3VD1A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
202
Chain Sequence
HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
total genus 36
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd1A00
2J21A 2BIMA 3US0A 4L0ZA 4G83A 4GUQA 5G4MA 1YCSA 2X0WA 1EAOA 2PCXA 4IBTA 4IBWA 3IGLA 2P52A 2IOOA 3Q01A 2WGXA 5ECGA 1HJCA 3WTWA 3D06A 2J1XA 3D07A 1TUPA 5AOIA 1LJMA 4XR8C 4IBSA 2VUKA 3WTTA 3US1A 5G4OA 5ABAA 5KBDA 4AGOA 4IBZA 5LGYA 2GEQA 3WTVA 5AOLA 5AB9A 4LOFA 5AOMA 1E50A 2AHIA 2X0VA 4IBQA 2IOIA 1H9DA 2ADYA 3D05A 3KMDA 2BIPA 3EXJA 2AC0A 4LO9A 3WTXA 1CO1A 3Q06A 1GZHA 1HJBC 2BIOA 1TSRA 5AOKA 4IBYA 2MEJB 1UOLA 2FEJA 3D0AA 3IGKA 4AGQA 2X0UA 3KZ8A 4MZIA 4IBVA 4HJEA 4G82A 2J20A 1EAQA 5AOJA 2J1ZA 3EXLA 1CMOA 2H1LM 3WTSA 4AGLA 4L18A 5LAPA 2BINA 3WTYA 4IJTA 3WTUA 2BIQA 4IBUA 3QYMA 2J6WA 2IOMA 2ATAA 5A7BA 3VD2A 2RMNA 4GUOA 2J1WA 1HU8A 2YBGA 3D08A 4A63A 5G4NA 4AGNA 1T4WA 5BUAA 1KZYA 2XWRA 1GZHC 4QO1B 4AGPA 4AGMA 1IO4C 4MZRA 3D09A 3QYNA 4LOEA 3VD1A 4KVPA 3TS8A 2J1YA 3ZMEA 1EANA 2XWCA 3Q05A 3VD0A 3WU1A 2OCJA 4L0YA
chains in the Genus database with same CATH superfamily
4EDWH 5CSBA 1D5MA 1X7SA 3FUMA 3QI9A 4ZUSA 3R7QA 1ES0A 4JPSA 5IK3A 2OQJB 1I1AB 1M7DB 1G6RL 3TV3H 1JPTL 1J5IA 3GKZA 3EOAB 4PJ5E 1BJ8A 2FNWA 1UXLA 5KSAC 1NGPH 1YEIL 4AM0Q 3BSZH 1F4WH 1I1FB 1WC7A 1X5JA 2AMGA 2VDML 3L5XH 3C2AH 1G87A 4CMHB 1JK8B 4NPKA 2A6JA 5CIPA 1GYVA 3HE6D 3QCUL 4DKEH 1KN4L 3WUWG 2HFFB 5TE4L 5HDBE 2YEZB 2YD0A 5HHXH 4EIZC 1RZQA 5LGYA 2VLJB 4MQXD 1ZLDA 3IETB 1OAUH 4P2RD 1E9OA 3NSCA 4OCXH 2WYIA 1MCQA 1V27A 5I26A 2E7MA 2B16A 1DO5A 3GSVB 3OB8A 4NOFA 4U1JA 3G6JE 4BFIA 1DANT 2ICEB 1NEZA 4WWKC 1EFQA 5C0AB 3VCLB 2N4IA 1FP5A 3MRKB 2PCPB 3Q8EA 3HNSL 4QHMA 5F7BA 4BD4A 5IW6B 5ISZD 2W88A 3CFKB 1AE6H 3BE1L 1RK1A 2YAFA 5TDOB 1GMEA 3QI9C 1LE5A 3ESNA 1FI8C 2YGPA 4L1HA 1P6WA 3HAEB 2D0FA 2FIKB 5CJBA 4KRPD 4DKDC 2CRYA 4RVBA 2XKSA 4UV7H 3FAWA 5JHLH 2BRQA 4FLHA 5EBMB 2ZXWB 4HK3N 5DZPA 4ZAKD 1ZRUA 1Z0NA 4TQ8A 4JPIB 4KK5C 4A04A 4A2HA 4ZZFA 2YLHA 5L4FA 3K46A 2FLBT 3DO7A 2CO6B 4U0QB 3MFFA 3IJSB 4HUNB 4ZFGL 3CBJB 2RCSL 4AUJA 5DMGD 4U6XA 2OMTB 3QEQE 5JOEA 5DTFB 1JZ6A 3ARFB 2ADGA 4NQTA 3Q8FA 3D48R 1CL7I 1KIUA 2WUCL 2NMSA 4I2XB 2W0PA 3GSNH 5FCSH 3FPXA 2D7NA 4QXTA 4AG4H 2PTUA 1S5IH 4JN1H 4PS4L 4QXUL 4LOEA 5LXGL 3H85A 4UYQA 3ELAT 4B0MM 5I17A 1YECH 1Z7JA 3GSXB 3WY3A 2AXJA 4Z7NB 3AACA 4A2MA 4HKJA 5AFAA 4B5EA 1NKGA 4MA7L 3WYRA 1FNHA 3GZQA 4PJ8A 4PJEE 4C4BA 1MAMH 5IW1A 2EDXA 3LN5A 3ZUCA 2K7QA 1EAOA 3V2AR 4WHCA 5D7SH 2RACA 3IGLA 3QNZA 3MV7A 2DM7A 2F54A 2GJ6D 3ARDB 1P5UB 2ICWJ 2Y6SD 2FIRT 4KK9C 1CG9B 1AP2B 5CUSL 4DP6X 4DOHE 1CQYA 2XOTA 1RZPA 1CB4A 5FB8A 5L2KB 4LBEA 1TXKA 5SWQB 4UT6L 3TEXA 1VDGA 3SD5A 3FNKA 1CFVH 2PO6B 1OSZB 3FONB 5ENWA 1H8LA 1DO6A 3PQYD 1A7NH 4U31A 3FCGA 5I2IA 3EAKA 3SKNA 5FOBB 1OP3K 4DERA 4ODWB 1WIPA 1FCGA 2VSCA 5EN2B 1OK8A 3C6SA 1QI5A 1N8ZA 4N0YH 2NY5H 1FFPA 4OJFL 4R5XA 2XZCH 4ZUUA 1KNOA 3FB6B 4L8DB 2QZQA 2OYKA 4NKMA 2Q76B 3W0WB 3UOAB 3CDZB 2Y22A 3F01A 4K3HA 4PJ8C 2E4FA 1CGXA 4ELMF 4DZBB 1HHGB 5L8JB 4HDIB 3C5ZC 1NM9A 2OL3L 4LSQH 1OP3H 4P4RA 4ONFL 4PGBB 1B4JH 4TN9A 1HHHA 1RZ7L 4WW1A 2EEBA 3GFUA 2FSEB 3IFPA 4NM4H 3CFCL 4YLQT 5KVMC 1BOGA 5LCVL 1DQML 3MBEA 4E5XG 5AKRA 1OE3A 4LLMB 2PNDA 4X8JA 1GXEA 4LLYA 5I66A 5AYQA 3I85A 2FX9L 3WJMB 1WFOA 1B2WH 4RRPM 4JHAH 4XCEB 3R8QA 1F02I 1SEBB 3PP4H 2ZG3A 1PD6A 2W65B 2ZXEB 2H1XA 5KYYA 3ZDXE 4HU2A 3NOIA 3KS0H 5J89A 3V6ZB 4HUKB 5ALCL 1EV2E 2YRBA 2GSGB 3JYCA 5KYUA 2NT0A 5K9JH 4TSCL 4TUKH 4YDJA 3BN9C 3CFJA 3UACA 3O11B 1MQKH 1BM3H 4WU5A 4F2MB 1WBXA 5J06A 3GHBH 3IDNB 3UERA 2W8CA 1SNRA 2AEPH 4C47A 3ZDZB 3EKCA 4JKNA 1ITBB 4G9FA 5EU6A 2C9VA 2DW5A 1UVQA 3KH4A 5DEGA 3BOVA 4GKZB 4EE2A 3BZDA 2EUWA 4YHIA 3P3RA 3TBTB 5JDSB 2I5YL 4CGTA 2PP9A 1LEKB 3MBEC 5DRWB 1UQSB 2DQEH 2EXWC 1Q9KB 3BPCA 1M1XA 3G5VA 3TH4T 4PCSA 3FW6A 1J1PH 1A1NA 1UYWH 4HIQA 3IDYC 4JVWA 3ML9A 2HCZX 4AVIA 3TVMA 5AYUL 2XTJC 4J3OD 1W72H 2QVKA 3NN8B 2XYBA 2P52A 3QDAA 4JPVH 1CYGA 4YDIL 4OCMC 3WG7B 3SJVA 3IJYA 3DA0A 3QHFL 1UB5A 1L9SA 2ICWI 3NK3A 4I18B 4XR8C 1BFTA 1DP0A 2Y0SA 4O2CA 3WNOA 5BRPA 3WFDH 4LDLB 2EYRA 3WKML 2P5EB 1UA6L 3CZSA 3U6RB 1ZGLP 5E1IA 5DMIL 5DHVA 4Y88A 1P7KA 3LKSA 2YD2A 1IFGA 4JFDB 4OJCA 3CZFB 1HSAB 2WVVB 3S4SA 5EUOA 2JKJA 5J6GB 1QBML 4LEEA 4G6AD 4Q74A 1A8JH 2DV6A 4YDKH 3F7PC 5DXWA 1QFUL 4C8XA 2EDQA 2LV4A 5LGKA 5F0JB 1PLAA 1ADWA 1YUKB 5H37H 3VXTA 4CBZA 2EUXA 3T0XA 3VFPA 2QSQA 2WB7A 4XMZA 1Z9SB 1BF5A 2GPZA 3FAXA 4RLDA 3TVMC 4FFWC 2X88A 1PPIA 4PJ9C 2ENSA 1PYWA 4UIKL 3HIZA 4PJ7B 5FM4A 3EO0B 4GRWH 1G6RH 3GBEA 1JPTH 2EC9U 3L1OL 4AKOA 1FH2A 2G3XA 2I25N 2W92A 1YEIH 2AQSA 2VJ8A 3WSQL 3EOBA 4ZS7L 4LLQA 3PG2A 3UTQA 3HJEA 3GJEB 4LLUA 2JCCA 3VFVA 2VDMH 4O58L 3WTUA 1I8LA 1S7QB 2DQJL 3OR7A 1T1ZB 3AW5A 2VWEC 1QPXA 2JLLA 3QCUH 4ADGA 1KN4H 5TE4H 1MZZA 1PZ5A 3CN2A 4KUZH 4UQ3B 5TGBB 4UZUA 1JZ3A 2J56A 2I69A 3TN0B 4FRWA 3NGBC 4X5PA 3V4LA 1S7VA 4D7PA 1U8LA 4HMCA 1UZGA 3Q6FA 4CN4A 2AQ3A 3TT1L 3IBOA 1B88A 5MENE 2OSXA 2J88L 2C9XA 3FK3A 3HNSH 4CMMB 5EPMB 1PCXA 1OP9A 2Z93B 4PD4J 4JGUA 2MKWA 5E8OA 5ITFB 2HAZA 1RK0A 2X87A 3O6FD 3SDAB 3C5JB 4FA6A 1FC2D 4KH9A 4G7QB 4YDMA 1QWHA 5C0CE 1QFHA 3T3PF 1LO3L 4D0BA 2FYYA 3EW3B 3HBGA 4WUKL 3LH2L 4AT6B 1OSYA 2D73A 2NXZD 5E9DA 3VXOA 5HPMA 2G30A 1JWMB 3HS0A 4KU1A 4XC1L 2YGNA 3CVHA 4TUOB 3HNVL 1DVTA 1W0VB 2YPLA 2EE0A 3OR6A 3O3EA 2QZ5A 2XXGA 3PXJA 3RVWC 3MA9L 5FUCC 1YC8A 4AQ8A 1AD9B 2CUHA 3T0EB 1OCCB 4XXDA 3RX9A 3KLKA 3WTWA 5I1DA 4X0KB 5E0FA 3S5LG 2V7NA 2J7LA 1KGJA 4R7LA 3FOLA 1TVBA 3ZTEA 3HUJB 3SDXA 4ZFGH 2RCSH 5A7EA 3QORD 3FRUB 1ODAA 1JCVA 2KS0A 4M1GL 3S96B 2ZUQC 3QCTL 3L2MA 4PP2B 4FYRA 2XC8A 1ZDSA 2VYRE 2WUCH 2XZZA 3QUXB 2KZWA 5I71C 2KZKA 2V9UA 4HWBA 4S1DC 5BZDA 2K4WA 2XI9A 4FG6D 4PS4H 4QXUH 3X12B 5LXGH 2JKSA 2H2PC 2OS7A 2Y5TA 3RIAK 4GRLD 5CLXA 5FKAA 2X38A 1QSZA 3AXHA 3WGUB 4HGKC 1NBYA 4HIEA 3MXVL 3QIUA 3MRLA 4R7NA 3HS0C 4LPUA 2G5BA 3NIFB 1AIFA 2XN9E 4MA7H 2VLRD 1ZWIA 4P57A 3HZMA 5GSVA 4N0UE 2X53A 4AQ8C 1H5BB 2EECA 1G9MC 1B3IA 3U0WL 3WTSA 5E6SB 3RY4A 4DCQB 4XNXL 3QUZB 1IEBB 3W3BA 1RSYA 4HWUA 1PY0A 4MQ7B 4JG0L 4PV8B 5CUSH 2CBTA 2ATAA 4IEFB 1EDHA 3B9KD 3MLXL 4UT6H 4EDXB 3KYOB 3NAAL 4PGCB 1ZTXL 3LNDA 1CZ8L 1KTDA 1COBA 1T7XA 1BQ5A 4DFHA 2OSLB 4CMHC 4E9YA 4OI8A 1T4KA 3ZZLA 4FHKA 1CGUA 1F6AA 3BP4A 3HZVB 4W6YB 3EF4A 2DLIA 1F3DH 1DANU 2LU3A 4QD2E 2D9CA 2NTSP 3MGOB 3FU3A 2PWDA 3M1BB 1DBJL 1PZAA 1XGRB 2EIKB 5BV7C 1K8DB 3IU3A 4OJFH 3TJEL 3QYNA 5ERWA 1JFQL 3TO4B 1I3GL 1INQA 1OGSA 1SJEA 1WCBB 1ZJAA 3HW7A 3ZVVA 2RFXB 5FDWA 1ED3A 4L1LA 4QTIL 2N56A 2XWTB 4F20A 1FL6A 3GINA 2EVIA 3SCMD 2CK2A 4Q4EA 4HIIB 3TZVA 1NSNL 4JY6B 3NYKA 2IJ0C 2D31B 5IQLA 2Q8AL 2MOQA 3T08A 1MJ7L 5JIQA 3C6EA 4ONFH 3Q8CA 4IRZL 1OTTD 1RZ7H 3JTSA 1TLMA 3RL1B 3CFCH 2JWYA 1L5GA 3GHPA 5LCVH 1DQMH 4XGZB 4IBTA 2HRPL 3MMEA 4YHKL 4TL4A 3BZ5A 1JV5A 2FX9H 3WHE0 1MCJA 1UCBL 3LRGA 2BSEA 4JJ5A 4GIAA 1ZPLA 3C6LD 4LVOB 1NDTA 5JMOC 1IAOB 2I26N 3CSFA 4FNSA 4KXCA 2Z31D 1TVDA 2VR6A 2VR3A 3DHPA 4WNJA 1ZEAL 3BZ4A 1CTMA 3EFOB 4NQDA 5ALCH 4KH2A 2AXGA 4YWGL 3RGHA 5AKTA 4NAQA 1SDDA 4TSCH 1NOLA 1KCKA 1TYRA 2EKSB 2F53E 2FWOB 1YA5A 2GUOB 3FN3A 4KZCA 4MX7B 3ATDA 2XZAL 3KMDA 3GD1C 3TZVC 3EH1A 2IAMD 1XX9C 4F27A 1AZZC 2ODHA 1VESA 2MEJB 2D4DA 4BQBA 1F45A 2GIMA 4GRMB 5F88B 2WO2B 1O6SB 5KS9A 3DBXA 2I5YH 3U7YL 4RAVB 3PFUA 5JHDA 3HVDA 1N68A 2FEDC 1NGQL 5ES4B 3K0YA 1A8ZA 5DA4A 4WY7L 1Z3RA 2XKUA 5CN3A 2CRIA 3KW7A 1S7TB 2CU9A 4X9GA 5IMKA 5A2JH 5JW4Q 3TNMB 5AYUH 1D9KB 3ARQA 4MNGA 2BINA 5HYJE 2XUWA 2VQ1A 2FSDA 4JM2B 4AJ0A 1Z9LA 2KUTA 2G2PA 3QG6A 2H6PB 2BIQA 2AERT 1AR1B 4YAQB 5E5LA 2EDEA 3P4OB 1KXTA 4JZJA 4NP4L 4YDIH 5FGSA 3Q5TA 5GIRB 2VXTL 2EABA 1Q9LB 5C0NC 3QHFH 3KJ4C 3IDMB 4QHLA 2A73B 3WKMH 1JVLA 4OZ4B 4CVXB 4MCMA 1UA6H 5DMIH 2IADB 3EGXA 1K4DA 2AEIT 5FYJU 2FK9A 1V10A 2WWMD 4KO5A 1CDCA 1NC2D 3NCBB 4PWIA 2F7PA 1TTCA 3CFEB 2X2IA 3NIGF 1QBMH 1B0GB 5CR1A 5LGHL 4UIMB 1F4XL 4RRPA 4LL1A 3OKNB 3B7TA 3KPMA 2XBDA 2HYMA 5IR1B 1QFUH 1TTGA 2PYED 2Q86A 4J3OF 3GXPA 4H7VA 3I84A 4F7EA 4E41E 3QDMA 1OCWL 2AP2A 1I75A 2CO7B 3V0WL 3G04A 4MQSB 2BCMA 3L2NA 2EQDA 3B5TA 3L3KB 4L4TA 4UIKH 4RQQA 4TLUA 5AW5B 1YMHA 4XMUA 3BVXA 5FO7A 3L1OH 1HNFA 3SPVB 4JZJC 1V3JA 3WSQH 4EBQL 1PX8A 4PGEB 4ZS7H 4WU7B 4PRHD 4LEOA 4DN4L 1J8RA 1ORSB 3UTTB 4JY4B 1MOEA 2W5PA 4KTGA 3JTTB 2DQJH 4PLJC 1W8EA 3BWAA 4BFOA 1YZZA 4P04A 1V3MA 2B4CC 3MUJA 1AGDB 4HUXB 3BSZA 1ZIBA 4XP4L 3R7RA 3BYTA 1U3ZA 1V55B 5HJDA 3ZX1A 1NFDA 3TT1H 1QSVA 3WLWD 3WL9B 4IOFC 5GGVL 1EZVY 3SQBB 1AQ8A 5KZCD 2NXYD 2YUXA 4P4KA 3VXME 1BX2B 2VLLB 1EBPA 1FYTE 3U2JA 2NY4C 1OQXA 1TSRA 4Q52A 2YD7A 2FEJA 4XVSL 3PV7A 3W11D 2X1PA 3MRIB 5MHSD 3MLYL 4RSVA 3K6DA 4YZFF 3IF1B 5C3IA 2WTRA 1LO3H 4ZX5A 4HKZA 3U1PA 5AYTA 4WUKH 4HS6B 1XH3A 2EH7H 3BO8B 3LH2H 2Q7AA 1BECA 1M2VA 1TQVA 1TYEB 4I13B 4XC1H 3OG4B 1T0OA 3R06B 4LPTA 3HNVH 4TS6A 3IKKA 4BH8A 4ELME 4Z77A 1S4IA 1GL4B 1S7UB 3O81A 4XNZB 5BJTA 5CCJA 3MA9H 2YEQA 2X1XR 2GHWB 3QZPA 4P8QA 5JHLA 4QAMB 1F3JB 2VDPB 4N9OB 4HPYL 2Y25A 3C5XA 5D6CA 1MNNA 2ZONA 1B4TA 1GKOA 3Q2WA 3KPSD 1SJXA 4QRPD 1XEUA 1AFVL 3FYIB 1J9SA 5IQMA 3VI3A 4KQ4L 3IDJB 5JOPE 2YBGA 3HBQA 3QJRB 4M1GH 4BKLB 2I27N 5GGUB 4P4KC 3QCTH 3AXLB 1E43A 2JJWA 4N2AA 1PGRB 3LEXA 1KB5B 4Q0XL 4YO0B 4H8WL 1NINA 2O72A 5DC4B 4AQOA 4HLEA 1HOCB 3ZE2B 1BQHG 4JRLA 3N40P 4QKTA 1RQ5A 2YR3A 2QQKL 3BUPA 3R18A 2OL3B 3RPIA 4EKJA 2LVEA 1MCFA 3FUIA 4AJYV 4HXBL 3GSNA 4K8RD 1A0QL 3T3MB 1FWXA 4J3UA 5D6DA 3L4UA 3MXVH 1MWAB 2O6PA 1N67A 3H1ZA 2NY6C 3BUDA 1K72A 4MNHA 1JHLL 4MB1A 4N2BA 1ZHNA 2WO3B 3NP4A 5A40E 1SJVA 1L9TA 3FO2B 4Z6AT 3U0WH 2IBBA 2CPUA 3KCPA 5I6KA 1CDJA 3QXUA 5E2WL 4XNXH 2BHYA 2P43B 2AQNA 5FW8A 5CEYA 4IW4C 3C8KA 3QFJE 4JG0H 4WHDA 2J12B 3KDMA 4LSTH 3MLXH 1AGCB 5IWLA 4WI6A 5L2JB 5CWSA 3NSXA 5E1GA 2EVFA 3NAAH 1BD2D 2NUPB 1ZTXH 4X7TB 3WTTA 5IJKC 1QSEA 4OIBA 2I9TA 3LQAL 4X6DA 3T0WA 4LHQB 1NIDA 4B9FA 2J8UF 4ANVA 2CK0L 4P5KA 3WN6A 3BPNB 5INDB 2H5UA 1F4YL 1NCAH 2JI2A 2K1MA 4MAYD 1DBJH 4PRPA 1AC0A 3MX0B 3TJEH 4GO9A 5DZ9A 2GBTA 3QQ9C 3X11B 1JFQH 4H4NA 1I3GH 1E0OB 2VN3A 1WRFA 3QR2A 4Y4FD 3VDCA 1MFVA 1RJYA 2C5DC 1QW8A 4QTIH 4PV9B 3O45A 3MUGA 3PV6B 3W39A 5C0DB 4Q9RL 4GQQA 1GGBL 1A7OL 1NSNH 2OTWA 4V1DE 3HZYB 3PWNB 3BEWA 1MJ7H 3DX6B 1QAWA 2B1HL 3FUKA 4IRZH 5CJOL 4JZNA 4PY7A 1P4IL 4XOEA 4BE6A 1MKFA 2XKNB 1R34A 3FQYA 4IK7A 3OTTA 3QJXA 3QJQB 3CZJA 5DD3L 1EO5A 3HLAB 2HRPH 4YHKH 1OF2B 4OZGB 1UCBH 3JWOL 5IWLC 3H6AA 4C56B 5D5MB 4ZO6A 1UEMA 1IL1A 3WHE1 1QSFB 3DX0A 3KGRA 1K5NA 4IOIB 2VDNL 3CH1A 3O0LA 3Q43A 2J1WA 1ZEAH 4X4ZA 4EI5D 2QADC 3L5WA 4LGRB 4WGVB 3GTTA 4YWGH 1Z9NA 3BVTA 3UGUA 2BCKB 4OV5A 2LHAA 3DBSA 5LKNA 2J25A 3V0GA 5DS1A 5F7DB 1KIQA 3F05A 5ESVA 3P0YL 5ECJE 4TVUA 2K0RA 4R0LA 2XZAH 4H44C 5EOCL 3POHA 2A77L 5TH2B 4ZMPA 2NY5C 3TT3L 4LPVA 1D5XA 1H19A 3IYLW 5DJ2B 3WIIH 1IGFL 3VACA 4M5YL 3HG1B 1E5CA 1P7QD 2OCJA 2CHWA 2A6DB 3FT3A 4FI8A 3U7YH 4RSYA 3H9ZA 4X4XA 1NGQH 2HJFA 2QVIA 1F6LL 2GC7C 4WY7H 5F1OB 2F7QA 3LXUX 5KJRL 1RJCA 2DQ6A 4JB9L 1VRSA 3HHRB 1R1CA 3CPLB 1AD0B 2EH8L 2ZAIA 1WICA 4XCCL 1GCYA 3SDCD 1NWPA 3CSTA 5IJDC 4HZAA 1U8HB 3T3PE 4JR9L 2CO2A 4CU7A 5E51A 5JUEL 5EU7C 5DWPA 3LKNB 4YE4L 1ACXA 3MROA 2F7IA 4NP4H 5IVXB 2VXTH 1XMEB 1CDGA 1IGTA 3FRPB 3LQZA 4N6RA 4GT7A 1K6QH 4X2UA 2OXGA 4MLSA 1X9QA 1W72A 4FP8L 3TFKD 2NY3D 4PP1C 3TU6A 2P5WE 5J13B 1WGOA 3VXSB 5I6XC 4OIIL 2Z35A 4P2RE 2HG5B 5JXED 4Z0XA 1DLHB 2AW2A 3JZ7A 3MN8A 4R0LC 4QO1A 1E3FA 4KRNA 1WZAA 2B7DT 4FERA 1T7YA 1HESA 1A3LL 2X0VA 3TC9A 4IBQA 2X10A 4P5TA 2EXSA 5KW9L 5SV3A 4A37A 1HXMB 4JLRA 5DRXA 1KT2B 2ZXQA 1FAIH 2E46A 3AAZB 4TPRL 5DCCA 1FHGA 5FYKD 1T04A 2CAKA 3OGOE 3PAZA 1U6AL 2C7FA 2VZOA 1ZTMA 2CDFA 5B1AB 3T09A 3R1GL 3V4VB 4OJEH 1OCWH 4DP0X 3VFGL 1SQ2N 5C0BA 3V0WH 4P06A 1T7ZA 4YE0A 3TBWA 1G7MB 5CKGA 2G9HA 1YNKH 3MUZ1 4MD4A 4HOZA 2WNGA 1BBDL 5H37A 3MKGA 3NZHH 5CEZD 4EBQH 3VXPB 4DN4H 5B8CB 5BZWA 4ETQA 2WZ5A 4HJSA 2HMIC 5B38B 2ALAA 2H7WA 2FHFA 4G8EA 1G6RA 3WD5L 3DRQA 5M7QA 3VD9A 1BLIA 2JVUA 3DYOA 1E65A 2A7BA 1D6EA 2MWCA 4XP4H 3DOSB 4B53A 2IWFA 1H6TA 3B7UX 2X2JA 2HN7B 3V79C 1DBBL 3V5HA 4P5TC 3NCJH 2K8MA 4MQTB 3ZQWA 2EACA 4XNMB 4N0FA 2QGEA 3INOA 4LHUG 4FYTA 4X4ME 2XG5A 4UQ2A 1BYPA 4APQA 4UAHA 5GGVH 1WEJL 4L0PB 3CN1A 3KXFA 5T1LD 1Z32X 2NY2B 2JI3A 2GJZA 1PLGL 4ZO8A 3CLEH 4XVSH 2HKHH 3VFUB 5C7XL 1IZJA 2PW1B 5EEZA 4KITB 4FQ1L 4YVNA 2P8MB 3MLYH 1SLVA 3CC5A 3H9SB 4NQCD 4W9EC 2RALA 4PCYA 4PN6A 4GG6A 5DVKA 1J05A 1U8OB 1X5AA 3U48A 3SYCA 3S3JA 3QR1A 1HI6B 2FX8L 3QXVA 4LESA 2NX5A 4PAZA 5E99L 4RGND 1YMMD 2ZF9A 4TNWK 1Q38A 1CFNA 3BAXA 3UBXB 2GJ6E 1Q94A 3IJHA 4ZXBB 2ZAGA 4PJDA 5DF0A 2G75B 4IKKA 2H47C 1V5JA 1H15B 2BK8A 4PJ5B 3BQUD 5D8JL 5ILTL 4HPYH 5MERB 2DWDB 3H3PL 2EDMA 1FIGL 4CKVX 2WNKA 3BH8B 4L4JA 1GY1A 1KY7A 4KROB 2MMXA 1AFVH 4KQ4H 3D69A 4DO4A 5CF3A 5EEYA 4APQC 1XSOA 5IG7B 3PQYE 4CJ0A 4G1MA 4G6FB 1FV1A 4KKAC 1U8NB 4L1TA 4Q0XH 1JZ7A 4H8WH 2P46B 5CBAB 5DZLA 3QNXB 4PBWD 1ZS8A 3CHPA 3HBZA 4WWKD 1GW0A 1LTXA 4NPYB 4OGAD 1BYNA 2QQKH 3N44B 4ILDA 5IESH 5LXVA 1PG7X 3MLVH 3OKOB 3DETC 2VDQL 3DGGA 1FJ1A 5TDPA 4HXBH 1A0QH 3G6JB 1WZ1L 5DK0B 2YC1B 4HIHA 5GISL 3BC9A 4MMXA 2Q6WA 3RKPA 2YIHA 1JHLH 2AQ2A 3AREA 1LO5A 4NRYA 4TUJA 3BIKB 4W4NA 2AV7A 3B6SA 2O5ZL 5F6IB 3UEZA 4N24A 5HI4C 3OKYA 4OKVB 2XBZA 1EGJL 4G59C 5E2WH 1MG2C 5DDHB 1KYUA 3O3AA 2OX5A 2EJ1A 1INDL 3MCG1 4AJWA 2D3LA 4Z7WA 4J28A 4Y19A 2ZOTA 4L3EA 4XPFL 3SE9L 2E86A 2J8OA 3P3TA 1CI3M 4UOJA 3LQAH 5AVYB 3ILPB 4CNIA 4WUUB 2CK0H 2B3IA 1T7VA 5I1CL 5CJXA 3BUTA 4NQVA 3W2DL 1JGDB 1F4YH 4UT6A 3F5WA 2GT9B 5IJVA 4UF7C 5EMYA 2R8SL 4M6ML 1ZA3A 3QEQB 1E27B 4JFED 1EXGA 1FO0L 3K91A 1YEDB 3VRJA 3W37A 2BIHA 4MMXC 3QNFA 5CS7A 4OCRL 2NZ1A 2X4UA 3NJMA 4OB5L 3L95B 5AZEL 2XWJA 1I82A 3WU1A 3N06B 1GGBH 1A7OH 2YQ2A 5H2BA 4PBVC 5IZ7A 3T6VA 3I75A 2B1HH 2XA3A 3U46A 3NIGE 3L9BA 5CJOH 4BA8A 3O3BA 4LU5L 2DYSB 1P4IH 3OLDA 3H53A 2VUOA 1T5WB 3FQRB 5I5JA 3FN0L 1PAZA 5DD3H 2BVTA 1XF2A 4LDEB 1QTYT 1T20A 1WAEA 3F04A 4GMSL 1OAZL 3JWOH 3CIAA 4PJEB 3ZO0A 1RPKA 5DR5L 2K7PA 4JFWA 5BRQA 5IFJB 2C9PA 3LD8C 2VDNH 4U1LB 1TZHA 1Z9OA 2VXVL 2W81C 5CJXC 4YEFA 1REIA 3OGCB 4I9WD 4C57C 5IBUB 2J6EL 2V2TA 5KYXA 2CG9X 2X7LA 1WWBX 3SODB 3AS2A 3RGBA 3AT0A 4N2HA 6PCYA 4AE0A 5HHQA 3F65A 1SPDA 3BD5A 2H32H 2O5XL 2I07A 3P0YH 5LWYL 2J8HA 4MD0A 4JRXA 2X6CA 3DXAA 3KL5A 1FVCB 3FPYA 3OKEA 3TT3H 2R4RL 3WIFA 4TVPD 4AXWA 4MJJA 1IGFH 1YNTF 1T0NB 1IAII 4M5YH 1I8MB 1TDQA 2VOTA 3NZ8B 3EYVA 4WF7A 2BVOA 1MAKA 5I82A 3SPGA 2Y4SA 3DDGA 2AVGA 3FCTB 4NWTL 4XBPB 3MRJA 3CWGA 2WZAA 5KJRH 4JB9H 4FQCL 2RBLA 1O75A 1CLYL 4DGIL 2YD8A 2EH8H 1UM5L 2W07A 4P23A 1YO4A 2F54D 4XCCH 5TDNA 5AKSA 3S37L 4JR9H 4YZFE 3OXSA 2J2ZA 3BH9A 1TQSA 4G7VL 2PABA 3MLWL 4JDEB 4JCMA 2BVQA 5IQ9A 4A68A 4K5MA 2DS4A 3RNQB 4Z8FL 4FP8H 3UAJA 3QQNA 5HI3D 1D7DA 1IBBA 1DTUA 1LO2L 3IJEA 3KPLB 3L9EA 4NB7A 4OIIH 5KVGL 1ZS2A 5ADPL 3RTQB 1MLBA 2D2OA 4DZ8B 3ZDXB 1S9KC 3MRBB 2AXFA 5C1MB 1A3LH 3FCBA 2QQQA 5KW9H 1CFQB 4CDGC 4PJIA 1ZIAA 1NGYB 4KKBC 3KPPA 3SGEH 2Y2YA 1PAMA 5BRZB 3ULUH 3FB5A 5C0FA 1GHFL 4TPRH 4U3HA 1EUUA 5DC9B 3WKYA 1AZBA 1U6AH 2WYHA 4QRFA 3ZTDC 2R1YB 4N5EC 1KOAA 3R1GH 4EN3A 2F15A 1OD9A 3VFGH 3L5IA 5C0GA 2DJSA 4K55A 3MBED 1JTPA 3IDXL 1HN1A 1TR7A 3UXFA 4D3CL 1T1YB 1M05B 3MLZL 1BBDH 5T1JA 4IRJB 4S0SD 1MI5A 4AW7A 2W91A 3V0VA 2K3HA 3KBFA 4YHZL 4ZDHB 2KC0A 4MWFA 2COVD 1J0HA 1U8QB 1DJYA 5CGYC 3FBKA 3MREB 3REVA 4ZX4A 3WD5H 1XQ4A 2XX1A 2IPKB 3PHOA 1U36A 2HTKC 2PP8A 1MCOL 3UDWA 5I15L 1W8NA 1ZLUK 4N1CA 1UWYA 1XD1A 3L3IB 3U2SB 3QIBA 3U36B 3VMPA 5SX4H 1DBBH 5ACZB 4BXVA 4LNRB 4DPRA 3MRFA 4JE4B 1BG1A 2WO4A 2ZPKL 3MLPA 3L1GA 1SY6L 4GOSA 2DWXA 4H8PA 4ZPVB 5DC2A 4MJ4A 5J9PA 5EU6D 1WEJH 3D05A 1N64H 5HVFB 4G7YL 2YZ1A 3UGEA 4D94A 1ZLUH 3H42L 3SBPA 4A2GA 1SVCP 4EN3C 2J8UE 4XNQB 4LXFA 2LW3A 1S46A 4BCXA 4NSKA 5C7XH 4X6CF 4FQ1H 1PG7W 2BP0A 3S2AA 2VLRE 4X5QA 1UADC 4DUVA 3S36L 5CD5D 1YEGL 1HX0A 1I53A 4R7DA 1MJ8H 2MFNA 3TVMD 1KACB 2VE6A 1A02N 4GLRI 2UWEB 4O2FA 2FX8H 3KWWB 3P11H 2BO0A 2DTML 1ZA6B 1WWCA 1TJMA 2OMZA 3L3GB 4C4KO 3O2VL 3QIBC 5GGVY 2X6AA 5ILTH 4QRRB 5D8JH 3H3PH 1QA9A 1FIGH 1EQWA 2VL5B 3HA0A 3DYMA 5BO0D 1A4JA 5B39G 2OSWA 3ABGA 2WOBA 1OE2A 5JPNB 3C5SB 1NWOA 2JKXA 3VMOA 3LKPB 5JPMA 4OZHF 1SYSA 1T4WA 2VC2B 2XACC 3UTZA 2G60L 4DT2A 4U1MB 4R4BA 2HT4D 4QLRA 5FA3B 2X05A 5DZVA 4QXGL 5F9WB 1T7WA 4KKQA 3LN4B 3CBKB 2ZD0A 1QRKA 2VDQH 5I0DA 4ANWA 3PWPA 1WZ1H 5MENB 5GISH 2CDEB 1J0IA 3G5WA 5EV7A 2IBZY 3TIEA 1EUTA 4YSTA 4LVEA 3FTYA 1EA9C 1E9PB 1FNGB 2BWIA 5HD8C 4NQQA 4B50A 3VFOA 4KOBA 2O5ZH 2LR4A 4HISA 1EGJH 1A1OA 3GO1L 3S8FB 4LFHG 2GI7A 4LCUA 4OZFH 4PWEA 5LDUA 4Y5VB 1H8OA 1INDH 1T0MB 2XYCA 2ZXCA 3WNIA 1T22B 2XJLA 3BXNB 4X8GA 3SKMB 2H8PB 4F8LA 1CLCA 3G5YB 3QWOB 2CHNA 2EDJA 4N9GB 4XPFH 5CGMA 3SE9H 4OH2A 5JPMC 2XPYA 4E36A 3O41B 2YEVB 3DVIA 5CLZA 1II4E 3SY6A 3VYOA 4HEME 4YLCA 3E9UA 1SMAA 4JO3L 5I1CH 1JBJA 2R23A 3W2DH 1XGQA 2AHIA 2W94A 1DBAH 2X2UA 5DHMC 1JE6A 2WSKA 4M6MH 1FCCA 4UILL 1U8MB 2EKJA 4XN9A 5K1VA 4M62L 1KG0B 2H2PD 4IBYA 4OCRH 1PF3A 5FYJL 3W9EA 1TVHB 4OB5H 3H3BC 1FIEA 4U1IA 1LE9A 2EVJA 5AZEH 3U4AA 4PWKA 2BP5M 2R15A 3I02B 4MZIA 5E9DD 3ZR6A 1RUPL 4Z76B 3BP5A 5FYKU 2NY2C 3LEYL 2Q7NA 3QUMB 2YPLD 4LU5H 4OF8A 5I75B 1AC6A 1JGEB 1FGNL 3QZMA 1DJWA 2I32A 3FN0H 2ZF8A 3UO1L 4F33A 2IXQB 2Y1VA 2OK0L 3SQOH 2XN9B 2QTVA 1F56A 1SVBA 2BMKA 1MFBL 3QZWG 1UHVA 5ETUB 1OAZH 4N0UB 2CO1A 4JFQA 1NDMA 5DR5H 2B15A 3TYFB 1KLGB 1NMBL 4YR6B 4F9LC 2E59A 3UL4A 4E68A 4MD5A 2VXVH 4GBXA 5EWIL 3RY5A 3NABL 4R97B 1EHLL 1MWOA 3IFLL 4HIJB 1SF5A 4JPQA 2J6EH 2WQRA 5FECA 4Y4HD 2A0LD 1XDTT 2BNUA 4QRSA 1GVIA 2X4PA 3P2TA 1EJ8A 3OKLA 2DQDL 2HLFD 2O5XH 5LWYH 3ZTNL 4HWEL 4MZRA 2ROYA 2ZOKA 2A74A 3RHWF 3ET9F 3QPKA 2VDRL 2LE9A 2R4RH 4X98B 5IMOA 3QIUD 2PYEE 4KHXL 4Z78A 1LD9B 4FJZA 5C09A 4HFWA 1RZGB 4TNEA 4WW2F 2VSMB 1E3XA 4QR7A 3VYNA 3K6SB 4Z7VA 3NPZB 4G9DB 1FLRL 5CLYA 2HTLC 4NWTH 1SYVB 4J4PC 4FNUA 4IIQB 1DVXA 3DI3B 4ZMZA 5EFIB 3TCLA 4FQCH 2PPEA 3QAZB 1CLYH 1W16A 4DGIH 3KPNA 2Z0BA 4J2QA 1TTAA 1UM5H 3HE7A 3DJZA 3G3LA 4NYLB 4G71B 2GB2A 1S5HA 2OR7A 3FO9B 4PRHE 3S37H 5E1AA 1SVZA 4NKOA 4QCIB 4G7VH 1H3XA 3MLWH 4TV3A 3FFDB 3ATFA 3S5YA 5KBPA 2NDGA 1BVLA 4FXGB 4XVJL 1HWWA 5HHNA 4HBCL 1A64A 1P69B 4HS8L 4PSRA 3FT2A 4N26A 2E8ZA 4K73A 3APFA 1LO2H 5KVGH 1SN2A 5ADPH 4OJDH 1IBHA 2BSRA 4WDIA 3RWGA 5HI5C 2A74C 1F1DA 1OP4A 4YSPA 4UWQB 1AYRA 5H35B 5E8PA 5KSVA 1L0XA 1X5MA 2VXQL 1GZHA 4OFQA 1GHFH 1KBPA 4R7VA 1K4CB 3LPPA 5J57B 5MHSE 4CDHA 1QR4A 1OAJA 2OMUB 4JFUA 1FFQA 2GI0A 4P2OD 1JGUL 2Z1PA 3P4NB 3T2QA 3HE7C 2FEDD 2XQYK 2ZKXA 4AX3A 1J48A 2C3VA 5JIMA 4D3CH 3MLZH 4QRTA 4M02A 1CDUA 1YN7A 5IOPA 3HAEG 1AGEA 1R3JB 3L3JB 4RETB 4BQCA 1FLTX 2JFCA 1I8KA 3CCHA 4QIRA 4UNTA 4YHZH 1KPRA 4AK2A 3MZGB 4NQDD 1ML0A 1PX3A 3B2PA 1MCOH 5HYJB 2ZUYA 3KPSE 5I15H 4QRPE 4HKBB 1DZ0A 3U30B 1TCMA 4YIQB 4J2XA 1M7IB 3QSKB 1A6WL 4BK8A 3FHAA 2E9GA 4MB5A 1XR8A 2ZPKH 2DYPB 2EYTB 3APMA 4XHJC 5E6IA 5G4NA 1SY6H 2DOCA 2JI1A 3SE4A 1GZHC 1XIWB 4JDVA 4DTGL 3LDBC 1R4XA 4XMVA 2HX8A 3RG1C 2AJ3B 4R4FL 2SEBB 4X4YA 2UV3A 4DJMA 3F12A 3H42H 2MCG1 3OHXB 1Z5HA 2R83A 1WT5A 5I1AB 5JHDD 4I77L 1RULL 3KYNA 4RZCB 1X5XA 3V0AC 3ARRA 1IBZA 2BW5A 4I4WB 3EDJA 3S36H 1PU0A 5INCB 2R59A 1YEGH 5FW6A 3LKQB 1Q90A 3MACL 2Q8BH 4LSSL 3MRPA 1C08A 3QXTA 4JRYB 4FG0A 2FLRT 4Z5RB 3CVDA 2ICES 3ES6B 1T03L 4E41B 3VGBA 1KYFA 2ED8A 3KS0J 3QA3B 2DTMH 1E7UA 2X44D 3LRLA 2N0KA 2WY3B 1J8HB 1IILE 3PDOA 3O2VH 1XFPA 5T3ZE 4PLJD 4WO0A 1XVSA 5IP4A 1BD2E 1BP3B 3SE4C 4F3FB 5E94B 2YSTA 3QDJE 3VD5A 2MCAA 3UPCA 1DZBA 5I0WA 4JANA 5FF6B 2OI9C 1BFSA 3C12A 1FO0B 1KYDA 4ZMOA 4LSVL 5ACLA 3MV8A 2G60H 3UYPB 1HEZA 3VJ6A 1YN6A 2FH8A 4QXGH 5CEXB 2D7QA 4FQXA 3QJHB 3T4YB 2X4RB 4GW1B 1DUZB 4XVUC 4MA3B 1OD7A 4TNGA 3QDMD 2NY4D 4IRSC 7CGTA 3FOMB 3RNKB 3WELA 2W60A 2CLRB 2WSDA 1I8IB 4HT1L 4U6YB 5EU4B 1UB6B 1IC5H 1RUAL 4L4TD 3WHXB 3WI9A 2Z7UA 4B9IA 3JWDL 4TXVB 1JPFB 1FYTB 2Q2LA 3P9LB 3EXLA 3U4KA 3D85B 3TCXA 4ZSOA 2BS71 3CZUB 3OSVA 4HJIA 4DGWC 2Z91A 4QNPF 2Q9OA 5J6HB 1HDMB 1S9YA 2ZWNA 3GO1H 1FL3A 3T65A 1RZ8B 4FTVA 5MEQB 2BSSB 2FJFA 2XLLA 5JO5A 1RZIB 4KKRA 1MUJB 3DGDA 3J2PA 5EUOF 5K39B 3QULA 3MA7A 4PG2A 3ROLB 3CTTA 4L1SA 2RMNA 4U3SA 5GJTL 1A4KA 4BINA 1KXQA 4DFIA 4DKFL 3HI5L 3SGJA 4B9KC 1M7DA 3ARBC 4BM7A 2B2XH 3INUL 4XWGL 4JO3H 1HAUA 2MOVA 5DYOB 3T8XA 4FQXC 5JNYA 1S9XA 4P4KD 2KDGA 3BW9A 3JSSA 4AVHA 3ML8A 4HK0B 4NO0B 4NRZB 1WTGT 2QLYA 1AY1L 4H8WC 4UILH 3QWNA 3SPHA 5JTWA 4Q2ZA 5HYIA 4M62H 1FZJA 1T5KA 1CCZA 1XH0A 5FYJH 5IFHH 2X6UA 4HFUL 4Z7OF 1OVZA 3ROOB 1G9HA 1Y6NR 5AW8B 3JVFC 3FN9A 3LRKA 1RUPH 2X41A 3O4OC 4JKMA 1A7QL 2V8MA 2YUWA 3A21A 2ZE0A 3LEYH 4RH4A 2W0LA 5K9KA 1NCDL 2WLNA 1CT8A 4R6UA 1FGNH 4EPSA 4AC2A 2V3EA 2ICEA 5DFWH 2WKLA 2OK0H 3UO1H 4LCCA 4YFDB 5DHYB 5I6PA 4PG2C 4MA8L 1TQBC 4ZOCA 1MFBH 3G9AB 3H0TB 2V5YA 4NBYB 1HHKA 1DLFL 2ADJA 4NZTL 4YJZL 1NMBH 1SJHB 3GEFA 4I1PA 3RWEA 2J1XA 3QXAB 43C9B 4Y1AB 3Q3GB 4OZIB 3MRDB 2QFPA 1IBFA 3K6FA 5EWIH 4M7KL 1X5HA 3NABH 1EHLH 3QQ3B 4Y2DA 2MCPL 2XFXB 5EBMA 5K33A 1FFRA 4LVNC 4RA0C 5C0CA 2VDPH 4Z3JA 3LQAC 2H45A 4LOFA 1EXUB 1A6ZA 3RRQA 4NDMA 1XGPA 4UV4L 1R24B 3ZGHA 2DQDH 2A6KB 3ZTNH 2CO6A 4HWEH 2EVGA 1J8SA 1CICA 5AG8A 2HFTA 2IANB 1OTSC 2VDRH 3AG1B 3CLWA 3RZWA 4Y8DC 3V7AE 1G9NL 4BFEA 3BFOA 3QQ9D 5FYKE 1WUNT 3IJSA 4KHXH 1TJXA 3NTCL 5TD4A 4BHUA 5C8JB 1NGWA 2H32A 3X1EA 1WS8A 1Y18A 1O5PA 1FLRH 4NUQA 5C0JB 1XGTB 1IEHA 1BCIA 3SDXF 4A7VA 3PXLA 4A7TA 4L29B 2WLZA 6TAAA 2AFNA 1FFTB 2FHBA 2VAAB 4P49A 1DQDL 4DEPC 5CEZE 1FBIL 4JFPA 1WAAF 4X6CE 3D3VB 4BZ2L 3AT9A 2A83B 2QMKA 4NHUA 2Z8RA 2FO4B 3A67L 5E4EB 1EEYA 1CLVA 4Y2DC 4AUUA 4XVJH 1QSED 4MSWA 1MSPA 3JVGC 3QNYA 4MS8C 4HBCH 3LN9A 4DW2L 3BVVA 4ZUTA 2Y2TA 2HFEB 4JZOA 3N40F 5D1ZA 1VFAB 1T3FB 1P7BA 2QADD 4Y5VC 5J4MA 2EDTA 1WBZB 1KGYE 2R1XA 2IPUK 1CICC 5L4IA 4PRPD 1HVXA 3L3DA 4JKWA 4H0IA 1KZYA 3ZY7A 1J7VR 3SB3A 3PHQA 2G0LA 1PZ2A 5JYMA 2VXQH 2W59A 1C12B 3QVAA 1LP9A 3VD1A 1CG9A 2DBJA 1AQMA 2BHUA 3LPWA 2WLHA 4RMUA 3VFNB 5EH1A 2NSQA 4OSUL 4YSOA 4OZHE 5E00B 5HJ3B 3QJOA 2WGNB 4NJ9L 4LSRL 3WNNA 4HLJA 2C3WA 1JGUH 4NQCE 4UT9L 5D1QA 3OX8A 3HG2A 3FONA 2G5UA 5IEKA 3IDGA 4QF1A 1OOAA 4GAGH 4GAJL 7TAAA 5IHBA 1B4LA 1Y6MR 4UTBL 4TLKA 2CJTA 1C5DB 1IRAY 3DV4A 4RGNE 2IFFL 3LPFA 1YMME 1XR9A 4GO6B 4OF6A 3RJOA 3RDTA 3H3KA 4L8DA 5F1IA 3CDCA 1M7UA 2AV1A 1CD8A 2PCFA 2FUQA 1VZHA 2VDLL 5D1ZC 2Q3ZA 4MDRA 5DD1L 2C7UA 3RWJA 3US1A 2BOCA 1C16B 4PGBA 4KMTL 2FSEA 2FDBP 4PP1D 4J3OH 4U7SA 3WTVA 1N26A 1SBSL 4LDCA 1A6WH 3HE6B 5E5MB 4E9XA 4M6AA 1ZHLA 1OB1A 4Z95L 2ITDA 2VIRB 3ZKMD 2IOIA 4DTGH 1G7PB 5D2NB 1KN2L 3VFRB 1IQDA 4P2RB 4CA4A 4L9LB 3NACL 3BLKA 4B41A 4LCWD 5D1QC 5DS8B 3BPOB 3B2DC 4LKXA 2NQ3A 5B3NA 2B14A 4I77H 3IN0A 3CMGA 1OM3H 3V6ZA 3S3SA 3JXAA 2P3YA 2YMOA 4KV5F 3U9PL 5ISZB 5B1CA 1DN0B 1QOKA 5DFAA 3UGXA 5EC2B 4HX1B 3MACH 4LSSH 4R4NC 2CUMA 3MLSL 3BHBB 2LLNA 1K9TA 2EDOA 4W6WB 5C07A 5J56B 1T03H 1U3HA 2HX7A 4GT0A 4KRPB 4A1RA 2F74A 2V17H 3HG4A 3S98A 1QLRA 4GQ9L 3MJGX 3CHRA 4XN1A 1F4AA 1E2ZA 2ZX8A 5CHNA 4ZAKB 1BLNB 4N8VA 5FLUA 3EHBD 3U0TB 2Q10A 3BSHA 4YSUA 3RVVC 4HZLB 4P07A 4BRJA 2IGFL 1P2CA 3BZEB 2DQGL 1P4BL 5DO2C 2DKMA 1WV7T 1CFTB 5F89B 1X3DA 3DGCR 3O8XA 3K7UA 4Y16A 4HA1A 1L0YA 5E9AA 4PW3A 1F42A 2A4CA 4DSYA 2IMNA 4G8AC 4RCAA 5AW0B 3SZ6A 4P5TD 1ZOXA 2NNAB 4HCRL 4LSVH 4A7GF 2YN3A 3WN5A 3UZQA 4RIRB 4HIXL 1A6TB 1USZA 4JCWA 2EP6A 4JFEE 1ACYL 5IHWA 1FRGL 3LX9A 4KGLA 2J5LB 4HJGB 4BWWA 4BKSC 4RDQG 2WZPD 5A16B 4M3HA 1ZAGA 4IU3B 5LNGA 4I18A 3G6DL 5C0BD 1XF4A 3QH3B 5JQ6L 4HT1H 4ORGA 4A7QA 1RUAH 5F8RC 2CZNA 3JWDH 2ZP9A 1U3HC 2UY7B 3QQ4B 4PRDA 1OTUC 4AW4A 2WIIA 4EUPB 3CZKA 2E4TA 4MZ2A 3CLFL 5E2VL 5DEFA 2IDFA 1JD9A 4WRLA 4I1RA 5J6GA 4J3SA 1N8OE 3VYPA 3VTMA 3P54A 3O8XC 4BFBD 3KG5A 5FGCB 2WXNA 4NZFA 2AJZB 4Y16C 1CVRA 5ICUA 3JT0A 1JNLL 2APFA 4HCGA 2JQAA 3CDGA 1IUZA 1SLWA 1UXWB 2KKQA 2WZ0A 2XQYG 3HI6L 1A1MB 3JV0A 3HC0B 3RB7A 3I3BA 2ZSVB 5GJTH 3H2PA 2EYSA 2NW3A 4I9WE 3WN5C 4OZFA 4YDNA 1TZOA 3HI5H 4JN2A 1AS6A 2I24N 3INUH 3WE1A 2AITA 4XWGH 3DYPA 4APQD 1AO7B 4MNQB 3D1MC 4P9HH 1GYCA 3C09C 2HJKA 5I1HL 2OMYB 5EO9A 4PLOB 3TBCA 1MREL 1AY1H 5GS2H 1O5DT 4MDJB 3PQYB 4XAWL 5I76B 2B3RA 4TVPE 2MQGA 4W9IC 1HJBC 3SBWA 4CVZB 4HFUH 4XO4A 3WNMA 5KG9A 3DETD 5KANI 3O6ML 1XIWC 2JE8A 1G7JA 3GSQA 4WWNA 1MLCA 3NVQA 1A7QH 1MAJA 3ASWA 2PWFA 4QHKI 2X70B 3X17A 4BWUA 5AD0B 1NCDH 1ZLVH 2F54E 3SDDB 3P4LA 3ZYJA 1SMOA 4XMTA 5J3HC 4O2EA 4MA8H 5EPMA 2X9YA 3L4WA 1NFDF 3QDHA 2NTFB 4HGWB 1DLFH 4M03A 4NZTH 3LRMA 4M8UA 5J7CC 4G8IB 4OLVH 2IOMA 3VXMA 3BT2L 4ELKA 3KYKH 1CBVL 1YEHL 3PCYA 3MRGB 1JOIA 1NLDL 2MCPH 1PG7H 4ZBJA 1BVKA 2JKWA 5JMRA 2XWBA 3T77B 4OCYL 2ZNXA 1OGTA 4AGNA 3DTXB 1M6UA 4UV4H 5IROA 2WP3T 3SBWC 4AGPA 3T0EA 5T3ZL 1PDKA 3VI4A 4H13C 3VGGA 4YHLL 4ZFFA 4ZMXA 5CM1A 2J6EA 2QHRL 3VB8A 4ELMA 2WYTA 3GC3A 3MRHB 1G9NH 2PPDA 5IQNA 2G2RB 4IDLA 3SN6N 4M5ZL 3IAPA 1WFJA 3D2UA 3J7HA 4XB3A 2LAGB 4JFYA 5IIEA 3O2WL 3ARED 4L0YA 1HQ4B 3BKCL 2HT3D 3MCLL 4X5RA 3W9DB 3VXUB 1DE4A 1YLBB 1R3HB 5B7EA 1HH9A 3HB3B 3VI3F 5IW3A 2NNCA 3DJTA 3FQ1A 3ARUA 4I85A 2FECI 4GSQA 2AAVA 4UDUB 1DQDH 1FBIH 5BS0E 2BNRD 2CJ3A 4XO5A 3X12A 4HS3B 3SZKC 4BDVB 4BZ2H 3EYOB 3LS5L 2WMPB 12E8L 1SXBA 3DO4A 4Y19D 4L3ED 4ZFQA 3A67H 3MODL 2WVTA 1S9VB 1TUPA 3TA3B 1IGYB 4DW2H 4KMQA 2A9AA 3NJJA 3NIDF 3M45A 1DQLL 3KPRB 3G5XA 3FU7B 1T5XA 5HHME 4AMKH 1CFSB 3NDYE 1EHKB 3H2WA 4NO3B 3QJFB 4WFGD 5D1XE 4YLBA 4RBPK 1HKLH 3L5HA 4A2EA 3QQDB 4WJ5A 4LLDB 4S1SL 4DCQA 5E23A 5EU6E 3D0VB 5J12C 2P7TB 5HTSA 5DD6B 4K3EL 4PV8A 2ED6A 1U4FA 1K5WA 3ZHFA 2VN4A 2I60L 1U8CB 1EMTL 1RIVL 1ZPUA 3KYOA 5LLIC 2O93L 2O6DA 1X6NA 4PJXB 3QFJA 4NJ9H 2G4EA 2H9GA 2CLVA 4JAMA 4JO5A 4LSRH 4RBPH 4UT9H 3V6BR 2OSLA 2YKKA 1KFAL 3MZTA 3DX9B 4AZ8B 4NAMA 1HAWA 1B9KA 3ZU8A 4GAJH 1OO2A 2F8OA 2Y69B 3M1BA 4UTBH 1ASOA 5ESQA 1MCWW 3CVBA 4Z1PA 1A3QA 3DECA 1WVZA 2IFFH 5A43C 3FKUS 4KX7A 2A6IB 1J12A 4NUGL 5SWZA 4AM0B 4W68A 3QCVL 2RFXA 2WB1A 4TSAL 5FM5O 4WO4A 3RVUD 4HJUA 3SBRA 4FN0A 2VDLH 3GUTA 4U3XA 3EBIA 4KKCC 2VWEE 1A6AB 4RAUA 3MPCA 5DD1H 5DEZA 4QNPE 1H3GA 4FDWA 4FOMA 2HRHA 3NT0A 5SWSA 5FO8A 3NEXA 4KMTH 2OCFD 1G43A 4EVNA 4KXAA 1JV2A 4V1DA 2VUYA 4JDZB 4QOKD 5D4IA 5EUOE 4WNSA 1XGUB 3DXAD 4JRXD 4Z95H 3K72A 4BEIA 5A2IH 5DJZA 4GKSB 1KBBA 3SYQA 1MCNA 4NN5C 2F2HA 1KN2H 2P8PA 3JBG7 1X5KA 3WXWL 2O5YL 3NACH 3WXVL 4YSDA 4WCYH 1FZOB 1SY6A 4M61B 3FH8A 2ZKMX 1U4EA 1T6BX 3NCYS 2MHAB 1J0KA 4GXFA 2NUTB 3U9PH 2ZSWB 2BX5A 5MEOB 5HHOE 5HGHB 3FQTB 1L3WA 3ZTJG 4F8TA 3O6FB 2BIMA 2Z3FA 1RUQL 4ZG1A 4P23D 1Q9WA 3PGDB 5KANG 1J86A 4KDTC 2EIBA 2JNZA 3PJSA 4QI3A 1DQQA 4Z7OE 3PNWA 4MX7A 5AKVA 2DQTH 4GQ9H 2ATPB 5FYKL 5GZNA 1DUYA 1KJ2L 2NXZB 1CI5A 5JXAL 3GGWB 4M93C 4OUOA 4JKKA 2WXIA 3RLSA 3VXRA 2IGFH 3UAJD 1GGIL 1CURA 1NUGA 2DQGH 4LVHB 5HYSB 4J1UA 1P4BH 4GNKB 3DJSA 2YGVA 5CMAB 5AW1B 1FFOB 5C0IA 2HTKD 2IDUA 2H0FA 2WVUA 3LKRA 4G5ZL 4QTHB 5D7LB 4YS4A 3DPDA 4JW3A 5CEZL 5E4EC 5AOLA 3MNVA 4HCRH 3LMJL 4WQOA 1D9KA 4BH7B 2Y7MA 3CHQA 4GG8A 4YHNB 1C9SA 2APVA 4HIXH 3WY1A 1T6VN 4XP5L 4JRWA 1F58L 5DRNB 4NUMA 5KUKA 1ACYH 2OZNA 5BOZG 1H3WM 5DJYA 1FRGH 5GIRA 4NRXB 1EO8H 1Q9LA 2E7LA 3BVNB 5CJ8A 5T3XL 3OKMA 4EN3D 3JWNH 4U1GC 3G6DH 2ICWB 4P5SA 3BD3A 5JQ6H 2CIKB 2IPUG 2EDDA 2ERJB 5E9DE 3ZSSA 1PMYA 3RBSA 1IZKA 4MRCA 2YPLE 4GRLB 4WJKB 2J1ZA 3CLFH 3BX7C 5E2VH 2P5WA 1RP9A 2QGCA 1SN0A 1NGXB 4TQIA 1RCYA 5D93B 4B7LA 2R0KH 4R84A 3PDGA 1JK9B 4NNYA 2HX9A 4UIMA 4IHOB 4E9QA 1IC0A 3NFSH 3OC8A 1DJSA 1QTPA 3UBXI 2WQAA 3PWJA 4QWWD 3SDXE 1QRNB 1JNLH 5EB9A 5C9JA 3QIBD 3HI6H 4OGQC 3PWLA 5JDJA 1YEKH 2AJVH 4L5FL 5FFLA 3EDKA 1SGKA 4QTFA 5IM7A 2BOLA 1GC1L 1FSKB 4XCNB 1WAAE 1BFOB 2O61B 1UUNA 1R5IA 1R0AL 3B9KB 1QO3B 3C2SA 1UENA 4X99A 3HI1A 2MTAA 1JS4A 5T1KD 4WU7A 5I1HH 2VH5L 2CUAA 1MREH 1TJGL 4Z7QF 4XAWH 4G2AA 3RL2B 3CFMA 1OEZW 1SFHA 2XV2A 1IT9L 4JCLA 4X0NA 3T1WA 4UBDC 4LQFL 1AGDA 1JWUB 3O6MH 1PY4A 1U8JB 1HE7A 4GRWF 5C6TL 4MQXC 3KPQA 4IS6B 2OJEA 4KY2A 1NCIA 4LARL 5F3HB 1VIWA 4L9LC 2R4SL 4G43A 4OLXL 5JHMA 2X12A 1AG6A 1MIML 4AQ1B 4FQQB 5HD8D 3SE8H 4TNFA 2EUVA 4M4RB 5JOFB 3K71B 1BX2A 2X5PA 1W80A 2CUIA 2WK2A 2KQNA 1LEIB 3LZLA 3KHOA 4OUUB 3BI9X 3BT2H 1X9LA 4AYDC 4KRPC 1FNEB 3Q13A 3OKKA 2E7CA 2R0ZL 4PJGE 5D4QA 1CBVH 4LEXL 1YEHH 4L48A 4PWFA 4YDVA 1D7BA 4HS6A 4KXZH 1KCLA 3BWUF 3SYOA 1ZSHA 1NLDH 4GAYB 3C6LB 2QL1A 4MBRA 2YSSA 4Q8BA 4ZMTA 3HMXL 3NFNB 5IKCB 3F7VB 3FRPG 1X4ZA 3RQ3A 1VPOL 5IB2A 2H0PA 1NFAA 4WWOA 1I3RA 4KUCF 1ZT7A 1HL9A 2FX7L 3GKWL 4X6BA 4YHLH 5EC1A 5T3ZH 2KLRA 2QHRH 1FDLL 3HHSA 1G7QB 1I85C 2CLZA 3CJJA 3GPEA 3K80A 4M5ZH 5GGRB 2GJ6A 4XX1G 2DBLL 2WOYA 1DDHB 4UQIM 5DMGC 4HUWA 3O2WH 5ICZB 3BKCH 3MCLH 5DUBA 5FO2A 3SD2A 3ZE1F 4WHYG 1CXLA 2HA1A 1IM9D 2XJKA 3G5ZB 2EIEA 4JUSA 1JPGB 5EDXA 1ZT4A 1ZHBA 5I18L 1IE4A 4O4YH 2CXKA 4NCC1 4AE1A 1M53A 4KV5E 2BY0A 4MAUL 3LS5H 4HHGA 12E8H 2HPOA 5B1KA 5AL0A 4FA7B 1G5GA 3TWCL 3GBLA 2NW2A 2OFQA 3CK0L 3MODH 1BQRA 3PIQA 1XF3A 1J11A 2DM2A 3DROB 3FTGA 1KIPB 1DQLH 1EZUA 3FU5A 2A99A 1GTFA 1JI2A 5PCYA 3BUQA 2O5NA 5DLMH 3T2LA 2ZX7A 5GRJH 5B38G 4S2SB 4E42B 5AVSB 3UBFA 4YMPA 3QISA 2J57A 2AXHA 1TSHA 1A2YA 4F7CA 4MGXA 5AOZA 1TQWA 5DURB 5BUGA 2Y6SC 1UACL 4CSSA 4RFNB 3T2PA 4K3EH 3N1MC 2YUZA 2CA3A 1U8KB 3LZPA 4LP8A 4X9FA 5JHDE 3TASA 4ZYKA 2I60H 5I8EA 1JUFA 1EMTH 1RIVH 3N42F 3KWUA 3EH4B 4KGJA 4AEHL 2EZ0D 3VGAB 3TBVA 2VXQA 2ENPA 4Z7WF 1KFAH 5I0XA 3C8DA 4K3JL 4HOWA 3RIAF 5EIIA 2PYEB 2HTLD 3TEUA 5DVOA 5B4MD 4G8FA 4HG4K 1AHWA 3VU2A 4P3DB 2PPAA 2EILB 2X6MA 4N5UA 3X1GA 2HUHA 4L3CA 3RAJL 4YGAB 2Z7WA 2BHZA 3DURA 4FNLL 4NUGH 4QT5B 3QCVH 3MNZB 1N6QH 2JB6B 3BEVB 4TSAH 2EE6A 2P24B 3TOPA 4GBXD 5KYWA 1WTLA 5DLLA 4WEMB 3DIFB 4OV6F 3A6BL 2N59A 4AGOA 1D6VL 3UBXG 5E8NA 1NBZB 4KBPA 5BQ7A 1CE1L 1OGAD 4WNQA 3DVNA 2GHZA 3L4ZA 3D18A 3NJLA 5EIQA 1N5YL 3L08A 4HWZA 1KWGA 2O4EA 5GGRY 3O9WA 2J1KA 4MDIB 4Y5XA 3BUYA 3FF7A 3LZRA 3UPRB 5C09D 5J1AA 2BWQA 2O5YH 3VXQB 3WXWH 3WXVH 5EUKA 2FZ3B 1QHPA 5G5DB 4ZMVA 3E2HB 4IOIA 3QDME 2HVJB 3DX8B 4UM9D 1R33A 3MYJA 2N01B 5JQIB 3ULAB 2QPFA 4P05A 4OI9A 2HUEA 2NXYB 3GSOA 3KLAB 5E95B 1JDAA 1AHWC 4XBEH 4FEMA 5EF3A 2BP3A 2V2WA 1DQKA 3GDCA 2K9UA 4MMZB 3HE7D 4Y2OB 1T83A 1G6VK 3QFDB 4UM8B 1OT4A 4Z7UF 5LDSA 3U0PB 1XCQB 3UAEA 4JK0D 5FYKH 2WXKA 5I23A 1KJ2H 2IQ9L 3GMOB 2UZIL 1YDPA 5DJ2A 5SX5K 3WIAA 5JXAH 4IIZA 2FQEA 1GGIH 2HRLA 5E2TL 1AKJA 2BERA 3VGFA 4LZKA 3IAGC 1JDCA 3BKJL 2ROXA 3VGDA 3P2BA 3WDHA 2Q2EB 1YSOA 3WS6A 3LV3A 1U95B 4RFOL 3UYRL 1ZVYA 3BCFA 32C2B 1NFDE 3BGFB 4G5ZH 1WITA 5F0LB 5CEZH 4G6MH 3O9WC 4Y5XC 4R7XA 4OLYL 4J3OC 3LMJH 3MUY1 4HHAB 4DP4X 3CAFA 2CKNA 3AQYA 3KPSB 1PQZA 5SX5H 4QRPB 3UFIA 4PLNC 3PUUA 4XHJD 4XXWA 4XP5H 5DJ6B 4I8DA 1F58H 1KGXA 4QEGA 4GI9A 4EF3A 2PW2A 5DJCA 2QQNL 3CHOA 2CM6A 1B4RA 3K0WA 4HLZG 3D25A 3D0LB 5E56A 1CLZL 4OBSA 4U1KB 1CDHA 4JFFA 1OT2A 5T3XH 3UZVB 5F9JB 2HT2D 2Z65C 4AEEA 4YHYC 4FQIH 3VXSA 1T83C 2ZX6A 2X4QA 3UTPE 2IO5A 2HG5A 2K6YA 3SY0B 3VWKB 1DLHA 1I9IL 2PTTA 4I87A 4KQ3L 5DD5L 3US0A 1OALA 4YN3A 5LB1A 4N2NA 3SO5A 5ICYB 1AQDA 4G3YL 1RIHL 3JV4B 5GGSY 4WVRA 2X42A 1PKQE 3MUHL 3WS6C 4Y9FA 2XETA 3ABKB 2X2YA 2ZOOA 3DO3A 3FQXB 3DRTB 1OPGL 4YGVB 3VI3E 1ZCRA 2JB5L 5HGBA 5K1NA 4L5FH 2Q20A 2MNWA 1GC1H 4UNUA 4PI2A 4Q6IB 1HFUA 4NX0A 4QHNA 3H4FA 5GS3A 2GEQA 4XOCA 1KTLA 5E6ID 3QR0A 3B4NA 1TU2A 4WHTA 5KTEL 4YPGB 2AK4B 5CINL 1R0AH 4OY9A 3DX1A 1OZUA 1N4XL 1BD2B 5EU3A 3MXWL 3X3FL 2FGZA 1QZNA 3PWUA 1HSBB 1L9MA 3NIDE 4H2AA 2VH5H 4N28A 1MCRA 1QR1B 1TJGH 1F1GA 1I9EA 5IBUG 3BD4A 4FD0A 1R75A 3E6FA 5IVZA 4GFTB 1KBVA 5FM8A 2GFBB 2Q1EA 3NJFA 4MAYB 1IT9H 4F24A 4LQFH 3LS4L 3ATAA 4XVUD 2GBUA 5C6TH 5DSCB 4GW5A 2WXJA 4XNUL 4LARH 4FKHA 4PRAA 5FR3A 4I0PD 4Y4FB 3VXNA 2QQLL 4OLXH 3JWDC 4D9QD 1MCCA 3I50L 1MIMH 4IJ3C 5C92A 2DB8A 2XPGB 5KVFE 4AQZA 4NJAL 3JTBA 1BAFH 3NQIA 1RZFL 3N3EA 5IMLB 2B77A 3MBWB 4BIKA 1TO5A 5EBLB 3QO1A 3WTYA 2FO8A 5FA4B 1FZMB 3AG4B 3V5KB 4MTMA 1KWKA 3BP6A 1QSEE 1T2QL 4BFGA 1KBGL 4NBXB 2J8UA 2R0ZH 4WEEA 1E4XL 4LEXH 1JN6B 3GSUB 3K6IA 2QT6A 5I1GL 3VG9C 2I9LA 5LGJA 3I6KB 1ZY9A 4PB0L 2IAAC 2ED7A 3V6FA 1VKXB 1EEQA 2NXZC 3ZDWA 3GLEA 3IN2A 3BPLC 3MV8D 1OY3B 4N2GA 4XZUA 4B9GA 3HMXH 2VLRA 4HUVA 5LO7A 4LVHC 5LBVA 1VPOH 3MRMB 4NQXA 1FZKB 2WM0A 3L45A 5ICXB 1M6OA 2FX7H 3E8UL 3GKWH 4XT1C 1ND0A 4I3SL 2QMJA 1FDLH 8FABA 3BVUA 4QRQB 1MHEB 5FK9A 4RFEB 1U91B 3LHPL 4V33A 3GEWB 4HYTB 1DQIA 3SKOA 3GB7B 4U6VL 2MIZA 2WSPA 3QORC 43CAA 4TLTA 2R2BA 1KLUB 5E2JA 3S35L 4N25A 2QR0B 5JW4M 2P80A 4ABQA 1UJ3A 3RHWK 3V7MA 1HT6A 4WSKA 3E6HB 5I1JH 3N43B 5GRVL 1P7QB 2PR4L 1GAFH 1UXSA 3EJTA 5I18H 1Y0LA 3GMLB 4FTVD 3O4LA 5FXCH 5K5YA 1LLAA 3GMRB 4RMSA 4NC1E 1P4LB 2DQFB 4N68A 1PZCA 2GUYA 3N6YA 3OKOA 2IDCA 4BFJA 2GVYA 3FQUB 3TWCH 4Q89A 3ARGA 3CK0H 3VRIA 4Z3EA 1XH1A 2NT1A 3DI2B 3LSOB 2EDFA 3SDCB 3VE0A 4ZTOL 4JFZL 2CM5A 5D93C 3ARYA 2GY7B 4BZ2A 1I1AD 4LLAA 3BP7A 2FJHA 3P77B 3UX9B 4MJ5A 1W0WA 2EAEA 3B56A 2CDGA 2HZHA 2UX7A 4HV8A 5LAXB 1S9WA 3SGEI 2OCCB 3VH8B 2NY3B 1EVUA 4H8UA 5E7BA 4ZI8A 4HOXA 2X40A 1FN4B 3WDJA 1HC1A 1BVOA 3BCDA 1UACH 3F7YA 4W93A 3COOA 3OAWA 4LCWE 3L7FA 2J73A 2BIOA 3B9KC 2ZYSA 2VLJD 1MEXL 3RX8A 1G7IB 2V3FA 1G9NC 1UJ3C 3S8GB 1TT6A 4AEHH 2Z31A 3D50A 1QABA 4WUUA 3CXDL 2XTLA 4K3JH 2ZUTA 2C1PB 3HRZB 4YSCA 3LEVL 2K4AA 3HPLA 4C83A 4ODHL 4ZQKB 3K4ZA 3RAJH 3ZE0B 4HEMA 1E27A 4UT9A 5KEZA 2J3SA 4FNLH 1MW1A 25C8L 4LK4A 1QNZL 2CGZA 3X1NA 4G1EB 2L4OA 4L37B 4H1LH 5C3LD 2K6ZA 3LRHA 1AZUA 2ZYIA 4NZ8A 3SCMC 4UTBA 4FABL 2RR3A 4H26A 2IAMA 4OLWL 2H3KA 4X6CB 1GGCL 4LCVA 4MS8D 4I0CC 4HJ0D 1OTTC 1D6VH 2PPFA 1KTRL 1CE1H 4FLSA 1DEEA 2FBRA 5HGDB 3FQRA 2E5EA 1N5YH 1NCJA 1HHJA 2ZOWA 5HDBF 4OM0L 4QY8B 1JZGA 2H1PL 4TF4A 5GGQL 4KRMB 2QVTA 1DBKL 3FFOA 3QJVB 1EAPA 1YUHB 3C75A 4OIAA 4M5TA 3HZKB 1RLBA 2D7OA 2EIZB 3C6LC 1H0DB 5IB5A 5IFJA 4R2GC 3CN3A 2Z31C 4KFZC 3VDAA 3I74A 2XWCA 3IGAB 4U1LA 1TKWA 3UADA 1R47A 1QNIA 1G1YA 1DJGA 4KDWA 5I8CA 2VITA 1KCWA 2HLAA 2EUZA 3OGCA 4Z7QE 2NCMA 1T0PB 5F2FA 1TENA 1J5CA 5I1LB 3IMBA 4U1SB 1O7SA 3VWJA 4OZHB 2JTYA 4LPWA 4NQCB 4GRWE 1CBJA 4X9IA 1MQ8A 2K6WA 2IAMC 2XN1A 1FVDA 1YNLL 2IQ9H 2UZIH 4OFYD 3RKDD 2PP7A 5BVJA 4F58L 3E80A 2GSIB 5D2LA 2DLEA 5E2TH 1PD0A 1RFDL 3BKJH 4JREB 1YMMB 5D1ZD 5KSAB 2E3VA 1QLEH 1I8UA 3APNA 3H9HB 4XBPA 4JO8A 4RFOH 3UYRH 4JPKL 4YXLL 5AVXB 4CU6A 4U0RC 4WV1B 2E9WA 4Z7VF 3SEPA 5IGXL 4OLYH 2KT6A 4NENB 2R0WH 5HYEA 3ARDD 3M46A 5IF0A 4YXKL 4U1NA 4MYPA 1BQLH 4DWHA 1TMQA 2QSVA 4AIZA 1N7ML 2OMVA 4AMXA 4DQOL 1ZGLB 4AEFA 5HHPA 3ZDYF 2QQNH 2Y7SA 5GGSA 1NL0L 5HDLA 4B95C 4PRHA 2COQA 3IKCB 4HCRA 1CLZH 5D1QD 3D0AA 4KX9A 2PO6D 4WKZA 4JHWL 3ULUD 2Y36L 1UZ8B 3NZSA 4WWKB 3MTRA 4LCYB 3VWJC 3RWDB 1ILSA 4RFNC 1I9IH 3RFZB 3STZB 3OPUA 3BISA 5DD5H 3W5MA 1Y1DA 2F68X 5C86A 2WWMC 1KV3A 1D5MB 3QI9B 4ZUSB 1T21A 2F61A 1CFQA 1ES0B 4G3YH 3RDTD 1NMAL 1RIHH 5DU7A 1NBCA 2CHZA 2HXAA 2KLSA 1BYOA 5BRZA 2A9BA 2PYFA 5IQOA 3FCSA 4OIFA 3ZE1E 3FUJA 2WWOA 3W38A 1OPGH 1WC7B 4GW4A 5ANME 1R5WA 2JB5H 3PPEA 5C3TA 2Y7QA 4P48A 5E4IA 1RPUA 1M7XA 1YYCA 5DO2D 2A6JB 2W0FA 4Y2LA 4N20A 5EA0L 1ZHKA 3K5SA 5KTEH 4XAKD 5CINH 1AVAA 3FMGH 3FHQA 1H8SA 4NM8L 3MXWH 3X3FH 1AACA 1E9OB 1HKFA 1NGZA 1DFXA 4BKTC 2WCGA 4WJG3 4U1JB 3K2UL 4BFIB 4GP5B 4XBGA 1NEZB 3NJKA 2MKLC 1UJTA 4QHMB 1XB8A 2H6OA 3MGTA 3KLSA 3QZLA 3PAVA 4DGYL 4R83A 1G7LA 3CMOH 2OYMA 3VD0A 1RK7A 2UXGA 3FQNA 3ZK0A 1RK1B 4M4PA 5BUPA 4XNUH 4YEEA 1XXFC 1LE5B 4XN7A 2EVHA 4D0CB 1MCPH 3D4CA 4WENB 5C07D 1E5UI 1U3HD 2QQLH 1JNHA 1OTUD 3GMPA 3E2HC 3VX0A 3I50H 2ZX9A 2OM5A 3WLWC 4YNYA 4NJAH 1RZFH 4X42A 2BNRE 1WLHA 2VTFA 4K23L 5GRYA 1O9ZA 4Z7WE 4Y19E 3ZR5A 1OT1A 3C8HA 4L3EE 1S3KH 5C97A 1LEGA 4MMZC 4PJBB 3O8XD 2QKIA 3D06A 1NKRA 4MLIA 1V3LA 5BPPA 4Y16D 1HXYB 1T2QH 2DJ4A 3ETBJ 1E4XH 3HVNA 1J18A 1JF1A 3MFFB 3NH7L 3OF6D 5I1GH 4EDWL 4MRBA 3CPUA 5ID1A 4S10A 4A2DA 4MB3A 1ZLEA 2K3TA 2V5RA 4WFGE 4QRUA 1LVEA 2NLJB 3J07A 2ADGB 4OBRA 5T5NG 2BSBA 1KIUB 1SFDA 3E8UH 1XB6A 4I3SH 2CXGA 4U4IA 2I7OA 1PEZA 4QRRA 3LHPH 4M7LT 1WWAX 3H7BB 4JQIL 4DKEL 5E24E 5I17B 3WE6B 4U6VH 2WXLA 3HN3A 1KUMA 1SMDA 2Y24A 2P26A 2X4OA 1ZSDB 5HHXL 1C5CL 4JFDD 3S35H 4HKJB 5A2CA 1J9TA 3S3DB 3MRQA 1TNNA 4OCXL 4L3AA 3QDJA 3ZW3A 2PR4H 4D8PA 4PJ8B 4NXSA 4PS8A 5IW1B 2QKIC 3LN5B 3LN4A 4PCTA 5GSRA 1I7RA 5IHZA 5CP7A 4K8RC 3PF2A 3MV7B 3QNZB 3GMNA 4YK4C 3JUZA 2F54B 5IHUL 1MJJA 4JFZH 4ZTOH 4F37F 4Z7UE 4TNWF 1MHPL 3KWXA 5FB8B 4HETA 3RFRA 4LBEB 3QEHA 5K9OA 2DMGA 2AMUA 3L4VA 4QOKE 1KCVL 4A63A 2VLKB 2JXMA 1SHMA 3HR5A 4JRXE 1AGFB 5F6HI 4IBLT 4ZPTB 5ENWB 3NSDA 3J8F7 1ONQA 2DJUA 5I2IB 4W9ZA 3GZKA 3QC5X 3SKNB 2BNQE 4PTUA 1YNTA 1U92A 2VSKB 1LO0L 3C6SB 1GTNA 3SKMA 4QHPA 1N8ZB 2E76C 3TIDA 1FFPB 1ILUA 1MEXH 4BQ8A 4ZUUB 5AL8A 1KNOB 1QASA 4FNTA 2DQUL 4QYOA 5FHAL 4PS3A 3O41A 4F7PB 4FULA 3IWUA 1WDAA 3CXDH 3WKNA 1YJDL 4EI5A 4WWPA 3GQFA 4MAYC 4M8QA 4P4RB 4ODHH 1TQCB 1HHHB 4WW1B 2UZXA 5E2UL 3IFPB 4BV1A 2LQRA 3GJFK 25C8H 3MBEB 1QNZH 4UI2A 1U58A 3VFMB 3VXMD 1A7RL 2BVEA 1XGZA 2ENYA 4LLYB 1UH2A 5I66B 3LYRA 3TJHD 4FABH 3IDYB 2D0HA 4JFOA 2DMKA 4OLWH 1HL8A 1NCCL 2BOBA 2AI0L 3I02A 2EDBA 1XL4A 2XTJB 1GGCH 1F00I 2GJJA 2IDSA 5KVFL 3QUMA 5KYYB 2JIXA 2CWRA 1WA1X 1MAML 2M8XA 3GJFH 3LRSA 5IROD 2PN5A 3HCVA 1OAQL 4XH2A 3T0ED 4OM0H 1GRWA 4YDJB 3V4PL 2FQDA 2H1PH 5GGQH 5B39B 3UG4A 2BC4A 1DBKH 2DEXX 4WU5B 5T1DL 1EJFA 3WAJA 1WBXB 4O02L 3D2UD 2E9JA 4G72B 3O6LL 5AVRB 4J5VA 4UQCA 1JD7A 4LAQL 5D9SA 4ZOBA 3B9VA 4G9FB 1MH5B 5EU6B 1QWUA 4EI5C 5DEGB 1UVQB 2XG4A 4YHIB 2CKBL 3CDFA 2ZCLH 3QUXD 1KTCA 2IH3A 1TLKA 4HEPA 5H4ZA 3MNWA 4ABUA 2D7TL 2DH2A 2DAVA 2ZWKA 3L2LA 4AH2A 5JXEA 2ALWA 1M1XB 1W8OA 3D9AL 2VERN 3G5VB 5I6OA 4H8HA 1A1NB 3CFUA 5CGBA 1E8ZA 4MA1C 2XZCL 1YNLH 3TVMB 3AU1A 1W2KT 1CL7H 4F58H 1MVFA 4AY0A 1VAHA 3QUGA 1MVUA 4XXCA 4KKCD 4JL1A 4NS0A 1NKOA 2FTAA 2V2XA 1KJ2A 3X3GH 2ZCHL 3IJYB 4JPKH 1XL6A 3SJVB 1UB5B 4LKCA 2WP3O 4YXLH 4O2CB 5IGXH 2EYRB 3QUZD 2JJSA 7PAZA 3L3OA 1BW8A 5DHVB 1P7KB 3LKSB 4YXKH 4B60A 4DQOH 1N7MH 2K70A 3ARWA 2F7OA 4IOSA 5KSBA 1B2WL 1EIBA 3HEIB 4N2IA 4BQ6A 3S4SB 1NL0H 3BRDA 4PG9A 1X5IA 1BZDA 1EANA 2D7PA 2OMWA 4IKJA 4FFTA 3TFKC 2A9NH 4JHWH 4Z7NF 2Y36H 4EZJA 5AZUA 1CGYA 4LE8A 5JXEC 1JSYA 3VXTB 4KNSA 4TUKL 1NZRA 3ULSA 3VFPB 4BSWA 2C4FT 2B1OA 2ZUWA 2F58L 3EF7A 3AZUA 1K3ZA 5SWZD 1UA3A 1PYWB 1RVFL 3GHBL 1D2PA 3CIQA 1NMAH 4K5LA 5A2BA 3K3QA 4WO4D 3QIWA 1CXIA 1NEPA 4XXCC 5HY9A 1E5YA 1XT5A 2IOOA 2VR7A 3LIUA 3N5AA 3EOBB 8CGTA 4LLQB 1MRDH 3UTQB 4Z3GA 1B0RB 4LLUB 1SUHA 2JCCB 3GSRA 2KHAA 3IGFA 1RHHA 5SWSD 5T1LA 3VFVB 2LABA 1LP9F 1S7SA 2JJUA 2JK5A 3OR7B 4L8CA 1QPPA 5LG6A 1GZQA 2UY6A 2JJSC 4V1DD 3L3OC 1HQRB 5E8DL 2F8IA 4W9JC 2GTQA 5EA0H 1RMFL 1PZ5B 1VACA 2HJLA 1IBYA 5IEHA 5FEBA 2YFOA 1E6JL 3PPSA 3ULUF 4BXSV 4NIYE 4NM8H 1F5WA 1S7VB 1W72L 5A6LA 1U8LB 3Q6FB 4ANXA 2FJGA 5FV1L 1H8NA 3K2UH 1YYML 3VQ2C 2ZUQB 4WLCA 2JJTA 2NRDA 2PETA 3C60A 4LRNL 5T5FL 5JZ7C 4DGYH 4FHBD 3WENA 5E8OB 1KJMA 4FMVA 4JMXA 4PR5B 5I71B 1NA8A 1VF5C 1OM9A 1RK0B 3BQUA 3N9GH 3E0GA 3S8WA 1KPUB 3Q6GL 3L6FA 3RJQB 1V7NL 3OM3B 5DJ0A 3E3QC 3TCTA 2DYPA 3QIWC 4ODUA 5HGGS 3V0DA 4D0BB 2IVFC 3GXTA 1Y6KR 2FYYB 4N8UA 2D7MA 1CE6A 2XQ0A 5GZND 1UWGL 4X83A 3VXOB 2WBJA 2ZKHL 3HS0B 4OVVA 5HPMB 4K23H 3CVHB 3VXRD 2YPLB 3OR6B 3ME0A 4JHVA 4PVNA 3O3EB 1U9KA 2FATH 4MJIE 3UZEA 2XDHA 2JQZA 3JT2A 5JLZB 1IGJA 4ODTL 1G7HA 4XXDB 4L4VE 3TPUA 2WXQA 3NH7H 3LVEA 2DIJA 2AVFA 5I1DB 3LKQA 1HH6A 2DD8L 2ZXBA 3QUHA 3RWCB 1YY8A 3FOLB 1D9KD 1TVBB 4YFLF 3T4AA 3GDBA 3SDXB 4Z5RA 3T6QC 1ZTXE 1M57B 3RY6A 4PVMA 4RGNC 4R96A 7FABL 4JREC 5I9QC 1NCBL 3ATEA 5M95B 3P3YA 2JJTC 2F1BA 2YWZA 1P1VA 3C60C 3MV9B 1SOKA 2EICA 4E9WA 1DHKA 1Q0EA 1KBKA 4WV1C 3FUHA 3HMXA 3BQUC 2CBPA 4TMPA 5BZDB 2KPWA 4LOVA 1V3KA 1T1XA 4FFVD 5IB1A 4UQBA 1UM4L 4JQIH 1M71A 1XZWA 2Y9RT 4KUZL 4UBDD 5BV7B 1C5CH 1MCHA 5FKAB 2AJUL 2P5WD 1NBYB 4HIEB 3QIUB 4DK6A 3MRLB 2WBJC 4R7NB 2G5BB 3EJPA 1JHTA 4QHUA 1AIFB 3WLBA 1ZWIB 3UYPA 4P57B 3HZMB 5GSVB 1YPZB 3UZEC 5CEXA 1X4XA 2XNAA 4L8SA 1E5ZA 4OGAC 4I88A 2WGXA 3RFZC 4GW1A 1W91A 4JFEA 4YHOL 1F13A 3RNKA 2H3NA 5IHUH 3T4AC 5LBGA 1MHPH 2LOEA 4K9EH 5F9DC 3RBGA 3RY6C 2FT8A 2GAZA 1OGAE 4LASL 3GZPA 3IRCA 1KCVH 4IQHA 4HIPA 1DJXA 3UTTD 3ARXA 5HSFA 1T4KB 3Q2NA 1F6AB 3BP4B 5TK2A 1AOHA 5A1AA 2BSSA 4FMFA 4XODA 5GRWA 5E8EA 1LO0H 3DMMA 4NZDA 4WW2A 5C09E 3UO8B 2VAJA 3FH5A 3IU3B 1AXSA 3ROLA 4Z7VE 1A14L 2L7UA 4UU9A 2X1WL 4X6FA 3UMNA 1UOLA 1B2YA 5DJ8A 3GMMA 5ERWB 3UJIL 4ETYA 1SJEB 2VDKL 1BJ1H 2DQUH 3WEXA 5FHAH 4NZUL 1ED3B 3II3A 5FDWB 4C4UA 2PWEA 9PCYA 4MKTA 2GTWA 1FL6B 5FYJD 1NUFA 3ZYOA 3TZVB 1VHPA 5IMMA 1YJDH 3ZDYE 1EX0A 4L8SC 1BZ9B 3JTSB 4IHBA 1YQVL 5E2UH 3N41F 3HC2A 2K9FB 1L5GB 1KTBA 4S0TD 3MMEB 1A7RH 2DYRB 3EGSA 3MAWA 2ZXGA 4BK4A 1KTJA 1ZV2A 1BIHA 1E28A 3QYMA 1JV5B 5F70A 3ZLQC 5LBSL 3VD3A 5C2UB 4ZFOL 1NCCH 4B0MB 5F44A 2AI0H 4POZC 5DK2A 4ZW8A 1BQSA 5JYLA 5F7LB 4M7JL