3VCPA

The 2.2 angstrom structure of stc2 with proline bound in the active site
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
401
structure length
397
Chain Sequence
TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-hydroxylating dioxygenase
publication title Quaternary Ammonium Oxidative Demethylation: X-ray Crystallographic, Resonance Raman, and UV-Visible Spectroscopic Analysis of a Rieske-Type Demethylase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 119
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3vcpA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 3vcpA01
3DQYA 2E75D 1WQLA 1BE3E 3GKQA 2YFIA 3H1LE 4H13D 2DE7D 3C0DA 3L71E 4H0LD 1G8KB 1Q90C 4NB9A 1UUWA 1NYKA 1SQBE 2NVFA 3GTSA 2XR8A 3CX5E 4NBGD 1PP9E 2FYUE 3EQQA 3VMHD 4NBHD 1NTME 1BCCE 2YFJA 3GTEA 1O7HA 4NBCD 4NBDD 4P1CH 4NBAA 4HM7A 5AEWA 4NBEA 4NBFD 4PD4E 2E4QA 1VF5D 3L70E 3BCCE 4U3FE 5HL4A 3VMGA 2JO6A 1ULJA 3H1KE 4HM1A 1P84E 3GZYA 2JZAA 3L74E 3H1HE 1SQQE 1EG9A 4NBCA 4OGQD 4QDCA 2YIUC 1Z01A 2DE5A 3GL0A 1O7GA 3GKEA 1NU1E 2HMKA 2FYNC 1ULIA 1O7PA 3D89A 2XSHA 3GZXA 4NBBA 2Q3WA 3VMGD 1SQXE 1VCKA 3GCEA 3GOBA 5KLVE 2B1XA 3L73E 4PV1D 1G8JB 4HM2A 4NB8A 5KLIC 2I7FA 1WW9A 4NB9D 2E4PA 3EN1A 4HM8A 3VCPA 2BMRA 3CXHE 2HMOA 2DE6A 3CWBE 2NVGA 4QDDA 4HM5A 1NDOA 2DE5D 2QPZA 1L0LE 2NWFA 3TGUE 2DE7A 2NUKA 2GBWA 4AAYB 5BOKA 3H1JE 1SQVE 4QDFA 4NBAD 1EZVE 3VMIA 4NBED 4EMJB 1JM1A 1O7NA 2NUMA 3N0QA 1VM9A 3H1IE 3GB4A 3AZCA 3VMHA 5KKZC 2YVJB 4QDFB 4QUPA 4NBHA 2QJPC 5AEUA 2DE6D 1L0NE 1FQTA 1UUVA 1ZRTE 2QJYC 4NBDA 1KB9E 4QURA 4HM6A 2YFLA 1PPJE 1NTKE 2HMMA 4HM3A 3GCFA 4NBFA 4QCKA 2HMLA 5CXMA 1O7WA 2D2CD 3L72E 1RFSA 2HMJA 1Z02A 1NTZE 2E76D 1Z03A 2QJKC 2B24A 3VCAA 1SJGA 2IBZE 3GL2A 3L75E 4HKVA 3VMID 2CKFA 2XSOA 1RIEA 2ZYLA 4P1BH 4NBBD 4HM0A 2ZT9D 1SQPE 2GBXA 2XRXA 3FOUA 1KYOE 2A06E 1O7MA 2BMQA 4H44D 4HM4A 4NBGA 4NB8D 4AIVA 2BMOA 4QUQA 2HMNA 4HJLA 2E74D 2NVEA 2BCCE
chains in the Genus database with same CATH superfamily
3DQYA 2E75D 1WQLA 1BE3E 3GKQA 2YFIA 3H1LE 4H13D 2DE7D 3C0DA 3L71E 4H0LD 1G8KB 1Q90C 4NB9A 1UUWA 1NYKA 1SQBE 2NVFA 3GTSA 2XR8A 3CX5E 4NBGD 1PP9E 2FYUE 3EQQA 3VMHD 4NBHD 1NTME 1BCCE 2YFJA 3GTEA 1O7HA 4NBCD 4NBDD 4P1CH 4NBAA 4HM7A 5AEWA 4NBEA 4NBFD 4PD4E 2E4QA 1VF5D 3L70E 3BCCE 4U3FE 5HL4A 3VMGA 2JO6A 1ULJA 3H1KE 4HM1A 1P84E 3GZYA 2JZAA 3L74E 3H1HE 1SQQE 1EG9A 4NBCA 4OGQD 4QDCA 2YIUC 1Z01A 2DE5A 3GL0A 1O7GA 3GKEA 1NU1E 2HMKA 2FYNC 1ULIA 1O7PA 3D89A 2XSHA 3GZXA 4NBBA 2Q3WA 3VMGD 1SQXE 1VCKA 3GCEA 3GOBA 5KLVE 2B1XA 3L73E 4PV1D 1G8JB 4HM2A 4NB8A 5KLIC 2I7FA 1WW9A 4NB9D 2E4PA 3EN1A 4HM8A 3VCPA 2BMRA 3CXHE 2HMOA 2DE6A 3CWBE 2NVGA 4QDDA 4HM5A 1NDOA 2DE5D 2QPZA 1L0LE 2NWFA 3TGUE 2DE7A 2NUKA 2GBWA 4AAYB 5BOKA 3H1JE 1SQVE 4QDFA 4NBAD 1EZVE 3VMIA 4NBED 4EMJB 1JM1A 1O7NA 2NUMA 3N0QA 1VM9A 3H1IE 3GB4A 3AZCA 3VMHA 5KKZC 2YVJB 4QDFB 4QUPA 4NBHA 2QJPC 5AEUA 2DE6D 1L0NE 1FQTA 1UUVA 1ZRTE 2QJYC 4NBDA 1KB9E 4QURA 4HM6A 2YFLA 1PPJE 1NTKE 2HMMA 4HM3A 3GCFA 4NBFA 4QCKA 2HMLA 5CXMA 1O7WA 2D2CD 3L72E 1RFSA 2HMJA 1Z02A 1NTZE 2E76D 1Z03A 2QJKC 2B24A 3VCAA 1SJGA 2IBZE 3GL2A 3L75E 4HKVA 3VMID 2CKFA 2XSOA 1RIEA 2ZYLA 4P1BH 4NBBD 4HM0A 2ZT9D 1SQPE 2GBXA 2XRXA 3FOUA 1KYOE 2A06E 1O7MA 2BMQA 4H44D 4HM4A 4NBGA 4NB8D 4AIVA 2BMOA 4QUQA 2HMNA 4HJLA 2E74D 2NVEA 2BCCE
chains in the Genus database with same CATH topology
3DQYA 2E75D 1WQLA 1BE3E 3GKQA 2YFIA 3H1LE 4H13D 2DE7D 3C0DA 3L71E 4H0LD 1G8KB 1Q90C 4NB9A 1UUWA 1NYKA 1SQBE 2NVFA 3GTSA 2XR8A 3CX5E 4NBGD 1PP9E 2FYUE 3EQQA 3VMHD 4NBHD 1NTME 1BCCE 2YFJA 3GTEA 1O7HA 4NBCD 4NBDD 4P1CH 4NBAA 4HM7A 5AEWA 4NBEA 4NBFD 4PD4E 2E4QA 1VF5D 3L70E 3BCCE 4U3FE 5HL4A 3VMGA 2JO6A 1ULJA 3H1KE 4HM1A 1P84E 3GZYA 2JZAA 3L74E 3H1HE 1SQQE 1EG9A 4NBCA 4OGQD 4QDCA 2YIUC 1Z01A 2DE5A 3GL0A 1O7GA 3GKEA 1NU1E 2HMKA 2FYNC 1ULIA 1O7PA 3D89A 2XSHA 3GZXA 4NBBA 2Q3WA 3VMGD 1SQXE 1VCKA 3GCEA 3GOBA 5KLVE 2B1XA 3L73E 4PV1D 1G8JB 4HM2A 4NB8A 5KLIC 2I7FA 1WW9A 4NB9D 2E4PA 3EN1A 4HM8A 3VCPA 2BMRA 3CXHE 2HMOA 2DE6A 3CWBE 2NVGA 4QDDA 4HM5A 1NDOA 2DE5D 2QPZA 1L0LE 2NWFA 3TGUE 2DE7A 2NUKA 2GBWA 4AAYB 5BOKA 3H1JE 1SQVE 4QDFA 4NBAD 1EZVE 3VMIA 4NBED 4EMJB 1JM1A 1O7NA 2NUMA 3N0QA 1VM9A 3H1IE 3GB4A 3AZCA 3VMHA 5KKZC 2YVJB 4QDFB 4QUPA 4NBHA 2QJPC 5AEUA 2DE6D 1L0NE 1FQTA 1UUVA 1ZRTE 2QJYC 4NBDA 1KB9E 4QURA 4HM6A 2YFLA 1PPJE 1NTKE 2HMMA 4HM3A 3GCFA 4NBFA 4QCKA 2HMLA 5CXMA 1O7WA 2D2CD 3L72E 1RFSA 2HMJA 1Z02A 1NTZE 2E76D 1Z03A 2QJKC 2B24A 3VCAA 1SJGA 2IBZE 3GL2A 3L75E 4HKVA 3VMID 2CKFA 2XSOA 1RIEA 2ZYLA 4P1BH 4NBBD 4HM0A 2ZT9D 1SQPE 2GBXA 2XRXA 3FOUA 1KYOE 2A06E 1O7MA 2BMQA 4H44D 4HM4A 4NBGA 4NB8D 4AIVA 2BMOA 4QUQA 2HMNA 4HJLA 2E74D 2NVEA 2BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQY A;  2E75 D;  1WQL A;  1BE3 E;  3GKQ A;  2YFI A;  3H1L E;  4H13 D;  2DE7 D;  3C0D A;  3L71 E;  4H0L D;  1G8K B;  1Q90 C;  4NB9 A;  1UUW A;  1NYK A;  1SQB E;  2NVF A;  3GTS A;  2XR8 A;  3CX5 E;  4NBG D;  1PP9 E;  2FYU E;  3EQQ A;  3VMH D;  4NBH D;  1NTM E;  1BCC E;  2YFJ A;  3GTE A;  1O7H A;  4NBC D;  4NBD D;  4P1C H;  4NBA A;  4HM7 A;  5AEW A;  4NBE A;  4NBF D;  4PD4 E;  2E4Q A;  1VF5 D;  3L70 E;  3BCC E;  4U3F E;  5HL4 A;  3VMG A;  2JO6 A;  1ULJ A;  3H1K E;  4HM1 A;  1P84 E;  3GZY A;  2JZA A;  3L74 E;  3H1H E;  1SQQ E;  1EG9 A;  4NBC A;  4OGQ D;  4QDC A;  2YIU C;  1Z01 A;  2DE5 A;  3GL0 A;  1O7G A;  3GKE A;  1NU1 E;  2HMK A;  2FYN C;  1ULI A;  1O7P A;  3D89 A;  2XSH A;  3GZX A;  4NBB A;  2Q3W A;  3VMG D;  1SQX E;  1VCK A;  3GCE A;  3GOB A;  5KLV E;  2B1X A;  3L73 E;  4PV1 D;  1G8J B;  4HM2 A;  4NB8 A;  5KLI C;  2I7F A;  1WW9 A;  4NB9 D;  2E4P A;  3EN1 A;  4HM8 A;  3VCP A;  2BMR A;  3CXH E;  2HMO A;  2DE6 A;  3CWB E;  2NVG A;  4QDD A;  4HM5 A;  1NDO A;  2DE5 D;  2QPZ A;  1L0L E;  2NWF A;  3TGU E;  2DE7 A;  2NUK A;  2GBW A;  4AAY B;  5BOK A;  3H1J E;  1SQV E;  4QDF A;  4NBA D;  1EZV E;  3VMI A;  4NBE D;  4EMJ B;  1JM1 A;  1O7N A;  2NUM A;  3N0Q A;  1VM9 A;  3H1I E;  3GB4 A;  3AZC A;  3VMH A;  5KKZ C;  2YVJ B;  4QDF B;  4QUP A;  4NBH A;  2QJP C;  5AEU A;  2DE6 D;  1L0N E;  1FQT A;  1UUV A;  1ZRT E;  2QJY C;  4NBD A;  1KB9 E;  4QUR A;  4HM6 A;  2YFL A;  1PPJ E;  1NTK E;  2HMM A;  4HM3 A;  3GCF A;  4NBF A;  4QCK A;  2HML A;  5CXM A;  1O7W A;  2D2C D;  3L72 E;  1RFS A;  2HMJ A;  1Z02 A;  1NTZ E;  2E76 D;  1Z03 A;  2QJK C;  2B24 A;  3VCA A;  1SJG A;  2IBZ E;  3GL2 A;  3L75 E;  4HKV A;  3VMI D;  2CKF A;  2XSO A;  1RIE A;  2ZYL A;  4P1B H;  4NBB D;  4HM0 A;  2ZT9 D;  1SQP E;  2GBX A;  2XRX A;  3FOU A;  1KYO E;  2A06 E;  1O7M A;  2BMQ A;  4H44 D;  4HM4 A;  4NBG A;  4NB8 D;  4AIV A;  2BMO A;  4QUQ A;  2HMN A;  4HJL A;  2E74 D;  2NVE A;  2BCC E; 
#chains in the Genus database with same CATH topology
 3DQY A;  2E75 D;  1WQL A;  1BE3 E;  3GKQ A;  2YFI A;  3H1L E;  4H13 D;  2DE7 D;  3C0D A;  3L71 E;  4H0L D;  1G8K B;  1Q90 C;  4NB9 A;  1UUW A;  1NYK A;  1SQB E;  2NVF A;  3GTS A;  2XR8 A;  3CX5 E;  4NBG D;  1PP9 E;  2FYU E;  3EQQ A;  3VMH D;  4NBH D;  1NTM E;  1BCC E;  2YFJ A;  3GTE A;  1O7H A;  4NBC D;  4NBD D;  4P1C H;  4NBA A;  4HM7 A;  5AEW A;  4NBE A;  4NBF D;  4PD4 E;  2E4Q A;  1VF5 D;  3L70 E;  3BCC E;  4U3F E;  5HL4 A;  3VMG A;  2JO6 A;  1ULJ A;  3H1K E;  4HM1 A;  1P84 E;  3GZY A;  2JZA A;  3L74 E;  3H1H E;  1SQQ E;  1EG9 A;  4NBC A;  4OGQ D;  4QDC A;  2YIU C;  1Z01 A;  2DE5 A;  3GL0 A;  1O7G A;  3GKE A;  1NU1 E;  2HMK A;  2FYN C;  1ULI A;  1O7P A;  3D89 A;  2XSH A;  3GZX A;  4NBB A;  2Q3W A;  3VMG D;  1SQX E;  1VCK A;  3GCE A;  3GOB A;  5KLV E;  2B1X A;  3L73 E;  4PV1 D;  1G8J B;  4HM2 A;  4NB8 A;  5KLI C;  2I7F A;  1WW9 A;  4NB9 D;  2E4P A;  3EN1 A;  4HM8 A;  3VCP A;  2BMR A;  3CXH E;  2HMO A;  2DE6 A;  3CWB E;  2NVG A;  4QDD A;  4HM5 A;  1NDO A;  2DE5 D;  2QPZ A;  1L0L E;  2NWF A;  3TGU E;  2DE7 A;  2NUK A;  2GBW A;  4AAY B;  5BOK A;  3H1J E;  1SQV E;  4QDF A;  4NBA D;  1EZV E;  3VMI A;  4NBE D;  4EMJ B;  1JM1 A;  1O7N A;  2NUM A;  3N0Q A;  1VM9 A;  3H1I E;  3GB4 A;  3AZC A;  3VMH A;  5KKZ C;  2YVJ B;  4QDF B;  4QUP A;  4NBH A;  2QJP C;  5AEU A;  2DE6 D;  1L0N E;  1FQT A;  1UUV A;  1ZRT E;  2QJY C;  4NBD A;  1KB9 E;  4QUR A;  4HM6 A;  2YFL A;  1PPJ E;  1NTK E;  2HMM A;  4HM3 A;  3GCF A;  4NBF A;  4QCK A;  2HML A;  5CXM A;  1O7W A;  2D2C D;  3L72 E;  1RFS A;  2HMJ A;  1Z02 A;  1NTZ E;  2E76 D;  1Z03 A;  2QJK C;  2B24 A;  3VCA A;  1SJG A;  2IBZ E;  3GL2 A;  3L75 E;  4HKV A;  3VMI D;  2CKF A;  2XSO A;  1RIE A;  2ZYL A;  4P1B H;  4NBB D;  4HM0 A;  2ZT9 D;  1SQP E;  2GBX A;  2XRX A;  3FOU A;  1KYO E;  2A06 E;  1O7M A;  2BMQ A;  4H44 D;  4HM4 A;  4NBG A;  4NB8 D;  4AIV A;  2BMO A;  4QUQ A;  2HMN A;  4HJL A;  2E74 D;  2NVE A;  2BCC E; 
#chains in the Genus database with same CATH homology
 3DQY A;  2E75 D;  1WQL A;  1BE3 E;  3GKQ A;  2YFI A;  3H1L E;  4H13 D;  2DE7 D;  3C0D A;  3L71 E;  4H0L D;  1G8K B;  1Q90 C;  4NB9 A;  1UUW A;  1NYK A;  1SQB E;  2NVF A;  3GTS A;  2XR8 A;  3CX5 E;  4NBG D;  1PP9 E;  2FYU E;  3EQQ A;  3VMH D;  4NBH D;  1NTM E;  1BCC E;  2YFJ A;  3GTE A;  1O7H A;  4NBC D;  4NBD D;  4P1C H;  4NBA A;  4HM7 A;  5AEW A;  4NBE A;  4NBF D;  4PD4 E;  2E4Q A;  1VF5 D;  3L70 E;  3BCC E;  4U3F E;  5HL4 A;  3VMG A;  2JO6 A;  1ULJ A;  3H1K E;  4HM1 A;  1P84 E;  3GZY A;  2JZA A;  3L74 E;  3H1H E;  1SQQ E;  1EG9 A;  4NBC A;  4OGQ D;  4QDC A;  2YIU C;  1Z01 A;  2DE5 A;  3GL0 A;  1O7G A;  3GKE A;  1NU1 E;  2HMK A;  2FYN C;  1ULI A;  1O7P A;  3D89 A;  2XSH A;  3GZX A;  4NBB A;  2Q3W A;  3VMG D;  1SQX E;  1VCK A;  3GCE A;  3GOB A;  5KLV E;  2B1X A;  3L73 E;  4PV1 D;  1G8J B;  4HM2 A;  4NB8 A;  5KLI C;  2I7F A;  1WW9 A;  4NB9 D;  2E4P A;  3EN1 A;  4HM8 A;  3VCP A;  2BMR A;  3CXH E;  2HMO A;  2DE6 A;  3CWB E;  2NVG A;  4QDD A;  4HM5 A;  1NDO A;  2DE5 D;  2QPZ A;  1L0L E;  2NWF A;  3TGU E;  2DE7 A;  2NUK A;  2GBW A;  4AAY B;  5BOK A;  3H1J E;  1SQV E;  4QDF A;  4NBA D;  1EZV E;  3VMI A;  4NBE D;  4EMJ B;  1JM1 A;  1O7N A;  2NUM A;  3N0Q A;  1VM9 A;  3H1I E;  3GB4 A;  3AZC A;  3VMH A;  5KKZ C;  2YVJ B;  4QDF B;  4QUP A;  4NBH A;  2QJP C;  5AEU A;  2DE6 D;  1L0N E;  1FQT A;  1UUV A;  1ZRT E;  2QJY C;  4NBD A;  1KB9 E;  4QUR A;  4HM6 A;  2YFL A;  1PPJ E;  1NTK E;  2HMM A;  4HM3 A;  3GCF A;  4NBF A;  4QCK A;  2HML A;  5CXM A;  1O7W A;  2D2C D;  3L72 E;  1RFS A;  2HMJ A;  1Z02 A;  1NTZ E;  2E76 D;  1Z03 A;  2QJK C;  2B24 A;  3VCA A;  1SJG A;  2IBZ E;  3GL2 A;  3L75 E;  4HKV A;  3VMI D;  2CKF A;  2XSO A;  1RIE A;  2ZYL A;  4P1B H;  4NBB D;  4HM0 A;  2ZT9 D;  1SQP E;  2GBX A;  2XRX A;  3FOU A;  1KYO E;  2A06 E;  1O7M A;  2BMQ A;  4H44 D;  4HM4 A;  4NBG A;  4NB8 D;  4AIV A;  2BMO A;  4QUQ A;  2HMN A;  4HJL A;  2E74 D;  2NVE A;  2BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...