEA 2VNVA 5GZDA 5HXVA 2ZHKA 2WQZC 1DQ2A 2ILMA 3MV11 3P3PA 4HMZA 4FXKB 4MGYE 1EAH3 1WCKA 5A7WB 1GOGA 2XXZA 1AYM2 3VDDC 1UYXA 2YBKA 4FOVA 5FZIA 2K46A 1RMU3 4SLIA 1G9BA 3H8RA 4CCJA 1S2KA 3D3AA 4LKEA 3WD5A 1OUXA 3MW4A 2BNMA 1UOGA 1S0FA 3OUIA 5A3WA 1REFA 4CDWC 4GKYA 5I0SA 1AL23 2ZAAA 3UGFA 3UYJA 3LSDA 3LA7A 1UYYA 3J7NA 2YUEA 2GALA 3OBAA 4XDQA 3WINE 3ZXKA 5ABJC 5CKNA 1V6LA 5T5LA 4BQ2A 1JZ4A 3PDQA 2W08A 1SFYA 1T6BX 3ZFEB 5C33A 3FL7A 2W91A 5JIAA 1GWKA 2H6CA 1YJKA 1GFF2 1KS4A 1YXWA 3RSJA 3M70A 3CMGA 1SLAA 1HV1A 3NJYA 2VZOA 4BIOA 1AXZA 5DQ0A 1VALA 3ZIXA 4ZU7A 2A3WA 3VBRB 1IQAA 2VMIA 1G8WA 2WZR1 3D4KA 1JUIA 3KQRA 3VBOA 2ZGMA 3ZYGA 1XNCA 1OFSA 4GWJA 3ZN6B 3NNLA 2Y33A 2YU2A 4A7KA 4U36A 1HXS2 1VBA3 1LU1A 2YBSA 5A7QA 4BYYA 4CVUA 2HYKA 4RFRB 5T5JA 3DL3A 1G9DA 1XNTA 1GLHA 3GZUC 3BUCA 5C3SA 1FOD1 1VE0A 4RGKA 4W4ZA 2ID4A 1V9U3 4OHYA 1A6CA 3PURA 1HJGA 1AR62 3NWKA 5JOXA 5FOBB 3CNAA 4JRAA 3AKSA 1VAKA 4OCTA 1M06G 4DUXA 2WBKA 1GOHA 3WW4A 2VW0A 1Y9QA 1V70A 2BVVA 2DUQA 4IE4A 5IFPA 2Q1FA 1D7PM 2GC2A 3LFIA 2FCUA 3PVOA 4QXBA 2OPKA 3GZAA 3JBG3 1BQPA 2UWCA 2TBVA 4XTMA 4A6OA 4JQTA 2UURA 4UOJA 1R091 4BJ0A 1VRH3 1XYPA 1ZBA3 2V5DA 4IEVA 4AGVA 3WDTA 4FOYA 2F4PA 5ISLA 4BK4A 4ZU4A 5FXWA 2JDKA 2X8KA 5F6KA 2GN3A 1MS5A 1BEV1 4E27A 2XJVA 3HQXA 2IXIA 4YW4A 1W6NB 4MHRA 1DGWX 3R4DB 1H8TA 1HB1A 2AENA 1OXCA 3LPFA 4QX7A 4LO8A 3ENRA 4YGBA 4FFHA 1RVF3 4AWDA 5C8CC 3TN91 1U0AA 2Q30A 3W5MA 4AAXA 4FVVA 4M3CF 3J8F3 1YLLA 4AI8A 5EJ1B 2CDOA 4C0HA 3WDWA 5AC93 1YNAA 1JH5A 2ZKLA 1V9U1 5LRSA 4BXFA 2LALA 3P6BA 2BPA2 1UKGA 1W6QB 2DCZA 5FZ0A 1IS5A 2W3JA 1H1AA 2LM3A 2J42A 4D6QA 2EIDA 2WC2A 2GC0A 2ZX4A 3CEWA 3N3HA 1A78A 4URAA 1GOFA 1ND3A 2VW2A 1VRH2 4ARYA 3HPNA 4PIYA 4S2GA 1LGCA 4LO7A 2R071 1SLTA 2ARBA 2OX0A 5KHGA 2VJXA 2WLPA 3OG2A 4B3NA 1JI6A 1V6KA 5JZGB 2QQMA 4BQ4A 1W0OA 3VDAA 1EAH2 1W9WA 3M3OA 4PIZA 1RVF1 4QPIB 3USSA 3HT1A 4CU7A 2QKDA 5LBFA 4D7SA 1H6YA 5BV6A 4YVSB 3VBHB 2GH8A 2CWMA 2WSUA 4MGIE 4P9IA 5F3EA 5FCCA 4MZUA 4XYXA 4NOTA 1CJPA 2BYVE 1F2NA 1NA1B 2XL9A 3ES1A 4GWNA 1F5JA 4NO4A 1NA1C 1AL22 4YM2A 4GA9A 4AK3A 3POEA 1PK6A 1LESA
chains in the Genus database with same CATH topology
4RR3B 4IV1B 4GB32 3AKTA 3VZJA 3MW2A 2OUJA 3SXWA 3ILRA 5CIRA 1DGLA 1R081 5AVPA 5GLWA 4DY5A 2V5YA 4FPOB 4YFZA 4EV0A 1TNRA 1H0BA 3AP6A 5GLUA 3BIWE 3THTA 2GDFA 3ZMOA 4RSUA 4BMBA 3UK9A 1C3HA 1YWKA 1W6OB 4WVZA 3WDYA 4LUMA 2F6BA 3W58A 3FUOA 4HL0A 4Q4X3 5DUVA 1MVQA 2RS11 1TME1 3BB6A 4JV4A 1GR3A 2VNRA 3UJQA 4FPLA 4XFCA 3HD8B 5K0UA 2QZ2A 1W39A 2XHKA 2WFF3 4KGGA 3MIHA 1XYNA 1AYM1 4YW5A 3WZ1A 1COV2 4RQPA 5K8SA 1DG6A 3LA2A 3M3QA 1R083 1AX1A 2JDZA 4CDQB 3PHMA 2A7AA 1BEV2 2DYCA 2FQPA 1OPOA 5CFCA 5J98B 2DU0A 4LO4B 2WLQA 3QD6A 3D82A 4HVRA 5C8WA 1Y7BA 2Q0AA 3VKLA 4CDUC 5FLHA 2PLV1 1PVXA 2AYHA 2HEYF 4MGKE 3OGGA 4KWKA 3IIAA 5TSWA 3M3CA 1CD3G 3ILNA 5H9PA 1S0EA 2GNTA 3ZSEA 3MF9A 2ZGSA 4ONUA 4OVEA 2UWBA 2WSVA 5CFCC 4E4ZA 4ATEA 2PHWA 1TMF3 4I0AA 1RUF3 4Q1PA 4MGZE 2JD4A 2YY1A 1WMDA 3BTAA 4AHZA 3TNPB 4HPKB 2HEWF 2EIGA 4B7KA 4ES9A 3U4XA 4XEZA 2JJ6A 2RS53 1PVC2 2XJUA 2R061 4LBMA 1WCSA 3B69A 4UXAA 3GBGA 1RUC2 1PO22 4XETA 3K51A 4BQ1A 2AGSA 3SH3A 2UU8A 2GZWA 4YVWC 4K1ZA 2XJQA 5GM0A 1N3QA 3N7JA 1AHSA 1VBB3 3B00A 1SACA 3N7KA 2AREA 1AR82 4B4QA 2CL2A 3H1YA 4YGCA 4QPGA 3NAPB 3M7AA 1LODA 4LT5A 2VECA 1G9FA 2VOVA 1TEIA 4N7UA 4UW4A 1HLCA 2DVGA 1QGLA 4P9LA 4D3WA 3BPZA 3U07A 3WUCA 1HRI2 1DGRA 1I6XA 4DZGA 3QOPA 4CEWB 1QJZA 3M8LA 3FBYA 3MEPA 2UYAA 2QJVA 3HIFA 3PTYA 1AL21 1XU2A 4S2FA 1QHDA 1D2SA 1SFNA 3H8UA 4IV3A 2GH2A 4KQ7A 2RMU3 4MUVA 4Y5Z0 3ZFGB 3ZSKA 3PVEA 5JIUA 4M3CA 4Y20B 2WZR2 5FREA 1SBEA 5A32B 3POYA 4YW3A 2B39A 4LBNA 1H2MA 3MIDA 2RS31 5L19A 1ASJ3 1UU6A 1UPSA 2D7FA 4LBLA 2YDEA 4UW5A 4YSFA 3AZWA 2FZ2A 4GH4A 1ZREA 3POSA 2E51A 4NHKA 4YGEA 1X50A 4AVVA 1FOD2 4L2NA 4OULA 4NR1A 2V09A 1VBD1 1X8EA 3J8F1 3MIFA 2GC3A 1IZ3A 2GNDA 3RG0A 4JVAA 3B93A 4R9DA 1S0IA 2NM1A 4WM7B 5I93A 2DVAA 3OGJA 5F5QA 2RMU1 2BWAA 1GZCA 2X5IB 5HCBA 1WD4A 5JSPA 4B4PA 2BNNA 2O8OA 4GB33 3H7YA 5CBLA 1C8M2 4EN9B 5T3NA 1OPMA 4I3PA 5EFUA 1KD7A 1W6MB 1HQNA 1ZRDA 2XBO1 4JDMA 5IK5A 3H3UA 1PMIA 1O4YA 2EAAA 2HWD3 4RHV1 3ZSLA 4AQSA 4CEYA 1KITA 5K9YA 1QQP2 4YGDA 4PLMA 2JG8C 4Y1VA 4AFMA 4QXKA 3AMMA 1OOPC 4LLOA 4XFIA 3I54A 3VDDB 1YHFA 4DB5A 1FMD1 1QH6A 1OLQA 4XJ8A 1UZYA 2WJSA 1ULGA 2XG3A 2XLAA 3O0WA 2XGXA 2P37A 4COZA 3VBUA 4OI1A 3I4IA 4Q8KA 3KS7A 1ASJ2 1OA2A 1QMJA 4PBOA 5FTTC 1NLSA 2PHRA 3ZPYA 4Q8LA 4Y22B 4LHNA 4MV2A 1D4M3 2HKXA 2WKKA 3WQ0A 3FWEA 4HN1A 3GZTB 4XXAA 2EAKA 3BOWA 5GZFA 5BNOA 4FPHA 4NWVA 3C3VA 4B4RA 3M3IA 1MS8A 5BNNC 1SEFA 2Z69A 2QFEA 4PIXA 3FC0A 3O14A 4BZ4A 4R4XA 2WT1A 4S2HA 1QJX1 3AFGA 5A33B 4GKXA 4Q4Y3 1WMFA 1B35B 3WG4A 3WUDA 4AF9A 5JPNB 1RUF1 4EWAA 4FCAA 5CA6A 3MPPG 1LB2A 1FPN2 1Z7S2 4QQOA 4C91A 1JYIA 4I02A 4AEKA 3VV1A 1LOFC 3WLUA 2VMHA 2VULA 4YZ5A 3D6EA 3AYEA 4N9IA 2B45X 4I3GA 1RUI1 4YLZA 2VQAA 1W0PA 1IS6A 1CAVB 1LR5A 2RM21 1AVBA 3QLQA 2PHUA 3KGZA 3OYWB 2ET7A 4M0HA 4K1YA 1V9U2 3MIEA 2A5ZA 1RC6A 2LUWA 2RS52 5CU1A 3EBRA 3MW3A 2IXHA 2RS13 2CNAA 3VBRA 1KFXL 5DUWA 1C5HA 2BUKA 2R042 4LHLA 4IEQA 1EP0A 1ZZ9A 3KCYA 2WA4A 3OF1A 3ZXGA 1XQNA 4LO5B 1VBE1 3M4FA 3IM0A 2D97A 3MLJA 1FV3A 2HWF3 1X82A 4N43B 2D43A 5JOWA 1PO13 1HRV3 2GNBA 1GYKA 4IERA 4JGZC 2C1FA 3OBTA 4IV3C 1BKZA 2IC1A 4Y26A 2JKBA 3PVBB 4YRDA 5E89A 3B01A 2E9QA 4JGYB 2A71A 1UU5A 2XJTA 1CONA 1OA4A 5I0UA 1O3TA 3S0MA 4XQWA 4N53B 3WVJA 3ALQA 5BYNA 3WR0A 2HWE3 4WZFA 3O0XA 1ND3C 2BQPA 2CGPA 4YW1A 2NQYA 1RUC3 2IFRA 2BBVA 4TWTA 2GNMA 4WV8A 1W6NA 2GC1A 1RUE2 2AH2A 1FT9A 5EYYA 5L73A 3MLKA 3S30A 2P34A 4WM7C 4ZXKA 1KDKA 3ST7A 1RUJ2 1NG0A 2CY6A 3R0RA 2TUNA 4HLTA 5J96B 4E9KA 4AEDB 1K5MC 4HK8A 1NE6A 3PJQA 5FQ0B 4IEYA 2VG9A 3T2TA 2VY0A 3VBFC 2HEVF 4XQDA 2Q1ZB 2ZPXA 3KCXA 3NV2A 4Q0UA 1J59A 2X53S 5T5OA 1NY71 1RUJ3 3LKJA 3ZXJA 1J58A 2B9UA 1XXNA 4W6WA 2AZ5A 2HWB2 4E2SA 4QGLA 1Q56A 1QJU3 4F83A 3RI8A 4PBPA 1X7NA 4QU2A 2PELA 5F9TA 1TE1B 4FBFA 2P3IA 4RHV3 3R6SA 1DDLA 1ZRCA 2ZABA 3FLPA 4GWMA 4XFHA 4EN0A 1YRZA 1OFNA 2E7QA 1MS9A 1F5FA 3WT3A 4C90A 2D3RA 1Q8PA 3KM5A 5JAXA 3MZHA 1SLIA 1ALYA 5JOZA 2ZHNA 1S0BA 2XH6A 1DQ4A 3VBSC 1COV3 4L9BA 3WQ7A 4WM8B 3AKRA 1UZZA 1WLTA 3JBG1 4HT1T 3NAPC 4BOWA 1RUOA 4W6YA 1CGPA 4Q4X2 4GH4C 2VOXA 2D6OX 2FBEA 1C1LA 1OOPA 3ZYRA 3MPBA 3S7EA 3SHRA 2PHXA 3SMHA 1ZNPA 2OZJA 5SV8A 2EF6A 3APBA 4UW6A 1U5IA 1HQWA 3UV9A 2XVLA 5KXDA 4BLJA 4A7ZA 2JG8B 1TMF1 3V56A 3NAPA 5JMCA 1TNFA 5FO8B 4AQTA 4KL1A 3V0AA 4XF9A 4LNVA 1ND2A 1B09A 3ZFFA 1AL0G 5AC91 2FMYA 1SLBA 1ZZ6A 5I0RA 3IPVA 1PO12 3U10A 1GBGA 3E6BA 5J3UA 3E6CC 2RM23 4Z07A 4WZCA 2D5HA 1T6GC 1URXA 1AUYA 5A32A 4FPGA 5L36A 1NQDA 1NXMA 1O4TA 2PYTA 1DYKA 1GQHA 3RNSA 1C8M1 3M1HA 4PDWB 3GBWA 2MEV1 2DVFA 3VKMA 2EXHA 4RGGA 3VKNA 1CX4A 1V6JA 2D3SA 2PFWA 3LGRA 1R1ZA 2DTYA 3INAA 2ES3A 1W6PB 2WNUA 5L7OC 5GLVA 4FPKA 2XPJA 3N7LA 4HPKA 4XFGA 4J1WA 3RJRA 2D6KA 1BJQA 3FJSA 3IDEA 5DUUA 2JICA 5GZGA 4XBNA 3VZKA 2CAUA 2GSYA 4XIOA 2R49A 3U0ZA 1LGNA 3D8CA 5CB7A 1NCQB 2ZGRA 1LHOA 1UAIA 1ZBA2 3ZXDA 1WA4A 3VBOB 3TOJA 1ASJ1 1VJ2A 2YGLA 4LBQA 1NY72 1TME3 1Q8QA 4XF0A 5C9AB 3ZXEA 4FTSA 4CEYB 3TNQA 2CAVA 3RWNA 3UKNA 1REDA 4MXWA 1RL3A 4UW3A 4RL7A 4BCUA 4FXGB 4COVA 4I2OA 1VBE3 1NCQC 3T1LA 3TB0A 1DGWA 4L11A 1GZWA 4LEJA 4RR3A 2PAKA 3E97A 5CG8A 4P9YA 4KBBA 1RITA 3BODA 5FFOC 4N7IA 1EY2A 1FNZA 1LU2A 2PHLA 4X6QB 1BBT1 2D44A 1NCRB 3D0SA 3VBUB 1C57A 4KH9A 4AFAA 1RUNA 3VGIA 3RMYA 1OD5A 5L7OB 4Y22A 2TEPA 3NJZA 2PLV3 5JVVA 4ORFA 5BNPA 2D40A 2DCJA 2IWGB 3BCWA 2R0FA 1AXYA 3KT1A 1CAXA 2JECA 4JRLA 2VGDA 4FAGA 3ZYPA 1XNBA 3HT2A 1RB8G 1QH7A 5GKAC 4HVQA 4CDXC 1LOAA 3ZXLA 4B8EA 3VZNA 1D4M2 4AGRA 1LEDA 1GNZA 4MSVA 1FYUA 1X36A 1V00A 3WXPA 3ZX7A 2P3JA 2UY8A 3I59A 1JBCA 4W6XA 5J7MA 2DUOA 3CJXA 1H4HA 4AHXA 1L3JA 1RMU1 2DU1A 4K20A 1R1A1 2QZ3A 3K48A 1MZEA 1ND3B 4QMAA 4XBQA 3RJ2X 1QWRA 2VU9A 4Y1YA 1CAVA 4HKLA 4FTEA 1AYN3 4A3XA 1YI9A 1PZ8A 2ZGQA 1W6MA 1VBE2 4OUSA 1A8MA 4YVWA 1BMV2 4EWEA 4QQPA 4KWLA 3ZVXA 4XPVA 4YVSA 4YZ4A 3E5UA 5JR7B 2XKPA 4IEPA 5I8TA 3WNXA 1DHKB 4Q0VA 1VBC3 2YPJA 5AVAA 4FOWA 5GZCA 4YM1A 3POWA 4KGQA 2WS91 2CYFA 2VVFA 2BWCA 2WS92 4BA6A 2WT0A 3L2YA 2ZS6B 1VB2A 4RS5B 2NMOA 3TRSB 1N3PA 2O1QA 2OZ6A 5KXBA 2KXLA 5C8CA 1A3KA 3WP4A 1Q3EA 4YG0A 5F6LB 1BVP1 2DCTA 2CTVA 5KC5A 2ETEA 3CF6E 2W39A 1SMVA 1MQTB 1VP6A 4HKOA 4RR3C 1PNFA 3FLRA 2P3KA 1TME2 1W2UA 3FBMA 2TNFA 4XZPA 5J09A 3H0OA 1AX2A 1VAMA 3B02A 2FZ1A 4INDA 4IXLA 1OLRA 4CP1A 2WNVC 1V6IA 2A73B 3VBHC 5K0UB 2QVSB 1H2LA 2NN8A 4ZKTB 5KWRA 1AR83 1WUVA 2DV9A 1IS3A 4QGNA 1RUF2 2JG9B 1R1A2 3SH4A 3SISA 4LA3A 2DFCA 5JZGC 3PMSA 2OIIA 3GYDA 5D8AC 2MEV2 2PN5A 4COWA 4Y4YA 2EXJA 2Q8OA 5E16A 3WP5A 1S1AA 4Y24A 2PA7A 4Q4W2 3W59A 3ZXAC 5E8AA 1LGBA 5GZEA 3N36A 1CN1A 4WBBA 2NMNA 1APNA 2YHJA 1H1IA 4YYOA 2XLFA 5DDJ3 5ACA3 5IK8A 1FMD2 4AEDA 5HI0A 1GANA 1LTEA 2ZX2A 1JUHA 4YG3A 5J36A 1K5MA 1CQ9A 1CVNA 1MEC1 1J3QA 2ZMLA 1FPN3 1DZRA 1HIXA 5AFEA 1LHNA 4DRVA 3LOBA 1KFUL 2WFF2 1MZ6A 2B46X 4V1PA 4WM8C 4TLFA 1G86A 3ASIA 3MIGA 5ABJA 3AJZA 1UW8A 4M01A 5C6CA 1I9RA 1RUG1 4CZSA 4OHVA 1LOGA 4X8PA 3H9AA 2A6ZA 4MVTA 5ACA1 2JX9A 1N1YA 3FX3A 2D93A 3OJBA 2YV8A 5LRRA 3AM2A 4QQ2A 3CL1A 3ZN5A 4O9GA 1ENXA 2XWBB 3IT8A 1FPN1 4Q4V3 4YZ3A 1R082 4FAHA 5EJ3A 4QGMA 4FSJA 2ZACA 3AFKA 1LRHA 2WFPA 1SBFA 2A6VA 4KU8A 4XHBA 1VBC1 1DGRN 2DCYA 3I7DA 4JGYA 3VDDA 2RM22 1ND2C 4LO6B 4N53A 4EN6B 4AVCA 2ZOEB 1DU3D 4J6GA 5JLVA 4AEDC 2G9FA 3AJYA 2K2SA 4Q2FA 2R6QA 3M2MA 3RQ0A 3LB9A 3AXEA 5DXDA 4AVSA 5BNNB 3N4MA 1CAUA 1F31A 3M3EA 1ZRFA 3G7DA 2AUYA 1TQ5A 4D94A 1ND2B 1MQTC 2ZGLA 2RS32 2R1DA 3IMNA 1IGOA 4BH9A 3MFCA 2GAUA 2ATFA 3VHPA 4AVAA 3QH6A 3D0JA 4LULA 5BNOB 1AZDA 1PGW1 3ZYJB 2VUJA 1U12A 1QU0A 1SDWA 4Q4W1 2PHDA 2QDNA 1GQGA 3AMNA 1RVF2 2I07B 3ECQA 1XYOA 1U5ZA 1JOJA 1D2QA 3P3NA 4AEJA 3LA3A 5FO7B 2ZZJA 2Y0OA 2XLGA 4BE3A 1H8VA 1S55A 5FRAA 1OA3A 4OZXA 3SH5A 1QOTA 2VNOA 1Z7S1 5K7PA 2NYYA 5KHIA 1G9CA 4P14A 3RZZA 2D5FA 3MFAA 3BOPA 2WNUB 2HJIA 5KC6A 3KZ4C 2VVDA 3FE5A 4RQPC 1ENSA 5C4WA 2ZCWA 4COYA 2JG9C 3W9AA 3JU9A 3LCPA 3TN92 4LBOA 1ZX5A 2DVBA 2VH9A 4DMIA 3V0BA 2WNVB 3AKQA 4RGAA 4XILA 2RR12 1NCQA 1KQRA 4A7YA 1OOPB 5HCFA 2VNGA 2ZGKA 1QJX3 2VMGA 5KXEA 4LBQB 1JXNA 3NKGA 2YZ4A 4DNYA 4MLOA 3EO6A 1RUE3 1EV13 4OHZA 1KJRA 1AX0A 3BALA 1BYHA 4PCRA 3DV8A 4FT8A 4Q0SA 4LA2A 1QDOA 2DCKA 2QE3A 3J9SA 1FX5A 3J8F2 2HWE2 1B35C 4N43A 1RUG2 2BTVC 2NLRA 3B3QE 3CU7A 2A6WA 1NCRC 1N47A 3TAYA 3WW1A 1Q43A 1PGL1 3ZFGC 3DPRC 1QJY1 2HWD1 1HRV2 3SCFA 1O3QA 1WLWA 4DPNA 1OSGA 1YFUA 5A33A 1OHFA 1VR3A 2YXSA 2ZGNA 2DURA 4FQZA 1SCRA 3NV4A 3I8TA 4DS0A 1Y43B 1RUD3 1HDKA 2Z2SB 1ENRA 4CDQC 4K21A 5C9AC 3EHKA 2E63A 1JW6A 4I30A 3WCRA 1WD3A 1PK6C 2K0GA 1BMV1 5T50A 3VL8A 1ZA4A 1RUE1 2ZGOA 4PLOA 3RRDA 3KGLA 1JTZX 2RS12 3FMGA 1YI7A 1PIV1 2A75A 2B5HA 4Z1VA 1WW6A 3OYWA 2B7YA 1X8MA 4PF5A 4XF4A 1DYPA 3QH7A 2QQPA 3LOIA 5E88A 1I5ZA 1LOFA 1ZVFA 2XWJB 3AP5A 5BNQA 1RMU2 5I91A 2OW4A 3WDXA 1RTVA 3ZFFC 2GMPA 4E4DX 4K9SA 1H1MA 2YMZA 3ELNA 2R072 3SITA 1VBB1 1R093 2A6XA 1AF9A 1AXKA 1XNDA 1IS4A 3VHOA 4FP2A 1Q5OA 2X5IC 3RDIA 1Z7S3 3SCGA 4AEMA 5DUXA 2QNKA 3USUB 3RPQA 4CDXB 3JZVA 5B2GB 3OTFA 2RR11 3N7MA 1XE7A 4GB31 4URTA 2OYZA 4F3JA 1HKDA 1REEA 4QPIC 1H9WA 4EWDA 4XIKA 5DDJ1 4D7TA 3R05A 1NCRA 2EA7A 1F9KA 4HSLA 1AR73 2VVEA 2QCSB 4CEYC 4IL7A 1YFWA 3FFZA 2G4IA 1HX6A 1Z78A 2PQQA 3AP7A 4K3UA 2H0VA 4QD2A 4GMP3 1D4VB 4PJYA 2RS33 1CPNA 1C8M3 4FQ4A 1UKRA 2R16A 3JD71 1CAWA 4E2QA 3NSTA 1UX6A 2OUHA 3ROUA 3KT4A 2UY9A 4CEWC 4HETA 3PNAA 4YG6A 3HBZA 2B8MA 3RS6A 2ZTNA 1FV2A 4XMIA 1MZ5A 2H0BA 4OFGA 1U5YA 4WVMB 1GZ9A 5H9RA 3THPA 2ZZQA 2EXIA 1ULEA 1WW7A 4ZU5A 3VBOC 1CIWA 3WP6A 4XJUA 4OHXA 1LOCA 3VBSB 4Q4X1 1QNWA 1DF0A 3E5XA 3LWCA 4AI1A 5GLTA 4C0BA 3UKVA 1QJY2 4R9AA 3ZIWA 1DQ0A 1ZRRA 4L92A 3PJYA 4DQAA 4PDWA 4YVWB 1RUD2 4ITCA 4CP2A 5JSRA 2B42B 4YVSC 2BGCA 1LOEA 1C4RA 4AFDA 1SCSA 4IEWA 3VLBB 2ZHLA 1CR7A 1ZZ8A 4CDWA 3S6PA 4CRQA 2XB6C 3DGTA 3CJIA 1HRI3 4WM8A 2RE9A 4BMEA 1S0GA 4R9CA 1FOD3 4PDWC 2HWC3 4P9JA 5KHKA 2E6VA 3GF6A 4TYSA 2OA2A 4RS5A 1UPIA 2PAEA 3IN9A 3AX4A 4AVTA 1PGSA 1QXRA 1BVVA 1G7YA 3OY8A 3VBRC 2NP0A 4D7YA 3IDBB 2WZR3 2Y0IA 1LENA 3FZ3A 4O9EA 3NL1A 5C9AA 1HRV1 4CDUB 3DPRA 3ZXFA 4HFSA 3V64A 5KBFA 4Z82A 1ZBA1 4MXWB 3LAGA 1HXS3 2ZAHA 1WW5A 5BY5A 5KXCA 1QOOA 1WGPA 4IEXA 3CO2A 1RUH1 4Q1RA 3VBFA 2PHTA 1YO8A 2JG9A 1XRUA 2P2KA 5BXXA 4AVBA 3JB8A 4HZFA 4UBGA 2HWE1 1PVC3 3ZFFB 2ZX1A 2BVBA 1HV0A 2ZBJA 3IPVB 4JGZB 1S2BA 4FTBA 2H6BA 4DXZA 1EYBA 1LULA 4LE3A 5E1RA 1R1A3 4ATFA 1O91A 5BNNA 3MF6A 1AR92 3AZVA 4JTNA 3VZLA 1RJ8A 2R063 1QKQA 2ZGPA 5T52A 4AGGA 4DRRA 3MICA 5BNPB 3MYXA 1CAXB 5LK5A 1M4WA 4OLLA 2GN7A 5IUQA 1GKBA 4K8FA 3ZDSA 2Q5TA 1HXS1 1LKNA 4Q0QA 1QXPA