3VCPA

The 2.2 angstrom structure of stc2 with proline bound in the active site
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
401
structure length
397
Chain Sequence
TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary Ammonium Oxidative Demethylation: X-ray Crystallographic, Resonance Raman, and UV-Visible Spectroscopic Analysis of a Rieske-Type Demethylase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Ring-hydroxylating dioxygenase
total genus 119
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3vcpA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 3vcpA01
1VM9A 3L74E 3EQQA 1P84E 3VMGD 4AIVA 4HKVA 4H0LD 1L0NE 2GBXA 2XRXA 2HMKA 3L70E 4HM7A 3VMGA 5AEUA 1SQPE 2BMRA 4OGQD 2YFLA 2XSHA 4QDFA 4EMJB 4P1BH 2DE6A 2DE5D 1RFSA 2B24A 4HM3A 2GBWA 4NBHA 3FOUA 3GCEA 1VF5D 2NVGA 3L72E 4NBED 2E76D 3CXHE 4QUQA 4NBGD 2ZT9D 3GTSA 1O7HA 2NUMA 1ULJA 1NDOA 4NBCA 3GTEA 4NBCD 3VMHD 2E4QA 3N0QA 1O7WA 4HM5A 2DE7A 2YIUC 2QPZA 4NBFD 2JO6A 4QDFB 1O7MA 2DE6D 5KLVE 5AEWA 3H1LE 1UUWA 2FYNC 1FQTA 1BE3E 2FYUE 1SQXE 3H1IE 3GCFA 1RIEA 2YVJB 1VCKA 4NBGA 3GZXA 3D89A 1Z03A 1JM1A 5KLIC 4NB8A 4H13D 2HMJA 4HM8A 4NBEA 1NTME 2IBZE 2QJKC 3DQYA 1WQLA 4NB9D 4NB9A 3TGUE 4QDDA 3CX5E 3C0DA 3VMHA 4NB8D 1SQBE 5KKZC 1Q90C 1Z02A 3GL0A 2CKFA 3CWBE 1O7PA 4HJLA 4NBFA 3L75E 2B1XA 2YFIA 4QCKA 3GB4A 3L73E 5BOKA 1ZRTE 2QJYC 2BMOA 5CXMA 2A06E 2HMMA 2BMQA 2E74D 1EG9A 1L0LE 2XSOA 2HMLA 2NVEA 3H1HE 3L71E 4NBBD 4NBDA 2Q3WA 4NBHD 4QDCA 4HM4A 4NBAD 2YFJA 3GZYA 3VCPA 2DE5A 3VCAA 4NBDD 4NBBA 1EZVE 1ULIA 3H1KE 2E75D 1NU1E 4QUPA 2E4PA 2D2CD 1WW9A 4PD4E 4PV1D 1O7NA 3H1JE 2BCCE 2I7FA 1BCCE 2QJPC 1G8JB 2HMNA 1NTKE 1UUVA 3AZCA 1SJGA 1KYOE 2NVFA 4HM0A 1NTZE 3EN1A 2DE7D 3VMID 1Z01A 1O7GA 3GOBA 2NUKA 2ZYLA 4QURA 4H44D 2XR8A 4U3FE 2JZAA 2NWFA 1SQQE 3BCCE 4AAYB 4HM2A 3VMIA 2HMOA 3GKEA 4HM1A 4P1CH 3GL2A 4NBAA 1G8KB 5HL4A 1PPJE 4HM6A 1PP9E 3GKQA 1KB9E 1NYKA 1SQVE
chains in the Genus database with same CATH superfamily
1VM9A 3L74E 3EQQA 1P84E 3VMGD 4AIVA 4HKVA 4H0LD 1L0NE 2GBXA 2XRXA 2HMKA 3L70E 4HM7A 3VMGA 5AEUA 1SQPE 2BMRA 4OGQD 2YFLA 2XSHA 4QDFA 4EMJB 4P1BH 2DE6A 2DE5D 1RFSA 2B24A 4HM3A 2GBWA 4NBHA 3FOUA 3GCEA 1VF5D 2NVGA 3L72E 4NBED 2E76D 3CXHE 4QUQA 4NBGD 2ZT9D 3GTSA 1O7HA 2NUMA 1ULJA 1NDOA 4NBCA 3GTEA 4NBCD 3VMHD 2E4QA 3N0QA 1O7WA 4HM5A 2DE7A 2YIUC 2QPZA 4NBFD 2JO6A 4QDFB 1O7MA 2DE6D 5KLVE 5AEWA 3H1LE 1UUWA 2FYNC 1FQTA 1BE3E 2FYUE 1SQXE 3H1IE 3GCFA 1RIEA 2YVJB 1VCKA 4NBGA 3GZXA 3D89A 1Z03A 1JM1A 5KLIC 4NB8A 4H13D 2HMJA 4HM8A 4NBEA 1NTME 2IBZE 2QJKC 3DQYA 1WQLA 4NB9D 4NB9A 3TGUE 4QDDA 3CX5E 3C0DA 3VMHA 4NB8D 1SQBE 5KKZC 1Q90C 1Z02A 3GL0A 2CKFA 3CWBE 1O7PA 4HJLA 4NBFA 3L75E 2B1XA 2YFIA 4QCKA 3GB4A 3L73E 5BOKA 1ZRTE 2QJYC 2BMOA 5CXMA 2A06E 2HMMA 2BMQA 2E74D 1EG9A 1L0LE 2XSOA 2HMLA 2NVEA 3H1HE 3L71E 4NBBD 4NBDA 2Q3WA 4NBHD 4QDCA 4HM4A 4NBAD 2YFJA 3GZYA 3VCPA 2DE5A 3VCAA 4NBDD 4NBBA 1EZVE 1ULIA 3H1KE 2E75D 1NU1E 4QUPA 2E4PA 2D2CD 1WW9A 4PD4E 4PV1D 1O7NA 3H1JE 2BCCE 2I7FA 1BCCE 2QJPC 1G8JB 2HMNA 1NTKE 1UUVA 3AZCA 1SJGA 1KYOE 2NVFA 4HM0A 1NTZE 3EN1A 2DE7D 3VMID 1Z01A 1O7GA 3GOBA 2NUKA 2ZYLA 4QURA 4H44D 2XR8A 4U3FE 2JZAA 2NWFA 1SQQE 3BCCE 4AAYB 4HM2A 3VMIA 2HMOA 3GKEA 4HM1A 4P1CH 3GL2A 4NBAA 1G8KB 5HL4A 1PPJE 4HM6A 1PP9E 3GKQA 1KB9E 1NYKA 1SQVE
chains in the Genus database with same CATH topology
1VM9A 3L74E 3EQQA 1P84E 3VMGD 4AIVA 4HKVA 4H0LD 1L0NE 2GBXA 2XRXA 2HMKA 3L70E 4HM7A 3VMGA 5AEUA 1SQPE 2BMRA 4OGQD 2YFLA 2XSHA 4QDFA 4EMJB 4P1BH 2DE6A 2DE5D 1RFSA 2B24A 4HM3A 2GBWA 4NBHA 3FOUA 3GCEA 1VF5D 2NVGA 3L72E 4NBED 2E76D 3CXHE 4QUQA 4NBGD 2ZT9D 3GTSA 1O7HA 2NUMA 1ULJA 1NDOA 4NBCA 3GTEA 4NBCD 3VMHD 2E4QA 3N0QA 1O7WA 4HM5A 2DE7A 2YIUC 2QPZA 4NBFD 2JO6A 4QDFB 1O7MA 2DE6D 5KLVE 5AEWA 3H1LE 1UUWA 2FYNC 1FQTA 1BE3E 2FYUE 1SQXE 3H1IE 3GCFA 1RIEA 2YVJB 1VCKA 4NBGA 3GZXA 3D89A 1Z03A 1JM1A 5KLIC 4NB8A 4H13D 2HMJA 4HM8A 4NBEA 1NTME 2IBZE 2QJKC 3DQYA 1WQLA 4NB9D 4NB9A 3TGUE 4QDDA 3CX5E 3C0DA 3VMHA 4NB8D 1SQBE 5KKZC 1Q90C 1Z02A 3GL0A 2CKFA 3CWBE 1O7PA 4HJLA 4NBFA 3L75E 2B1XA 2YFIA 4QCKA 3GB4A 3L73E 5BOKA 1ZRTE 2QJYC 2BMOA 5CXMA 2A06E 2HMMA 2BMQA 2E74D 1EG9A 1L0LE 2XSOA 2HMLA 2NVEA 3H1HE 3L71E 4NBBD 4NBDA 2Q3WA 4NBHD 4QDCA 4HM4A 4NBAD 2YFJA 3GZYA 3VCPA 2DE5A 3VCAA 4NBDD 4NBBA 1EZVE 1ULIA 3H1KE 2E75D 1NU1E 4QUPA 2E4PA 2D2CD 1WW9A 4PD4E 4PV1D 1O7NA 3H1JE 2BCCE 2I7FA 1BCCE 2QJPC 1G8JB 2HMNA 1NTKE 1UUVA 3AZCA 1SJGA 1KYOE 2NVFA 4HM0A 1NTZE 3EN1A 2DE7D 3VMID 1Z01A 1O7GA 3GOBA 2NUKA 2ZYLA 4QURA 4H44D 2XR8A 4U3FE 2JZAA 2NWFA 1SQQE 3BCCE 4AAYB 4HM2A 3VMIA 2HMOA 3GKEA 4HM1A 4P1CH 3GL2A 4NBAA 1G8KB 5HL4A 1PPJE 4HM6A 1PP9E 3GKQA 1KB9E 1NYKA 1SQVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM9 A;  3L74 E;  3EQQ A;  1P84 E;  3VMG D;  4AIV A;  4HKV A;  4H0L D;  1L0N E;  2GBX A;  2XRX A;  2HMK A;  3L70 E;  4HM7 A;  3VMG A;  5AEU A;  1SQP E;  2BMR A;  4OGQ D;  2YFL A;  2XSH A;  4QDF A;  4EMJ B;  4P1B H;  2DE6 A;  2DE5 D;  1RFS A;  2B24 A;  4HM3 A;  2GBW A;  4NBH A;  3FOU A;  3GCE A;  1VF5 D;  2NVG A;  3L72 E;  4NBE D;  2E76 D;  3CXH E;  4QUQ A;  4NBG D;  2ZT9 D;  3GTS A;  1O7H A;  2NUM A;  1ULJ A;  1NDO A;  4NBC A;  3GTE A;  4NBC D;  3VMH D;  2E4Q A;  3N0Q A;  1O7W A;  4HM5 A;  2DE7 A;  2YIU C;  2QPZ A;  4NBF D;  2JO6 A;  4QDF B;  1O7M A;  2DE6 D;  5KLV E;  5AEW A;  3H1L E;  1UUW A;  2FYN C;  1FQT A;  1BE3 E;  2FYU E;  1SQX E;  3H1I E;  3GCF A;  1RIE A;  2YVJ B;  1VCK A;  4NBG A;  3GZX A;  3D89 A;  1Z03 A;  1JM1 A;  5KLI C;  4NB8 A;  4H13 D;  2HMJ A;  4HM8 A;  4NBE A;  1NTM E;  2IBZ E;  2QJK C;  3DQY A;  1WQL A;  4NB9 D;  4NB9 A;  3TGU E;  4QDD A;  3CX5 E;  3C0D A;  3VMH A;  4NB8 D;  1SQB E;  5KKZ C;  1Q90 C;  1Z02 A;  3GL0 A;  2CKF A;  3CWB E;  1O7P A;  4HJL A;  4NBF A;  3L75 E;  2B1X A;  2YFI A;  4QCK A;  3GB4 A;  3L73 E;  5BOK A;  1ZRT E;  2QJY C;  2BMO A;  5CXM A;  2A06 E;  2HMM A;  2BMQ A;  2E74 D;  1EG9 A;  1L0L E;  2XSO A;  2HML A;  2NVE A;  3H1H E;  3L71 E;  4NBB D;  4NBD A;  2Q3W A;  4NBH D;  4QDC A;  4HM4 A;  4NBA D;  2YFJ A;  3GZY A;  3VCP A;  2DE5 A;  3VCA A;  4NBD D;  4NBB A;  1EZV E;  1ULI A;  3H1K E;  2E75 D;  1NU1 E;  4QUP A;  2E4P A;  2D2C D;  1WW9 A;  4PD4 E;  4PV1 D;  1O7N A;  3H1J E;  2BCC E;  2I7F A;  1BCC E;  2QJP C;  1G8J B;  2HMN A;  1NTK E;  1UUV A;  3AZC A;  1SJG A;  1KYO E;  2NVF A;  4HM0 A;  1NTZ E;  3EN1 A;  2DE7 D;  3VMI D;  1Z01 A;  1O7G A;  3GOB A;  2NUK A;  2ZYL A;  4QUR A;  4H44 D;  2XR8 A;  4U3F E;  2JZA A;  2NWF A;  1SQQ E;  3BCC E;  4AAY B;  4HM2 A;  3VMI A;  2HMO A;  3GKE A;  4HM1 A;  4P1C H;  3GL2 A;  4NBA A;  1G8K B;  5HL4 A;  1PPJ E;  4HM6 A;  1PP9 E;  3GKQ A;  1KB9 E;  1NYK A;  1SQV E; 
#chains in the Genus database with same CATH topology
 1VM9 A;  3L74 E;  3EQQ A;  1P84 E;  3VMG D;  4AIV A;  4HKV A;  4H0L D;  1L0N E;  2GBX A;  2XRX A;  2HMK A;  3L70 E;  4HM7 A;  3VMG A;  5AEU A;  1SQP E;  2BMR A;  4OGQ D;  2YFL A;  2XSH A;  4QDF A;  4EMJ B;  4P1B H;  2DE6 A;  2DE5 D;  1RFS A;  2B24 A;  4HM3 A;  2GBW A;  4NBH A;  3FOU A;  3GCE A;  1VF5 D;  2NVG A;  3L72 E;  4NBE D;  2E76 D;  3CXH E;  4QUQ A;  4NBG D;  2ZT9 D;  3GTS A;  1O7H A;  2NUM A;  1ULJ A;  1NDO A;  4NBC A;  3GTE A;  4NBC D;  3VMH D;  2E4Q A;  3N0Q A;  1O7W A;  4HM5 A;  2DE7 A;  2YIU C;  2QPZ A;  4NBF D;  2JO6 A;  4QDF B;  1O7M A;  2DE6 D;  5KLV E;  5AEW A;  3H1L E;  1UUW A;  2FYN C;  1FQT A;  1BE3 E;  2FYU E;  1SQX E;  3H1I E;  3GCF A;  1RIE A;  2YVJ B;  1VCK A;  4NBG A;  3GZX A;  3D89 A;  1Z03 A;  1JM1 A;  5KLI C;  4NB8 A;  4H13 D;  2HMJ A;  4HM8 A;  4NBE A;  1NTM E;  2IBZ E;  2QJK C;  3DQY A;  1WQL A;  4NB9 D;  4NB9 A;  3TGU E;  4QDD A;  3CX5 E;  3C0D A;  3VMH A;  4NB8 D;  1SQB E;  5KKZ C;  1Q90 C;  1Z02 A;  3GL0 A;  2CKF A;  3CWB E;  1O7P A;  4HJL A;  4NBF A;  3L75 E;  2B1X A;  2YFI A;  4QCK A;  3GB4 A;  3L73 E;  5BOK A;  1ZRT E;  2QJY C;  2BMO A;  5CXM A;  2A06 E;  2HMM A;  2BMQ A;  2E74 D;  1EG9 A;  1L0L E;  2XSO A;  2HML A;  2NVE A;  3H1H E;  3L71 E;  4NBB D;  4NBD A;  2Q3W A;  4NBH D;  4QDC A;  4HM4 A;  4NBA D;  2YFJ A;  3GZY A;  3VCP A;  2DE5 A;  3VCA A;  4NBD D;  4NBB A;  1EZV E;  1ULI A;  3H1K E;  2E75 D;  1NU1 E;  4QUP A;  2E4P A;  2D2C D;  1WW9 A;  4PD4 E;  4PV1 D;  1O7N A;  3H1J E;  2BCC E;  2I7F A;  1BCC E;  2QJP C;  1G8J B;  2HMN A;  1NTK E;  1UUV A;  3AZC A;  1SJG A;  1KYO E;  2NVF A;  4HM0 A;  1NTZ E;  3EN1 A;  2DE7 D;  3VMI D;  1Z01 A;  1O7G A;  3GOB A;  2NUK A;  2ZYL A;  4QUR A;  4H44 D;  2XR8 A;  4U3F E;  2JZA A;  2NWF A;  1SQQ E;  3BCC E;  4AAY B;  4HM2 A;  3VMI A;  2HMO A;  3GKE A;  4HM1 A;  4P1C H;  3GL2 A;  4NBA A;  1G8K B;  5HL4 A;  1PPJ E;  4HM6 A;  1PP9 E;  3GKQ A;  1KB9 E;  1NYK A;  1SQV E; 
#chains in the Genus database with same CATH homology
 1VM9 A;  3L74 E;  3EQQ A;  1P84 E;  3VMG D;  4AIV A;  4HKV A;  4H0L D;  1L0N E;  2GBX A;  2XRX A;  2HMK A;  3L70 E;  4HM7 A;  3VMG A;  5AEU A;  1SQP E;  2BMR A;  4OGQ D;  2YFL A;  2XSH A;  4QDF A;  4EMJ B;  4P1B H;  2DE6 A;  2DE5 D;  1RFS A;  2B24 A;  4HM3 A;  2GBW A;  4NBH A;  3FOU A;  3GCE A;  1VF5 D;  2NVG A;  3L72 E;  4NBE D;  2E76 D;  3CXH E;  4QUQ A;  4NBG D;  2ZT9 D;  3GTS A;  1O7H A;  2NUM A;  1ULJ A;  1NDO A;  4NBC A;  3GTE A;  4NBC D;  3VMH D;  2E4Q A;  3N0Q A;  1O7W A;  4HM5 A;  2DE7 A;  2YIU C;  2QPZ A;  4NBF D;  2JO6 A;  4QDF B;  1O7M A;  2DE6 D;  5KLV E;  5AEW A;  3H1L E;  1UUW A;  2FYN C;  1FQT A;  1BE3 E;  2FYU E;  1SQX E;  3H1I E;  3GCF A;  1RIE A;  2YVJ B;  1VCK A;  4NBG A;  3GZX A;  3D89 A;  1Z03 A;  1JM1 A;  5KLI C;  4NB8 A;  4H13 D;  2HMJ A;  4HM8 A;  4NBE A;  1NTM E;  2IBZ E;  2QJK C;  3DQY A;  1WQL A;  4NB9 D;  4NB9 A;  3TGU E;  4QDD A;  3CX5 E;  3C0D A;  3VMH A;  4NB8 D;  1SQB E;  5KKZ C;  1Q90 C;  1Z02 A;  3GL0 A;  2CKF A;  3CWB E;  1O7P A;  4HJL A;  4NBF A;  3L75 E;  2B1X A;  2YFI A;  4QCK A;  3GB4 A;  3L73 E;  5BOK A;  1ZRT E;  2QJY C;  2BMO A;  5CXM A;  2A06 E;  2HMM A;  2BMQ A;  2E74 D;  1EG9 A;  1L0L E;  2XSO A;  2HML A;  2NVE A;  3H1H E;  3L71 E;  4NBB D;  4NBD A;  2Q3W A;  4NBH D;  4QDC A;  4HM4 A;  4NBA D;  2YFJ A;  3GZY A;  3VCP A;  2DE5 A;  3VCA A;  4NBD D;  4NBB A;  1EZV E;  1ULI A;  3H1K E;  2E75 D;  1NU1 E;  4QUP A;  2E4P A;  2D2C D;  1WW9 A;  4PD4 E;  4PV1 D;  1O7N A;  3H1J E;  2BCC E;  2I7F A;  1BCC E;  2QJP C;  1G8J B;  2HMN A;  1NTK E;  1UUV A;  3AZC A;  1SJG A;  1KYO E;  2NVF A;  4HM0 A;  1NTZ E;  3EN1 A;  2DE7 D;  3VMI D;  1Z01 A;  1O7G A;  3GOB A;  2NUK A;  2ZYL A;  4QUR A;  4H44 D;  2XR8 A;  4U3F E;  2JZA A;  2NWF A;  1SQQ E;  3BCC E;  4AAY B;  4HM2 A;  3VMI A;  2HMO A;  3GKE A;  4HM1 A;  4P1C H;  3GL2 A;  4NBA A;  1G8K B;  5HL4 A;  1PPJ E;  4HM6 A;  1PP9 E;  3GKQ A;  1KB9 E;  1NYK A;  1SQV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...