3VCRA

Crystal structure of a putative kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase from oleispira antarctica
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
MTQLDTWLANTKPLIPVIVIDDLVHAIPMAKALVAGGVHLLEVTLRTEAGLAAISAIKKAVPEAIVGAGTVCTADDFQKAIDAGAQFIVSPGLTPELIEKAKQVKLDGQWQGVFLPGVATASEVMIAAQAGITQLKCFPASAIGGAKLLKAWSGPFPDIQFCPTGGISKDNYKEYLGLPNVICAGGSWLTESKLLIEGDWNEVTRRASEIVKLSDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase
publication title Genome sequence and functional genomic analysis of the oil-degrading bacterium Oleispira antarctica.
pubmed doi rcsb
source organism Oleispira antarctica
molecule tags Structural genomics, unknown function
total genus 67
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3vcrA00
4MFDA 2W6RA 3W1TA 3G3DA 1OJXA 1UJPA 5T26A 2BWGA 2XN0A 1N7KA 1DBTA 3CT7A 3OA3A 4PEKA 3NVTA 2AQWA 2GOUA 4AHPA 1T99A 1R2RA 3IIPA 1G4TA 4MUZA 2E6FA 1ICSA 3ABRA 3W7NA 3TSBA 3SJ3A 3SGUA 2JKEA 5I3JA 1X1ZA 2A7PA 5HR6A 3TE9A 3AJXA 3W23A 2J9YA 4RCXA 2VFIA 2QKFA 2PRLA 4M6QA 3O6CA 3R12A 3W70A 1W5QA 1FCUA 2FPVA 3NQ2A 1LRTA 4UXDA 5U7SA 1O4UA 2J6XA 4S1FA 1CX9A 4M6PA 3DHFA 3B0PA 4JXCA 4OQVA 3S9YA 3W2LA 4JTJA 3TH6A 1WAUA 3W1PA 1T0OA 1KLZA 2GJLA 1EWDA 3MHFA 1G69A 1MO0A 3BLEA 3LV6A 4XWUA 4JN6A 3HGJA 2H8XA 2ISWA 2TSYA 5D2TA 2ZZ7A 5LNVA 5AYZA 3L0GA 3ATYA 3Q58A 3EX6A 1IIGA 3MI3A 2A6NA 4O17A 4JY8A 3PAJA 5FF0A 4MY1A 5EBUA 5C6MA 1JJKA 1TRIA 2A0NA 3EX2A 1N8FA 2E6YA 2YYTA 5F1VA 1P0KA 4WOZA 5EA9A 1OF8A 4FF7A 1KFLA 5D33A 4TU1A 2VENA 5DN1A 3KRUA 4ZVJA 3W7IA 1R2TA 3IIOA 1DQXA 3CM4A 1YADA 4A21A 2YPIA 3CB8A 4MZ8A 4IX2A 4K6AA 1A5BA 3R13A 3B05A 4MFEA 1KM5A 5CZSA 1LCOA 3M41A 3LXBA 3GDMA 5E1QA 3C6CA 2VFHA 4FXRA 4IPIA 3QZEA 1OHLA 4ML9A 3ANYA 2NX3A 2V5LA 4IQLA 4A2SA 4UTKA 4QITA 2WOQA 4TIMA 1PCWA 4HNTA 5CKSA 2CLIA 3G1AA 3LB0A 2QR6A 5AYYA 3W73A 2QUUA 4H6KA 1VZWA 4MOZA 4Q32A 1SZFA 3BGGA 3QFEA 1X1OA 1O60A 4EF8A 3LRMA 5DLCA 1GVOA 4YWIA 5D03A 3UXDA 1SW7A 3FJLA 1FDZA 4WQ6A 1VRDA 3UNDA 4BK9A 3I6RA 1RQHA 3KFTA 3GDTA 5AOUA 4FB7A 1K7EA 1SW0A 3TXVA 4JTUA 5I3HA 4IJBA 1XBXA 1O94A 2NX1A 2GVLA 1OG0A 3BV4A 3NDOA 4K8EA 3VE7A 4LVAA 3NQGA 4S2BA 1PL9A 3O6DA 3QSTA 3NQ7A 3BW3A 4Z0JA 1DJQA 1K3UA 2WSQA 5K9XA 1ZHAA 2QF7A 2NUYA 3BO9A 4C1KA 5E0KA 3KHJA 3O6YX 1OFQA 1VCVA 3IGSA 5D09A 2VFDA 1LLWA 1DJNA 3MP5A 5EL1A 3W7JA 3TROA 3FFSA 3W88A 4CCCA 2C1HA 4LS1A 4X22A 3C2EA 3TMQA 3VE9A 1ADOA 4FNTA 2YX0A 3W7GA 1EP3A 4N4PA 3LI1A 3ATZA 2ZA3A 2GJNA 3HG5A 1VHNA 4M6VA 1ZCOA 1M5WA 1PE1A 3ABSA 1KM6A 3SW6A 4C1LA 5A8GA 3QQ1A 4MPQA 3P62A 5F1UA 4LVDA 1L6SA 4MZ1A 4K8HA 4AMAA 1B4EA 3FYOA 1FX6A 5D37A 3WK3A 1A5SA 4CNOA 2E1DA 3LBMA 1W3NA 4HPJA 3G1XA 3Q37A 5BMWA 3W7RA 3QH2A 2B7NA 1WV2A 3NL2A 3L0KA 4JS3A 3BGJA 3EXSA 3B8DA 1I2OA 5G2WA 5I3GA 4RV8A 2YR1A 1TB3A 1FWWA 2VOMA 4WXZA 4YXGA 3GZ3A 1G7VA 3SIZA 3PBWA 2YFOA 1VQTA 3FKRA 3DAQA 4UNLA 3DXIA 5L9FA 4DF0A 1W0MA 1LTDA 1XBVA 3GDLA 3QMRA 3OG3A 4FX6M 3QJAA 2ZZ1A 1FQ0A 1ZNNA 1KTNA 2G96A 1QNVA 2RH9A 3CC1A 3THAA 4LWWA 3HGOA 3N3MA 1XCFA 3LCIA 1YTDA 5AHLA 3P84A 2HSAA 3GDKA 1JVNA 1YPFA 2RDTA 4ADTA 5AHFA 2NV2A 5I3IA 4WZHA 2F84A 1PS9A 2A5HA 2H6RA 2I14A 2JGYA 3TJLA 3GR7A 3NPVA 5DXXA 3P74A 4N4QA 4DPPA 5FEWA 1KTBA 4HNVA 4BR1A 2PURA 4ADUA 3P80A 3HQ1A 1TQJA 4UUIA 3NL6A 2HS6A 3NO5A 3O15A 5HULA 3NAVA 3EXTA 5HWNA 3NZRA 5LKYA 4FEZA 1WXJA 4GXMA 4WY0B 4IMGA 1PV8A 4N9BA 4UC5A 1SFLA 4DBDA 4KWWA 4X9SA 4ZQNA 3BW2A 4XTDA 1GVQA 4CCDA 1AG1O 1U5JA 3G0SA 3PB2A 4ZQOA 1FUYA 1C9DA 5CPMA 3BLIA 2C18A 5D02A 3PY2A 4JTEA 5EYWA 2DZPA 3HF3A 3WK0A 3G0XA 1XFBA 2V2CA 3HIJA 4DEFA 3EKZA 5DY2A 1W5PA 3DHDA 1TPDA 3HG4A 4DO4A 3W76A 1OF6A 4M7SA 1TREA 3BLFA 5MHBA 3H53A 1GTHA 3G1YA 5LNRA 2VEPA 3INPA 4OHQA 4AWSA 2PE4A 4PFMA 4GUIA 3NPXA 1RPXA 3PBYA 4P61A 1OYBA 4NJHA 4H3DA 3FIGA 1SUXA 3E12A 3C2FA 5D32A 3TV8A 2RDWA 1XDLA 4X2RA 5CPLA 3S5OA 2JKAA 4FXSA 1Z44A 2OX1A 4NJIA 5BRBA 4TMCA 4JDBA 2E68A 3A5VA 3QM3A 3SZ8A 1QPNA 3MW7A 4UNKA 3KOFA 3W7CA 6TIMA 2X2GA 5BNKA 4UTIA 2A2IA 1SFJA 2ISSA 3W1NA 1Z48A 5KZEA 3EWZA 2V9DA 3UWUA 3LBCA 4AHQA 4UTJA 3G3MA 3HPZA 3C61A 1TV5A 1LDCA 2G97A 3L5LA 2GVGA 3W7KA 3PUEA 1JCMP 3P81A 1FY6A 4K37A 1OFOA 4ADSA 1KLYA 3LRLA 1OFBA 5IM51 1KFCA 3G1FA 3NQCA 1W37A 1VPXA 1XXXA 3T4CA 3W6YA 4Y8FA 3NA8A 4XKYB 5D04C 4LV4A 4KFNA 2DJLA 2V5BA 4IPJA 4O0ZA 4LUJA 3PF3A 4LRSA 2O7SA 4ZQPA 2ZFAA 1RVGA 3MYPA 4IWWA 1F5ZA 4HT3A 2V2HA 1NF7A 1GT8A 3L0NA 1UCWA 4LOCA 4MJMA 2DJXA 2EPHA 2X16A 3TCEA 3W1QA 2YFNA 3M5VA 3Q94A 3O1NA 1JUEA 1QDSA 3N19B 3DFOA 2DZTA 3NM3A 2Y70A 3JR2A 3L67A 2A85A 4LTSA 3UZJA 1G67A 1ZJIA 3FS2A 6ALDA 4XTIA 3NQEA 3SECA 2HS8A 3FOKA 2B7OA 5AHNA 4O57A 4RXGA 4NZJA 1TPH1 3NYZA 3H54A 1SSDA 3W07A 5HUOA 3LCXA 2C0AA 1DOSA 3LX9A 1Q6OA 2E5BA 3PVFA 3B04A 5A5WA 2ZDRA 2Y62A 2JBMA 4XBSA 3STEA 5F2GA 2NX9A 1IXPA 5D2VA 3L2IA 1GVSA 3HBLA 4MJZA 1W5MA 5DCBA 4DELA 2B0MA 2VFFA 3LGEA 3B06A 3TDFA 1JCLA 4XZ9A 2H8ZA 4NX0A 1R47A 5AHMA 1L6WA 3THQA 4OT7A 1B3OA 1UBSA 3E0IA 3W7QA 3MI2A 3UYCA 3DFSA 1TIMA 3MBDA 4O13A 4O4VA 3GAKA 2B7PA 1DKWA 2OCZA 3TFXA 2JKPA 1VHCA 1THFD 5HWJA 1W56A 5HR7A 3W71A 1QOPA 1WQ5A 2QCDA 3PSVA 3CLMA 1QPOA 3P8IA 4RLIA 4K39A 1F76A 3N34A 2G95A 2A21A 1VLWA 3C8FA 3U2OA 2VEIA 3SFKA 2DZXA 2NUXA 3R8RA 3G8RA 1WOAA 3GB6A 3KVLA 2GQ8A 7TIMA 4AAJA 2C14A 2R8WA 2YSWA 4NX5A 5AC7A 5HUPA 4FX7A 1QO5A 3KVMA 3FYPA 4FX8A 2R14A 3BG5A 3KRSA 3TAOA 5F2LA 3QMSA 2Q3OA 1P4CA 2YGYA 4G1KA 1WX0A 3UXAA 3NM1A 4AB4A 3LXCA 1GG0A 3MJYA 4AWUA 1J5TA 4PCFA 5K7JA 4K38A 3DBPA 1FDYA 4RXFA 1F73A 4OWGA 1JCXA 3RF9A 3L65A 3GKAA 3UWVA 1DVJA 4HPXA 1S5WA 4W9TA 3SSJA 3W85A 4GE8A 1CI1A 2NZLA 3TUUA 3O8AA 3W1AA 2YDAA 4PL1A 5K4XA 4OE7A 4BWLA 2Y88A 4GUHA 1D3HA 1JULA 5J5RA 4HNUA 3DI0A 2PRMA 5EMUA 2QEZA 2GQAA 5U4NA 4RJEA 2OT1A 2YYUA 1QOQA 3U8GA 2C3ZA 2CZEA 1FXQA 5DY3A 1TV8A 1RR2A 3R5EA 2OZ0A 3DU0A 2NUWA 1D3GA 3I7QA 4OU1A 4R7JA 1K8YA 3TC6A 2CLLA 3TKFA 1TPEA 1Z42A 3PG9A 1GVFA 1TV7A 2QCNA 3EWXA 4UFIA 4LVBA 3IGXA 3S1XA 1W3IA 2OJPA 3FKKA 1F74A 4DO5A 1XDMA 5G2IA 5HWMA 2ZRYA 3A5FA 1LBMA 3W7PA 3DFQA 2FPYA 3LDVA 1F6PA 3EKLA 4POCA 3IVTA 2V82A 3BK0A 3GYEA 4S2CA 4OBTA 3UWQA 1I2QA 3YPIA 3PUOA 4N02A 5D05A 3N14A 1LYXA 1WA3A 2PC4A 2Y63A 2QJGA 4PTNA 1LOSA 3W72A 3NXFA 4LVGA 3VNDA 3S5ZA 2QCCA 3NPUA 2QCHA 4WX2A 4UMBA 4TO8A 1WDWA 2Y7DA 3W7HA 5IBXA 3P60A 2RKXA 3W2KA 4DPQA 3MO7A 5KTLA 1FCBA 4JNMA 3GXPA 4IX0A 3NQ6A 1H5YA 5D2XA 4PH6A 1FXPA 4WY0A 4MIMA 2DZSA 4LS2A 2J9ZA 1LZOA 1OABA 4UTWC 3I68A 2WNQA 2G5WA 2VXNA 4YCPA 4TMBA 4WD0A 3M6YA 3DENA 1FDJA 2DZVA 2E77A 3GR8A 3LHZA 1GWJA 1EUAA 1D9EA 1I2PA 4RR4A 1TPC1 5C2XA 3TC7A 2Y85A 2CLMA 1LROA 4E2DA 1KBJA 3W1XA 2A1YA 3LRKA 1H7WA 3OVRA 2Z1BA 4MYAA 4GUJA 4Y6GA 2FB3A 4CNPA 4O8RA 1SZGA 2QAPA 1YTKA 2NXHA 1Q3NA 2ZRUA 3R89A 2ZZ5A 2DZWA 1NF0A 1GPWA 1LM1A 5K9DA 3M43A 1NSJA 5H2ZA 4HKPA 2H90A 1TPFA 1ZAIA 1BTMA 1QO2A 1YDNA 3T44A 4UFKA 3UWYA 3EB2A 1MEWA 1KA9F 1SO6A 1SSGA 2ZRZA 1MXSA 1A5CA 3MI6A 2VEMA 4UFHA 3ZFHA 1TMHA 3FLUA 4UIOA 2I1OA 1AL7A 4NZFA 2WQPA 3HPSA 4PC8A 3G1HA 4O53A 4HSNA 1A5AA 3PC0A 1YXYA 3E02A 4JX6A 3W87A 2ABBA 4JGDA 1UB3A 3W2NA 3HB9A 3U6WA 3CPRA 3AO0A 3LCFA 2EKCA 3PG8A 5K2ZA 1EA0A 1VR6A 4DF1A 4IXXA 5LSMA 4NUWA 4IGHA 3G0UA 2O7QA 4O54A 1PCKA 3L68A 5HMSA 1JQXA 2ZCGA 4TX9A 1LRQA 4YL2A 4Y90A 4HSOA 2HTMA 4ZQMA 3HMJG 1H7OA 4XKYA 4AF0A 2ZQ0A 1P5BA 2A7NA 2I9EA 4RZ5A 4GRSA 4U4MA 3WJXA 5AB3A 2Q8ZA 1NVMA 3CQ0A 2BLEA 2XN1A 3T40A 2ZZ4A 1FCVA 5F4WA 3FEMA 2DU2A 3G18A 4ZZ9A 3D0CA 1S3HA 4JYFA 2FQIA 1MZHA 3OHIA 1Z41A 4EF9A 1GTEA 1YXDA 1BEUA 4WOQA 2Q3RA 1R2SA 3ZWTA 1EX5A 4LC6A 3DKJA 3FA5A 3E49A 4DF2A 3W1UA 2P10A 3LHUA 2CLKA 2CLEA 4E0CA 3SY5A 1TPVA 1XM3A 5LGXA 4IUOA 2QCMA 1CW2A 1ML1A 3RLUA 4H4IA 3I7SA 4O52A 5DCEA 1KFJA 4YCOA 2W79A 1O5XA 4RX0A 1S5TA 3CIWA 4BF9A 4N6EA 3W9ZA 5AHIA 4NU7A 4O11A 2DP3A 2VELA 3M7WA 1VC4A 1K8ZA 1SO5A 3PM6A 3VI2A 3MHUA 1XI3A 5CPNA 3KAOA 3LI0A 3TQKA 3EEGA 1EEPA 3LHVA 4XUGA 4Q33A 1F05A 1VYRA 5K4ZA 1GOXA 4Z1DA 4X3ZA 3PB0A 4AH7A 1TJRA 3IIZA 4LUIA 4BI5A 4HN4A 2CZ5A 4AXKA 1GEQA 3TNOA 1ME8A 4OV9A 4Q4KA 1KW1A 5SWUA 1I2NA 2JGQA 1TYGA 5KZMA 1AK5A 2JK2A 3BG3A 4JR5A 3W2JA 4GUGA 3T55A 1RV8A 2WNNA 4I7VA 3C3NA 5F2IA 1OX5A 3S1UA 3NZ1A 1FWRA 3WK2A 1AW2A 2OT0A 3WJSA 4FHAA 1AW1A 1FWSA 3K30A 1OFEA 1EP2A 1K03A 1IXNA 2ISVA 3C2OA 3NQFA 1L6YA 3MP3A 1EIXA 2FFCA 3MMTA 4NXSA 2V81A 4BI7A 4LV9A 2Z2UA 1VH7A 3TQ0A 4E38A 5KMYA 5LNSA 3M44A 2QCLA 1WOBA 2YZRA 4KKXA 1KM3A 1NEYA 5G4WA 1IF2A 4LT9A 2PCQA 1TTPA 1E51A 4LU0A 2ABAA 1NFBA 5LNWA 3NPWA 1AL8A 4KFOA 1H1YA 1GVRA 2YXGA 3LCLA 3SR7A 4WY0F 3NR0A 3W2MA 5CZTA 3P7YA 3QMTA 3A24A 1H61A 1X8FA 2UV8G 4LY8A 2QCFA 2WPBA 3A22A 3ZS4A 2WKJA 1XBYA 3B03A 3O16A 4M5PA 3TW6A 1PHWA 2VFGA 2TPSA 5AYXA 4K7VA 1GQNA 1A50A 4DBEA 2V2DA 3HG2A 4BWLC 2TMDA 3LCWA 2E09A 3L21A 1SZNA 5GVJA 4L4LA 3B0VC 4K7YA 3USBA 2WO5A 5BOOA 3S1WA 4RZ6A 2EF9A 4LC8A 1EP1A 1KTCA 2CFFA 1KM4A 1VYPX 5G2HA 3BARA 3GXTA 4GBUA 2CLHA 3DI1A 2C16A 3MWAA 2WNZA 3W1RA 1J4EA 4FNSA 4DQWA 3CEPA 1HTIA 5BW6A 3LV5A 3QW4B 1PIIA 1JCYA 1SR9A 3LM7A 4NNAA 4JYDA 2E6DA 3IRDA 5TBOA 3OIXA 5DBTA 3W86A 1F2JA 1OX4B 2V30A 2BX7A 1M7PA 5FEZA 3UQNA 2C15A 1LOLA 4LW7A 1S5VA 3MBFA 3S0CA 2FPTA 3TFCA 5AN7A 3F03K 2RHGA 1ICQA 4M19A 1W5NA 4O28A 3EWWA 1OFRA 2FLIA 3JS3A 4O16A 3TAKA 5DCDA 1EPXA 4CCEA 4Z0SA 3ABOA 5AHEA 3PR2A 1JUKA 1K8XA 1JUBA 5KZDA 3TMLA 3JRKA 3IVUA 2CLOA 1VJIA 1QPRA 2A6LA 1L9WA 4KWVA 1G4SA 1B57A 3IIVA 4N9CA 1IIHA 4KFPA 3N73A 5IBXC 3T78A 3G8EA 3O05A 1VLIA 2E6AA 1H7NA 1SO3A 2VFEA 2EGZA 3TSMA 4WJEA 1SU5A 2VKZG 2ZRVA 1Q6RA 1ICPA 4NJJA 4PODA 4O0KA 4EVZA 5G1TA 4O15A 1F6KA 3NQMA 2EHHA 5AFDA 1HO1A 1LBLA 3S5NA 3PUDA 1HL2A 1A53A 4O10A 3HG3A 3KVJA 2Y89A 4EWND 1I45A 2P0OA 2QDGA 4O1DA 5FF2A 3E96A 1FCQA 2ATMA 4UTMA 2QJHA 2QJIA 3C0JA 1BWKA 3T7VA 1KM2A 3E9AA 1EUNA 3W1MA 4A29A 2Y7FA 4HHPA 5K3VA 1UUOA 4WUIA 4A22A 4JIPA 1QFEA 2YCEA 3NQAA 4UMAA 3UWWA 4UR7A 5G5IA 1XBZA 4GJ1A 2CU0A 2IQTA 4JTTA 4ZQCA 3QW3A 3KRZA 1H60A 1ONRA 3QC3A 1KFKA 3G24A 1X6UA 3UY7A 4B5NA 2QCEA 1MSSA 3MHGA 3P67A 5DBUA 2R94A 1G4PA 3CWNA 3LOTA 1LRNA 5E93A 4AWTA 1TQXA 4QJ1A 4UTTA 2B4GA 1ZALA 3CEUA 5CZ0A 2PRHA 4JDYA 3ELFA 5CZJA 1R30A 4QM1A 2X1TA 3LHTA 4RZ4A 2QUTA 2WSYA 2CZFA 1F7BA 1ZENA 3O63A 2CLFA 4UR8A 1W31A 3DFNA 3N9RA 2YW4A 3PBUA 3NNTA 2ZA1A 3W22A 3QF0A 3L9CA 3HPXA 3W3OA 3GX9A 4IMDA 4MZYA 1P0NA 1UASA 4NQ1A 3LLFA 4QNWA 1H1ZA 4JICA 5J5DA 5D38A 3TW7A 5CSRA 2NWRA 3DFTA 1VGAA 4FNPA 4WXYA 3GDRA 2ZRWA 1ME9A 4XBKA 3C56A 3TXZA 1K7XA 3EXRA 3GXNA 4O1BA 1JRBA 3M16A 3IVSA 4UMCA 5AC6A 2W0UA 3M9YA 4IMCA 3C2VA 1RD5A 2E5DA 5DELA 4JD4A 3UD6A 4CQ8A 5LHFA 4R53A 1ZFJA 1LORA 2KZHA 3UPBA 2J24A 3SI9A 1QWGA 2BZNA 3P5YA 4I9AA 2NV1A 3TK7A 2DZUA 3GAYA 4Z1AA 2GUUA 3WJYA 2P1FA 3MP4A 4TR9A 1XUZA 3I65A 2FIQA 4LNYA 4UTHA 1RQEA 3CTLA 5F4SA 3OEXA 4A3UA 3N9SA 1TTIA 1TTQA 4CLMA 3NOEA 4O19A 1H50A 3KVKA 3C4UA 3UZ5A 5FF4A 1P1XA 3CIXA 3NL3A 3PS7A 4NNBA 3OVPA 1ME7A 3W7MA 4NXKA 1OK4A 1V7YA 4EOUA 2GPTA 3SGZA 1DV7A 2TRSA 4LVFA 2RFGA 3UY8A 1OVDA 4JTFA 2Z6JA 2ATSA 1UUMA 3OVQA 3NGJA 4P2VA 4MKNA 3TQVA 3EX4A 4O4WA 1T96A 4QSHA 4J9JA 1XKYA 5K9CA 3F4WA 2QCDB 3IV3A 4QNEA 3RFAA 3HJZA 3LERA 5HQEA 2VEKA 3QSRA 4MY8A 2NXIA 1AMKA 4ICNA 5L6UA 1TPWA 1Q45A 3W84A 3RNDA 2BSLA 4FNQA 3TSDA 4JTIA 3NEVA 1LLZA 3NQVA 5FF3A 1IGSA 3M5ZA 1TRDA 3O06A 1SQ7A 2AAMA 2VC6A 3F1QA 4ORIA 3RMJA 5KITA 3N2MA 4O1CA 2CZDA 5LHEA 5HNRA 4QISA 1N55A 5FEXA 1KFBA 1PVNA 2F7FA 3O07A 3BG9A 4I7WA 4QQ3A 3CWOX 1TPB1 2FDSA 2EAWA 1ALDA 3VCRA 2C19A 3QYQA 3PWAA 1C29A 1OYAA 3TX9A 5C55A 1QPQA 4GC4A 4R34A 2H3BA 4UTLA 5FEPA 1TCDA 1H7XA 3QPZA 4IMEA 4CQAA 2WJZA 2V8ZA 1O95A 4RK8A 3CU2A 4BI6A 4LS0A 2DORA 4ZMGA 2ZTJA 1FBAA 5HJLA 1I8JA 2J9XA 1KM1A 3W7OA 2X1UA 4M7TA 4Z1CA 4OV4A 1VS1A 3HGRA 3B4UA 3WJWA 1BWLA 4DO6A 3WFAA 4JX4A 1PHQA 4IMFA 2ZA2A 5CG7A 1H51A 1RZMA 4R33A 1K02A 3W7DA 1YLVA 2C6QA 3GIYA 3W74A 1B4KA 1KFEA 3LXAA 4N9DA 4AHOA 2A4AA 2ALDA 2HMCA 1TO3A 1U83A 1IXOA 4Y96A 1GJPA 4A2RA 1GG1A 5LZLA 3W2UA 1H7RA 5KSWA 3CHVA 2LLEA 3DFPA 3N2XA 3NQ8A 5ABTA 2NXGA 1G7UA 1JCNA 1X7FA 2X1SA 4XQ6A 4JTKA 1RQBA 2X1RA 3DH7A 1SZEA 3M1ZA 3M47A 3S42A 4JTLA 3TR2A 1HG3A 1KV8A 3OBKA 3GNDA 3QQ0A 1LBFA 1OFPA 3H55A 4CNNA 2ZZ3A 3TJXA 3W75A 1KV5A 1H62A 4N9EA 3V75A 3MYOA 2XFWA 1M7OA 4QIUA 3F4NA 1W3TA 1OX4A 4JTSA 4GWEA 4NNCA 8TIMA 5CPOA 3NG3A 1ZAHA 5HINA 2ZYFA 3S8HA 2Q8LA 1SO4A 3TIMA 4L4MA 1ZY9A 2Y6ZA 4UTWA 3STGA 2WSRA 2J88A 3V1PA 4LRTA 4HNNA 3R2GA 4UCGA 5I3KA 1H7PA 3TU9A 3QRHA 1R46A 5CSSA 4Z08A 1GYLA 4MLJA 4FNRA 3BW4A 4ALDA 1JCJA 2R91A 1EWEA 4O50A 4DXVA 1SPQA 2ZTKA 4JTHA 4UFMA 4FIQA 3WK1A 4ZL1A 3GLCA 4D2JA 3UPWA 3Q2DA 3DZ1A 4QAIA 4FO4A 4UTUA 1QCWA 3S1VA 1XL9A 4O12A 2AGKA 2FTPA 3GKFA 3P8JA 4N6FA 1WBHA 1VYSX 3HGSA 3IIXA 5DXYA 2ZBTA 4OGZA 2Y7GA 5C5YA 4RKAA 3PSWA 4O18A 3RU6A 3WJZA 4GUFA 5FESA 2ZZ6A 3GNNA 5G1YA 3BVJA 4JTGA 4CQ9A 4PA8A 4I7UA 4FNUA 4O1AA 3W7LA 3EWYA 4JYEA 5I3FA 1WYIA 3C52A 4Z1BA 1YTEA 1G6CA 1GYNA 1JR1A 4E2BA 1HO4A 3RK8A 3M5XA 2Y61A 1QR7A 2YW3A 3G22A 2GQ9A 1YPIA 3EWBX 4MLRA 2QDHA 1O5KA 3STFA 3B0UX 3S6DA 1TPUA 4MYXA 1XUUA 3PBVA 3RLVA 3UWZA 1LP6A 3LCHA 3ABQA 2CW6A 4EIVA 2NWSA 4IOTA 1OFDA 5H91A 2Z6IA 3P61A 3P82A 3LTYA 1V5XA 2OMAA 3LTSA 4NT0A 3L5AA 3LHYA 1JQVA 1XC4A 4NJKA 4MVAA 2GVJA 5F2MA 3DKLA 3ZR4A 1YYAA 4JY9A 3W83A 3GVGA 4BFAA 3KXQA 1GZGA 1DQWA 4FIRA 4ORMA 2V0TA 1AW5A 4YLWA 1Q6LA 3KX6A 1FWTA 4GNJA 1HUVA 3L5MA 5G4EA 1L2UA 4PL2A 5EPDA 3LLDA 3MUXA 3PULA 2FJKA 1OFAA 3G1SA 2QAFA 2C13A 3LHWA 4AF0B 3ZWSA 3M5YA 1HFBA 4UTTC 2QCGA 1B9BA 4JIQA 3LCGA 3NQDA 1YDVA 1W54A 5EKYA 4O14A 3A9IA 2CWNA 3STCA 1J2WA 1VCFA 4NVTA 1YXCA 5D30A 2Y7EA 1Y0EA 4JX5A 1W1ZA 2QUVA 3LTPA 2ZRXA 1OX6A 5D2YA 1MEIA 4NJGA 2Z0IA 5EY5A 4AEOA 3C2RA 1LOQA 1I2RA 1OYCA 4U28A 4ZQRA 2BTMA 2XN2A 4HIBA 3A21A 3IGUA 3QEZA 4JEQA 4Y9AA 3EX3A 2WV8A 4YMZA 2D73A 2RDUA 5TIMA 1WBJA 1DHPA 2A7RA 3P5ZA 3GK0A 2BXVA 5C54A 2J27A 2TYSA 3TA6A 2NLIA 1K7FA 3FJ6A 3QPYA 1C8VA 5FF7A 5F4XA 1QMLA 3EWUA 4GFSA 4AVFA 1G4EA 4MY9A 5D2WA 1H63A 2E5CA 2H3DA 1BKSA 3EX1A 5TQLA 3W7EA 3HO8A 3VKJA 3DGRA 3M0ZA 1OK6A 1EB3A 1FWNA 1JRCA 2X30A 1DORA 5BMXA 1NAL1 1ZAJA 2ZZ2A 3VFLA 1Q6QA 2FB2A 5AC8A 3NL5A 5KINA 1W5OA 1TJPA 4N2YA 4K36A 3BPWA 1T8XA 3W1LA 4UFLA 1TTJA 2B7QA 3G1DA 1KM0A 3S5YA 1MEHA 1I4NA 4UFJA 5LGZA 1IXQA 3A23A 3IEBA 1DL3A 3HOJA 4ONVA 5LNUA 1M6JA 5CGQA 3I7RA 1W8SA 1TSIA 1YDOA 3G1VA 1KBIA 5FI8A 1VCGA 1QAPA 4IXHA 3L66A 1SW3A
chains in the Genus database with same CATH superfamily
3W1TA 4Y9OA 4QBXA 4DLMA 2QDDA 4KCWA 1IV8A 3PTQA 1JZ5A 3ZVHA 1FWCC 1T99A 1R2RA 3IIPA 3SJ3A 3ARRA 1J96A 1RLCL 3B9OA 1YDYA 2JKEA 3V5CA 5I3JA 3TE9A 4KBXA 1XG4A 2V63A 2QKFA 2PRLA 3S1GA 3R12A 4Q7NA 1A5MC 2WAGA 3CBWA 3AXMA 1LRTA 2WVVA 3RUBL 1B1YA 1C3FA 3B0PA 3VGFA 3S9YA 4JTJA 5IDZA 2F8QA 4HJWA 1WAUA 3W1PA 1T0OA 3AMCA 4TV6A 1ZBVA 2Y8VA 3GH7A 3I6EA 3BLLA 1DE5A 4W86A 1JZ6A 5AYZA 4PB3A 2I17A 4PZVA 5HATA 1XSJA 3SFWA 1IIGA 1LWJA 4U5KA 1C90A 2A0NA 2VGFA 3EX2A 4QG9A 1W6TA 2B31A 3KCJA 4JQ2A 4PUKA 3WMCA 3T0CA 1YMYA 2VENA 2PBGA 5M03A 4Z1YA 4ZVJA 1KGUA 1PZ2A 4QXIA 3IIOA 1YADA 2YPIA 3CB8A 1Q6DA 4K6AA 3G6MA 4AMCA 1GOQA 1B0IA 2OQYA 3R13A 4GI9A 1UHVA 1XYZA 2AMGA 3AMGA 3SRDA 4EP8C 3W81A 3U48A 4IPIA 3H2MA 2DUZA 2NX3A 4IQLA 1QI0A 1EJWC 3WMSA 3BJSA 3MVIA 1Z3NA 2DVXA 5HXMA 1TR9A 1QI2A 2CLIA 3FW6A 1S38A 5AYYA 1UYQA 5BXTA 4H9TA 4H6KA 4XG1A 4MOZA 1W2PA 3QFEA 5BRPA 1EOMA 1X1OA 1ZL1A 3WH6A 2R24A 4EF8A 1E0WA 4YWIA 3K8LA 2D22A 1H4PA 3KWSA 2AL1A 2DSKA 3GIQA 3KTSA 1ISWA 3TXVA 4HNLA 4RE2A 3IJQA 1KCZA 3BV4A 4DJDC 1UR8A 1XGEA 3S2NA 2ONEA 2XGBA 4JCLA 4J4KA 3O6DA 2CPUA 4Z0JA 1K3UA 2DQXA 1QBAA 4DNHA 4F40A 3H2OA 4I9MA 3BO9A 4A8IA 2FZNA 4L9ZA 4HHLA 4AIUA 3POHA 1XYBA 4WDWA 3AMDA 4PMJA 3W88A 1EDTA 4LS1A 1XSKA 3C2EA 3O7UA 3TMQA 1ADOA 4FLOA 3VE9A 2YX0A 3W7GA 1NP2A 1X97A 4NYUA 2WXDM 1DTUA 1DIKA 3N4AA 1ZCOA 1FH9A 1SJAA 2F2KA 1PE1A 3ABSA 1HQTA 3TYUA 4KCVA 4YVVA 4H2CA 4A8RA 3I10A 5F1UA 4MZ1A 2Z26A 3HN3A 1EFZA 4IHCA 2OLSA 5D37A 1H49A 4PYSA 2JALA 3KOYA 3TN4A 4W4QA 4HPJA 1ITUA 4AQLA 3G1XA 4IL2A 3QH2A 3NL2A 3B8VA 3L0KA 3B8DA 1I2OA 1FWWA 4C1NA 3FNDA 2PF0A 1RJPA 3VFCA 3SIZA 1PBGA 2YFOA 3DAQA 3DXIA 3GH5A 1W0MA 2C91A 4B15A 2PLCA 4CD7A 2DH2A 2WWCA 4YNGA 1VD6A 3ISIX 1QNVA 2NQZA 1XCFA 4LBRA 5AHLA 1JVNA 2I7GA 2O56A 3L4ZA 5I3IA 2F84A 4IIEA 2J78A 2GJXB 3M46A 3VD9A 3BL3A 4WR3A 1CWYA 3NPVA 5DXXA 3P74A 4QE5A 1KTBA 2X40A 1FFQA 4KMQA 3MSDA 3K13A 4PULA 3E2QA 2HS6A 3RYSA 3O15A 5REQA 2OODA 4UQ9A 3EXTA 4GXMA 4GZJA 3L23A 1H0IA 2ZXQA 1SFLA 4DBDA 2REQA 4XTDA 2VX7A 1GVQA 1VEMA 2ZUUA 4ZQOA 4XVDA 2W27A 4F0HA 1V0KA 2GOKA 3ZO9A 4JTEA 1T6MA 2DZPA 3WK0A 3G0XA 2V2CA 2NVAA 4P5UA 2NQ5A 1GTHA 1F07A 3KL5A 3SQMA 4RE0A 3Q4DA 4H9MA 4S3CA 2PE4A 1CXHA 4NJHA 1Q2SA 4X2RA 3A4WA 4AW7A 5CPSA 2J8FA 3CUXA 1NY1A 1ZJBA 4TMCA 5C9RA 2CESA 2E68A 1JDFA 1IEQA 2CBVA 3MW7A 1G0CA 1JIBA 4KQNA 1ZUAX 2X2GA 1W1IE 2A2IA 3UZWA 3EWZA 2V9DA 3UWUA 3LBCA 3QN3A 4AHQA 2PGFA 3VMOA 1NU5A 4Z17A 3UR2A 1TV5A 1LDCA 4IPLA 4Y9PA 4JN8A 3V5FA 1XIJA 2D1ZA 2HWGA 3PUEA 1UWTA 4QFUA 3ZXWA 4B2DD 3R94A 3UCQA 4HCHA 1KLYA 3LRLA 5IM51 4YTQA 1BD0A 1V6TA 3NQCA 1U1JA 3RCNA 1RCXB 1Q7ZA 2YB1A 4MGGA 2QHAA 1E40A 2DJLA 4LUJA 1UWQA 2O7SA 1QPKA 3QOKA 4YVPA 4IWWA 4XX6A 2VR5A 1GT8A 3EPNA 1UCWA 4MJMA 1P6CA 2DJXA 3TCEA 5TAOA 2VCBA 4A8NA 1R5YA 3MUAA 4LB3A 4AWEA 3M07A 4HA0A 3DFOA 3H70A 3NM3A 3L67A 1M41A 1G67A 2PD5A 4JIEA 1BAGA 5D9NA 2HS8A 2VHLA 3VNZA 3FOKA 1QHZA 4NZJA 1TPH1 2FKPA 3LZ5A 3H54A 2Z2BA 4PSPA 2VWTA 3W07A 1KNWA 2C0AA 2QT3A 4JQ1A 2E5BA 4MJ4A 1KGXA 2WMKA 3GM8A 2I57A 2YL8A 4HNCA 5AY7A 3WDIA 3QR0A 2ANUA 4PCNA 3L2IA 1GVSA 3HBLA 3VOJA 4IF2A 2VFFA 3MY9A 3LQLA 2PDCA 4XZ9A 1GVYA 4MADA 1S5NA 1RCQA 3UYCA 1XSIA 3WO8A 5F7UA 2JKPA 5HJXA 3LZ3A 1QOPA 2QCDA 4K39A 3N34A 2G95A 3ONCA 1J8VA 3C8FA 3U2OA 3SFKA 4OFCA 1V0MA 1S3TC 2VO5A 2VC9A 2GDVA 2YBUA 3KVLA 1CBGA 5XINA 4KERA 4EXBA 2YSWA 3C5QA 2AL2A 4LEQA 4KWSA 1P7TA 3SCPA 1JGMA 2HPMA 2CNCA 5HMDA 1S5MA 1ZJHA 2Q3OA 2YGYA 4KS0A 1J0YA 3NM1A 3LXCA 2QDEA 3MJYA 3NO1A 1WDSA 3BQ6A 1SJCA 4WGXA 5K7JA 3DBPA 3D5HA 4N0RA 4RXFA 2E28A 3IS4A 4AVOA 3LNMA 4OWGA 1H11A 3VOCA 5LA1A 2WJDA 3UWVA 1N8WA 5CPTA 2GGGA 3W85A 1EIBA 2E3ZA 2NZLA 2VP8A 3TUUA 1HJVA 1UD2A 4DLFA 2BBFA 4PL1A 4L6OA 3BOXA 1D3HA 2G3NA 1XIIA 1BQCA 5EFDA 5J5RA 2V67A 4HNUA 3DI0A 1YBQB 2GQAA 4PUMA 5U4NA 4RJEA 4IT1A 1UZ1A 2CZEA 3FHQA 3HV8A 4M3PA 2X05A 2NUWA 4I9JA 3IAQA 1T7LA 1K8YA 4XIMA 4IIFA 3TKFA 4DXXA 1TV7A 4GKLA 1E9YB 3IGXA 2OG9A 5HK4A 1DWGM 1VJSA 1F74A 5G2IA 5HWMA 3R79A 3ES7A 3WUFA 4Q8NA 3DOPA 2V82A 3GYEA 3BJTA 2P53A 3UWQA 5MF5A 3QHNA 3N14A 1WA3A 4OOZA 1IWAA 2Y63A 4I8YA 2PWHA 5DQPA 2OR2A 3W72A 4LVGA 3CZGA 2QCHA 1LT8A 3K4AA 4UMBA 2ZUNA 5BRQA 3WNLA 2OEMA 3WLQA 1GPFA 3KW3A 3P60A 3UPMA 2F6KA 4ZO7A 4TV5A 1EO7A 2YIHA 4JNMA 3QGAC 3R0KA 4AD1A 3FAWA 4IX0A 5EFFA 1WZKA 5D2XA 3UT0A 1FXPA 2JQXA 2DZSA 4LS2A 1HF6A 1PKMA 1OABA 2IW0A 3WNOA 3RR1A 3GR8A 3LHZA 2X7VA 3MZ2A 4LY4A 4RR4A 4PBFA 4DYEA 3SSZA 1TPC1 3WQ6A 4ERAA 1LROA 4HZMA 3W1XA 1TWIA 3EB4A 2A1YA 1V0NA 1YHTA 1E1CB 1A4MA 3LRKA 3OVRA 4Y6GA 4MYAA 4O8RA 1DE6A 1MW0A 2QAPA 1OB0A 2ZRUA 3WQ5A 1VP5A 2ZZ5A 3GXMA 3M43A 4LEFA 2G8ZA 2C71A 1R3TA 1TPFA 3T44A 1MXSA 3PPHA 3VM5A 1A5CA 5ENLA 3MI6A 1PO9A 3V3WA 2WMHA 3WBYA 2I1OA 1CLKA 1AL7A 4J3ZA 2Y1HA 2WQPA 1XLGA 4PC8A 3RJYA 1I60A 2WW5A 4O53A 4LBUA 2WVTA 1A5AA 1MNZA 2GFTA 1YXYA 3OYXA 3E02A 6TAAA 4JX6A 1QNRA 3W87A 1EZWA 2WVVB 1PWMA 2R82A 3LCFA 3PG8A 1AFSA 1CXEA 2UZ9A 1FWEC 1UD8A 1A5OC 5DRIA 1Q2RA 3VIIA 4DO7A 2EG8A 2O7QA 3S9ZA 1PCKA 3L68A 5HMSA 1XLAA 1XIEA 3MUCA 3FGCA 4YL2A 4HSOA 3ARQA 4NRSA 5H8MA 4IP5A 2ZQ0A 1A0EA 4RZ5A 3J7HA 4U4MA 1WKDA 2XINA 2Z27A 2BLEA 3GR4A 3T40A 3KDOA 4GYPA 1U33A 5F4WA 4D8AA 3G18A 3VX0A 1ESWA 5A6BD 3NFUA 2FZMA 3OHIA 4ZB5A 3VAVA 2WC7A 3ZWTA 2ZE0A 1S2CA 2PDNA 5CGTA 1ZGDA 2PDIA 3E49A 4HHMA 3PP7A 4A05A 1V3IA 3W1UA 2P10A 3ABZA 2CLKA 1JZ4A 2RUSA 4ZXOA 2NT0A 3V16A 5HBFA 4S3DA 3RU8X 3GFZA 1F4AA 1V6VA 1NH6A 3SIMA 3C0QA 3UG3A 1KKOA 4LF1A 5I23A 5D4YA 1KFJA 2BASA 2WBGA 6CGTA 2W79A 4A4AA 4RX0A 4DUOA 3CIWA 1CLVA 3VC5A 4BJHA 4O11A 2DP3A 2VELA 3SY1A 1UQZA 4J35A 3MHUA 1XI3A 4L5ZA 4AG0A 4XUGA 4ECLA 4K1GA 1UROA 4Z1DA 5A69A 4X3ZA 1XG3A 3IIZA 3GU1A 4BI5A 4EPBC 3PNUA 4Y9MA 1MRAA 2JF6A 3H6OA 3PBMA 3GVRA 4J5NA 2OOGA 5GJMA 5B7YA 1KRCC 2ACQA 1PWLA 2XVKA 4RNFA 4JR5A 1J12A 3PJXA 3TTOA 1CGUA 2XFRA 3NUKA 1E5NA 3VUPA 5F2IA 1OX5A 3S1UA 2Z1WA 1EJUC 5CLTA 1FWRA 4N42A 4JAWA 1IEXA 4AD4A 3DFHA 1AW1A 3OZYA 1FWSA 3UA3A 4F66A 3K30A 1K03A 5D9OA 1XP3A 3C2OA 1JYXA 1W9BM 3MP3A 2FFCA 1DWJM 3K8KA 4LV9A 1L2QA 1BVZA 2FMOA 1VH7A 4TTGA 3AS1A 4J28A 5KMYA 1HKKA 5DEZA 3CAKA 1KWGA 3RLGA 3T1GA 3SUTA 4LU0A 3W82A 3WSUA 3SJNA 1GVRA 5CC3A 2C8NA 2YXGA 3SR7A 4WY0F 3W2MA 2F2HA 1GQLA 1XIGA 3GDBA 4GX9A 1H61A 2QCFA 2WPBA 2WKJA 4M5PA 1PHWA 5AYXA 3VNYA 4IIDA 2VZSA 3IV8A 3VOHA 3R1ZA 4DBEA 3UJ2A 2V2DA 3HG2A 3BSHA 1C93A 5BYWA 1GKPA 3H8AA 4C1NB 3E74A 4GIRA 1A0DA 3GTIA 3GYCA 3S1WA 3OB8A 4TTUA 4W5UA 3ZT6A 4L65A 3PPFA 2A3LA 3BARA 3BC9A 4DNMA 2ZUMA 2WNZA 4RNHA 1LQ2A 3CEPA 3F4CA 3QW4B 1PIIA 1F4HA 1EL3A 3K4DA 4NNAA 4RNIA 2E6DA 3CXOA 4IGNA 4HPGA 3W86A 3GNOA 1F2JA 4ZTXA 4C6LA 3QZ6A 2J4GA 1LOLA 1VEPA 4HBKA 1UP0A 4C6KA 1V3HA 2BXZA 3WQDA 4RDVA 3WH7A 4S3EA 4M19A 3CB3A 2FLIA 5HNUA 2PU1A 5D9MA 4ERGA 2WB5A 3ABOA 3PR2A 3B8TA 3CUZA 4KIEA 4LCQA 4OZOA 5REQB 3WX7A 2QF8A 4RE3A 2OVLA 4ZA0A 3JRKA 3IVUA 1VJIA 4R5EA 1I9CB 2A6LA 2GDQA 4MMWA 1ISVA 1W2VA 5HMFA 1BLIA 3TTSA 2REQB 4MNJA 3IIVA 4YVXA 1IIHA 1UKTA 2OLHA 3N73A 5ABHA 1W3KA 3O05A 3GG0A 4ERIA 2OOFA 1U1HA 2I5QA 3MVTA 5ECUA 1SO3A 1UZHA 2VFEA 4GX8A 1OC5A 1QNOA 4NJJA 4PODA 4RUBA 3WEZA 1IQ8A 5AFDA 1HO1A 1LBLA 4RW5A 1NM9A 4UQCA 4O10A 2XVGA 3KVJA 2Z7KA 4Q8TA 1EC8A 1FCQA 3NDZA 1OM0A 4AU0A 1NDVA 1ZZMA 1KM2A 4DI8A 2GDUA 2WM1A 3HQOA 1EUNA 3W1MA 2GVYA 4FS9A 4JIPA 1BXBA 3UWWA 1ELSA 1S2WA 4GJ1A 4URIA 4IFKA 4JTTA 3JZUA 4H19A 1JGIA 2VRKA 3UY7A 4B5NA 5M1TA 3LSBA 2DSWA 2JE8A 3IJ8A 5HDRA 3EB3A 1ZS2A 3MSRA 4Q8PA 3CWNA 5E93A 4AWTA 4QJ1A 4UTTA 4C6OA 3R8GA 1T8QA 4XAFA 4W7WA 3A6OA 1ZB5A 3CEUA 3N4EA 2EO7A 3TQPA 4RZ4A 4A35A 1ZENA 2Y5EA 1W31A 3GQYA 3NZQA 3P0XA 4GYFA 1S2AA 5CGMA 4LYRA 1IR2A 2DSZA 3EGJA 1B90A 3DUGA 3GX9A 4IMDA 5FAGA 1P0NA 4JICA 2VVSA 5D38A 3W27A 2NWRA 3DFTA 1QW8A 1VGAA 2ZRWA 4XBKA 1WDQA 4O1BA 5A8MA 5I6SA 3IVSA 5AC6A 3ITYA 3C2VA 1RD5A 4LH8A 4J3VA 1AODA 1A5NC 1ZFJA 1LORA 2HE8A 2J7BA 5A3HA 4KPLA 4GYPC 5E0FA 3RX3A 1E5JA 2P1FA 4M24A 2XVLA 1XUZA 2VZOA 1TA3B 3WN6A 2FH6A 4R3UA 4CNSA 4QE1A 1TR1A 1KRMA 2XWDA 1TTIA 4M6UA 4O19A 1H50A 3W01A 1BYCA 1NDZA 3ZVIA 2ZE3A 4GI4A 3APTA 4RPQA 3FAXA 3AAMA 2TRSA 4LVFA 3O6AA 2RFGA 4W85A 4JTFA 3T8LA 2ATSA 1UUMA 3OVQA 3NGJA 4MKNA 3TQVA 3EX4A 4NAFA 3PANA 1T96A 3C0SA 3FK4A 2QCDB 4J3SA 5EMMA 3RFAA 3ZQ9A 5HQEA 2I5IA 1TIWA 3RPTA 4FXJA 5ECVA 1AMKA 5AVHA 1Q45A 3V36A 2QNEA 3WYZA 4DWSB 1W3LA 3NEVA 1OGGA 4MWAB 3B40A 1MQRA 2AL2B 3NQVA 1P7TB 5M2FX 1GCYA 1TRDA 3VKBA 1Q63A 3O06A 1SQ7A 3ONBA 3H24A 2CZDA 5LHEA 3GIPA 3W4RA 4KGJA 2F7FA 2KX9A 1KCXA 2EAWA 4V33A 3ZMRA 1ALDA 3QYQA 4AD3A 3TX9A 4GC4A 4R34A 3TN5A 1OGBA 1DIOA 3QPZA 4PRTA 4J2MA 4IMEA 2BXYA 1JNEA 2V8ZA 1O95A 6A3HA 4NYYA 4LS0A 2DORA 5HJLA 1RH9A 4HU8A 2HE5A 2FDMA 1TV3A 3NSXA 2X1UA 4Z1CA 3SO7A 4OV4A 3WJWA 4DO6A 3SUWA 3IJDA 1M01A 4JX4A 4GO8A 2BVDA 4D71A 4IMFA 4WJ8A 1BXNA 1H51A 1RZMA 1GK8A 2I56A 1B4KA 1KFEA 3LXAA 4AHOA 5A8NA 2A4AA 2ALDA 3ABXA 1IXOA 2DW7A 4L9YA 5I02A 5EGRA 5KSWA 3AMKA 1O1ZA 3CZLA 2ZVRA 3QYSA 3QY8A 4CN6A 4MDOA 1LQAA 4C6QA 1XJBA 3TC3A 1SZEA 3M1ZA 1BYBA 1HG3A 1F3WA 1LBFA 3OOQA 1OFPA 3H55A 3PTKA 1FKXA 1QNQA 2W62A 3TJXA 2IMRA 3RAOA 4BA0A 1H62A 1M7OA 3W25A 4Q6XA 1X8CA 4JTSA 3SCOA 5CPOA 5HINA 3URNA 3BAYA 2ZYFA 2Q8LA 1SO4A 3H2AA 4UCGA 2BY3A 3RPDA 4MLJA 4FNRA 3BW4A 3F2BA 1EWEA 3LU2A 4O50A 1SPQA 3CMGA 2ZTKA 4FPSA 5AECA 4ZL1A 2XIBA 1TX2A 1R86A 3DC8A 3RXZA 4FO4A 5I0DA 1KR1A 3P2VA 4C6NA 4Z2KA 1YEYA 1JZ3A 3GKFA 4X0NA 3TP4A 3NIYA 5IHRA 3VD4A 4G1NA 1E72M 3P14A 4OGZA 1NWTA 3PSWA 1LL4A 2W67A 5G1YA 4CQ9A 1TKKA 1XPGA 3FY1A 2VRQA 2GGJA 3W7LA 1OCBA 1DWHM 3WQOA 4JYEA 1E4MM 1ZBWA 1H2JA 4IGMA 4MAZA 3RK8A 4V2XA 1FWAC 2PTDA 2QDHA 2WMIA 2CW6A 2VWSA 2NWSA 4C5ZA 1M3UA 1US3A 1S39A 1JEZA 2O55A 3LTYA 3E1F1 4JTRA 1EQCA 1V5XA 2PB1A 4NJKA 4MVAA 3ES8A 4H9VA 3KM8A 2PD9A 4JY9A 3VYLA 3WLLA 3KRBA 1DQWA 4DZIA 3S2CA 3U4AA 4YLWA 1FWTA 3A3WA 5G4EA 5JBDA 2A3CA 1QXLA 1V03A 2HVNA 4J27A 3B9AA 1TZ9A 4ENLA 1LL6A 3ZWSA 1HFBA 4UTTC 2OWWA 1X6NA 4CQDA 4GLEA 1W54A 1YQ2A 4R27A 3KZSA 1VCFA 1YXCA 2AQVA 2VUYA 2ZX6A 3LTPA 2ZRXA 2VDHA 3T81A 4B90A 4AX7A 1ONWA 1REQB 5D2YA 2WKGA 4QSFA 5EY5A 1GKRA 1LOQA 2HXTA 2EEXA 1JPHA 2YA2A 2OSWA 1VFOA 2ZC1A 3A21A 3QEZA 3VGGA 4NILA 2WV8A 4YMZA 1MQPA 1VEOA 1AH0A 5TIMA 3TTEA 5LA0A 1Q85A 2DUXA 2J7GA 4IJRA 4P8WA 2A7RA 3P5ZA 1EOKA 2PU0A 1VPYA 1EO5A 5FF7A 1UD3A 1QMLA 3MV01 2DW6A 4AVFA 5BOFA 4MY9A 2O4MA 2H3DA 2C1IA 3DG6A 4O0QA 2QMJA 4IG2B 5DT5A 3FDGA 5TQLA 3S46A 3WD0A 3HO8A 4LX4A 3S47A 2YL6A 3F5KA 2QVHA 2EPNA 2X30A 5BMXA 3VFLA 1JPMA 2FB2A 4MB4A 4N2YA 3BPWA 3W1LA 4UFLA 1UPMB 5A2AA 1KR0A 3AHXA 3SRFA 4LYQA 3IEBA 3WBXA 2PUZA 4ONVA 3G1VA 3LMZA 4CGTA 2XVNA 5RUBA 3L66A 1KXHA 4ZO9A 2W6RA 3MA8A 1OJXA 1UJPA 2BWGA 1MUCA 1HNYA 1DBTA 3LM3A 3GVQA 3NVTA 4AHPA 2JIEA 2DVUA 5I7GA 2XH7A 3PK7A 3W7NA 4NKCA 3VINA 1X1ZA 1CNVA 1B31A 2A7PA 3AJXA 3LGGA 2J9YA 4RCXA 3O6CA 4CKQA 4XAYA 1FCUA 1H09A 1UR2A 2WJEA 1P6BA 5U7SA 1UZ4A 2J6XA 3UU0A 2BHYA 2A79A 2Z25A 1WAWA 1CX9A 1WE5A 3G5EA 4Q4SA 4OQVA 1JCTA 3W2LA 1A3XA 5GJNA 2ACUA 2YZ5A 3AYRA 5CG0A 2VC5A 3WLTA 5A8PA 3PNZA 4NZ1A 5A2BA 3MHFA 3CV2A 3MT1A 1KO0A 4XWUA 2ISWA 5D2TA 2ZZ7A 3GC4A 4MWAE 3CWHA 3Q58A 3EX6A 2PLMA 3N6HA 4AVNA 3MI3A 2A6NA 3TYDA 4O17A 4JY8A 3PAJA 1HJQA 5EBUA 5C6MA 1BYDA 3ITGA 2QV5A 1A49A 1P0KA 3BCFA 5EA9A 4ICCX 1US0A 1OF8A 3ARWA 3QC0A 1KFLA 5D33A 1WKYA 2E9MA 3RM4A 3SADA 1Q8AA 4JBRA 1OIFA 3W26A 4F4RA 3KRUA 3DYOA 5C70A 3UJFA 1DQXA 4B2DA 4A21A 4WDTA 2XWEA 4MZ8A 1POJA 3B05A 4HK7A 4XO6A 4O8AA 1LCOA 5E1QA 3C6CA 3QZEA 5CJ5A 4F2UA 1OHLA 4PEEA 4X0VA 4UTKA 4KRZA 4QITA 1XLCA 2YJQA 2WK2A 4TIMA 1PCWA 3WQPA 3G1AA 2QR6A 3N11A 2R1PA 1E4IA 3W73A 1AZ1A 3MCOA 1SZFA 2PMQA 4QJ5B 2XIMA 5DLCA 3U57A 1GVOA 3OLIA 3RO6A 3N3TA 2PWDA 2UBPC 5I3DA 3FJLA 3I6RA 1BVNP 3GDTA 5AOUA 9CGTA 1K6WA 1U5HA 3N2TA 5I3HA 4IJBA 1UJQA 1MNSA 4OUEA 2GVLA 1XLJA 5E5CA 5JBFA 3TYCA 1Y5WA 3VE7A 1PYFA 4LVAA 4MKVA 3MMDA 4H6EA 3NQGA 4S2BA 1Q65A 3WQEA 4QP0A 5BOEA 3BW3A 1DJQA 3UXIA 1ISXA 4QJ3B 2NUYA 4L1WA 4C1KA 2BNJA 1N82A 3QV9A 3N25A 1NOFA 3JZEA 3I4EA 2DY3A 1CXIA 4V27A 1UIPA 4ZEPA 1LLWA 3W7JA 1ONXA 3MMUA 3TROA 4CCCA 2C1HA 1OCQA 2E7FA 1D7KA 3BLKA 1O7AA 3EKGA 1HP5A 1XC6A 3LI1A 4W7VA 2GJNA 3HG5A 1I75A 1KB3A 1CDGA 1VHNA 3N18A 4Q4QA 1M5WA 3QY7A 2XIQA 4ZE5A 1KM6A 1TJ0A 4K68A 3SW6A 4C1LA 4PUUA 1O66A 5A8GA 4MPQA 1VFLA 2PTZA 3FVDA 5LXEA 1L6SA 4LVDA 3WY1A 1ITCA 2E9BA 3FYOA 1GORA 2PTYA 4A3YA 3WK3A 4DZAA 2J13A 1PDZA 2E1DA 1BRLA 3H23A 1W9PA 3LBMA 4Y9NA 1MYRA 3W0KA 4E3TA 3Q37A 2MNRA 1WV2A 3I6TA 3BGJA 3EXSA 5I3GA 3UXKA 4LBSA 2VJXA 3MANA 3WH5A 4H7ZA 1G7VA 4N7QA 1A0CA 1UR9A 3DDMA 1JD7A 3FKRA 3R58A 1LTDA 1XBVA 3GDLA 1SR0A 3QMRA 2WVSA 4GIYA 3CAWA 2ZZ1A 1FQ0A 1KTNA 2G96A 2AQOA 2ISFA 2BY1A 2RH9A 3CC1A 4LWWA 2Z1KA 3UJRA 1JYNA 4U2ZA 2PBOA 1YW1A 3WLHA 4UOJA 3GDKA 2RDTA 2NV2A 4RZBA 4WZHA 1EJ7L 1PS9A 4PBEA 4UTFA 4N4QA 3GXDA 5FEWA 4DY1A 2CKRA 2PURA 4DWSD 4PCPA 4MB3A 4MWAD 3WD2A 4UUIA 3NL6A 3NO5A 1X6LA 3CH0A 3NZRA 1OC6A 3KOWA 3URQA 3T4WA 1UR0A 4N9BA 3WD1A 4X9SA 1E0XA 3TEVA 1ODUA 4GQGA 3L2LA 3T0BA 3G0SA 3PB2A 4HN8A 3MU7A 2GUBA 1HKIA 3BAWA 1CGYA 3PY2A 1TUXA 4IL0A 3HF3A 4EANA 4AUBA 4DEFA 3BICA 3DHDA 3W76A 1OF6A 3EDDA 4JTDA 3BLFA 1XCWA 4B3LA 4DBSA 5LNRA 1HJUA 1RUSA 3INPA 4AWSA 1BGAA 3LLXA 3SQSA 1BHGA 4P61A 1OYBA 3UCDA 4PMQA 1SUXA 3E12A 1Z8AA 3CZKA 2RDWA 1XDLA 3QXBA 3RRAA 1FWFC 1TJ1A 4FXSA 3RRXA 3VD5A 1R38A 1CZ1A 4CVWA 1VIWA 4JDBA 3K5XA 3CUFA 3S6OA 5FSEC 4I5XA 6TIMA 5BNKA 4UTIA 3MWCA 1DJXA 3BOLA 5DANA 1AVAA 1J6PA 4JFWA 4UTJA 2PDJA 5HNNA 3SRKA 1FHVA 3HPZA 3C61A 2Y0FA 4MB1A 3L5LA 2GVGA 1JCMP 1EHNA 4XD5A 3RLHA 3WUBA 1FY6A 4ILSA 4IICA 3VNIA 1OFBA 1KFCA 2MANA 1W37A 2Q71A 3T4CA 4Y8FA 4R85A 3CO4A 5D04C 2ZWYA 4KFNA 4IPJA 1C8XA 3ALGA 4O0ZA 3PF3A 2ZFAA 3GZAA 3B0YA 4AY7A 5A6AA 3HTWA 5HPOA 3BMVA 4HT3A 1W9XA 1DJGA 2Q8XA 3CHEA 4HZ6A 4ZSTA 3XIMA 2YFNA 3OLGA 1HZYA 1QDSA 3N19B 3FN9A 5H6HA 4QROA 3WD3A 2NT1A 2Y70A 3ZJ6A 1UMLA 1WZAA 4DUWA 2ZX8A 2FGZA 4H9UA 3VZXA 6ALDA 3SECA 3W00A 5T9CE 1WCGA 1SVDA 3IK4A 4Q8VA 2B7OA 5AHNA 2ZADA 2OGYA 4RDYA 1LQ0A 4U3CA 3NYZA 4AZCB 3H2NA 1HKVA 4CN1A 1EYEA 4K1WA 3HU7A 2ZDRA 4ZR8A 4PCSA 3STEA 5D2VA 4V1YA 1ZP4A 3GXFA 3THQA 2J7CA 1M7XA 4OT7A 3PZIA 3WDHA 4B91A 4YYCA 3BE7A 3SDOA 3P3BA 1NDYA 1C9WA 3DFSA 5FA5A 1TIMA 3MBDA 4O4VA 3GAKA 1HX0A 2B7PA 2YA0A 2I9UA 1THFD 1CGXA 1CTNA 1UR3M 1W56A 4CEUC 1FH7A 3PSVA 7REQA 3L4VA 1F76A 2JF7A 4D6DA 2DZXA 2NUXA 3LEPA 3BSGA 3R8RA 1WOAA 3GB6A 4B16A 2DEPA 2QPXA 1JD9A 7TIMA 4AAJA 1VKFA 3QTGA 2R8WA 3MCMA 5AC7A 4Q7BA 2A3EA 1QO5A 4PRWA 3LPOA 3NJ3A 1DPMA 3BG5A 5F2LA 3QMSA 4G1KA 1GOKA 5D9PA 4AB4A 3THCA 3GW0A 3OPSA 5H8PA 4JQ3A 1FDYA 1XRTA 1PZ0A 3ZYZA 2WMIB 1FWJC 3SUVA 3GKAA 4Q8QA 3G2GA 4HPXA 1H0GA 3KL0A 1CI1A 4U33A 1O5QA 3O8AA 3W1AA 4CNTA 5E9XA 3WLIA 3PJUA 5A6SA 4BWLA 1K6AA 1JULA 1L8PA 3MUZ1 3URAA 1R3VA 4S3JA 4M0XA 3F2CA 3KEHA 3EWDA 3WBWA 2VYOA 2GYIA 2OT1A 1EGMA 2YYUA 4WVXA 3ITOA 5FJOA 4GG9A 4OTKA 1EBHA 5C9XA 4KESA 1TV8A 1RR2A 1E4LA 4GQQA 4OU1A 4QGCA 3TC6A 4U2YA 2ZXAA 3DYMA 1E1FA 4XD6A 1B3ZA 5EU9A 1QW7A 3STPA 1LUCA 3PG9A 5EMYA 1GVFA 3AHVA 2CKSA 4JL2A 2GGEA 3EWXA 4B4FA 4UFIA 4LVBA 3S1XA 1W3IA 1MRQA 4YHEA 3H22A 3FKKA 3WQ4A 3T8QA 3BAKA 4DO5A 1XDMA 1XHGA 3W7PA 1XKJA 3VABA 1CXKA 1I0DA 4XSLA 1F6PA 3IVTA 3BK0A 5C2CA 3PUOA 4DJED 5EMJA 2XDFA 2DT0A 4PTNA 2BVWA 3GS6A 3NXFA 3VNDA 1XW8A 3RJXA 3NPUA 2B81A 3Q45A 4WKHA 2Y7DA 2BODX 1IZJA 3CL8A 4UQDA 3W7HA 4WF7A 5CBIA 3PJWA 4JEJA 2FTWA 4DPQA 3MO7A 2W92A 1FCBA 2AGTA 3GXPA 4LB4A 4TOQA 1MDRA 4U31A 5CSYA 2CBJA 1LZOA 1CB7B 1W1VA 4UTWC 3I68A 1W8GA 2WNQA 1QWKA 2G5WA 5JMUA 4C6FA 5I5RA 5CC6A 4GVIA 4KWUA 1E73M 4AXNA 3VKAA 1GWJA 1EUAA 1I2PA 5D8WA 1ADDA 1MFVA 3IPWA 2ISDA 2OEKA 5C2XA 2J8GA 2YLAA 1CIUA 2BOFX 5LIWX 4DM2A 3CPGA 5CC7A 2X09A 3MJMA 1SZGA 4Q7IA 1LG2A 4I8DA 2J47A 3GHUA 3AS2A 2DZWA 3V5OA 1Q6FA 4HKPA 1XH0A 2WSKA 3M0XA 1ZAIA 1BTMA 1QO2A 3VX1A 2ZUSA 4UFKA 3UWYA 1SO6A 2ZRZA 4D6FA 3LPGA 1JXJA 4I6VA 3FLUA 1YNQA 2BS9A 2VZUA 4YTUA 5A8QA 4LUYA 3PC0A 1HGYA 2ABBA 1P6WA 3CPRA 3KDNA 1VFHA 3H2CA 1VR6A 2OO6A 4F0KA 2XIIA 4D9PA 2HCVA 1SFTA 2O9RA 4O54A 5TD4A 1JQXA 2E8ZA 2XYLA 3CNYA 3KLLA 4GXPA 4S3FA 3HMJG 1XIBA 2RJGA 1DWIM 2I9EA 3WJXA 5AB3A 3E5PA 4R7OA 2XN1A 1Q7MA 5CAHA 2BOGX 2DU2A 4ATWA 4E4PA 2X2YA 1S3HA 2FQIA 1M7JA 3FXGA 4W88A 1Z41A 3VKCA 3ID7A 3AOFA 1YXDA 3PWIA 4PTWA 4HU0A 1R2SA 4HZ7A 1EX5A 5FOOA 3K1GA 1J0KA 4JKLA 2FZ9A 4UBPC 3LHUA 4Z2IA 4IGSA 2CLEA 4E0CA 2C0HA 5FJJA 4IUOA 2QCMA 4A6GA 2DT3A 4H4IA 3B8SA 3ZZ1A 5DCEA 3GG8A 3M0LA 1XRVA 4YCOA 1V02E 1O5XA 3WF0A 2FGLA 4N6EA 2QYGA 2Z29A 5AHIA 2IS7A 1Y5VA 1VC4A 1K8ZA 4QLJA 3S9IA 3PM6A 3VI2A 1JF5A 3V4BA 1ISZA 4GCAA 3VDAA 3REQB 1EEPA 4FF5A 4XSMA 1XYMA 3OQEA 1TELA 2OKTA 3UG5A 2TODA 1Q66A 1M65A 2D3NA 2VMFA 4I5RA 4AH7A 1TJRA 2Q09A 3UJEA 1DJZA 4PUEA 1NQKA 2CZ5A 4AXKA 4Q4KA 4IH3A 1KW1A 5SWUA 1PZ3A 1I2NA 5KZMA 1DWFM 3NGFA 3BG3A 4D6EA 5CZKA 3DG3A 1EPVA 4GUGA 3UJSA 2WNNA 2OZ8A 3GTFA 3LUTA 3NZ1A 4TX6A 3WJSA 3NTYA 2EKGA 1EZ2A 4IIBA 4LALA 4RE4A 1EP2A 4HK5A 4ROQA 3NDYA 3E6EA 1N8IA 2OFJA 2XH2A 3NQFA 3UETA 1UWAA 2FMNA 4Z2HA 2CYGA 1IGWA 3TQ0A 2PDUA 2XHYA 3M44A 2QCLA 2YZRA 1KM3A 1G01A 1NEYA 5G4WA 1NFBA 1AJ2A 5JQ9A 2CXGA 4DBWA 3GC5A 1AL8A 1E3XA 2X0SA 1BF6A 3CAVA 1WDDA 2ZDSA 5AVNA 2W61A 3CQJA 1X8FA 1BRLB 4JTCA 1XBYA 3TW6A 3K1DA 2XZ9A 3ALFA 4JQAA 1A50A 4HCDA 1TE1A 4XK2A 1GNXA 3GG7A 3ITVA 4BWLC 2GSHA 2TMDA 4LCRA 3L21A 1SZNA 1LJYA 4XZIA 3OW1A 4Q4RA 1IEIA 3DHPA 4WIWA 1VBUA 3BCDA 4K7YA 5MKGB 4W89A 3MKKA 1WO2A 2EF9A 4WDXA 1KTCA 2CFFA 1VYPX 2G3MA 3PAOA 5E0CA 5G2HA 2CLHA 2C16A 3W1RA 5I07A 1J4EA 4FNSA 3WZ0E 3MSYA 1JCYA 1SR9A 1K77A 3IRDA 2D2OA 1OX4B 3QOMA 4PN2A 2BX7A 1M7PA 3UG4A 2R1KA 2CZVA 1E0UA 2J79A 1S5VA 1A47A 4ATLA 4JFUA 2FPTA 3IWPA 4HA1A 1TV4A 1A5UA 5AN7A 1BXCA 5DMMA 1JNDA 5H8UA 1W5NA 3B9DA 1OFRA 4O16A 3JS3A 3KUMA 3USZA 1EPXA 3FVMA 2W5FA 2VRJA 1JUBA 1HN1A 1YPXA 1KBKA 1AQFA 3TMLA 3JUGA 3SM0A 4JNYA 1OY0A 2HVMA 1DIDA 3V0SA 3W53A 1OCJA 1JDCA 4KWVA 3RO8A 3OQ8A 3H7RA 4N9CA 4XZMX 3T78A 1UH2A 5FD0A 1VLIA 2BHUA 4ZE4A 1SU5A 3WL1A 3WQGA 2ZRVA 4US6A 5M17A 1ICPA 4R9XA 4P7RA 3MKCA 2J7EA 3CUGA 3NQMA 2EHHA 5HANA 3ARYA 4B9YA 2IPGA 3R7MA 1E71M 2R1LA 1A53A 4ICMA 2WHKA 4EWND 2OZTA 3A4AA 4DUVA 3N4FA 2G4JA 5FF2A 3E96A 2ATMA 1LWHA 2QJIA 3IK2A 4B5VA 2XGZA 1R3RA 1PB0A 3OO2A 2OQHA 1C91A 1M03A 1JFHA 1W1B1 2VR2A 3MDUA 1UUOA 4A22A 1QFEA 4M1RA 3OIHA 4UMAA 1XBZA 1NJJA 2IQTA 3AS0A 3KRZA 1H60A 1ONRA 3QC3A 1KFKA 3G24A 1X6UA 4HJFA 2YXXA 3KBWA 2QCEA 1S2VA 1NDWA 1EHAA 3MHGA 3P67A 3D3AA 3GHRA 2R94A 4WSHA 2D0HA 3VU2A 1LRNA 1TQXA 2B4GA 5CZ0A 4JDYA 1K9TA 3W28A 2QUTA 2CZFA 4H9ZA 2NSXA 5I00A 4DB7A 1OD8A 3QF0A 2G50A 4BQ3A 3HPXA 3W3OA 1OZMA 2E67A 4MZYA 4V1XA 3WH9A 3AICA 2ZX7A 3ICJA 1H1ZA 4PUDA 3PTMA 5J5DA 5CSRA 2E25A 2OU4A 2PDHA 3C56A 3CHDA 5DMLA 3PZUA 2ZWZA 2Q6ZA 3M16A 3KLKA 4HU4A 2X8RA 3LK6A 1FHLA 2E5DA 4JD4A 4G8TA 3UD6A 3VNMA 4R53A 2OQLA 3SI9A 4I9AA 2NV1A 4I5UA 2HPIA 2DZUA 1KCLA 2VQUA 3BDKA 3WJYA 3MP4A 3QLLA 3FV9A 4B92A 2Z1VA 3D46A 3CTLA 3L4YA 4KF1A 3OEXA 1JF6A 1TTQA 3ZLGA 2RGLA 1GW1A 3UZ5A 3U5UA 4LAZA 1XV8A 4JOMA 3WIJA 4NXKA 1V7YA 4R9OA 5BU9A 1PAMA 5J04A 3SGZA 1DXEA 3AI0A 1RJRA 4M29A 1E56A 4PMDA 4O4WA 4EK7A 2PDPA 3CGTA 1YX1A 1FA2A 3NYDA 1XKYA 3F4WA 1WXZA 3T2OA 2QS8A 4AISA 1KBBA 3LERA 7REQB 1FOBA 3U2EA 3QSRA 4MY8A 4ICNA 5L6UA 3WL0A 3SN4A 3BAIA 3RNDA 1I6NA 4FNQA 4CQBA 1E6NA 5FF3A 1E15A 3AJ7A 1IGSA 3H4XA 3B0XA 1QOXA 2VC6A 3P0WA 4GVFA 4ORIA 2O9OA 3MDWA 5C9UA 4U5IA 3IJ6A 5FEXA 4YN5A 3O07A 3BG9A 4AIBA 1E9IA 5A94A 3KCOA 2C19A 1UPPA 1OYAA 1QPQA 3L4UA 4PR4A 4DHGA 2WJFA 3TJIA 2GL5A 1KFWA 2PFHA 1ENUA 1NOUA 4LUSB 5TF0A 4RK8A 3CU2A 2ACSA 2ZTJA 1I8JA 3VKDA 1V93A 1KM1A 3CLWA 3IAPA 3B4UA 1BWLA 2ZA2A 1BSIA 1K4GA 5CG7A 4N9DA 1SGJA 5CCZA 5BWFA 1GJPA 1PKYA 5LZLA 4IP7A 4BF5A 3AC0A 3CHVA 3DFPA 3VXGA 2NQJA 1LUCB 1OCNA 4AZ7A 5ABTA 3ERPA 4XAZA 1E3ZA 1JCNA 4CEXC 5JBEA 1TWWA 2HDJA 4XQ6A 3POCA 5GNYA 2PCEA 4BQ2A 1QNSA 4JTLA 1KV8A 3GNDA 3OZMA 2VM8A 2Z1XA 2VQTA 3GFXA 1XIDA 4WHBA 1EC7A 1XYLA 2FYMA 3PZ9A 4N9EA 3MYOA 4QIUA 3E0FA 4MM1A 3VZYA 4NNCA 6REQA 2EBNA 1EQPA 4PMZA 3NG3A 4CU8A 3I3BA 3S8HA 1V8EA 3IARA 3TIMA 2VEGA 3DG7A 2J88A 4LRTA 4HNNA 2PC8A 5I3KA 4Z08A 2Y5JA 1GYLA 3GH4A 3O3RA 2WMGA 4E4FA 4UFMA 1IZKA 1XISA 2EJ1A 4D2JA 3Q2DA 1EJSC 2CIPA 3S1VA 4W8LA 4OVXA 1XL9A 2BVTA 3PZMA 3RCYA 3KBNA 3IIXA 2BOEX 2CLPA 2CHRA 2VD9A 5C5YA 4XV0A 4H00A 4XB3A 4GUFA 1ITQA 4W84A 1KRAC 4I7UA 4L4PA 4LUTB 3MC5A 5I3FA 1XLMA 3UF9A 3S83A 3C52A 1M53A 1YTEA 4Z1BA 1G6CA 1HO4A 1E6PA 2FVMA 4QCEA 1YPIA 4INFA 1UD6A 2PLKA 3BTNA 4XVEA 3ZJ7A 4QEHA 2DZAA 1DEDA 4ACZB 3B0UX 1P0EA 1TPUA 4MYXA 1XUUA 2CWXA 5CPQA 3UWZA 1LP6A 3LCHA 3VTRA 3GC2A 4IOTA 1OFDA 3P61A 2GK1B 3KE0A 3RCMA 4M82A 4NT0A 3AMLA 3RMEA 3LHYA 1JQVA 2PWGA 3FDKA 2GVJA 2WZHA 2PSNA 4PTXA 4GZ7A 2D2HA 4BFAA 3KXQA 3AROA 1V08A 4FIRA 1VPQA 2YCJA 3FSUA 1AW5A 4ORMA 1Q6LA 1MDLA 5DO8A 4KGLA 3L5MA 4Q8MA 1Q7QA 3VM7A 3WKZA 2FGBA 4HYVA 2FJKA 1NTHA 3TYBA 2C13A 2VOTA 4LSBA 4M81A 5TNVA 2QCGA 4AC1X 4UQEA 2F6XA 1YDVA 2CBIA 5BZAA 2CWNA 3NOYA 1RBAA 4XZNX 3N29A 5D30A 4PMNA 1Y0EA 4JX5A 2QUVA 1RXOB 3L4XA 4CU6A 2OYLA 1QI4A 4ZB2A 2DFAA 3C2RA 1CXLA 3GNRA 1UOZA 3MQTA 5LYRA 1C8QA 1JDDA 4JEQA 4Y9AA 3EX3A 3S2LA 2DIKA 2PS2A 2RDUA 1HXJA 4GIEA 1KD0A 1TA3A 1WBJA 3UZXA 3WMLA 3EDKA 5C54A 3TA6A 3FJ6A 3QPYA 1K1DA 2BFGA 4GFSA 1ZCCA 1DXFA 4YTRA 5HMEA 1G4EA 2P3ZA 3B4YA 1IHIA 5HQMA 2OYKA 3DGRA 3UBPC 5A6MA 2WZTA 1OK6A 1EB3A 3SEPA 2ZZ2A 1V3LA 3VDGA 1W5OA 4AFYA 4K36A 3W6LA 2Y8UA 3AU2A 2B7QA 3G1DA 3A4XA 3S5YA 4QJ4B 4UFJA 4S38A 3HOJA 4P7NA 1VJZA 1YDOA 3LA4A 4LXFA 1KBIA 5AC5A 5FI8A 1VCGA 1SW3A 1HVXA 4FP1A 3G3DA 5T26A 3SN1A 4HMEA 1MFUA 4DWSA 3KS5A 5M5DA 3D6NA 3CT7A 3AIBA 3OA3A 4PEKA 4MWAA 2UY2A 4GKTA 2Q02A 3FCPA 3SURA 1LT7A 3SGUA 4Q4OA 4HVXA 1BF2A 1MUMA 1EYWA 5HR6A 3OP2A 1ITXA 1QJWA 1H3GA 4M6QA 1AQHA 3R8HA 3W70A 3SUUA 1W5QA 1XQKA 3ITXA 2CITA 3PZOA 4MF4A 2FPVA 6ENLA 1UMYA 5C9WA 4UNIA 4AY8A 1OEPA 4UXDA 2P5NA 3URBA 4S1FA 3EOSA 1IWBA 3DHFA 3H21A 1FFRA 1VF8A 4Z42C 3N2BA 4GVGA 4I6KA 4GMEA 1GOIA 1G69A 1ZBCA 3LV6A 3XISA 2H8XA 5LNVA 2TSYA 3WD4A 1IE7C 3G6LA 1S1PA 3L0GA 3ATYA 4OECA 4H2HA 2GSJA 2VR4A 3CH9A 1X38A 1JJKA 1TRIA 3DGBA 4H6RA 1N8FA 2E6YA 2YYTA 4YTSA 4WOZA 1EC9A 4FF7A 1WKEA 3AQUA 2FJUB 2GGIA 3QGVA 3LGDA 1IWPA 2EPOA 1XGZA 1R2TA 2E8YA 3CM4A 1VBHA 4IX2A 1J9YA 1D8CA 2OWCA 3PTDA 1JAEA 4CQCA 4MFEA 3RGTA 5CZSA 4W5ZA 3QR1A 3M41A 3GDMA 2QGHA 2VFHA 4Q3MA 3T6CA 4UQAA 4EXAA 4GI6A 3ANYA 1RJQA 2V5DA 3HPFA 4A2SA 1LF1A 1DJWA 3VIOA 3EYPA 2GSEA 3H2EA 4HNTA 2OKOA 2QUUA 3BGGA 4F2TA 4ZSUA 3A47A 2V3DA 4KW2A 5D03A 4D8ZA 4YJ5A 1SW7A 1FDZA 4WQ6A 1VRDA 4WJXA 5XIAA 4FB7A 1SW0A 4IISA 5C71A 2YL5A 1XBXA 1O94A 3BSMA 1OG0A 4NSBA 2VX4A 4K8EA 3CTTA 1M04A 4IQJA 3U4FA 3QSTA 3MPGA 4DWDA 1OZQA 2WSQA 1BGGA 1F3XA 1IEVA 5JU6A 3CJPA 3ANUA 4HMNA 4UR9A 1PIFA 5FL1A 1VCVA 4F9DA 3GW3A 5IFPA 5D09A 2VFDA 1W17A 4NG3A 2VL4A 1O5RA 4JFSA 3ZIZA 4NY2A 5GNZA 3DN5A 1SZRA 3AYSA 4YPJA 1EP3A 3PFMA 4M6VA 1GJWA 3TYEA 1ZBKA 3IJ7A 2OX4A 1J6OA 7ODCA 1TG7A 1KXTA 1P0DA 4RDZA 3C0LA 1Q4NX 1PX3A 4CNOA 4E8DA 1W3NA 2G41A 5BMWA 3W7RA 2B7NA 1LWIA 4JS3A 3ZOAA 3AWNA 2GUYA 5G2WA 2YR1A 4E3VA 1MXDA 2VOMA 4WXZA 4YXGA 3GZ3A 3OJGA 3WLNA 1VFTA 4JL1A 1J11A 3IUHA 3W37A 5L9FA 3SBFA 3QJAA 1E6QM 3LN3A 1REQA 3HGOA 3LCIA 1NFPA 3P84A 4GY0A 1YPFA 4ADTA 3WF1A 5AHFA 1QU4A 4H1ZA 2J75A 2H6RA 1J79A 4HZ8A 3TJLA 3AFBA 3GR7A 4IFOA 2DDXA 4DPPA 4HNVA 4BR1A 1HW6A 4B3ZA 3UP8A 4ADUA 3P80A 3Q67A 3HQ1A 3UW6A 1JZ2A 2NLYA 4H01A 3NAVA 4R88A 1KXQA 3U3HA 4FEZA 4FK9A 4WY0B 3AALA 1AZ2A 2ZICA 3PUGA 4IG2A 3LS9A 3VIJA 3JU2A 4KWWA 3EOLA 3SCWA 1D8WA 4ZTYA 4CCDA 1C92A 1LG1A 1FUYA 3ME3A 1C9DA 3BLIA 3O0FA 2OO0A 5D02A 1DJYA 2X0HA 3K2GA 1U22A 3O9NA 2E0PA 1XFBA 3HIJA 3EKZA 4FLQA 5DY2A 3II1A 1TPDA 4KRUA 3VIPA 4DJFD 4DJEA 8A3HA 5MHBA 2VTFA 3H53A 1ZRQA 4DUXA 3G1YA 2VEPA 4PFMA 1KQZA 3U9IA 1RPXA 2AKZA 3N2CA 4H3DA 3FIGA 3VK5A 3C2FA 5D32A 3TV8A 2BB0A 3S5OA 1GOWA 4JIIX 3OBAA 4NJIA 3MUY1 1C8YA 3IJ9A 2D24A 2BY2A 3QM3A 2PZNA 3SZ8A 3KS6A 1QPNA 2R9RA 4UNKA 3RILA 4DWSC 1W9DM 3W7CA 1SFJA 2ISSA 2P8BA 3W1NA 4MWAC 1T41A 1GZ1A 2FTYA 4ZCWA 1K9FA 2OSXA 2YCLB 3AUJA 2G97A 3AZTA 3P81A 3WLSA 2L5HA 2DQWA 2WZMA 4K37A 1E6ZA 1XXXA 4QG6A 3W6YA 1MW1A 4TVDA 3WQ8A 4XKYB 4WKFA 5BWAA 1RY0A 4L4OA 2V5JA 3CZ8A 2WZIA 3B97A 1VBJA 1RVGA 2HXUA 1DWAM 1F5ZA 2V2HA 3RITA 3NCOA 3L0NA 3SUSA 3AU6A 3WEOA 2EPHA 3R43A 1DHKA 1J10A 3CQIA 1FHUA 3M5VA 3O1NA 5HOSA 2UY4A 1JUEA 5KETA 3FYYA 4CVUA 2DZTA 3L12A 3UZJA 4LTSA 3FS2A 4LAOA 4XTIA 3ARXA 4RXGA 3VDCA 1XINA 1QI5A 5CEWA 2CETA 5FACA 1SSDA 4A8LA 5LIUX 3LCXA 1DOSA 3LX9A 5CXPA 1Q6OA 1CGVA 1ONEA 3B04A 2PAJA 2XPKA 6REQB 2G3FA 5LIKX 5F2GA 1OSEA 2NX9A 4JHZA 4JPGA 1ZP3A 1IXPA 4GISA 4H04A 3N2OA 2G3JA 1UR4A 9XIMA 1W5MA 4DELA 2CHOA 2B0MA 2Z4GA 4MSSA 6XIMA 4DN1A 3LGEA 2GWNA 3B06A 1MW2A 4P7LA 3TDFA 1JCLA 1R47A 5AHMA 1FP8A 1L6WA 1B3OA 1UBSA 3BV7A 3E0IA 3W7QA 3WCZA 4LAUA 4JIRA 1K9DA 1HJWA 3TFXA 1DKWA 2OCZA 1VHCA 3LSCA 2OTDA 4XO7A 1HJXA 3I3EA 5HR7A 3W71A 1XLBA 2VDIA 3RPMA 2FZDA 4AZBA 1J0HA 3CLMA 4RLIA 3P8IA 3SCTA 3U0HA 1VLWA 2VEIA 4JKMA 4HA4A 4QX4A 3HV9A 4DX3A 2PDMA 3CS2A 4NX5A 5HUPA 5E6ZA 4HGXA 3KVMA 3FYPA 4FX8A 4H6QA 3VCCA 2FVLA 3SGGA 1QT1A 2Y5SA 4PRRA 4HHHA 1WX0A 1IZCA 3UXAA 5PTDA 4WDUA 3CO8A 4QRNA 3KOXA 3VMNA 4WEVX 1KCKA 4KWOA 4K38A 3BGAA 3BLPX 3T0AA 1G5AA 1UG6A 2PWEA 3L65A 1DVJA 2D0FA 4FSAA 1JI2A 1V7AA 4LYPA 3SSJA 2PGEA 3TYZA 4GE8A 3OU8A 3VOFA 3GSMA 1KRBC 3UG8A 2YDAA 1R9ZA 5K4XA 3PBGA 4PB4A 1XR2A 4OE7A 1TFVA 2QPUA 2Y88A 4GUHA 1HL9A 4IJCA 4BS0A 2PRMA 1QOQA 1MWOA 1XYAA 4MNMA 3FA3A 3W02A 3S3GA 1FXQA 5DY3A 1AD1A 2OZ0A 2Z28A 3DU0A 5CLWA 1W9UA 3EPMA 4R7JA 2HBXA 2QZRA 2CLLA 1UD4A 1NIUA 1TPEA 1Z42A 2WC4A 4XZLX 2YOCA 1V3MA 2QCNA 1BFNA 2EQDA 3EPOA 2E9LA 5IOBA 2INFA 4WCJA 3T0DA 4QG8A 5A95A 5C7HA 4FLSA 3LDVA 4QS6A 3JVAA 4POCA 3FA4A 4ES4A 5FCZA 1I2QA 1CGTA 3YPIA 3VGDA 2BVYA 5D05A 3A3XA 3WQWA 1PUDA 4FAMA 2PC4A 4JQ4A 3TZFA 1V77A 4LJ3A 4X60A 3S5ZA 2QCCA 2JFEX 2VZTA 4WX2A 3RHGA 1WDWA 1XDJA 4XZWA 2RKXA 3W2KA 3C8NA 5KTLA 3OGVA 4C5YA 3MO4A 1V3KA 3WH8A 2GGHA 3BCJA 4PH6A 1VBGA 4AIEA 3GNXA 3WQVA 2J9ZA 3GRIA 1E6RA 2YXOA 4TMBA 3DENA 4Q8OA 2DZVA 3P6LA 4CNUA 2XG9A 1D9EA 4KEUA 1L6GA 3TC7A 2CLMA 1XH1A 1KBJA 2DIJA 3WDQA 2G37A 2F61A 3WF4A 1H7WA 1R3QA 2Z1BA 4ACYA 2FB3A 4OBSA 4QEEA 4CNPA 4HOZA 3H12A 3KBVA 1R7OA 3V1HA 3ENLA 2VX5A 2IPJA 1YTKA 4B5SA 1Q3NA 2WCGA 3QGKC 1GPWA 1LM1A 5K9DA 1NSJA 2J74A 3IRSA 5H2ZA 1JYWA 1E43A 2GLKA 3APYA 4C6BA 3ZLHA 4DJEC 3EB2A 1KA9F 4NI3A 2VEMA 1Z7AA 1EBGA 3ZFHA 3MTWA 4UIOA 4NZFA 1XGDA 2V3EA 3HPSA 2C79A 2J7FA 4GINA 4HSNA 3HFTA 4JN7A 2MUCA 3SB0A 1JDAA 1RK5A 5CJMA 3U6WA 5G4HC 5K2ZA 1JDEA 1MZRA 5I2UA 4DF1A 1TMLA 4IXXA 3MSGA 3NO3A 5BXPA 3GU2A 5LSMA 2XJ7A 2DSVA 4H8HA 3G0UA 3OLEA 2DPEA 3N9KA 3NSNA 3VIMA 4AZ6A 1LRQA 3TONA 1FRBA 4C6IA 4LAMA 4AF0A 1UQYA 1P5BA 2A7NA 2ALRA 1V02A 2ASHA 4X63A 4GRSA 2V6AA 2Q8ZA 2PF8A 1Q6EA 5A6LA 2IKGA 4H9XA 1R85A 2INZA 1PXGA 1XS2A 2ZZ4A 3FEMA 2YL9A 4HMCA 3A3HA 4ZZ9A 3D0CA 4JYFA 3GHSA 4QS5A 2YLLA 4EF9A 1GTEA