3VCRA

Crystal structure of a putative kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase from oleispira antarctica
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
MTQLDTWLANTKPLIPVIVIDDLVHAIPMAKALVAGGVHLLEVTLRTEAGLAAISAIKKAVPEAIVGAGTVCTADDFQKAIDAGAQFIVSPGLTPELIEKAKQVKLDGQWQGVFLPGVATASEVMIAAQAGITQLKCFPASAIGGAKLLKAWSGPFPDIQFCPTGGISKDNYKEYLGLPNVICAGGSWLTESKLLIEGDWNEVTRRASEIVKLSDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome sequence and functional genomic analysis of the oil-degrading bacterium Oleispira antarctica.
pubmed doi rcsb
molecule keywords putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase
molecule tags Structural genomics, unknown function
source organism Oleispira antarctica
total genus 67
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3vcrA00
2NXGA 3NL6A 3WJWA 2C1HA 1ZCOA 2ZRWA 2Z2UA 4LNYA 3HGOA 4ZZ9A 2CU0A 2OJPA 2WNNA 2X1UA 5C6MA 4C1LA 4O1BA 2C6QA 4JYDA 3NGJA 4O53A 2DJXA 3UWWA 1O95A 3IVUA 3MUXA 2OT1A 2E5CA 2R14A 2ZA1A 4AXKA 3W7DA 3U2OA 4UTTC 4DELA 4PC8A 4Q33A 3NQ8A 2QKFA 3B0PA 1R30A 4UTWA 5FF2A 3P84A 2QEZA 1JJKA 5D05A 4Z1AA 1JR1A 1H50A 2Y7EA 4HN4A 4M7SA 3WJXA 1AW1A 3TXZA 1QDSA 5G4EA 1TTQA 1DV7A 3MP5A 1KBIA 2G96A 1UASA 3DH7A 2D73A 5SWUA 4G1KA 1TREA 1BEUA 4NJHA 4BWLC 3FYOA 1B9BA 2ISSA 1L6YA 2CWNA 3LBCA 4BR1A 2YR1A 3PG8A 3SIZA 1TPC1 1SQ7A 3NQDA 4GNJA 5DBUA 1HL2A 3CIWA 3W72A 1TO3A 1ME7A 5CZTA 5I3GA 1AL8A 3IGSA 1JRCA 3P8JA 3LCXA 4NZJA 1OX5A 3HMJG 1G6CA 3IV3A 1H62A 4MVAA 5AYYA 2FTPA 2VFHA 2NXHA 1LORA 3HF3A 2AAMA 3TQVA 2FPTA 5EYWA 1G4PA 2A21A 3PC0A 1JVNA 2AGKA 3W1XA 5C2XA 3FKKA 1A5CA 1H7OA 3I7RA 3QF0A 1HFBA 3KVJA 4TX9A 2V2DA 5EBUA 1ZJIA 1H7PA 1SO4A 4Z08A 1FWRA 1DL3A 1LLZA 1FDYA 3KRZA 3MBFA 2QCGA 1AG1O 1QPNA 4NNAA 2W79A 1LRNA 3TH6A 3NL5A 4CCCA 3L0GA 3N2MA 5BMWA 3KVLA 2PRHA 2A7RA 4HSOA 4NUWA 3TAOA 4XWUA 1Y0EA 1LROA 1R2RA 2V5LA 1G69A 2ZZ1A 3G1DA 3FJLA 3ZFHA 1KFCA 2A7PA 3G1YA 3I6RA 3QPYA 3BW4A 1PCKA 1FUYA 5F4WA 3T4CA 4Z1DA 1W31A 2JKEA 1JCNA 2H3DA 1RQBA 4A29A 3C2VA 1XBXA 1ICPA 2B7QA 5AHIA 3N73A 3O16A 4ZVJA 3M1ZA 3R5EA 5K9CA 1DOSA 1H7RA 1Z44A 3EX6A 2NWSA 3MI2A 3NL2A 4XTIA 2EGZA 1GVRA 1QWGA 2GUUA 5G2WA 2EF9A 3C8FA 1RQEA 2PRMA 3MWAA 5FF3A 3W88A 5D30A 1YTEA 3LLFA 5FEPA 1TV8A 3TUUA 1TIMA 4K8EA 2QCDB 2FPYA 1VZWA 3TCEA 1MSSA 1TPFA 3TW7A 1SPQA 4OT7A 4QM1A 4UFIA 4FXRA 1H7XA 5KSWA 3W2UA 3GDTA 1DHPA 1OX6A 3C3NA 1OYAA 4N6FA 3W7KA 4J9JA 5A8GA 1DJQA 1ZAIA 3L2IA 2Q3RA 3UPWA 3SGUA 5LSMA 3SJ3A 2GQAA 1ME8A 3PAJA 3GKAA 1VYPX 2YGYA 3LXBA 2VELA 1F5ZA 3NQ6A 3LLDA 3M16A 4H3DA 4IMEA 1AL7A 2NX9A 3DI1A 2ZZ4A 1JUKA 3M5XA 5H2ZA 1FCQA 1UUMA 3HBLA 2YCEA 3N34A 1XC4A 3BW2A 3FYPA 1YTDA 4JYEA 3W7EA 3QW3A 5LZLA 1PE1A 3P8IA 1QAPA 1VS1A 4L4LA 1VHNA 5FI8A 5DN1A 4TR9A 4EF8A 3MJYA 1KFJA 3QMRA 2QDGA 5AHNA 2BLEA 3R89A 1R47A 4NXSA 4U28A 3ABRA 3S5NA 4FX6M 4NNCA 4DO4A 1P5BA 4Y96A 4HNNA 2C3ZA 2H8ZA 4UFMA 3PUOA 3F4NA 1W5PA 3C56A 1WYIA 1FBAA 4QISA 2OT0A 4K7VA 3STFA 3BG9A 3VFLA 2GJLA 3HIJA 3MP3A 2ZFAA 3KXQA 1JUBA 2DZXA 2G95A 3G1XA 3R2GA 1TCDA 1AMKA 4R33A 4WOQA 1FCBA 3WJZA 1WV2A 5K4XA 4DQWA 1K8ZA 1XFBA 3O05A 3GR7A 2RKXA 2WO5A 4JDBA 4ADSA 5GVJA 4TIMA 1KFBA 4UFJA 2ZZ3A 2A1YA 3N3MA 5D04C 2V2CA 1PVNA 3FLUA 2WQPA 2NZLA 3P5ZA 5G1TA 4AF0A 4PA8A 1VYRA 1VGAA 3DENA 2V81A 3NPUA 4MJZA 1B3OA 2FJKA 5J5DA 1KV8A 3CTLA 3C2FA 2V9DA 3PS7A 5HJLA 3TSBA 3HGRA 4JIQA 4YLWA 4IMFA 4IX0A 3STEA 3LTPA 3HB9A 2YFOA 4RZ5A 3WK2A 4FX7A 1TRDA 1H51A 2YYUA 3HG4A 2Y7GA 1MZHA 3DAQA 4K7YA 1YDOA 3KVKA 3PBUA 3UPBA 4UMBA 5EA9A 3O15A 5F4XA 3E0IA 4O54A 1FDZA 4JTKA 4XTDA 3HPSA 1LBMA 1GZGA 2RHGA 1JCJA 4QITA 3NNTA 3W3OA 1PCWA 3IVTA 4FNTA 3B03A 4O0ZA 4UIOA 4WXYA 1F05A 4MY1A 1X1OA 2EAWA 3L9CA 3M47A 3ZWTA 3PUEA 3DBPA 4K39A 1W5OA 4P61A 3NXFA 1R2TA 4JN6A 1RR2A 5FESA 2A6NA 4W9TA 4M6QA 3EEGA 2QCNA 5I3HA 3G0XA 1B4KA 4O8RA 3W71A 3O07A 4JICA 4LT9A 5TBOA 5D32A 2ZRZA 1SFJA 3M5ZA 4O1DA 1G7VA 4N9CA 1K03A 4O11A 1M7PA 4Y90A 4FNPA 2HSAA 3TX9A 2V2HA 1TQXA 4IMGA 3LXCA 4MKNA 3F1QA 2JKPA 4PODA 3WK3A 2Y63A 1TYGA 3GXPA 1XUZA 3DFSA 3DI0A 2GQ9A 2ISVA 2DZVA 3ZR4A 4R34A 2OCZA 3CC1A 2C15A 2RH9A 4E0CA 4ORIA 1K3UA 3LRLA 3IRDA 1YYAA 4YWIA 1J5TA 1HUVA 1VHCA 5LGZA 1JULA 2QCFA 2NX3A 4GBUA 3RMJA 4MYAA 3A9IA 3LCGA 2Y62A 3GAKA 1LOSA 1FCVA 1JCXA 5KZMA 1E51A 2C14A 4MLRA 1XBVA 2QJGA 1A5SA 2NUXA 2A7NA 5IBXC 4X2RA 3MW7A 2Y89A 4AHQA 4N9EA 3EXTA 2CZ5A 2F84A 1XM3A 3UYCA 3UD6A 3QRHA 4KKXA 5KMYA 1F73A 1P0KA 2QDHA 3VKJA 5C5YA 4NJIA 1ZHAA 2ZA3A 2CZEA 2HMCA 5TIMA 3LHYA 3LI0A 3IIXA 3KX6A 1GVFA 2X1TA 4AAJA 2Q3OA 3KVMA 2Z0IA 5F1UA 3MHGA 2ZBTA 4I7VA 1IXPA 1T8XA 1G7UA 5DELA 1GTEA 3HG2A 4ZQNA 1I2QA 3TQ0A 1JUEA 4IMCA 1OYCA 3TE9A 1P0NA 3TJLA 2CLKA 4RR4A 3W7JA 4LUJA 6TIMA 2H6RA 1H60A 4JEQA 1WOAA 1JRBA 3L5MA 1X7FA 1OJXA 4GE8A 3E9AA 3NAVA 2ABBA 3G1VA 1OFRA 3EX4A 2QCCA 4Z0JA 3CPRA 2Q8ZA 3Q94A 1H7WA 3B05A 3IGXA 1IXOA 2R94A 1EP1A 3HQ1A 3O6CA 3LHUA 3W1TA 5DY2A 3S5YA 5BOOA 4UC5A 2CLEA 5CPNA 5BRBA 3M5VA 3UWVA 3OEXA 1XI3A 3STGA 2YW4A 2P0OA 3KAOA 3K30A 1ADOA 4FX8A 3NQ7A 2CZDA 4OV9A 4RV8A 3TU9A 3W1AA 4FNRA 4NXKA 3AJXA 3M5YA 1KM0A 4XKYB 3DFQA 3NG3A 1WQ5A 5I3IA 2QCLA 4ZMGA 3BLIA 4O17A 2ALDA 4P2VA 3A5FA 3O06A 3L68A 1RV8A 3PB0A 1P1XA 5AYZA 1DVJA 3G1AA 1Q3NA 4IXXA 3PULA 5K9XA 4JY9A 1W54A 2NUWA 4CNNA 3G24A 3PSVA 1G4EA 1FQ0A 4UTIA 5BMXA 3UY7A 2I14A 1OFOA 3MHUA 5AYXA 1LP6A 3S5ZA 1KM5A 2VEPA 3LHZA 3UZ5A 1K7EA 5FF0A 1EWDA 2C19A 4MFEA 2CLFA 1L6SA 3HPZA 4XUGA 3HG3A 1T96A 4JTEA 3DXIA 4GUHA 2ATSA 3CWOX 3Q58A 4UR8A 5K4ZA 5HUPA 4GUJA 4QAIA 5BNKA 2HS8A 3RFAA 4LUIA 1NAL1 1VLIA 4GXMA 4NVTA 2DZTA 4O52A 1CW2A 1EA0A 4FHAA 1K02A 3W7MA 2DZPA 2OX1A 3EWYA 3PBWA 4BFAA 3JRKA 1F74A 3F4WA 4NZFA 1VR6A 3NQCA 2H3BA 3ANYA 1O5KA 4O28A 5F2MA 2GVGA 3NZ1A 5AC6A 2ZZ7A 5HR6A 2ZYFA 1Z48A 1OFPA 4MY9A 3W2MA 4N6EA 4AVFA 1WXJA 3M44A 3LRKA 1PHQA 2X1SA 3NPWA 1WAUA 4I7UA 2O7SA 2FB3A 1U5JA 4WY0F 3MMTA 4PFMA 3P5YA 5HWNA 3W7QA 4UNLA 1F6KA 4GUFA 1A5BA 3ABOA 4LV9A 4NNBA 4QQ3A 3G8RA 3DZ1A 4RX0A 1ZENA 2XFWA 3NYZA 1J2WA 2G97A 3T55A 4WOZA 3IIVA 4M7TA 3L66A 1GWJA 4OE7A 5D2WA 1OVDA 3QPZA 2WNQA 3C6CA 4JTIA 1S5WA 4RLIA 2R8WA 2HS6A 1EX5A 3CT7A 5L6UA 3M9YA 1EPXA 2FPVA 1I8JA 1H63A 2Y88A 1QFEA 5HR7A 4WY0B 4DF2A 5H91A 2XN0A 4CNPA 2FIQA 1CX9A 1KLYA 4YXGA 1I2OA 2NXIA 1PIIA 3GX9A 2TYSA 4JR5A 4AEOA 4UFLA 4DBDA 1OX4A 3Q2DA 4CCEA 1VC4A 3N14A 4E2BA 5F2LA 1KA9F 1W0MA 4A21A 4IJBA 2QCDA 3UXDA 3DKLA 1M6JA 4LU0A 3V1PA 4LC8A 4LY8A 3T44A 4LWWA 4NU7A 3IVSA 8TIMA 3TIMA 3W7PA 2E6FA 4N9DA 4JTUA 3C4UA 3W6YA 3LBMA 1XL9A 4C1KA 1MO0A 3FA5A 1T0OA 5AC7A 2ZZ2A 4LV4A 3ZS4A 3W1PA 3QYQA 3T40A 2V30A 3W84A 3GXNA 2E6YA 1FXPA 4FXSA 3D0CA 4N4PA 3U8GA 5LHEA 3SR7A 5F2GA 3W07A 1TTJA 3BW3A 3MYPA 1KBJA 4A22A 1OX4B 1BTMA 3GB6A 3THAA 1OF8A 3DKJA 3WFAA 4K8HA 4E38A 2NV2A 5I3KA 2VFEA 1TPB1 5T26A 3NPVA 2ZRVA 4ICNA 2YZRA 4HIBA 1KFLA 4UCGA 5LGXA 1TJRA 1FX6A 5CKSA 2AQWA 4JTFA 3W7CA 2JKAA 2B7OA 4RZ4A 4E2DA 3TR2A 1IXNA 1WOBA 5I3FA 3W1MA 1W37A 1ME9A 1DJNA 2JGYA 3B04A 3I7QA 5AHMA 3W2NA 3P60A 2CLOA 2WOQA 4LS0A 5AHEA 4H4IA 3TKFA 2DORA 5HINA 4Z1BA 3W7GA 3O6YX 2I9EA 1ZAHA 3G8EA 3OA3A 1VQTA 4NQ1A 3UY8A 4O13A 4UTWC 1QR7A 1W56A 2DU2A 5D2YA 1GG0A 3CEUA 1OF6A 1MEIA 4ORMA 4JDYA 1V5XA 4UTKA 2A6LA 2NWRA 2X16A 1W3NA 1QOQA 3HG5A 2QCMA 4O15A 5LNWA 4PH6A 4NT0A 3QQ0A 4TU1A 3S1XA 3TROA 5K9DA 2RDWA 3P62A 1YPIA 2GVLA 3NVTA 3W2JA 4QNEA 2C16A 2HTMA 1W5MA 3ATYA 2RDTA 1GT8A 4GJ1A 3GAYA 3R13A 3L0NA 1TSIA 5LNVA 3MHFA 4WQ6A 3S1UA 5TQLA 3QMSA 1GQNA 4AH7A 5KINA 4XBKA 5F1VA 3KOFA 1GVQA 4BK9A 2CFFA 4OV4A 4JTSA 3G3DA 3KRUA 3OIXA 3GLCA 3WJSA 3B8DA 1NFBA 3UXAA 2DZUA 3UWYA 3ABQA 2GOUA 1O5XA 4LVGA 1S5VA 3QW4B 2B0MA 1EP3A 1W1ZA 2E5BA 3NO5A 4N4QA 3C61A 1DBTA 4YL2A 1BWKA 4BF9A 4A2SA 2FFCA 4R7JA 4ZQOA 4JX6A 2A85A 3P81A 3LCIA 1I2RA 5I3JA 1FY6A 1VH7A 2NLIA 1B57A 5EKYA 1KTNA 3RU6A 3S5OA 2ZTJA 2E1DA 3BLEA 3ELFA 1KTCA 3LHWA 4IPJA 4M6VA 4AWUA 4R53A 4IMDA 1SSGA 2QF7A 1Q6OA 4JTLA 3S1WA 2R91A 3TV8A 1VRDA 1G4SA 4DPQA 4DO6A 5KITA 3O63A 3QEZA 4AWSA 2J88A 3S42A 2GJNA 2UV8G 3LB0A 3FS2A 1KM4A 3LX9A 4TMCA 2YXGA 4NJJA 1PV8A 4N9BA 4FF7A 3PBVA 1MXSA 4PTNA 1JCYA 2FQIA 3CIXA 1J4EA 1I2PA 1K8XA 2DJLA 4S2BA 2J6XA 2JBMA 1X6UA 1ZALA 4RCXA 3TDFA 3GXTA 3O8AA 2Y7FA 3N2XA 3NQEA 1W5NA 5CPOA 1XUUA 1SZFA 1OHLA 3OG3A 2BSLA 3RK8A 4RKAA 5AHLA 3W7IA 1YXYA 3MP4A 4DBEA 3P67A 2O7QA 3CWNA 3W7OA 1F76A 4Q4KA 5DXYA 3M6YA 5EY5A 3JR2A 4N02A 3QH2A 4FIQA 3W75A 3UWUA 2VFDA 4I9AA 4YMZA 2WSQA 2PE4A 3DFPA 1FXQA 4UFHA 3GDRA 3KRSA 2W6RA 4FIRA 2J27A 1OK6A 1LRQA 1KM2A 3NA8A 3BVJA 5AHFA 5HMSA 4Y9AA 3I68A 2QUVA 2CLHA 1GVOA 3LCFA 3EKZA 3G0SA 4IXHA 3WK0A 1TPH1 3RLVA 3CM4A 3HO8A 4HHPA 3UWZA 1UUOA 2IQTA 1I4NA 2OMAA 3QZEA 1QMLA 3UWQA 1YPFA 3NR0A 5G5IA 3EXSA 1W3TA 4JTJA 3SFKA 2X1RA 4X22A 5D2TA 1OFEA 3QC3A 3CHVA 3PF3A 4LVAA 4B5NA 3TW6A 1O4UA 3L5AA 1P4CA 4WD0A 2ZQ0A 4CLMA 3M0ZA 1WX0A 4UTMA 3PM6A 4OHQA 4UTTA 3NQ2A 4O57A 4QNWA 3DFNA 3SECA 4WUIA 3L5LA 3L67A 2WJZA 4Z0SA 4MZ1A 3KFTA 3C52A 1EP2A 5U7SA 4MY8A 3GZ3A 1JQVA 1TV5A 3VNDA 3P82A 1SSDA 3QFEA 3L0KA 4UXDA 1DORA 2JK2A 1X1ZA 3TMLA 3TFXA 1A53A 3VCRA 5DBTA 3OVQA 5D38A 3SY5A 4HPJA 1JCLA 4BWLA 3W1QA 3S9YA 3IIOA 1XCFA 1QPRA 1EB3A 4NX5A 2I1OA 3LI1A 4M6PA 1R2SA 3EX1A 5CZJA 3QSTA 1A5AA 5LNSA 1QPOA 2E77A 1VCVA 4JYFA 1SO3A 4CNOA 3TC6A 4HNUA 1GOXA 3W7LA 4LOCA 1MEWA 2C18A 4LVDA 4N2YA 2FB2A 3N9RA 4JXCA 4XKYA 4UUIA 4AHPA 4OQVA 4CQ9A 2QUTA 4EOUA 1OFDA 3PR2A 1XBZA 2VENA 3SZ8A 4H6KA 4EWND 1EWEA 2ZZ5A 4A2RA 3OHIA 2E6DA 2QAPA 2BXVA 2JGQA 4ONVA 1FDJA 2B7PA 5F2IA 2VFGA 3W2LA 2RDUA 1IIGA 4PL2A 1L6WA 1EEPA 3I7SA 2A2IA 1VYSX 3NQGA 1RZMA 1TB3A 1X8FA 2A0NA 3CB8A 3CLMA 5KZEA 4O1CA 2X2GA 4YCPA 5CPLA 1IGSA 2QJIA 1SUXA 2E6AA 4WJEA 4AB4A 4KFOA 4RJEA 1EUNA 3SW6A 4IPIA 2QCEA 4RK8A 4POCA 1MEHA 3RLUA 1C8VA 1FWSA 1OFAA 2KZHA 4XBSA 4Q32A 4MFDA 1YDVA 1YXDA 3LOTA 1ICSA 1OFBA 4YCOA 1OFQA 3HJZA 4KFNA 1SU5A 3TSDA 4K36A 4M5PA 2A4AA 5E93A 1ONRA 1H7NA 3R12A 3B0VC 3LGEA 5HUOA 2OZ0A 1L9WA 5EPDA 3S0CA 4RXGA 1TJPA 2E09A 2XN2A 2QAFA 1XDMA 4IX2A 3R8RA 4O18A 1ZFJA 3W2KA 2Y70A 1OG0A 2P1FA 2V8ZA 1GEQA 1XKYA 1SW3A 3P61A 5CZSA 4LC6A 2WKJA 3BG3A 5MHBA 3LHTA 7TIMA 3EX2A 2B7NA 1AK5A 3STCA 1QNVA 3CQ0A 1LCOA 3W1RA 3P7YA 4OU1A 4DPPA 3F03K 4O16A 5AOUA 1M5WA 4O12A 1VCGA 1QOPA 1IF2A 1IXQA 2V5BA 3NQFA 3G1SA 3IIPA 4JNMA 5KZDA 4M19A 4A3UA 1FWTA 3G18A 4UNKA 2ATMA 4EIVA 4QIUA 5D2XA 3G1FA 1LOLA 3IGUA 1UJPA 4LW7A 2TMDA 1SZGA 3N9SA 1EUAA 3PBYA 2Z6IA 3PY2A 1G67A 3LV6A 1HG3A 3TMQA 1SR9A 3H53A 1HO1A 1GYNA 2WSRA 4DEFA 1KM1A 4JTGA 3QSRA 4IGHA 1NSJA 1OK4A 3CU2A 1RVGA 1YDNA 3NPXA 3DFOA 4PEKA 4WY0A 3ZWSA 4QSHA 1TPWA 1ZY9A 4KWWA 4UMCA 4KFPA 1K7FA 4O1AA 2C13A 3PSWA 2QJHA 3DHFA 5E1QA 1VCFA 5G2HA 3O1NA 1BWLA 5KTLA 3MI6A 4ZQCA 1V7YA 3HOJA 2DZSA 4K6AA 3S8HA 3WK1A 1TV7A 2YPIA 3E96A 3W76A 3W9ZA 4I7WA 1WDWA 3BG5A 2FDSA 1TPUA 5DCEA 3LCWA 3W1UA 3IEBA 5LKYA 4HSNA 2PCQA 3TQKA 4EF9A 3C2RA 4WXZA 4ZQPA 2BX7A 3TXVA 2WNZA 3FJ6A 1EIXA 3EWZA 4BI5A 1VJIA 1F6PA 2WV8A 5K3VA 3T78A 3DHDA 4U4MA 2ZCGA 2VOMA 1JQXA 4MZ8A 4O10A 3I65A 5CZ0A 1KM3A 3RNDA 4IOTA 2CW6A 3TFCA 4O14A 4GUIA 5C55A 1CI1A 3USBA 4WZHA 5EMUA 3A22A 3LHVA 3NM3A 5CG7A 5CPMA 3DU0A 3PWAA 1RPXA 4JGDA 3NOEA 3VE9A 1SO5A 1K8YA 5AB3A 4ALDA 3GDKA 3BLFA 3H54A 1U83A 2Y7DA 1WA3A 5HNRA 1UB3A 1SO6A 4NX0A 5D37A 2VXNA 2YDAA 1FCUA 1SZNA 3DFTA 3L65A 3YPIA 3G0UA 1D3GA 1PL9A 2C0AA 2B4GA 2F7FA 4OBTA 1YTKA 4MLJA 2TSYA 4OGZA 1TPDA 5LHFA 3A21A 3W7RA 1KV5A 5D09A 1D3HA 3FKRA 4FNUA 2ZZ6A 4S1FA 4PCFA 3NL3A 1LM1A 2NX1A 2W0UA 4LS2A 3C0JA 4JS3A 2ZRXA 1RD5A 1NEYA 3W23A 3NDOA 1AW2A 2EHHA 3LTSA 4IWWA 4O19A 3S6DA 1LBLA 3HGJA 2YYTA 3JS3A 3HGSA 1KW1A 3ATZA 3BARA 3C2OA 4LVFA 2J9ZA 1QPQA 5FF4A 1B4EA 2VEMA 3BO9A 4OWGA 2H8XA 1SFLA 2VEIA 5AN7A 3BK0A 4JX4A 1XBYA 4IUOA 3EKLA 3O6DA 4GC4A 4CQ8A 3EWBX 1W8SA 4WX2A 1SZEA 4L4MA 3T7VA 1Q6RA 2EKCA 3M41A 1DKWA 3KHJA 1H61A 2VKZG 3VE7A 1ZAJA 4IQLA 1R46A 2ZTKA 4O4VA 1SW7A 4ADTA 1F7BA 4UTHA 4EVZA 1FWWA 2A5HA 1PHWA 2Y85A 3B0UX 4ML9A 1C29A 1KFKA 1AW5A 1TTPA 3QM3A 1Z41A 1SW0A 3AO0A 3PG9A 1ZNNA 3W83A 5D2VA 5AC8A 5IBXA 5DLCA 4ADUA 1ML1A 2CZFA 2Y6ZA 3LXAA 1WBHA 4MPQA 3A24A 4ZQMA 5FEZA 1HO4A 3LERA 3NQVA 5EL1A 3FOKA 3UQNA 3M43A 2V82A 4CCDA 1PS9A 1WBJA 4KWVA 4TO8A 2ZA2A 3RF9A 5D33A 2J9XA 2J9YA 4NJGA 2TPSA 3E12A 3FIGA 3U6WA 3W85A 1TPVA 5AFDA 3GVGA 3BGGA 3NQMA 5J5RA 4FNSA 3BV4A 4HKPA 4ZL1A 5CSRA 2CLLA 4X3ZA 3NQAA 4UTLA 1NF7A 2BWGA 3GNDA 5FEXA 4JD4A 3MYOA 3EX3A 1XXXA 4X9SA 2J24A 3H55A 4DO5A 2G5WA 1N8FA 5G2IA 3MBDA 3P80A 2VFFA 1QCWA 4DF1A 1H5YA 1A50A 4LVBA 4DXVA 3UNDA 3B06A 5DXXA 1NVMA 5BW6A 1TTIA 1RQHA 5F4SA 1LRTA 2Z1BA 2DP3A 1ICQA 3PUDA 3LTYA 3LV5A 3W7NA 4MZYA 3CEPA 5C54A 1C9DA 5HULA 4Z1CA 3GIYA 2ABAA 3GYEA 4RXFA 3G22A 3EB2A 1TRIA 2VC6A 3MO7A 4O50A 1KM6A 1G4TA 1Q6QA 4AWTA 2YX0A 5DCDA 2CLMA 2QR6A 3TNOA 1I45A 4NJKA 4BI7A 3V75A 5DY3A 4AF0B 1GYLA 2WPBA 1Q45A 1Q6LA 2ZRUA 3IIZA 4K37A 5G1YA 3S1VA 3OVPA 2NV1A 1LBFA 1XDLA 2Q8LA 5A5WA 4AMAA 2YSWA 3OVRA 3LM7A 2DZWA 2YW3A 5LNUA 2P10A 5CSSA 4JIPA 5D03A 3TJXA 4GFSA 4LS1A 2VFIA 1VLWA 5IM51 3N19B 3P74A 3FEMA 3DGRA 1I2NA 4UFKA 1DQXA 1KLZA 1VPXA 1S5TA 2PRLA 2WSYA 4FB7A 4QJ1A 1OABA 1KTBA 1GTHA 4HT3A 4JY8A 1W3IA 1M7OA 3W7HA 2PURA 1GG1A 4XZ9A 5L9FA 2ZRYA 4RZ6A 3TC7A 4GWEA 3G1HA 1T99A 1GPWA 2E68A 3EWXA 4HNVA 4MIMA 1LLWA 3TSMA 2H90A 3GDLA 3W74A 2VEKA 4XQ6A 1N55A 1GVSA 1O60A 2FLIA 1IIHA 2GVJA 3W70A 3B4UA 1LYXA 4UTUA 4MUZA 4FNQA 4O0KA 4UMAA 1UCWA 3OBKA 1OYBA 3PB2A 3UZJA 1W5QA 1HTIA 4O4WA 4GRSA 2QUUA 1S3HA 3QJAA 5G4WA 3MI3A 3INPA 3W22A 1O94A 1TQJA 4ZQRA 1LZOA 3BGJA 3QQ1A 5DCBA 3E02A 4MOZA 3TA6A 1QO2A 2ISWA 1LOQA 3A5VA 4DF0A 3E49A 1H1ZA 2BZNA 1YADA 2GQ8A 3ABSA 4MYXA 3SGZA 3LDVA 4TMBA 2GPTA 3BPWA 3LCLA 3NM1A 4FO4A 6ALDA 3LRMA 3W1NA 1F2JA 4CQAA 3WJYA 3A23A 4HPXA 4UR7A 2V0TA 1NF0A 1LTDA 4D2JA 4Y8FA 1H1YA 3PVFA 1THFD 1Z42A 1YLVA 2QCHA 5FEWA 3NEVA 3FFSA 4Y6GA 3QMTA 5U4NA 4S2CA 1LDCA 4JX5A 1D9EA 3SI9A 3W87A 3G3MA 3GR8A 1FWNA 3C2EA 2ZDRA 2CLIA 2Y61A 3GKFA 1ALDA 1GJPA 2TRSA 2YFNA 2NUYA 2E5DA 5HWMA 5K7JA 3SSJA 4LRTA 2Z6JA 2EPHA 3Q37A 3W73A 2PC4A 4PL1A 1UBSA 4BI6A 3M7WA 1DQWA 3HPXA 4K38A 1TPEA 1YXCA 3LCHA 4FEZA 3EWWA 3W86A 4JTTA 1L2UA 4LRSA 3GK0A 4GUGA 3TAKA 5E0KA 3THQA 3W1LA 1KFEA 1QO5A 5ABTA 2BTMA 5D02A 1JCMP 3EWUA 3TK7A 2X30A 3GDMA 4LTSA 1N7KA 2LLEA 3NZRA 3L21A 5HWJA 3GNNA 1TMHA 1K7XA 5K2ZA 3VI2A 5LNRA 5HQEA 3EXRA 4UTJA 4JTHA 1BKSA 2RFGA 4MJMA 5FF7A 5CGQA 4HNTA 2XN1A 4AHOA
chains in the Genus database with same CATH superfamily
4AQLA 4OFCA 3HGOA 4GD0A 2X1UA 5C6MA 4O1BA 3GTHA 2C6QA 3WNKA 2DJXA 2EG6A 3IVUA 3MUXA 1JI2A 2R14A 1XIJA 1TUFA 4PCNA 4DELA 4HTBA 4CD4A 2QEZA 1JJKA 1EYWA 3WQGA 4Z1AA 2OOGA 3WJXA 3TXZA 4B4FA 1QDSA 4Q8PA 5G4EA 1QT1A 4IICA 3MP5A 1KBIA 3N9KA 4Y7EA 1CGXA 4HHHA 3FA3A 1LF1A 1R3SA 2G96A 1U2YA 2Y5JA 3DH7A 2HWGA 3V18A 1HKWA 4G1KA 1TREA 4V2XA 4BWLC 4C6MA 1XCWA 1ZBKA 1WXZA 3BLKA 3V1HA 2DFAA 2ISSA 3LBCA 2CWNA 1AODA 3PG8A 1XIFA 3FXYA 4GNJA 4P7RA 3GS6A 2O56A 2YBTA 1TO3A 1ME7A 3HMCA 4IGSA 3P8JA 3UJFA 2VEGA 3HMJG 3KTXA 3M0LA 1LL6A 1JZ4A 1C8YA 2NXHA 4FXJA 3HF3A 1XLFA 4CD5A 1GW9A 3PC0A 4IL2A 3ES8A 3DOPA 3W1XA 1PZ1A 2WCGA 4FXFA 1H7OA 4UNIA 3OLGA 4IFRA 3UW6A 1UOKA 1V6TA 3AYTA 5G1MA 4YYCA 4XISA 1DL3A 1LLZA 4GQ0A 2PF8A 2PDIA 1W3KA 1RJRA 1QPNA 1A5MC 2Y24A 2W79A 3P93A 3NL5A 5A2AA 5BMWA 3KVLA 4LAKA 4NUWA 1R2RA 2EKGA 2V5LA 2ZZ1A 3IRSA 4MG4A 3T2OA 3QPYA 1PCKA 2F9RA 1UR9A 1W31A 2XSAA 5HPCA 2OSYA 2XVGA 3C2VA 3UG3A 2Z29A 4JZ5A 1QOXA 4QTGA 4P8UA 3S2LA 1Z44A 1JDEA 3MI2A 1JDFA 3CUXA 4XTIA 3QZAA 4ICCX 1B9ZA 4JHOA 2DEPA 3C8FA 4AZ5A 5CXPA 3ANVA 3MWAA 5FF3A 2W67A 1K77A 1V3LA 3RRXA 4TV6A 1TV8A 1TIMA 4K8EA 2FZ9A 3FK4A 1VZWA 1XYFA 1TPFA 1SPQA 3MMUA 5AVNA 3QHMA 2POZA 2Q8XA 1RA0A 4M8UA 3W7KA 3NQBA 3M0KA 2HVOA 4U3AA 1DJQA 1ZAIA 4AZ7A 3SJ3A 4W85A 1ME8A 4J2MA 3WFLA 1VYPX 2YGYA 1W6TA 1F5ZA 1S2AA 4RNHA 4JFSA 4GGBA 3M16A 4DUVA 3OIHA 2NX9A 4L4OA 4R27A 3M5XA 1FCQA 3HBLA 4NZ3A 3BW2A 1YBQB 1XLLA 3W7EA 1LG1A 2CZVA 3QW3A 1ONWA 5LZLA 4B5TA 4DWDA 1PO9A 3OQEA 5CH9A 2GK1B 3U0HA 4ERAA 2C7FA 5FI8A 2O55A 1E0XA 3WENA 5FSEC 1KFJA 4KGLA 1PWMA 1VBHA 5AHNA 1ZQ5A 3N6JA 4NXSA 2IPGA 4QCFA 3RLGA 1UW9A 2C3ZA 2H8ZA 1M03A 4QDWA 5HATA 3SRHA 1FBAA 4K7VA 3BG9A 2XWDA 4GJIA 4Q8VA 3MP3A 1CNVA 4PBFA 5EBAA 2X41A 3M0JA 2DZXA 2BP1A 4DJDC 2PP3A 1FCBA 3VIIA 1WV2A 4HP5A 1W9PA 4DQWA 1K8ZA 1AH0A 1UR1A 1S2VA 2RKXA 4ADSA 1KFBA 2PDYA 4HA4A 1EGVA 4S3KA 4W89A 4AZIA 5ENLA 2Z24A 2WQPA 3KCLA 2OTDA 5BXTA 1VYRA 1VGAA 1EJXC 3NPUA 3MVIA 1B3WA 4HU4A 1Y65A 4D9PA 3C2FA 1PX8A 2GDUA 4GI9A 3TSBA 4JIQA 1FRBA 4RZ5A 2WJDA 3EMZA 1H51A 5JBFA 4IHCA 4C6EA 1R9ZA 4PMVA 2XIIA 3UPBA 4UMBA 3O15A 1VD6A 3BMWA 4GY1A 4JTKA 4XTDA 4QHRA 5DT5A 1B3YA 5I0DA 5XIMA 2NVDA 1GZGA 2RHGA 3FGCA 1A47A 1Z69A 1BQGA 3W3OA 4Q4PA 2IPJA 3IVTA 4WXYA 4MY1A 3CUIA 5HBFA 3WLJA 2PA6A 3M0XA 2BVWA 1RR2A 2ZOXA 5FESA 4G9PA 4IMAA 3OTRA 5I3DA 3I6EA 3M5ZA 4O1DA 4LGXA 3C0SA 1QI3A 2VUYA 1XLDA 2HPMA 4NY2A 1MW0A 3AS1A 8XIAA 3WK3A 3GXPA 1XUZA 2XH0A 2RAGA 4A4AA 4F0LA 2GQ9A 2DZVA 2Z1KA 2OCZA 1N2VA 4ORIA 1XIGA 2Y5EA 3LRLA 3WEOA 1VHCA 3A9IA 3LCGA 2J7DA 4Q7IA 1EC9A 2WB5A 2Q71A 3SN4A 2NSOA 4PBGA 5KZMA 1E51A 3DG7A 1Y5XA 1XBVA 1DJWA 4GIYA 3F5JA 1A5SA 5TAOA 3N6HA 3MW7A 4B3KA 3K5XA 2G0WA 3UYCA 1KFWA 3UD6A 5KMYA 1VFFA 1F73A 3VKJA 4NJIA 2ZA3A 1JDDA 4QS5A 4FPSA 1ZBVA 4FZIA 4EP8C 3KX6A 5C7VA 2VCBA 1GVFA 2X1TA 2WMJA 2Z7GA 4GIRA 2ZVRA 4YTUA 1IXPA 1CECA 4WSJA 1GTEA 3HG2A 4ZQNA 3SFWA 1OYCA 3TE9A 1P0NA 2CLKA 1XG4A 6TIMA 1WOAA 2BHZA 2W9MA 1OJXA 3OB8A 1DWAM 2ACUA 2Y5SA 3VNJA 3H7RA 2AOSA 1H7WA 4CVUA 3L4VA 3M0HA 3CQHA 5D9NA 4MNKA 4ACYA 1IXOA 2P0IA 2R1KA 2R94A 1TCMA 5JXQA 1U1UA 5AY7A 1I0DA 3VGHA 3V0UA 3S5YA 4WF7A 3AS3A 2V38A 5CPNA 5BRBA 2WVTA 2A3EA 3M5VA 2XVPA 5JH2A 1XI3A 4JQ1A 1EHAA 4J3SA 2CZDA 4C6IA 4OV9A 2I56A 3N2TA 3WUBA 3BAIA 4ROQA 4FNRA 1VAHA 4EAYA 4O17A 4XVDA 5C9XA 3WLPA 1XSIA 1IZJA 3GTNA 4IXXA 3B8SA 4IUGA 4DY1A 2GZXA 2BVTA 3IJ7A 2Q01A 4JY9A 1W54A 3VOGA 1G4EA 2YLAA 4IJRA 2PSNA 1KRMA 1BXNA 1OFOA 1HP4A 5AYXA 5BU9A 3PUGA 4DZHA 2VEPA 1CB7B 3CXOA 4E2VA 4PYSA 1UR4A 3L2MA 4XUGA 5I7GA 2E4TA 4OJYA 4QAIA 5BNKA 3RFAA 4LUIA 3VMOA 1XPYA 1IT7A 2XTKA 4Z2KA 4X61A 2FTWA 3EA2A 4RUBA 4JFUA 1XQLA 3NQCA 2VEFA 3ANYA 1O5KA 3AHXA 2VWTA 2HCVA 3MCMA 5F2MA 3NZ1A 3REQA 2ZZ7A 3SADA 3SN0A 2VD9A 4DNMA 3T8QA 4AVFA 3CUFA 4JIEA 1LLOA 3NPWA 1VEMA 4I7UA 4OKDA 3H2OA 1B31A 3VOHA 1FKWA 3GH7A 3MMTA 5CSYA 5HWNA 2HVNA 3R7MA 2QUMA 3U3HA 1ZZMA 3APYA 1VFHA 4RX0A 1X97A 2XFWA 4LY4A 3NYZA 3ECQA 3BCDA 5DMLA 4MJ2A 1MW1A 3R43A 2JQXA 3PWIA 3AWNA 3AXKA 2RJGA 4OE7A 2GOKA 1RLDA 3TVAA 3QPZA 1F9CA 1O68A 4NP7A 1S5WA 2J7BA 3QGVA 2HS6A 3CQJA 1EX5A 2FGZA 4GK8A 1B0IA 3VGFA 1UPPA 6CGTA 4TVCA 4CNPA 1KLYA 3MUAA 1WP6A 2NXIA 5CBIA 3GX9A 4L65A 2I7GA 1ADDA 1OX4A 3Q2DA 4IQDA 1SGJA 1HGWA 1CDGA 1J0KA 4QG9A 1TJ0A 1CB2A 3ZSSA 4ZTYA 3EZ4A 4BKNA 2QCDA 2ZUTA 2GVYA 3V1PA 3OYZA 4LY8A 1NWTA 5A94A 3AUJA 3BXWA 1GORA 2E6FA 4N9DA 2ZZ2A 3ANUA 2XHYA 4LV4A 1E6SM 3GHRA 1RCQA 3ZS4A 2WMFA 1QW7A 3MDWA 1HJQA 4HJWA 4PEEA 4YS1A 2X42A 1KBJA 2Y0FA 3THAA 1P6CA 3B9AA 1OF8A 4K8HA 4BQ2A 1QASA 4S23A 2ZRVA 1KFLA 3OP2A 2JKAA 2Z26A 1EGZA 3GUWA 4Q4OA 1WOBA 3TR2A 3W1MA 3B04A 3I7QA 2EG8A 4H4IA 4XZMX 3TKFA 3IJ6A 2I9EA 4O13A 2DU2A 5D2YA 2PS2A 1GG0A 3CEUA 1OF6A 4GXPA 5D8ZA 4E4FA 4H9MA 4UTKA 2A6LA 4J27A 1W3NA 4U2YA 3UVAA 2QCMA 4X60A 5K9DA 3W2JA 1PIFA 3N4EA 1ODZA 3ATYA 1DIKA 2RDTA 4GH3A 1ISZA 2DV0A 3GY1A 3M7SA 2YCKX 3S1UA 5FOOA 5TQLA 1FWEC 2VGBA 1GVQA 4GCXA 1EJRC 2DIJA 4JTSA 4OV4A 5EMJA 2ZX5A 3B8DA 2D3NA 4TOQA 4OBSA 2I9UA 4LVGA 2J7FA 2VX6A 4DWSD 4N4QA 4GI4A 1RXOB 4H00A 1E6RA 3RPDA 1DBTA 1HIZA 2FFCA 1T40A 4R7JA 2NQLA 1P6WA 3VM7A 1FY6A 1F4HA 1PZ3A 1XR2A 1F6YA 4GYPC 4B92A 2ZTJA 3LHWA 3ELFA 1KTCA 4AWUA 3EPNA 2NQ5A 4IMDA 5M17A 3V0SA 2UY5A 2R91A 4UWMA 3DC8A 2G4FA 1UC5A 2O92A 4AU0A 3WEZA 3S42A 2UV8G 3LX9A 4Q4QA 4NJJA 1QI4A 1H09A 3BDKA 2XFRA 4HZMA 3A9BA 3DHUA 1OGSA 2XVNA 3H12A 3LYEA 3NZGA 4XK2A 1JCYA 1QHZA 3CIXA 4UZSA 2OKTA 3LN3A 5ABHA 1K8XA 3BLOA 1X6UA 4RCXA 3GXTA 1IQ8A 1ECEA 3SCWA 5CPOA 1W3HA 3WYZA 4ES4A 3ARPA 1OHLA 2BSLA 4XX6A 4FAMA 2RUSA 3CPUA 3OW1A 4LJ3A 2ZDSA 4RKAA 3A3XA 3SGGA 4Y9MA 3WMLA 4PMXA 4A8IA 3OVGA 2O7QA 5DXYA 4GOAA 5A6JA 2BY0A 5A8MA 2J66A 1FXQA 4UFHA 4DVOA 3GDRA 3VGBA 4FIRA 3SEPA 3OZMA 2X7VA 1VRXA 1LRQA 4IQEA 3V4BA 3NA8A 3WL0A 1MRQA 1JIBA 2QUVA 3B97A 4YTTA 1E4LA 3PPFA 4IXHA 3WK0A 4L9ZA 3H70A 3HO8A 4F66A 3UWZA 2OR2A 1QMLA 3UWQA 4K1GA 4DB7A 4J35A 6A3HA 5I77A 4ZO8A 7TAAA 4X22A 5D2TA 5GJMA 1JAKA 4MWAC 1V02E 4B5NA 2W63A 4ZCWA 2ZWYA 1MXDA 3TW6A 1EZWA 1FP8A 3GU9A 4X63A 3DFYA 4WRHA 1WX0A 4UTMA 3FAWA 4ZE4A 1GK8A 1X6NA 1MWOA 1BGAA 1J18A 4J1OA 2ACSA 4PSPA 3NO3A 3SECA 4JAWA 3E6EA 4E4PA 2XUCA 2ZKMX 3VMPA 1HJSA 1WZLA 3IJDA 4H41A 3JVAA 4MY8A 1JQVA 2OQHA 1POKA 1SSDA 1HKIA 3L4TA 1DORA 4MNMA 5EMLA 4JTDA 1JZ8A 2Y8KA 3U48A 1W9BM 3GYCA 3VVGA 1PDYA 3V35A 3W1QA 3S9YA 1XCFA 6PTDA 1TMQA 3CZ8A 4KS0A 5LNSA 4AG0A 9RUBA 1VCVA 3ZVHB 4PCSA 4HCLA 4Z2GA 1HNYA 3NJ3A 4LVDA 5F7UA 2FB2A 1YQ2A 4JXCA 2IKHA 4AHPA 1WUEA 2VENA 4JIIX 4H19A 2ZZ5A 3VZXA 3BGAA 2BXVA 1V02A 2B7PA 4HU0A 2JF7A 4CU7A 3DC0A 4NAFB 4PL2A 1TA3B 3I7SA 2E9MA 3M0YA 4E3VA 2QV4A 5I24A 3NQGA 1RH9A 1RZMA 3TN6A 1ITXA 5EMMA 4XZIA 2X2GA 1M3UA 5I2UA 1EUNA 3MPGA 1MEHA 3RLUA 3MVTA 1FWSA 1OFAA 4ZENA 4ZOAA 3U2ZA 1YXDA 1QW8A 4GQRA 2W92A 3VNLA 3H7UA 4PCPA 5HUOA 3WUFA 1L6FA 1AQHA 3S0CA 4W5UA 1TJPA 3SRDA 4GZIA 4IX2A 1ZFJA 2J47A 4UQAA 2P1FA 3Q4DA 1XKYA 2YDSA 3F4VA 3B9DA 3LHTA 4QP0A 1FH9A 3TONA 3F03K 2VCCA 5AOUA 1M5WA 9CGTA 1IXQA 1U30A 2V5BA 3FCPA 5KZDA 3PTDA 1FWTA 3ITLA 4UNKA 4EIVA 1BAGA 2X0YA 1XH1A 3IGUA 1BD0A 2OLSA 1UJPA 3PP7A 1KB3A 4UQEA 2R24A 1SZGA 3N9SA 2Z6IA 2WVSA 1KBBA 5CLWA 1HG3A 1AJ0A 3TMQA 1SR9A 1Q8JA 3ZJ6A 4GC3A 3UP8A 3EPOA 2DY3A 1BWVA 3QSRA 1S38A 1QNOA 3CU2A 2J4GA 1RVKA 4WY0A 1UD4A 1ZY9A 5I78A 1CGYA 3MKCA 3DECA 1IT0A 2QJHA 2QYGA 3D47A 4EKJA 4RPPA 3G6MA 1KWKA 2KX9A 3WK1A 5FJIA 2YPIA 3W76A 3LQLA 1Y7VA 1KRAC 3W9ZA 3WNLA 4WK9A 1F07A 3ZO9A 1OD0A 1BXCA 3A13A 3BG5A 1TPUA 1XGDA 5DCEA 3VU2A 3W1UA 2BGNE 3R4IA 1UC4A 2ZX7A 4HSNA 4Q7NA 1CXKA 3AYVA 3C2RA 4WXZA 1E9ZB 1GQIA 3TXVA 2C91A 2WNZA 3FJ6A 1VJIA 3FNDA 4GPNA 1VJZA 2PUZA 2WV8A 5IFTA 4OOZA 3SURA 1GKPA 3IJQA 2VOMA 1JQXA 4NRSA 3I65A 1OSEA 2WZTA 3N29A 5CAHA 4MPKA 2WHLA 1UKTA 4LAOA 5IXEA 3MA8A 1UZHA 4WZHA 4RZBA 3LHVA 4GO8A 2BOFX 2D0FA 3GH4A 3VE9A 4ALDA 5DEZA 3H54A 4CEXC 1U83A 3EDKA 2Y7DA 1WA3A 1CYGA 1PKLA 1UD3A 3E74A 3O0KA 1SO6A 4XZNX 1SZNA 3AMDA 4H7CA 3D3FA 4XAGA 3USZA 1WE5A 4BEQA 1EJSC 3C8NA 3G0UA 1RK5A 2C0AA 4N42A 4OBTA 1JZ5A 3PZ9A 3GG1A 1FTXA 3C0QA 1CXLA 4OGZA 1KXTA 1TPDA 1Q5MA 1RCOB 4FOJA 1OT2A 2X0SA 3SDOA 4YPJA 4ATDA 4ATWA 1KGXA 3KUMA 4LS2A 3R0DA 1TELA 4FR1A 1TKKA 1IZKA 1UP2A 1AW2A 2EHHA 4O19A 2VC5A 4WJXA 1LBLA 4H01A 1K1DA 2ZC8A 3GNPA 3WBAA 3WLNA 4S3JA 3UCQA 4KWUA 1V0LA 1TV4A 1B4EA 1GJUA 3DDMA 2H8XA 1SFLA 3BTNA 2WSPA 4JX4A 5AKQA 2PDBA 4GC4A 2QDEA 1TR9A 4WX2A 1W2PA 1ZUAX 4L4MA 1Q6RA 3BOXA 1FWIC 1DKWA 2HV5A 3FJNA 3EPMA 2VKZG 1MW3A 3VE7A 4Y8EA 3WQEA 2V5DA 2J74A 2ZTKA 4IISA 2EO7A 2V69A 1SW7A 4U31A 4MM1A 2V5JA 4UTHA 2WJFA 1QJWA 2CBJA 6ENLA 4EVZA 4GH1A 1FP9A 4D72A 4AD4A 3UZZA 2PDFA 1KFKA 2ZE0A 4NIRA 3AO0A 3PG9A 1XIBA 5D2VA 1E4MM 4G7EA 5IBXA 4PTWA 2E1WA 3RX2A 1ML1A 1CXIA 2Y6ZA 4MPQA 2OZTA 5FEZA 3NQVA 4IFKB 3FW6A 1V3KA 3UQNA 3CAWA 5M1TA 2P76A 4IH3A 3R0UA 3KHDA 5XINA 1HKMA 2D20A 2ZA2A 4J4KA 1D3CA 2FMOA 4KF1A 2AMGA 3ZYZA 4RDZA 1PZ2A 2IPFA 2O0TA 4HQVA 4AMCA 2E67A 3HN3A 2FHCA 1GJWA 4GIEA 3NQMA 5J5RA 2WMGA 5RUBA 4FNSA 4HKPA 4WR3A 4AFYA 3QR1A 2W27A 4L56A 1VBGA 4YHGA 1R3YA 1O5RA 2Z1VA 2BWGA 4QG8A 5FEXA 3VINA 4JD4A 3IANA 3MYOA 4U10A 3GG0A 2J24A 2G3MA 2PLJA 3H55A 3CBWA 3S9IA 5G2IA 3E38A 1GVEA 5GPRA 3P80A 2VFFA 1QCWA 3HURA 3K46A 1NOFA 4X0NA 4EACA 4LVBA 3UNDA 2ZVIA 4GJJA 2OWCA 1I60A 3GSMA 4JTRA 5IDIA 5BCAA 1R5YA 5BW6A 2QF8A 2QJJA 2PCEA 2O9PA 1S2WA 1DWHM 1QBAA 1ADSA 1ICQA 1EEXA 2VI0A 3PUDA 1UH4A 4B5XA 1CENA 3W7NA 1H11A 3T8LA 3CEPA 5C54A 1NP2A 1KXQA 1J0HA 3PBGA 4WGXA 1IR1A 1HJXA 2OLHA 9XIMA 3AIQA 3GYEA 4NILA 3VIMA 2E9LA 1KM6A 2DT3A 3CZLA 5DCDA 1HF6A 2GSHA 3LM3A 1ZRQA 1GHSA 4BI7A 1Q6LA 2PWFA 3SIMA 3TA9A 2NV1A 3GVVA 5A5WA 2DSWA 2Z4GA 3SN1A 1FFQA 3BUVA 1BF6A 3LM7A 2YW3A 5FJOA 3KBWA 1Z6KA 1KKOA 3TJXA 2HK0A 1B54A 1V6YA 2J7HA 5IM51 3WNPA 3P74A 1Q7MA 5HDRA 4D8AA 2QMKA 1VPXA 1GQLA 1XCXA 2F2KA 2WSYA 4FB7A 1ZJBA 3GR4A 4JY8A 4DI8A 5KETA 1DIOA 1NIUA 1NTHA 4HNVA 3SSZA 1FH8A 2Q6ZA 4XQ6A 2PDCA 1LWJA 2JALA 4HMEA 3VD4A 2GJXB 1CWYA 1JYWA 3PFRA 2G37A 4YVPA 2W91A 3TYZA 4R88A 2QUUA 1EOKA 3W02A 1S3HA 3HTWA 5HMEA 3GG7A 3QJAA 2AMXA 2OZ8A 2R1MA 1O94A 4ZQRA 3QQ1A 3E02A 2ISWA 1LOQA 1NY1A 3GRIA 3ABSA 3EKGA 4QDPA 2V3EA 1UHVA 3LCLA 6ALDA 3NO1A 4O8AA 4QE1A 1F61A 3WJYA 4US5A 3PZNA 3A23A 1OCBA 1NF0A 4ZXLA 3VAVA 3PVFA 1Z42A 2YBUA 5FEWA 3NEVA 3VIHA 5HNUA 4PZVA 1XLKA 3UF9A 3WLRA 2PDXA 3VO0A 2IQDA 1PX4A 1M65A 4NYYA 2J8TA 4HMCA 1GJPA 2TRSA 5K7JA 3JZEA 2IS7A 4LRTA 2EPHA 1GKQA 5LA0A 3AIUA 3B0YA 1DQWA 3GXDA 4K38A 3VPLA 5C71A 2FHFA 3E0FA 4JBRA 4NZ5A 4LRSA 3GK0A 4P7QA 1YPXA 2BTMA 3BMXA 4LTSA 2LLEA 2J78A 1P7TB 1YMYA 4DUWA 3PZMA 2PWEA 3VYLA 3VI2A 4YJ5A 1XIDA 1BKSA 2VZUA 3OGVA 3TEVA 1XF0A 1Q4WA 4QROA 2BVDA 3OLDA 4IIFA 4HNTA 2VX7A 3NL6A 3SUVA 2VYOA 2Z2UA 4LNYA 1UQYA 2OJPA 2WNNA 4LALA 5H8PA 4DZAA 3NGJA 3ARWA 1B2YA 1XRTA 1O95A 1F8IA 4CD6A 1JPMA 3T4WA 1NFGA 3SCTA 3ZSTA 4PC8A 4Q33A 4LF1A 3B0PA 4ZA0A 3IJLA 2Y7EA 1JGMA 2DT0A 1ELSA 1DV7A 3EWDA 3TW9A 1OC7A 5CPSA 1OG6A 2VZOA 5SWUA 1HZYA 2D69A 3V5CA 1BEUA 1E71M 4QE4A 1L6YA 2YR1A 1SR0A 1JG9A 1TPC1 1DWJM 1HL2A 1H1NA 5BWFA 3W72A 4C6FA 3PK7A 5I3GA 1AL8A 1GGOA 3IGSA 1JRCA 3O3RA 1WDDA 1R0MA 1G6CA 4F2UA 4E8DA 1BVNP 5GNXA 3TJIA 2AAMA 3B8IA 2FPTA 3CYVA 2A21A 2QDDA 1JVNA 2WZMA 2P5NA 2AGKA 2PGEA 3KVJA 4TX9A 3VA8A 2PFHA 3VKDA 1X7IA 3ITGA 4RNFA 4IQJA 1H7PA 1SO4A 2PPGA 3WF1A 4WIWA 1DJGA 5IHSA 1J9YA 4Z08A 3H2CA 4DJFC 3CZJA 4PRRA 1FWRA 1FDYA 3RM4A 3UFYA 4H9TA 4NNAA 4MUPA 1VF8A 3PPHA 2PRHA 3RPTA 4CNSA 3TAOA 1Y0EA 5REQB 3G1DA 1G69A 1CTNA 4B91A 3ZFHA 3G1YA 2UY3A 3BW4A 3T4CA 3ARVA 4Z1DA 4A29A 3A4XA 4LCSA 5ABFB 1ICPA 2B7QA 3T09A 4ZO7A 4KH2A 3M1ZA 3LPFA 3UWEA 1Y5VA 4JKMA 5K9CA 1DOSA 3DGBA 3EX6A 2NWSA 4IGMA 4IPPA 3NL2A 3AXMA 2PD9A 1GVRA 2PB1A 1JDAA 2GUUA 2G3FA 3U57A 1NWUA 5G2WA 2EQDA 2EF9A 1RQEA 2PRMA 5BRPA 4H6EA 5D30A 1YTEA 3LLFA 1DXFA 3WD3A 3F7JA 7PTDA 2FHBA 2FPYA 4YNGA 3GXFA 3IS4A 4L80A 4LEQA 1MSSA 3AICA 3L4UA 2BODX 1P0EA 3IWPA 1H7XA 5KSWA 3GDTA 1DHPA 1ONXA 4XD6A 3C3NA 1OYAA 3H24A 4RW5A 1A5LC 3N1AA 5A8GA 1PYFA 1X8CA 4AY8A 1ZJAA 3L2IA 2Q3RA 2PP0A 3GW0A 4V27A 2GGJA 3QHNA 1RK6A 2GQAA 3GKAA 2XGIA 4TUFA 3GHSA 3LLDA 4Q4RA 4IMEA 3BQ5A 1AL7A 2DQWA 3WH6A 3DI1A 3WBEA 4DIAA 2YCEA 1YTDA 4C5YA 1F3WA 4GBDA 3T6CA 2CXEA 1PE1A 1RD6A 2BNJA 1VS1A 4L4LA 2BOEX 3KDOA 2PZNA 1BXBA 2D0GA 5HANA 2PDLA 1UA3A 2BLEA 3R89A 1R47A 3ABRA 3S5NA 5IHRA 4NNCA 4DO4A 3ARTA 1U5HA 4LUTB 4CN6A 1P5BA 4NI8A 4Y96A 4HNNA 3CWHA 4UFMA 2I17A 3PHAA 2CYGA 2DH3A 1W5PA 3AXXA 4UOQA 4OOUA 3STFA 2V3DA 4ZO6A 3VFLA 1ISXA 4WDXA 2D2GA 3GC2A 4GHRA 1VBJA 1V3IA 2G95A 3G1XA 3R2GA 4KIEA 2V63A 2OB3A 3E1F1 1Y5WA 2FDMA 3EB4A 1XICA 4IG2B 2WO5A 5D8WA 1E15A 1UD8A 1GOWA 5D04C 1PVNA 3FLUA 5HNNA 4QRNA 1XHGA 3DENA 5IDZA 1B3OA 5JBDA 2GUBA 1V0MA 3HGRA 4IMFA 3VIGA 2AGTA 2YL9A 3WK2A 4FX7A 4I5UA 2YYUA 2Y7GA 2GGEA 3KVKA 2DT2A 3LGDA 1UPMB 3MMWA 3N2OA 5HA7A 4G1NA 1DJYA 1R3RA 1JCJA 1IEWA 3NNTA 5FL1A 2Y1HA 3CAKA 3B03A 4H04A 1X1OA 4N7QA 3M47A 1J2BA 3PUEA 3UG4A 3DBPA 4K39A 2WMIB 1ODUA 5TF0A 3QV7A 4JN6A 3VIFA 2A6NA 2OELA 3EEGA 2ZUMA 4XV0A 1AFSA 4XO6A 1XLAA 4LT9A 4JICA 5TBOA 4N9CA 1AH4A 4O11A 1M7PA 3EDDA 3ZR6A 2E28A 3TZNA 3U5YA 4IMGA 3LXCA 4E6MA 3F1QA 2AL2A 4PODA 1OCNA 2ANUA 3DI0A 3N25A 2YCIX 3RM9A 2QT3A 4E0CA 4AIUA 1BGGA 1R3TA 1J5TA 3OZPA 1HUVA 4C6CA 5CC5A 4Q3MA 3ORWA 5LGZA 1JULA 1VFOA 2QCFA 4GBUA 4MYAA 1P1MA 1FCVA 4DJDD 2VRJA 2X8RA 4BF7A 4FI4A 3PZGA 1RJPA 1W9XA 4IF2A 3W00A 3I3DA 2OQLA 2A7NA 3OBAA 3WLHA 4N9EA 2DUZA 1EKOA 2CZ5A 1VFMA 2F84A 1IEIA 3NUKA 4KKXA 1P0KA 1D8CA 3HV9A 3EOLA 3LI0A 4US6A 3IIXA 3ALFA 3PWGA 1L0PA 3H2MA 3WH7A 3ARXA 4M81A 1G7UA 1OZQA 5DELA 1FVPA 5DX7A 5DRCA 1I2QA 1TWIA 2WAGA 1UP0A 3QOKA 5CPQA 3CL6A 4JEQA 4BEUA 3E9AA 3SQMA 4FF5A 3HU7A 1JZ2A 1EPVA 3EX4A 2QCCA 1UMLA 3CPRA 4YWSA 1MW2A 3W29A 1XC6A 2QJMA 3IGXA 6REQB 1CLVA 3HQ1A 2PDKA 3OQ8A 5BOOA 1XH0A 2DVXA 4UC5A 3N3TA 4S3CA 3PFMA 2WZIA 2YJQA 1K4HA 2UY2A 5T9BG 3WDPP 3TR9A 2PLCA 1V4YA 5DMYA 2VM8A 3UXKA 3T2PA 1HL9A 2YW4A 4JKKA 3K30A 1ADOA 3NQ7A 1ZBCA 3ITVA 3QLLA 1RUSA 2BG5A 1KM0A 1WQ5A 2QCLA 5EB8A 2PDPA 3A5FA 4ZO9A 3L68A 1POJA 4L4PA 5AYZA 1DVJA 2WMHA 4CGTA 2NUWA 5CLTA 5BMXA 3UY7A 3SB0A 5BROA 2I14A 4XAYA 4CD7A 1U33A 2VL4A 1ZL1A 3MHUA 4J3UA 1J0IA 4S3GA 1KM5A 1E5NA 1VKFA 3AC0A 3UZ5A 2DQXA 3VMNA 4MFEA 2C19A 1L6SA 3HG3A 3DXIA 4U33A 1HGYA 4UR8A 1WCGA 4GUJA 1F3XA 2V67A 4AEFA 4GXMA 4NVTA 4IT1A 2XGZA 3CZEA 1CW2A 4FHAA 2DZPA 3JRKA 1FWHC 4NZFA 1E9IA 2H3BA 4O28A 2GVGA 4RNIA 4K1WA 5HR6A 2ZYFA 1OFPA 3AS0A 3W2MA 3M44A 1PHQA 2YLLA 1EJ7L 4IIBA 3MSYA 2F6KA 4HTYA 3WQ6A 1FH7A 3DYMA 3QN3A 3BZGA 4QGCA 3W7QA 4UNLA 3DYPA 1F6KA 1M9HA 1A0DA 3WLKX 1J12A 2NQJA 3DIPA 4NKCA 1I9CB 4WOZA 4RW3A 3G5EA 3VOIA 2IPWA 4KEUA 3TYDA 2QUNA 1UWRA 3KOZA 4KCVA 4JTIA 1YX1A 2YA1A 4RLIA 2PLKA 3CT7A 4UR9A 1EPXA 2FPVA 4CNUA 2PD5A 2QZRA 4L9YA 2KAUC 4BHYA 4DF2A 5H91A 3L4ZA 3GIPA 3FY1A 3GU2A 1W1TA 2XN0A 2FIQA 1CX9A 4Z1YA 3AIVA 4NHVA 1US2A 4KW2A 3WQPA 2QS8A 4W8BA 1EFZA 1JL8A 1CGVA 4AEOA 4UFLA 2CHOA 3N14A 2J7EA 5J04A 3LS9A 1OWQA 1KA9F 1W0MA 4IJBA 3NEHA 3UXDA 1QNPA 4LU0A 4TTUA 3LSBA 3MTWA 1AZ1A 4S39A 3UPMA 1GVYA 1AH3A 4LC8A 4F79A 3IVSA 1VFTA 1PUDA 1M41A 3W6YA 2WCAA 5AC7A 3WNMA 1UQZA 3W1PA 3QYQA 1HX0A 3GXNA 2E6YA 1FXPA 3O6AA 4N4PA 3N18A 3RJXA 5I06A 3LQGA 4C6PA 4RE2A 1OX4B 4ENLA 3VOFA 4OBRA 3DKJA 3WFAA 2XIMA 5I3KA 3DUGA 2WBKA 4LAZA 4ICNA 2YZRA 4UOZA 4HIBA 1MMFA 2OYLA 2B7OA 5H6HA 1KRCC 4V33A 3P60A 4LS0A 5AHEA 2GK1A 1KXHA 3W7GA 5FAJA 1ZAHA 3UBPC 1EF2A 8XIMA 1JPIA 1QR7A 2Q09A 5HPOA 4F2BA 2WCSA 2WKLA 3VNYA 2BY1A 5AZ0A 1KR0A 3CL8A 4O15A 5LNWA 4PH6A 3QQ0A 3AUOA 2O4MA 3RU8X 2RDWA 1YPIA 3NVTA 3K8MA 2D23A 4IP5A 1W5MA 4NF7A 3TWBA 1IHIA 2IW0A 3RN6A 4GJ1A 3GAYA 1LT7A 3VIPA 3PBMA 3TYBA 5LNVA 4E4UA 1DWGM 3BJTA 4W88A 3WKZA 3W26A 4XBKA 3KOFA 3L7RA 2IXVA 1JEZA 2G3NA 2HXTA 1EO7A 3T1GA 3QPEA 3W27A 5C70A 3KRUA 3OIXA 3GLCA 3S47A 3N15A 1TWWA 1E9LA 1QK0A 4ZBCA 4DJEA 1A3WA 4H6RA 3VD3A 3UJEA 4K2SA 3QW4B 2BMBA 1EP3A 1OIMA 4UOJA 3NO5A 2FMNA 4PTMA 3TLLA 3N11A 4YTSA 4BF9A 4A3QA 5DT7A 1T6MA 3B8UA 5C2GA 5I3JA 5JMUA 1R7AA 5EKYA 1GPFA 3S5OA 1U1JA 6XIAA 3FXGA 2QF7A 1Q6OA 1W1B1 1NM9A 3CLWA 3TV8A 1VRDA 4DPQA 4DO6A 3CUJA 5KITA 3QEZA 1VJSA 2IXUA 2YA2A 3OJGA 3LB0A 3FS2A 1OIFA 3AHTA 4RV3A 1UWAA 4QS6A 5IRPA 1ZTVA 5LYRA 4HMNA 2VRQA 4W4QA 3PBVA 4M29A 3P0WA 1UBPC 2FQIA 1GVIA 1KQYA 1I2PA 3UR2A 4S2BA 1MDRA 4IIGA 3VOCA 3VDGA 2GUYA 3TDFA 4PUMA 3O8AA 4GI6A 2Y7FA 3NQEA 3OG3A 3RR4A 2PDUA 3W7IA 4KEZA 2VGIA 3SCNA 3W7OA 4Q4KA 4H8UA 5HOSA 3VKCA 1KCLA 3UJ2A 3QH2A 4KCWA 4ML4A 3UWUA 3WG6A 1K6WA 5T9CE 2PE4A 2VUNA 2W6RA 1S5NA 1OK6A 2PWUA 5AHFA 5HMSA 5AC5A 3ZLHA 3NDZA 4Y9AA 2D2HA 4D6HA 5AZ1A 4LAMA 2R1NA 1GVOA 1BTCA 3QGAC 5BRQA 3DG3A 4KCTA 4MDOA 3CM4A 1XS2A 1P6BA 2D0HA 1UUOA 1WXYA 2OMAA 1I0BA 1YPFA 3PTMA 1QW9A 1FOBA 1W3TA 3MS8A 4JTJA 2X1RA 3CHVA 2ZXBA 2OGYA 1DJZA 2VDIA 2PLMA 4PRWA 3CJPA 5FACA 1WDSA 2A3LA 4C6OA 4CLMA 4CNTA 3SCVA 4AWEA 4UTTA 3W38A 4C6QA 3RXZA 3NQ2A 4QNWA 4ZGYA 3DFNA 1E1CB 4JKLA 5G4HC 2AQVA 3NFUA 4WUIA 3L5LA 3SRKA 2HZGA 3MSDA 4JFVA 4PFHA 2WSKA 1WKFA 4MZ1A 2DDXA 3WQ8A 3ZLFA 2YBVA 3T9PA 5U7SA 3VD7A 5I09A 3GZ3A 2OLAA 3E0WA 4W7UA 3LPPA 3NVDA 1V3JA 3QKEA 1O1ZA 3P82A 1EBGA 2Z1WA 3WO8A 2EPOA 3TFXA 3VCRA 1XP3A 4LB4A 1UMYA 4HPJA 3SJNA 3KWXA 2Z25A 1G9HA 1TVLA 1E70M 1EB3A 4NX5A 3LI1A 2GVEA 3RPMA 4M6PA 4BA0A 1WKEA 1QPOA 2E77A 3LEPA 1BYCA 3J7HA 4DM1A 5A8PA 4L1GA 2MUCA 3WDJA 4CNOA 2INEA 3G2GA 1JAEA 3ARUA 3TJ4A 4LOCA 1GZJA 1MEWA 1G01A 2V5KA 4ERIA 4UUIA 3DESA 4C6DA 3PR2A 3SUWA 3SZ8A 4H6KA 2HRWA 1N8IA 4C7FA 2E6DA 1W9VA 4GMEA 4ONVA 3VNIA 3FVDA 1SJDA 4I90A 1A4LA 3VXGA 4CN1A 2RDUA 2OGJA 4QJ3B 1IIGA 3AYSA 2UWFA 1VYSX 4EPBC 4MSSA 4YCPA 5CPLA 4MTVA 4AB4A 3EA3A 1PKNA 1MUCA 1UWTA 4KFOA 2Z28A 3C0LA 3DEQA 1J8VA 1W1IE 4MWAD 1BF2A 3SW6A 2WPGA 1ZP3A 3LG3A 4IPIA 4POCA 4XBSA 3CIVA 5A1AA 1MZRA 1YDVA 1ICSA 4YCOA 4KFNA 1WZMA 1SU5A 3TSDA 1KO0A 3MUY1 1H7NA 1PPIA 3LGEA 4Q6JA 3IK2A 1J79A 2WWDA 2OZ0A 4JNZA 4RXGA 1EF3A 5A6KA 2E09A 3FV9A 2PDGA 1GEQA 1TX2A 3P61A 5CZSA 2NV9A 3VIKA 5MHBA 3STCA 1AK5A 3W1RA 4DJED 3MQTA 1FHVA 4OU1A 4GZJA 1VCGA 4O12A 3WH8A 1ZBWA 1QOPA 1IF2A 2C71A 3TTSA 2Z2AA 3B40A 3B0XA 4JNMA 2WC4A 2IKJA 1Q6EA 3OU8A 4GISA 4A3UA 2Y8VA 4LW7A 1S1PA 2DGAA 2G3JA 3PY2A 1US0A 2FYMA 2Z1SA 1GYNA 1P48A 1XV8A 4GIAA 3S9ZA 1NSJA 4JN8A 3NPXA 1TV3A 3DFOA 4A8NA 4PEKA 4DBUA 1PIGA 4KWWA 2GDQA 4MADA 4O1AA 3PSWA 5E1QA 3O1NA 1BWLA 3SUUA 2X0HA 2DZSA 4V15A 1ZU8A 4K6AA 3IJ8A 1HJWA 5CC7A 3E96A 1AQ0A 1NH6A 2QPUA 4DAIA 4IP7A 1IE7C 4WDTA 1FWFC 1UWSA 1B1YA 1QPKA 4H9XA 3PZIA 5LKYA 4GVHA 1CPUA 1A5UA 1V93A 2CWXA 2YCLB 2D24A 2Z27A 5IFPA 3CL7A 2PTDA 2ZCGA 3O2LA 5CZ0A 4O14A 4GUIA 5DRIA 2NT0A 3S3GA 2PEVA 1H3GA 2DVUA 1IEVA 3NM3A 4GGHA 3PJTA 3B9OA 5D9OA 3CHFA 3BOLA 4AEEA 1YE6A 3NOEA 4GXWA 1SO5A 1LQAA 3KEHA 3WDHA 1ITUA 5AB3A 2QIIA 4LUSB 5C9RA 5HNRA 4H7VA 2OFJA 3MSGA 5D37A 3XINA 4I9JA 3L65A 1QWKA 3QBUA 4IIEA 3PJXA 3CS2A 5FJJA 1NWSA 1D3GA 3BAYA 5A8NA 4C7DA 2F7FA 1YTKA 2PWDA 2G8ZA 2ZUVA 3W7RA 1KV5A 5D09A 4PRTA 4S1FA 4AIOA 5BOFA 2IKGA 2YCJA 3NL3A 2W0UA 4JS3A 4BJHA 4BS0A 4CEUC 3AHVA 3AYRA 4B9ZA 4S3BA 3EEZA 3LTSA 5CSUA 3CUHA 3S6DA 3OGRA 4AC1X 3HGJA 1WZAA 1Z8AA 3LY0A 1NDZA 4G5DA 4PTVA 3EDFA 1E73M 2VOTA 3C2OA 4GCAA 2FZBA 2I5IA 4JPGA 3TYAA 5FF4A 4OWGA 3H6OA 2VEIA 3IAPA 3V36A 1XBYA 3KBNA 4J3ZA 3MKKA 3O6DA 3UG8A 1W8SA 3TTEA 3UGRA 1MRAA 2PZ0A 2J62A 4XVEA 1F4AA 3WF4A 1TJ2A 3DG6A 1B90A 1JD7A 3URAA 3KHJA 4B9YA 3Q45A 1ZAJA 4IQLA 4PR4A 1R3VA 4LEFA 1AA1B 1L2QA 1F7BA 3WMSA 1A5OC 2A5HA 1TTPA 3QM3A 4OZOA 1SW0A 1ZNNA 4GVGA 3S46A 5I23A 3AIRA 4ADUA 3UERA 4IPNB 4ZQMA 3LERA 1OD8A 5EL1A 4DLFA 3EMQA 2PWGA 3FOKA 4HHMA 2V82A 1WBJA 2QNEA 2PMQA 1MFUA 4I3GA 1EC7A 2VX4A 3RF9A 4XAZA 1DQUA 2J9XA 2B31A 4J3WA 3MB9A 3AZRA 2XVLA 2TPSA 4MWAB 4NJGA 3WY1A 3FIGA 3U6WA 3NGFA 4PSRA 3W85A 1TPVA 5AFDA 3BGGA 1RALA 3LNPA 2CLLA 1XPGA 3P3BA 3O9NA 1NF7A 3HA1A 3ZT5A 4EK7A 1UP3A 3CT2A 3SM0A 4YYFA 1JGIA 1N8FA 2QGHA 2P8CA 3MBDA 4DF1A 1TUXA 1ZCCA 1A50A 3BOFA 8CGTA 3OBEA 3ZOAA 2PGRA 4ILSA 4A8RA 3KE0A 3PN8A 4PGLA 1G0CA 4PTDA 4B5WA 4R3UA 1BYBA 4BQ4A 1XYMA 3ARSA 2XH2A 1DE5A 4JQ4A 4DUXA 1XLMA 1A80A 4F0MA 2ABAA 5H8MA 3G22A 1TRIA 4LAUA 3H4XA 1PJ9A 4O50A 2PDQA 2YX0A 2QR6A 3TNOA 3SO7A 1O1HA 5FAGA 5I5RA 4C6BA 5C9WA 3K8LA 3V75A 1N82A 1XX1A 4AF0B 2WPBA 4B16A 3HFYA 1Q45A 2A3CA 2ZRUA 3IIZA 1H4PA 4K37A 5G1YA 1F3EA 3AU2A 4Q8WA 4TX8A 2PU1A 1MQPA 3RJYA 4AMAA 5A6BA 2GSJA 3WD2A 3WN6A 2DZWA 8A3HA 2P10A 4GQGA 2NLYA 2H9AB 2ZICA 2HROA 2VFIA 4LS1A 4AZHA 1S2CA 3F4CA 3FEMA 1W32A 1I2NA 4H2CA 1M01A 4M82A 4EE9A 1DQXA 3BJFA 3LENA 2VDGA 1OABA 3AZTA 1KTBA 4HT3A 3KZSA 4C6KA 2XFYA 1W3IA 3WDIA 1E40A 3W7HA 1VBRA 1GG1A 4XZ9A 3TC7A 4RZ6A 4OECA 1EDQA 3G1HA 2R82A 2E68A 2FZ8A 4MIMA 1EGMA 2VEKA 3WDRA 4Z2LA 1B30A 1N55A 3ZVHA 2XH7A 1IIHA 2GVJA 2OEKA 3E2SA 4UTUA 4W8LA 4O0KA 1UCWA 1V7AA 1ITCA 3LPOA 3I4EA 1OYBA 3WFZA 1IEXA 1HTIA 1BHGA 1CXFA 4X9YA 3INPA 3BGJA 3A5VA 4DF0A 3LSCA 4NAFA 1TA3A 2HE5A 1BRLB 2GQ8A 3GD6A 4MYXA 4JFWA 3MMDA 3MSRA 4TMBA 2VTFA 4O1EA 3BPWA 3NM1A 3WLSA 1V08A 3W1NA 1F2JA 1DEDA 7ENLA 4GX8A 1QHPA 1LTDA 4D2JA 5MF5A 4EX4A 1H1YA 1THFD 4JCMA 1YLVA 2FH6A 3QZ6A 4Y6GA 2V3FA 2WQDA 4EPKA 5U4NA 1J10A 1LDCA 3QKZA 4TTGA 3H2NA 1M7XA 4KETA 3G3MA 1DWIM 4RE0A 1FWNA 2CLIA 2Y61A 3AHZA 4IM4A 5BOEA 4DJFA 3AMCA 2E5DA 3WBWA 3GIQA 4F8XA 1JZ6A 1UR2A 4XIAA 4MB5A 4LNCA 1MYRA 2Z6JA 5I6SA 6TAAA 2XIQA 3EGJA 4GFIA 2PODA 1JPDX 5ECVA 3FDKA 3EMCA 1YXCA 4QE5A 3LCHA 3EWWA 4DWSA 3W86A 4BF5A 2BGQA 3QHOA 3OODA 3C2YA 3VFCA 3TAKA 1C93A 4JNYA 3PNUA 4NASA 5E0KA 3S6TA 3W1LA 1QO5A 4DM2A 2NW0A 4NZ4A 5GJNA 3L21A 5HWJA 3W25A 3GNNA 2ZE3A 3URBA 4KWSA 3EXRA 4W8AA 1O5QA 4XD5A 1XD0A 4MJMA 5CGQA 3CH9A 4C7GA 4ERGA 1OQFA 1M1BA 3WJWA 3ERPA 2C1HA 1ZCOA 2DT1A 2NQ9A 1FHUA 2VGGA 2ZRWA 4H7ZA 4ASTA 4C6LA 4ZZ9A 4C1LA 4PMDA 3QY6A 2CBUA 2GL5A 4JYDA 4X0VA 4H8NA 2E5CA 3UZWA 1WDQA 3S2JA 3AIEA 4MKSA 3V5OA 3GW3A 2QKFA 1CGTA 4L64A 3B8TA 4UTWA 4CVWA 3LZ5A 3P84A 4LCRA 2RGLA 5D05A 3AALA 1A49A 4HN4A 4M7SA 4I6VA 3OZOA 4GKLA 2WLZA 2QPXA 4Z2HA 4QBXA 4G8TA 4YTRA 3S83A 2D73A 4NJHA 3FYOA 2ZX6A 3BV7A 4LSBA 4A35A 2R1PA 3TWAA 5IOBA 2GQ3A 3SIZA 3CIWA 3KOYA 3QR0A 3ALGA 1V0KA 4PMOA 2ISDA 4A05A 1OX5A 1H62A 1P0DA 4MVAA 4JIRA 3DBNA 5AYYA 2VFHA 2PGWA 4ECLA 4I6KA 3TQVA 3U2EA 4D6DA 3GTXA 5EYWA 1G4PA 2UY4A 1K6AA 4WSHA 4KEMA 5C2XA 3R8GA 4AVOA 3QF0A 1HFBA 1U5VA 2V2DA 3ZIZA 1ZJIA 2CESA 5A6BD 4H8VA 2EPKX 2CITA 4AZCB 1CBGA 4GZEA 4CKQA 3WUGA 4TQTA 1I1XA 4MJ4A 3KRZA 3ZVIA 7XIMA 1AG1O 3SUSA 2EXOA 3L0GA 2A7RA 4V28A 5BWAA 4XWUA 1LROA 3FJLA 1W2VA 1KFCA 1D7KA 1FUYA 5F4WA 1JCNA 3GDBA 4AD5A 2CCRA 1XBXA 2GWGA 4EXQA 1JF5A 4CQCA 5AHIA 3W28A 1ZSXA 3O16A 4ZVJA 4OTKA 1L8PA 4P8WA 1H7RA 4WVXA 2PF0A 4W87A 2AL1A 2DIEA 5DO8A 1ISVA 4GY7A 1MNZA 2PWHA 3FEQA 5D9PA 1GNXA 4XB3A 3BJSA 2ONEA 4Y9PA 2HEJA 4TV5A 4ZODA 4YN5A 4OUIA 3WQVA 3KBMA 2BY2A 4FP1A 1U1HA 4OT7A 4HCHA 4QJ4B 4QM1A 4UFIA 4CCZA 4FXRA 3RG6A 2VO5A 1QNRA 1UA7A 3CV6A 5CC6A 4J9JA 2WM1A 4F0SA 1H2JA 2JEQA 3O0FA 5LSMA 4MNLA 3GVWA 3PAJA 3NQ6A 2Y2WA 1K9EA 3ENLA 2ZZ4A 1YNQA 3N34A 3N13A 3FYPA 1UYQA 4JYEA 1XYBA 4XIMA 1UOZA 3KBJA 4HYVA 3ME3A 4EANA 3B9NA 4GKTA 3QR3A 3P14A 1QATA 3P8IA 4DJFD 5C2CA 2RJHA 3BWWA 1V03A 4TR9A 3B9EA 4EF8A 3RCYA 3VGDA 4DI9A 5CAKA 4HPNA 4FX6M 4PMYA 3WBXA 3WQWA 1BYDA 3BMVA 3IACA 2BASA 3F4NA 3WH9A 3C56A 2WVVB 3ONCA 4IIDA 3S2CA 1JFXA 2WM0A 1BFNA 3FAXA 1AMKA 1RBOB 2POTA 4WOQA 2HPIA 3GG8A 5K4XA 3KBVA 1EO5A 3TN3A 1XFBA 3KBSA 3RIKA 1VEPA 2CIPA 4TIMA 5GVJA 1W3JA 4UFJA 3T2QA 2ZZ3A 5BZAA 4JL1A 1QNSA 3I4KA 3TN5A 3LK6A 1OEPA 2NZLA 1CEOA 3P5ZA 5G1TA 1E6NA 2G41A 3ITXA 1IZCA 2FJKA 5J5DA 2OYMA 5T91A 3ARYA 3PS7A 5HJLA 2E0PA 2F8QA 3UG5A 3VNKA 4IX0A 3STEA 2JIWA 5EMKA 3HB9A 2YFOA 1TRDA 3HG4A 3K4WA 1MZHA 3DAQA 4K7YA 5TNVA 1YDOA 3PBUA 3VUPA 3E0IA 4TXEA 1FDZA 3G77A 3HPSA 1LBMA 1D8WA 4A6GA 4QITA 3SAZA 4FNTA 4O0ZA 4F9DA 2EAWA 3L9CA 1YNPA 2CKSA 3MV01 1G94A 5DANA 1WO2A 1W5OA 3NXFA 3THDA 1Q6FA 1R2TA 3OOQA 1O6IA 1KXVA 4W9TA 2NQZA 3W53A 7CGTA 2D1ZA 4M6QA 2QCNA 4HB7A 5I3HA 1B4KA 4O8RA 3KL0A 1JCTA 2E7FA 1SFJA 2GJXA 1G7VA 3BLDA 1K03A 3UCDA 2F38A 1KRBC 4Y90A 2CHRA 2HSAA 4FNPA 4P8XA 3TX9A 2V2HA 3SY1A 2FFIA 4Q22A 2JKPA 3WD1A 4FALA 1AQFA 1TYGA 2R6OA 3DCPA 2JE8A 3BLPX 3DFSA 3WQCA 2ISVA 1SJCA 3T07A 3CC1A 2C15A 4V1YA 2RH9A 1KCXA 4GI8A 4AD1A 1K3UA 4F3HA 3HJEA 3IRDA 1YYAA 3M0VA 4AYSA 4YWIA 2FGLA 3ONBA 3QFWA 4REQB 1UWUA 1CGUA 3GAKA 1LOSA 1JCXA 1UZ1A 1OC5A 1NDWA 2OQYA 1S1RA 5JU6A 4ZR8A 3AQUA 4DLMA 3E5PA 5IBXC 4X2RA 3CYJA 2GLKA 3EXTA 4URIA 2UBPC 5H8UA 3A64A 1XM3A 3QVQA 1JZ7A 2QDHA 4V1XA 5C5YA 4M0XA 1B3VA 1TZZA 5TIMA 1K9DA 3WNNA 2INZA 5BU6A 3CK5A 2FTYA 1UIPA 2Q3OA 3KVMA 4DYJA 3KOXA 2JFEX 5F1UA 3EB3A 4I7VA 1T8XA 1P0BA 1VENA 2J6VA 2XJ7A 2I57A 3VUSA 4GYKA 3VD9A 3TQ0A 1E72M 4QLJA 3TOPA 1XYCA 4IMCA 2NQHA 3TJLA 3W7JA 4LUJA 1E5JA 1RPKA 5AC4A 1H60A 4FLSA 4GQQA 5HJXA 1JRBA 5JVLA 1DIDA 4LQ1A 4GE8A 3NAVA 5A6SA 3G1VA 5JIWA 3Q94A 1P7TA 4JN7A 3NZQA 4NZCA 1F3TA 3AJ7A 3W1TA 3SCUA 5DY2A 3CHEA 4DX3A 2CLEA 2XINA 4ZOCA 4KT2A 3MU7A 3T81A 3UWVA 2OODA 3OEXA 3R11A 1A0EA 2GJPA 3STGA 1EQPA 2P0OA 1NFPA 3EA1A 2BHYA 4FX8A 3I10A 1DP0A 3TYEA 4S38A 4ZFCA 3ZXWA 4NXKA 4XKYB 3FVMA 1H41A 5I3IA 1UZ4A 1VPYA 4P2VA 2BDQA 4GABA 3UETA 2WBGA 1RV8A 1P1XA 1EH9A 4H6QA 3LBOA 1Q3NA 1EJWC 5LIWX 4DXKA 9XIAA 1B5TA 4CNNA 2CXGA 3G24A 4W86A 4UTIA 3LD5A 4H9UA 1XINA 4IIHA 3UJRA 1LP6A 3S5ZA 5CGTA 1K7EA 4KEVA 4CU8A 5FF0A 1EWDA 5EMYA 3HPZA 2EG7A 1V6UA 1T96A 3WNOA 4JTEA 4GUHA 3CWOX 2WZHA 2YXXA 5K4ZA 4M3PA 1CT5A 2HS8A 1VLIA 3TLQA 4O52A 1EHNA 4FMVA 1AJZA 3W7MA 2ACRA 1E55A 2I16A 2OX1A 1TMLA 3HFTA 4BFAA 1F74A 3F4WA 4GNKB 1VR6A 3KW3A 3WLLA 3GHTA 1X38A 4JTQA 1RP8A 5LIXX 3GE7A 2HE8A 3N2BA 1Z48A 4MNJA 1Q4NX 1BKHA 4S3FA 2ZXAA 3LMYA 2O7SA 2FB3A 2ALRA 4WY0F 3AFBA 4PFMA 4WDWA 3P5YA 6XIMA 1HP5A 2VD8A 2XDFA 4GUFA 3TC3A 3COTA 1BLIA 1A5BA 1PSCA 4GX9A 4LV9A 2WANA 4QQ3A 4L1WA 1ZENA 4HNLA 1J2WA 2G97A 2QQ6A 1REQB 3GNXA 2DSKA 3IIVA 3T08A 1PKYA 3L66A 1PZ0A 5EFDA 1HKKA 5D2WA 4PE8A 1Q7QA 1GOIA 1NQ6A 5REQA 1OVDA 4CQDA 1J0JA 4KIRA 4C91A 4H83A 3C6CA 4NL1A 2R8WA 2VVNA 2WJEA 1NJJA 5FJTA 3M9YA 2DPEA 1UZDA 5ABFA 1JPHA 3UGVA 4DBSA 1XGZA 5HR7A 4EXBA 1XGEA 4YVXA 1GQKA 2DZAA 4ZXOA 2TYSA 3TYCA 3QTGA 4UB9A 1A5NC 4CCEA 5BXSA 2J79A 4E2BA 5F2LA 4A21A 1LT8A 1UKOA 3DKLA 1M6JA 4AIEA 4D8LA 4H2HA 3T44A 4LWWA 3UU0A 4C1NB 4PTXA 3C4UA 3TCSA 3W4RA 5JBEA 1MO0A 3FA5A 3H4GA 2V30A 3W84A 3JW7A 3U8GA 3EDJA 5CC3A 5LHEA 1TTJA 3BW3A 3DN5A 3WLMA 3NTYA 2VVSA 1BTMA 4CQBA 4GZ7A 4Q7BA 1XKJA 2NV2A 4E38A 5T26A 2VFEA 1IWAA 4UCGA 4MAVA 5LGXA 1TJRA 3H8AA 1XIMA 2AQWA 4JTFA 3W7CA 4PUWA 4D1JA 4QJ5B 1OCQA 1IXNA 3NOYA 5I3FA 1RA5A 4ZOEA 5AHMA 1UJQA 2CLOA 1VFLA 2DORA 5HINA 3O6YX 3UVIA 3WH5A 4U5IA 1MI3A 3BAXA 1W56A 4ORMA 4U3CA 4GINA 4Q8UA 3BSGA 1M68A 5D4YA 4LUTA 4NAEB 5HQLA 3I3EA 4DRSA 4NT0A 4TU1A 3S1XA 2QPSA 4HJFA 2CKRA 3TROA 1K8CA 4Q8OA 2C16A 2ZX8A 1W91A 1TSIA 1WPCA 3MHFA 4FK9A 3QMSA 1GQNA 4IG2A 4AH7A 1QVBA 5F1VA 1E0VA 5EU9A 2FKPA 2CFFA 3BAJA