3VD1A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
202
Chain Sequence
HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
molecule keywords Tumor protein p73
total genus 36
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd1A00
2X0UA 1TUPA 4XR8C 2AC0A 2ADYA 2XWRA 3WU1A 4G82A 3TS8A 2GEQA 1CMOA 1GZHC 4IBVA 5LAPA 5A7BA 3WTUA 4GUOA 1T4WA 4IBUA 1EAQA 5AOIA 3EXJA 4AGQA 2J6WA 4IBZA 3IGKA 3D06A 4AGMA 2VUKA 5AOMA 4KVPA 2PCXA 4L0ZA 1H9DA 2WGXA 4IJTA 4IBSA 5BUAA 3D05A 2IOMA 4QO1B 3WTXA 2BIPA 5AB9A 4A63A 5AOKA 2J20A 3WTYA 2FEJA 3US1A 4G83A 5KBDA 2J1ZA 3D09A 4LO9A 4GUQA 2J21A 1IO4C 2J1XA 3D0AA 3Q06A 2H1LM 5G4MA 4AGOA 3VD2A 4IBQA 4MZRA 1UOLA 4L18A 3WTTA 4HJEA 2IOOA 5ECGA 1KZYA 1CO1A 1GZHA 3KMDA 2BINA 3QYNA 2IOIA 3Q01A 3IGLA 2AHIA 4AGPA 3WTWA 4AGLA 3VD0A 3D07A 5G4NA 2OCJA 5G4OA 3WTVA 2MEJB 2ATAA 3QYMA 4LOEA 3WTSA 5AOJA 5ABAA 3VD1A 1EANA 3ZMEA 3US0A 1HJBC 2J1YA 1E50A 2BIMA 3Q05A 1HU8A 1HJCA 1YCSA 2X0VA 4AGNA 2XWCA 5LGYA 2J1WA 3KZ8A 1EAOA 4IBTA 4IBYA 2BIOA 2P52A 4L0YA 1TSRA 2BIQA 1LJMA 5AOLA 2YBGA 3EXLA 4LOFA 4IBWA 3D08A 2X0WA 2RMNA 4MZIA
chains in the Genus database with same CATH superfamily
2D7OA 2K8QA 1NC4D 1T1YA 3X12A 2NPLX 4BFBD 5FA4A 3ECQA 5D1ZA 2FSDA 4BE5A 3FN9A 1XTMA 2IFFH 2FJGA 2L7UA 2GJRA 3MACL 1ZDQA 1NKRA 3BZDA 4TSCL 1J8HE 1MLBB 1MAKA 1CDGA 1T66C 3MBXL 5CSBA 3CPLB 2WAHA 1ZSHA 4FQIL 3HKFA 1JZDC 4KI5C 2XN9E 3IMRA 3E1F1 3IWVA 1LK2B 3NN8B 4KV5E 4N6RB 3MRRB 5DEZA 2EIZB 4IK6A 1KXQA 5E0FA 3L5WB 1TVBB 4PS4H 3FJTA 4L4TA 5KG9B 2HJKA 2LLLA 4GAGH 4QAWA 3DTXA 2PTTA 2GT9A 4F27A 2Z8WC 1RJLB 1TEYA 3EYSL 3BO8B 1HE7A 1KB9K 1P5VA 2ZXBA 3DX7B 3P4MA 4N87A 4P5MB 1RIHH 4OI9A 3T4AB 2IADA 3GBNH 2DQHL 1D5XA 4FKKA 5IB2B 4PJ5B 3W0WA 4GBXA 4G7VL 2VMEA 5AALA 5D1QA 2FBJL 2FO4B 4KJWC 3IS1X 1SLVA 4X80H 3MQIA 1SBSH 3IJ7A 2VLKE 2IPTL 5EZOL 4EOWH 1RFDL 4HKBB 2LVEA 2UX6A 2ZG2A 3CZJA 3GMNA 4CW1B 5LNDA 4U1GB 3J7HA 1OAZL 5CLZA 3V5HB 3POHA 4GG8B 1QI5A 5IROC 1F3DH 4ZFFA 2YAHA 2WBKA 1ND0A 4U6HB 4AENA 3E6FA 2Z91A 3BD3A 3GBMH 1M6UA 4LLMB 4JPSA 5GZOA 3ZVVA 3F12A 1KWKA 3NFNB 3O6FD 2B1AH 3CMOL 3KBFA 4LP8A 4NKDB 5MEOB 2CO6B 1T0OA 1I1RA 5CILH 1T7VA 4LU5L 1TCMA 3QWRD 12E8L 3IXTB 3X17A 4DNLA 5JHLA 2B20A 1BZ7B 3KPQA 3RIKA 4I9XA 4KKNA 5A40E 1TVBA 4X5XB 3NEXA 2V2TB 4JKWA 1KCBA 3GKWH 1HAUA 1MI5E 4QF1B 4JY4A 3CFEB 3DHPA 2Z31D 5I15L 4EN3D 4XPHH 5GGRA 4O58L 4DZBA 1I9IH 3M46A 3L9BA 3NEEA 4L8SA 3FTZA 4Z7WA 4K9EC 2NW2B 3QIBA 4NQED 5DUPL 1FNEA 4N0UE 1MFBL 2A2QT 3DX6A 1R0AL 3NIGB 4YFEA 3KYKH 5A2JH 1M05B 4PW9A 2XCMC 2XIDA 1B88A 1HKLH 3T04D 4RMVA 3H3KA 4HXBH 4QNPF 1I31A 3ZJAA 5B8CB 4GKSB 5F3HA 5FYKD 1RUKL 1WT5A 3KPTA 1PZ5A 3L5IA 4YSSA 2I9LA 3Q2CA 3PWVA 3WSQH 4XNMA 5SWSD 2AF2A 2WHVA 4LCVA 3ZHLA 4A7SA 2IJ0C 1A3RH 1F00I 3BEVA 3IMVA 1YHPA 3VG9C 4HKJA 5CIPA 5IQ9A 3SDDD 1HINH 3CXDL 1KJ3H 2R29L 4HETA 2EIMB 1FGNL 1YEFH 2XU9A 4AEEA 1ZGLA 1GPOL 4Q56A 4GI6A 4DOHB 3BP6B 4KZ0A 4MSWB 1PY9A 4G5ZL 1OWRM 1RQ5A 4PRID 1I1AD 2BIHA 2EAEA 5KJRL 1I75A 4WTQA 3QNYB 4Q97A 1AD9A 3OKMB 4PVMA 5GGSB 5BS0E 1ZGLP 5T3XE 3CC5A 3QNXB 1FYTB 3PXJA 4JQIL 3DJSA 5E5LA 2G60H 2X4OA 1EJFA 4NHCL 5T1MA 3X14B 1X7QB 2M83A 1FV1A 5DSCA 3Q8AA 3VCLB 5DHXB 4AIOA 1YECH 3ULUH 3UTQA 4XPGH 4JK0D 4HIHA 1IL1B 1UWGH 4HJ0D 1FA4A 2MIZA 4XN1A 1OAYH 3E8UL 4DTGL 2FX8L 2LOEA 4LK4A 3U83A 3WIHL 4H2AA 4LF3A 3FQXA 3RWFB 2VDNB 5F1NA 1KCVH 3ULSB 2IH3B 1BMGA 3FHEA 4EUPH 2XQBL 4HK0B 2JXMA 4KO7A 4Q6IB 4HKZA 3IU4L 1EGJL 3GYRA 3Q13A 3UGXA 4BFEA 3IVKB 1X4XA 3FB5B 1RUAL 2O30A 1BAFL 3M7FB 3QEHB 2C4FU 3GEWB 5C3IA 1TO5A 1NCDL 2AITA 3UC0H 3D07A 3DXAA 1BAGA 5ILTH 3L4UA 2F1BA 3MJ9L 1MWAL 4FKHA 4IRJD 3NH7L 3ZKMD 4ERSH 2QQKH 1EBPA 5I5RA 4NP4H 4PUBH 1D5MA 3W5MA 1TQWA 3NCMA 5C0ND 2IWGA 1DBMH 3T3PB 3BAWA 1J9TA 3AREA 1JGUL 2DTMH 5ID0A 3F7LA 4JFFB 1JS4A 5GISL 1AIFA 1JERA 2W1NA 2Q8BH 1IGIH 1OGAA 1UZGA 4A2HA 4TS6A 4CAGA 4WV1B 2EDKA 1CD8A 1IFHL 1F1DA 1HCYA 1UYWH 3HUJF 2K8MA 5DUJA 1NFDA 2Q87A 3L3KB 3I9GH 1OCOB 1KLFB 4HC1L 3HE7C 5DZJA 5IBUB 3K8KA 3ESOA 5BQ7B 1FGNH 1YEFL 2RH0A 3CSFA 2OR7A 3Q3GA 4HIXH 3EKCA 4YHPB 4AL8H 1AHWA 1YUHA 1IAKA 2CA4A 4Y1AE 1QD0A 2WBJD 5HYQB 4WUUD 3OV6A 2NYZA 1MSPA 3HZYA 3K1KC 3OL2A 4FF9A 4MB1A 2VO5A 3MLZL 5TF1H 3BAEH 1TETH 5CBAB 4FXKC 2X4QA 3G04A 4G9FA 3VQ2C 1U8LA 3LZFL 2X9YA 4PRDB 3X3GH 3ARDD 1YQ2A 2WVSA 2GJPA 5FYLD 2P8PA 3R4DA 3O2VH 3APNA 2CHNA 3CH1B 3HAEB 1J0YA 3GDBA 1RUQL 1QI4A 2F54E 3GXMA 5J13C 4OB5H 4P57B 2AAAA 4S10A 3L6FA 3WEXA 4Z7WB 4BXSV 5BNXD 4Q9QL 1CR9H 2ZCKL 2WIMA 4XVSL 3U2SA 1P7KA 3J07A 4FFYA 3BH9A 4TNWF 3WENA 5CR1A 1RIHL 4UV4H 5J1TC 3DPBB 3GBNL 3VXOA 4DP5X 3FPYA 4AZ8A 1H15A 5ANHA 1D2PA 4WY7H 4BWWA 1CD1B 4P2OC 2OL3L 2L7QA 1UH2A 3CLEH 4OZHA 4ENEC 4IRSB 1EZSA 2RAMA 1BLNA 3EUDA 4K3EL 2EUWA 4YHNB 2FGZA 3DIFB 2OJEA 3OLIA 4GQ9L 3RGVD 4NQVB 4Y16C 2DMCA 2X6AA 2WXIA 4K07A 1W8NA 3NN8A 4IQHA 5T1KD 4JY6A 4KO9A 1F90H 3CSGA 2XYCA 3WEBA 4D3CH 1UUSA 1DCLA 2WBWB 3II1A 2FJHB 1KY7A 1T5KA 5ECJE 5JUEL 4NO0A 5KVDE 4EZKA 5JXAH 2DI8A 1G6RA 3EH5B 3FUEA 1JFQH 3ILPA 3LRMA 1HS6A 4HEPG 1UEMA 2ZSWB 1KSRA 2HN7A 4LGPB 4X4YA 1JPEA 1HL4A 2OR9L 2YAEA 1OGTA 2BO0A 2YD1A 5CLYA 4HWUA 5ERWB 4KBPA 3WY2A 2X2YA 4CVUA 1PQZA 4HAKA 1EAOA 5LAXB 3IRZA 5D93C 3W0WB 5C0JA 4WI0B 3C6LD 3D3VB 1FZMB 5C0AB 2MWCA 3IJSA 2H0FA 5EBMA 1C5DB 4WI3A 4L8SB 3SQBA 5EF0A 2HPOA 5E6ID 3MA9H 3RU8L 2VDNL 2E47A 5DZVA 1WBXB 2DH2A 5MI0C 4JZOB 1T5WA 4X42A 3V5HA 2X4TA 4ZMNA 2QHRL 5BO1L 2BZDA 2WYHA 4BK4A 2A74A 4EVNA 4ORGA 3WU1A 2AJSL 3DV4B 4XP5H 5SV4A 2YOAA 1CFTA 3RVUD 5T1JA 4QMEA 4D9RE 3SY6A 4YHKL 4MXWL 3NJNA 2QTEA 4LAQH 3VXUD 2E4FA 1NCGA 2OW6A 1QI3A 3WV0A 5FAAA 3RPIB 3MNVA 4ZODA 1NFDE 1KCKA 3U6XA 3NJIA 4ODWB 4KC3B 3BSGA 4TNGA 3B6SB 1K8DA 1I4FA 4NPYA 3QA3B 3QG6B 5IK3A 4ZW7A 2VDMH 3FZUD 2VQ1B 4BSWA 1BFSA 1JXDA 1MW3A 2CGRH 1G5GA 3WXVL 5DZLA 1H3PL 1NLDL 4GRLD 2NW3B 5SWZA 3WO4B 5IVNA 4JE4B 4G1MA 1FHGA 5DD3L 1LO2H 2QV4A 5FC9A 1NBCA 2I5YL 4FNSA 3P4LA 4R4FL 2P5WB 2NX5A 1OF2A 4ELME 3QB7C 4AQ8A 3NTCL 3MV8D 4PS8A 3OZ9H 2WANA 3OLEA 4PJEE 4PJCF 2DEYX 3AXIA 3DTUB 3FO0L 3IM1A 5DS2A 4M9OA 5GGTA 4LVHB 5DUBB 3O6FC 5DT1L 4JRXA 1XF3A 1QWNA 3L16A 3C2AL 5GS1B 4Y2DC 3F6IA 3QI9B 4HSAC 3PF2A 4GW5B 5CMAA 5INDB 4JZNB 2WWMD 2QSCL 2IFGA 3K1DA 4AGLA 3BGFB 1FFOB 2YPKB 3FRUA 1E4WL 5INCA 4EKJA 1F4AA 2VDKH 2B1HH 1A25A 2NY3D 3O9WD 3QWOA 4NO0D 4TLUA 4UDUA 5H37A 1WTLA 2UX7A 2H3NB 2VMFA 3W9EB 5FV2A 5IM7A 3H9YA 3W57A 5KTEH 3FO1B 4DFIA 5F1OB 4HPOL 5CLXA 2RFXA 3V8CA 1CG9B 4Z0BL 4R8WL 3V0EA 4O02L 3IAGC 2ETWA 3QFJD 3AW5A 1F6AA 3FHAA 5BUPA 2D03H 2R23B 4UTAH 1VACA 1WPCA 5I75B 2H2PD 4XPGL 2QKIB 2X2HA 1VLXA 1L5GA 4R4BA 3MGOA 1T1ZA 2HKAA 1TQSA 1IQDA 5HJGA 2ZX8A 4NQXA 4HUUA 4K7FA 3T09A 3T4AC 3DWTA 1ZVHA 3PHOB 4CC1A 2D4DA 4KH9A 1JXFA 1UZ8B 4LE8A 4OZGB 2PO6A 2DWEA 3H2PA 4ONGH 1EV2E 3D30A 1KB3A 4F3FA 3R7QA 4H8UA 1MVYA 3ZT6A 3Q9PA 4M7LT 3VXUA 3P4NB 5D7IA 4DW2H 4OVVA 3F5WB 1IUZA 2UWEB 3OAUL 5TPWH 2DPKA 1R1CA 2MQ0A 2YC1B 3TYFB 1NGZB 4NP4L 4PUBL 2AEOA 4KROB 3DRQA 4GKLA 3SDAC 1F6FB 3BUQA 4WU5A 3LQZB 2EDQA 2WLMA 4NIYE 2DH3A 3UTSB 2UVFA 2IGFL 4PJ9B 2ZUQC 1DBBH 2NY4D 1NPNA 2RFXB 3F7YA 1D9KA 4HUWB 5KBDA 1FL6B 2CSPA 3S36L 4WHCA 2VLJE 2AGJH 2VXSH 4FMKA 4JFYA 1P4IH 1PG7X 4WFFD 4YBHA 1SYSB 2WLLA 4YHLH 4DP9X 4DFHA 4E9XA 1V55B 3G6AA 5AB1A 1KPUA 1KCWA 4ZTPL 2A6DA 5LLIC 1QO3A 1IEHA 1QSEA 3LN4B 4F8QA 1BBDL 6TAAA 3TIDA 3FO2A 3QIWB 3VGBA 4H8PA 2VJ0A 3LPWA 2ADGA 5F8RC 5EIIG 3T8MA 2ZKHL 1CLYH 1D5BB 4JUTA 4DKFL 2AHIA 3OKYA 4DZ8A 2CIIA 1ZT4B 3NT0A 2D7NA 4NQVA 3F58H 5DJ6B 4NZJA 4JM2F 3ABZA 2X3AA 3ZYJA 5EEYA 5AKSA 5ICXB 1QBMH 1KJ2B 5BRZA 5D1XB 4XP1H 1DJSA 1ZDSA 2HUEA 3QJFA 2X6UA 4XCNB 3BDYH 5FR3A 4GG6A 1MW2A 1QSFE 2G5RA 2O6DA 4XP4L 2ZWZA 3UBFA 2DB8A 3K8MA 5SWZB 2NNAA 3BUYA 4PY8I 1IB5A 4KKLD 4XGZA 5KYNA 3ZDWA 4LCIL 5C0AD 2FO1A 3FXIC 2CLVB 5C0DA 3UTSA 1IU1A 2C3GA 4ODUB 4XCYA 5SX4I 3SDDA 4NZUL 2D3NA 1KC5L 4LASH 4K7PL 4JPIB 3PGFL 4OGXH 5EHFA 5KYXB 5JHAA 1J10A 4NFBA 3ZR6A 2PW1B 2N3JA 5IMMB 1F2QA 4NJ9L 5ACZB 5CKAA 2PP9A 1U6AL 4RFNB 4XPBL 5AEAA 1MWOA 5GJSL 1CE6A 4D9QE 1SOQA 3WN5C 4JO4H 4NHUB 2WJ5A 2GI0A 4FQ2L 4U1JB 4N2BA 1JZGA 4X8GA 5FDWA 3ENEA 1N0LB 5T1KB 2CU9A 2X4RB 1JI2A 1LO5A 4Z7VE 4BSJA 1B0GB 4HS3B 2E75C 4OIIL 1BD2D 3R7RA 2HLAA 4G9DB 2CE6A 2NNFA 4CKVX 1CT8B 4OLUH 1E3XA 3MHZA 1CFVH 2JJSC 3FPXA 3L95B 4X9GA 4ZPTB 4PWIA 2WQVA 3WNJA 1D6VL 4Q6IC 4M7JH 4BCZA 1FGVH 4OGYH 3EJCA 5I6LA 2BVQB 5I23A 2VZOA 2WXNA 2G3MA 3KBPA 1M1XB 1LK2A 1ZTXH 4M3HA 3RWCB 4LCYA 4BQBA 4KKBC 4Z77A 5AOKA 2NDGA 4PV1C 2HT3C 3KLLA 4YSPA 2D0FA 4AYMC 2E8YA 1MOEA 4Z76B 2AJVL 1OTUD 3EDJA 2XACC 5I82A 1XDTT 5D1QE 43CAB 1AI1L 5F7UA 4GQZA 3RIAF 2V2XA 4ZQTA 3C60B 4N2FA 1A14L 1T5WB 3LKQB 1E6OH 3I6LD 4UINH 4JFHE 4JG1H 4YUEL 4R7NA 1AQHA 2IWKA 4UOW1 2JFCA 3J2PA 1YEEL 3TEXA 2F15A 2C9AA 4Q4IA 1VF5C 2ED8A 1WAAE 2DAVA 1VFAB 1W15A 3L4VA 5C6WH 4M1CC 4N2MA 3SPVB 1JNHA 4ZUWB 1NWOA 4HJGA 4GMTL 4O5LH 3RNQB 2P26A 4YDKL 1HSBB 2UWEA 3U0TA 2F53D 2ZOOA 4JRXB 1E5ZA 2EIDA 2J8HA 4J6RH 1A3QA 1XF5B 2WGNB 4HK3J 4ZT1A 4WI7A 4P4KC 5MEQA 1BF8A 1PG7W 4GKNA 5BV7H 4N24A 5ABAA 4L1DA 3Q6FA 1MCOL 1WICA 1T1WA 4O02A 1KFAH 5EO0B 4M48L 1JIBA 5EEZA 4HZ1A 1HWGB 2JCWA 3U7AA 3BZEB 3DHJA 3KLAB 1K3IA 1XZ0A 3RFZA 4NQXB 1LHZA 2XJKA 1RZQA 4U1KA 4JPQA 4BV1A 1HWHB 2ZWLT 1V7NL 5L2KE 3K46A 2JKJA 3L54A 2ZKMX 4RGMB 1BXUA 2MTPA 4BHUI 1JXJA 2BIQA 2K4AA 3RVTC 1WK0A 4P23A 1F6AB 3IRPX 5ETUB 3D08A 2ESVD 5LG1A 2VQ4A 3NDZE 1BJ1H 1BVKA 4N25A 1M9SA 5EU3B 3WE1A 1AD0A 1NDGA 1U91A 3O3AA 3FUMA 4QR7A 5GRUH 4A2LA 1TZHB 3H4FA 2EIKB 5DT1H 4EJ1C 3WJMA 4PGDB 3QPKA 3RIFF 4TSAH 5BCAA 3UTZA 4MDJB 1ZT4A 3V52H 5TE4H 2Y5TA 3NABL 4LGRB 4UQIM 1PW3A 4LU5H 3VMOA 3OQRA 4GW5A 1T7XA 4MJID 2Y2WA 3L4XA 4IBZA 3B9KA 4W9FC 4GAYB 5E7FA 1ZT7A 4G6JH 5EMYA 1OO2A 3SDCA 5SWSE 4W9GC 3Q8CA 3NIGF 4L0ZA 2XQ0A 3MX0B 4JCLA 1R46A 5EZIH 1VEMA 3V6ZA 4ODXA 3BWUF 4XNXH 5KS9E 2L7EA 3SE3A 4X4MA 3IJ8A 3P9LA 4PVNA 1J1OH 1RUPL 4HC1H 2B16A 2R1XA 3FOLA 4M61A 2DQGL 4PJAA 1F3RB 1D5RA 2B14A 3EUUA 3PDOA 4EI5C 2WCGA 3KPRB 3HVDA 4TL5A 5IB2A 4YDIH 3L7FB 4X50A 1YEEH 4E41D 3WDHA 3O45A 5I1HL 1NKOA 1C5CH 3DO3A 3V0HA 2Y23A 3BWUC 4R97C 4WHYH 1G7LA 2CO1A 4Y9GA 5I1DA 1WCBB 3GRWA 2P46B 3N42F 1S5IH 4PWFA 4Y1TA 3ULVH 3LEXA 2WINA 1PLGL 1E9QB 1G7MB 3GSVA 3IXTA 3GNML 1TQCB 1MJ8H 3FB5A 1SPDA 1MCSA 4CN6A 1R3IH 4OUUA 2JKSA 1N5AA 3ESPA 5GGSY 4RDQG 4QJ5B 4OI7A 4TPRL 1N18A 2DQDL 1S2EA 4JRFA 3U0PA 2VLKA 1AHWC 1WDAA 3DI2B 5GIRB 3WFEH 4AGPA 4PIBA 4CA4A 3S8WA 1G1YA 1KTJA 3T3PF 1MEXH 3IJHB 4M7ZC 1G6VK 4BIKA 2IQ9H 3VWKB 4DGIL 2CHDA 4QHUA 2AJZB 4UIMB 3RWJA 4KXZH 5I6MA 2XA8L 5GGVY 5LUMA 3CH8A 5DK0A 2XZCH 4JN1L 3PDDA 3HN8A 4XAWL 3TA3D 5C0BE 3LNFA 1RY7B 3H9SA 2WQ8A 5GRZA 2Z8RA 2X2IA 3SYQA 1KJVA 5EIVA 1EXUB 2FTAA 4WK4B 3UMNA 1YQVH 4MFHA 4NHUA 3UYRH 4LRIA 3TT3L 3ZE1B 4CDHA 1RI8A 5T5FH 1Q1JH 1SYSA 4Z7UA 4B60A 1MCLA 2GIYA 4QCIB 5J4MA 4HWBA 3T0DA 1F90L 2X9WA 2Y3AA 4M4RB 4R5XA 4XCCL 4PRBA 4HLZH 5AAWC 3JV0A 3OF6D 1ESOA 5E51A 5M94B 4M6OL 4R83A 1ETJA 5D1XD 5JXAL 2QQNL 1N12A 3QUZC 4XMVA 4MMYB 2EDJA 3V6FB 5ESQA 1BQHB 3NMEA 5KYXA 3W5NA 1T03L 2DV6A 2HFFA 3WO4C 3OHXC 3OJMB 4OCSH 3N0AA 4LSQL 3U6RB 1QFUH 4WW2C 1CFNB 1XGRB 2PXYA 1RJCA 2BMKB 3IPFA 4FXKB 3P4OA 4UCFA 1YYCA 3QUYC 1TU2A 3VQLA 5E1GA 2PWFA 3QORC 2F54B 2W94A 2IVFC 4LSTH 2YFNA 3BWZA 4XP1L 3THMH 1FIGH 4U1LB 4PD4J 4A6YL 5HD8C 2CJSA 2Z34A 1GS7A 3KPOA 5J13B 3FDWA 3BD5A 3JUYA 4LVHC 1YNKL 3K4AA 5IP4A 3AT9A 4XHQA 3WAJA 5IEHB 4QO1B 3S3SA 4GW4B 1MCWW 1PU0A 3NA4A 5DJAB 4PJHA 5ITBH 1NDTA 3JV6A 3TBYA 3VX1A 5K59F 4J3TA 4EUPB 1LVEA 5I1LB 3WMQA 1ZS2A 4HH9B 1UA3A 2HT2C 3NIFF 4GT7A 4WV1C 1JNHB 1MJ8L 2FD6H 1ED3A 4NO2A 1EO8H 2Y3NA 5IMMA 4YDJB 2O6PA 4MXVE 3IPBA 3PNWA 2VLRD 3EGSA 3UYPB 3VFWB 2ESVB 4G6KH 1KTCA 5LGHL 1FE8H 3MNMA 1E9OA 4N85A 1QATA 1HZHH 4L4VA 3QORA 1XF4B 4ZUVA 3LKQA 3REWA 4Y4HD 1Z9MA 1OQXA 1UZ6E 4R7LA 5EEWA 2BINA 5BQDA 2YXMA 3E6FB 5I8OH 1M57B 2KPWA 1F56A 1MPAH 3P77A 4H8WL 5TH2A 3BPLC 4HBCH 1MW1A 2NY0D 1AKPA 4HXAH 4X7CC 4FZ8H 1VADA 4B96A 2BWDA 5DLML 4HSQA 5JORA 1KENH 2Q20A 3BIKB 1DFBL 3VU1A 5HYEA 4N1EA 2FGWH 2CXGA 3G5XB 4QRPE 4JANA 3L3KA 3F83A 2YAOA 5CSGA 1I8IA 3PQYB 1FBIL 3AG2B 4L8SC 3G5VB 2DDQH 3QUMB 4OM1H 4WNQB 3GBML 4JPVL 4F1ZA 1BBJA 4DZBB 5HI5D 4P46A 5IFAL 2ZUYA 1I8AA 4F8LA 4J8RB 1Z5LB 3NQKA 3QIUB 4B97A 5LXGL 1WBYA 3LEXB 4P2OB 3AREB 2E86A 3KPPB 2JV6A 2EYSA 1G7LB 4HBQA 4YK4C 4ZX5A 4RFEA 5FO9B 3FL7A 2YS4A 3DBSA 4AQAA 2A6KA 3LPGA 3RY4A 4WLCA 2JB5L 4YVNA 1UGNA 5ALCH 4JFDE 3VGAB 2WXFA 4MCYA 4N2OA 5C07B 3ABLB 4QRQB 4XNDA 1NBVH 1OT1A 1U8MA 5CGTA 2F2HA 1T4WA 5GZOC 5TQ2H 1AFVH 4I2XE 3W11C 3C08L 4DKEH 5J57B 3FUJA 1NBQA 3OG6B 2H2SC 4G80B 4I48A 4K55A 2CKBA 5IROA 1XSOA 1G4MA 5BS0B 1T4KB 1DVFB 2ZCLH 2XWJB 3G04B 4G9FB 5D7LE 5I1GL 5LGKA 3S5LG 1BEYL 5IR1A 5L2KA 1CD1A 3MRPB 3MCLL 3NIDF 4ZW5A 2CR0A 2EECA 1ZT1B 1QBLH 2K6ZA 3HFML 2VDOL 1EO5A 2HFGH 3DROB 4A63A 1KV7A 1FO0A 5FKAB 2F08A 1CBJA 3FTYA 2W0FB 1KJ2L 4A68A 2F7RA 2D3JA 2HVKA 3TN0D 4J5VA 2VL5A 3D85D 2JCCE 1JGLL 4LESA 4EN3B 1F4YH 1U91B 3IE4A 1C5DA 4R3SB 3SQBB 2OFQA 3LAFA 3Q5TA 3EADA 3L2MA 3NCJL 2YAQA 2M2DA 5DQJB 5SX5K 3VXMD 4X8XA 1DO6A 3ZXAC 1A64A 1YJDC 3UIZA 1SEBA 1D2OA 2ZX7A 2WXGA 3QYNA 4FNQA 1GIGH 3TBSA 3U4AA 4CVZA 4DGUA 3VXRE 3T2PA 3FB7A 2H3NA 3W9EA 2NYYD 1H19A 1VKXA 1JK8B 4GINA 1N8ZA 2H32A 4Y4FB 4UMGA 5H35B 5CEYA 5J5EA 4AYBA 4QCIA 1K3ZA 1N3NA 4JZNA 2A1WL 4ELMF 5JZ7C 4XOAA 1JP5A 4UT9L 1KIPB 2FX9H 2GUYA 4NSKB 2O5ZH 2WXOA 4E41E 1CR9L 4JFDD 3DYPA 3KZ8A 4LQFL 4DGIH 1G0XA 1S3KH 2WZPA 4FA6A 3ZE1F 4KWUA 4RMUA 4UQ3B 1G6RL 1RZ7H 4U0RC 5FW6A 3RFZC 4L29A 4MB3A 3VFGH 3SDYH 1FPTH 1ZAGA 5FLUA 1OSPL 1ETB1 1WV7T 2AZAA 2NX5B 5D6DC 3WS3B 1RURL 2BSSB 4AG4H 1HVXA 3CIQA 3NJKA 4XXDB 4C55A 3HG2A 4B5EA 4P4KA 1I9RL 5F9OL 2Q6WB 5DQDL 1N8OE 3FSAA 2QKIA 2VLKB 4NQEA 4Z7OB 3VYOA 5GGTH 4MA1B 3QW9A 4MWFA 4UTBL 2YSTA 1NGQH 5GS1A 2OCFD 4IOSD 3O4LD 2EEDA 2X89A 5C0NC 4YL4A 5E7BA 3K71A 5DVLA 2ATKA 3VXMB 2VABB 3BPOB 1QPKA 3OKNB 3AY4C 2ITEA 4LOUC 4WI5A 3TVMC 5E4IA 3R4RA 4Z7VF 5C97A 3RPKA 3D0VA 5KYUB 3TFKC 2QQQA 1C1EH 4TUOB 4RNRA 1AQDA 3N42B 5MHSD 4AEHL 4WVRA 1FNLA 4X6DB 1D5IL 3CG8A 4AYEC 3G6JA 2G9KA 3ETTA 3IYLW 5DI8B 1YEKL 3K6SB 1XVSA 2V5RA 4ZUSB 1XZWA 4P49A 1KBBA 1BWMA 2EDHA 3O41A 4KKCC 2WV3A 1H5BB 2YN3A 1A7OH 5CZXC 1JHLL 2BS71 1L3NA 1X9RA 4K71B 4L29B 4M6OH 4IRJA 5HPOA 4J4PD 5E8OB 4YPGA 3S96B 4GT0A 4M8QA 3FRPA 2OYLA 2X2JA 1MAJA 2I9TB 1QA9B 5JPNA 1FGVL 1NIBA 4L9DA 3ZY7A 2DIAA 2KQMA 1B6DA 1A0QL 2IMMA 3HR5A 3FU3A 3Q7JA 2BFGA 4YBQC 5A2KH 1HZHL 4F9PA 3TFKD 2OCJA 1XGTB 5KVFH 1NUFA 5EU7C 3DYMA 3KCPA 5A3ID 1F4WH 2Q86A 1SEQL 1ZHBA 2CUMA 3AS2A 3CLFH 4BWTA 1BDYA 5KSAD 1E8YA 3KYOA 1G6RH 4RX4D 4IKLA 2EIBA 1SGKA 1TJMA 3PIQA 4WUUB 1RU9L 1RZFH 3ZTJH 5AOZA 4ABVA 5CJ5A 2XWCA 4LPWA 5AL8A 1HCVA 1R0AH 2ZIDA 5ITBL 3OB0H 4KDTA 1TJHH 4I18C 2VL5B 1ZA3B 4OY9A 2CDGB 3MJ7A 3ATDA 3O3DA 4HK3N 1BFVL 2WBJA 2DWEB 2WZPD 3DHUA 2AP2A 2W0FA 2NXYC 2X70B 3L9RA 3RZCC 3GTTA 3S35L 4B95C 1HSAB 1ODAA 4MD0A 3B9DA 4TQPA 3HHSA 4Q2ZA 4D0BA 3WNNA 5HHMD 4ENED 3RHWK 4L1LA 1U41A 4PJ8A 3ZE1E 3VWJA 3GMQA 3CXDH 3PAVA 4OAWA 4YO0A 4HALA 2R29H 3LHAA 1P5UB 4BK8A 4JO3H 5EBWA 1QA9A 3OMNB 3P0VH 4KRPD 2Y7SA 3UP1A 1G7HA 3SO3B 3FO9B 1J5IA 3BIAX 5ESVA 5ACMA 1BFTA 2NNCA 3QS3A 4G42A 4PGEA 3UZVB 5C07A 1F2XK 5LGJB 1P5VB 2OTWB 3FT4B 1ZLSH 1MDTA 2R0KH 2ICES 2ZOTA 2CHXA 5DLMH 3UZQB 1JPSL 3NK4A 1TQCC 1BLIA 1PD0A 5IF0A 4WFEE 1E43A 1V8HA 2V9RA 4HQQH 1Y6NR 3OSVA 1AXSB 5FHBH 4HMDA 4Y2NA 2YWYA 1NBZB 1MH5B 3WUWG 3KVQA 4X8JA 5DD1L 1ZLVH 1L3WA 5D7IF 4K7PH 3MCLH 2VUYA 5B8CA 4KJQC 4OJAA 5BZDA 3QUXB 2X1XR 5A16A 5KBKA 4G8GA 3U79A 4H13C 3MAWA 4XO3A 2MQGA 2VB5A 4LBEB 4MCNA 3GUTA 2SODB 1Q9WB 1INDH 3L7EA 2IC2A 1REIA 1UJ3C 2VRKA 5I74B 1F0LA 5FO8B 1O6VA 1WHPA 4QWWD 5AG8A 5I19H 1RLWA 1NBVL 3GMNB 4RMWA 5DRZB 3FMGL 3UDWC 2H8PB 4KXDA 5AQ0A 4WSKA 3FTXA 3QXDB 1CG9A 2FR4B 2NR6C 1D5MB 3OAUH 2YMXH 5TPWL 5EBLA 1DVSA 1U0QA 4LAJH 4G5ZH 1I8LC 1FG2A 2EXYD 3UABA 5I1HH 1WEJH 3VFMA 4P0DA 4JPIA 3BKML 1W2KT 3UTPE 2XTJC 1G7PB 3P30L 4JQIH 1PKQA 3SGEH 3AG3B 1ZA6B 3S2CA 3V9FA 4Z0XA 2X4UB 4N2CA 2NNAB 4EI0A 4X6DA 2O5NA 2CDEA 2B0SH 2Y25A 4F33A 2A1WH 3O3BB 3S36H 1OTSD 4YR6A 2ORBH 1EK3A 3V6OC 4OCMC 1CLOH 1MCQA 3HG4A 2OMWB 5F0JB 3WJMB 2GFBA 4BFRA 1IT9H 1TUPA 3FFDB 3IMSA 4UOJA 5IVZA 5GXBB 2R2HB 3HNVH 1UVQA 3BVNB 1AZUA 2HFEB 3MA9L 4CMMB 1PX4A 2GJ6A 3ZQXA 1PNDA 4DPCX 1RL1A 3UEZA 1RZ7L 2G3XA 2R15A 4Y2OA 3TYGL 4V2CB 5EC1A 1U8CB 4P9ML 3WJLC 4JY5H 2CIIB 4A2MA 2JSFA 3DVNA 4TUJB 3OR7A 4HJ1A 4D9QD 3H53A 2XZCL 1AS6A 4K4KA 4MA8L 4QXVA 3TNMA 4C4KO 5I6XC 2ZAIA 1QWUA 2Z31B 3KPSD 2DQFA 5L4MA 4Z8FH 3UC0L 1CK0L 3MJ9A 3OAYK 4HS8H 5D7EA 4ECNA 1R4XA 1KTBA 1L9QA 1C16A 4QF1A 5C9JB 3EF7A 3O4OB 3Q1SH 2R9HC 5D4JA 1CBVL 4X6CF 1GHFH 4LBAA 1CT8A 4QKTA 3Q43A 1QASA 2F9BT 1YYMH 1MFUA 1XIWC 4ALAH 1B0GA 1KCSL 2HA1A 2MSPA 4ZFGL 2CDGA 3UTTE 4HLJA 4C83B 3MLXL 1JAEA 3QPXH 2EE3A 3IF1A 3BSZA 3KPLA 3T9WA 3GWJA 2MOGA 2VR5A 5KANI 3QFJE 5H37G 2PPAA 4Y2DD 2Q7YB 2YPVA 1T1YB 3MX0A 1C1EL 3ARBB 5C8JB 3M45A 3S4SA 4HK0A 5PAZA 2B9BA 4P23B 5ETUA 3RX7A 3MLWH 3QC6X 1OCRB 4WZ9A 1R5IA 2YLHA 3NIDE 1VZGA 1TVHB 3QUML 4PJIB 4I88A 4MMZB 3OKOB 4IHOA 4IU2A 3WMSA 3DOHA 4K3DH 3CXFA 2WCSA 4H8HA 5TE7L 4L5FL 1WP6A 4NENA 3VB9A 3QHFL 4X9IA 3AWGA 5E5MB 3KBHE 3QCUH 3IJEB 4XNUL 2K6WA 3OPUA 1JWMB 3PJSA 3VWKC 3F65A 5HVHC 3NACL 3QQXA 2N7AA 4JRYE 4ZMVA 1Q94A 3ARYA 1Y07A 4JO8A 5CKGA 3EYFA 4IDJL 2J8UA 3I6GA 2WXHA 4I2XA 4L5FE 5EEVA 4KNQA 1WH0A 2VSKB 4X0KB 4GUPB 4NRZA 3GIZL 2W9LA 1UXWA 3U0PB 1C8PA 1XCTB 3QEGH 1H8LA 3IN0A 4JL1A 3WE6B 1WS7A 3H9ZA 4N0FA 4NERA 2L7JA 4XPHL 2B9AA 3QDGD 5HHPB 1TFPA 1MH5A 4ZDHB 3RU8H 4UV7H 2RCSH 3WFDH 4U1JA 3T6VA 2FQGA 3I84A 5GJTH 3N85L 3SQRA 3HC0A 5TD4A 3HIZA 1IAIL 1X5YA 5ESQB 1KZQA 2WLYA 4FZEH 3BUBA 5J1AB 4AIZB 4ANWA 5D7KD 1PBYA 2P5WD 2X4PB 5B38A 5IOPB 1NAMB 3O8XA 1QKZL 4WW2B 4GKZA 3LSOA 5D4QA 4AIXA 2D9QB 3GLZA 3VYPA 5I1JH 5HDLA 2IV8A 3TCLA 3QAQA 4HIJA 4NKDA 5MEOA 4LIQH 1XSIA 5JHLL 4TPRH 4LT7A 1CMOA 5HJBA 1VCBC 3UBXI 5HYSA 1A02N 2F5AL 4G7YL 4Y19E 1W9XA 3TWYA 5EA0H 1HT6A 3T6QC 2W88A 3M17B 3NZHL 2A9ML 4K73A 5CF3A 1EA9C 2B2XL 4I5BB 4TVUA 1MAML 3FT3A 2CIKB 3KLAA 1VGKB 3WJJA 1Q72L 3AZUA 4N28A 3MJ6A 2CM6A 3UTSE 3UMTA 1T2QH 1RK0A 4DP1X 2EC8A 1I85C 3KPNB 2Y36H 2EYRB 3O3DB 4JCMA 5IB4B 3WOVA 4J1UA 1RVFL 4X5WA 1NMCB 5ALCL 1MHPH 2BIIA 2G2PA 4UILL 1BQLL 1AD0B 2MH4A 4FKEA 3OM3B 2LLGA 1A7NL 5EZLA 1SY6A 3PAUA 1L9OA 1FL5B 1P53A 1EZLA 5BRQA 2Q10A 3GPEA 3BRDA 5F7MC 3VRIA 5FA3B 3GSRA 5CEXA 3E8UH 5JMOC 4TQEH 5GS2D 4UTBA 5KYYB 1WCBA 3UJIH 5G5DB 3ULUL 4WTXA 3G6JF 2MCPH 3A22A 4OTXL 5EOQL 2NXYD 3L13A 5KOVC 3RZCD 1AXTL 1JWUA 4YDVB 3UTTA 2UY6B 3WNKA 4OKVB 3VA6A 1BEYH 2X1QA 1RCYA 4O00A 4U0RB 3RFZB 4X7EC 5IT2H 1S78C 2A73A 1EERB 4UDTB 1BZOA 1XCQB 4YSUA 4EBQH 5D71H 4XHJC 5B3NA 2V7HA 3HNTH 5B7FA 3RUGB 1BD2E 1KPVA 2WNKA 3IGUA 1HILA 3QDJE 3ZKQD 1B0RA 3MGTA 3LOWA 4I5BA 3V0WL 4OV5B 4JDVB 5D96C 2IG2L 2PTTB 4UB0H 3NCXA 5I1KH 2NSXA 1T20A 2F19L 4G2AA 3WKPA 2VLMD 5FUCE 1LE5B 1KXVA 3S5ZA 1A21A 3MV01 1E0OB 2F61A 3ESVF 1NCBL 2AJ3B 2A6IA 4PJDF 3WJLA 4P06A 3QDME 4R4ND 3HN3A 1BXXA 4FN0A 1OP3H 4OQTA 3WLBB 4MZIA 4UM8B 3ZT5A 4DIXA 1O5DT 4ZXBA 1IGIL 4FRWA 2Q7AA 2VW6A 4BZYA 2QL1A 3V6OA 4NB7A 4JM2B 5D2NB 3WKMH 2VWEC 3EOTH 4XHJD 4LVNC 1I8UA 4OF6A 2NRDA 1A3LH 1WC7A 3I2CL 1VFMA 2DQUH 4U6VL 4XN2A 4Z7QF 1E3ZA 1HN1A 1Z9SA 5IJVA 1QUNB 1OPGL 3B7RL 1OAXH 3FCTB 4ZFZB 5KJ7E 2GCYA 3MREB 3MUJA 3PPSA 3EYFB 4QHUB 2E7LC 2XRAH 1RK7A 3FS9A 3LKPB 4OD1L 4PSPA 3UAJA 3VU2A 3FB6B 3EJQA 2IQ9L 1X5IA 1BZ7A 3BDXA 2CHWA 1NC4B 4ZK8A 5KTEL 2YD4A 5CZKA 2JI2A 2Z65C 3EYOA 4PJ7F 3NCYP 4F7EA 2W59A 4UNTA 2QGEA 3D18A 2ZWNA 4ZMAT 1GZQA 4KAQL 5KSUA 2I7SA 3WTYA 2H26B 3GSOB 3UP6A 5HDQL 1OAYL 5I5MA 1UJ3A 3GXPA 2GBVA 4X4XA 1IE5A 4OTXH 1YMMA 4WSJA 5EOQH 1YNTA 5E4AA 1JWSA 2NY6D 3G9AB 4ONOA 1Z5YD 2NTFA 3KW8A 1KBPA 3JUZA 4L4JA 2PWEA 4DO5A 1IAOB 1IC0A 4B9YA 4N86A 4LHUG 2WP3T 3DX9B 1OAJA 3MOBL 3CZGA 5I30L 4Q6KA 2BY2A 3FQ2A 1KTKE 3FT0A 4LPUA 2OQJA 2WYTA 3BKJH 1FNGA 5FCUH 2HXAA 1MWAH 1AOZA 2VYRE 3MR9B 1NCJA 3MUGA 3X11B 1TZAA 2Y06L 4JKPL 4N2AA 1CGUA 3P11L 4M62H 1S9KC 1TEGA 5EN2A 5FW8A 2GCYB 3MREA 4A2EA 4BSWB 3L3OA 4J2QA 1J8HB 4MXVF 3QCVH 3F3HA 5DO2C 3ULUC 1WQVT 3TPUA 3SIKA 3JWDC 1G1OA 4LLAA 4C56D 5D7LB 5DDHA 3QIWC 4I9WD 5DHVH 1THCA 3VXRD 1WZLA 2E7MA 1C12B 1KG0B 3MJGX 1YZZA 1CXIA 3V4UH 5BRPA 3LN5A 3S3PA 3TCLB 1TTAA 4PJBE 5IB4A 3F7YB 4Q9RH 1MQ8A 3UBGA 2WLLB 2WYIA 1JXGA 4YSAA 4AW4A 3ARGB 4DP7X 4HGKC 3IFOB 1SY6L 2DWYA 2DQCL 1UCBH 1UT2A 4JFQA 1NQBA 3HNSL 3QQ9D 3V0IA 3RDTD 5EN3A 4OLZL 2NTFB 4FFVD 3APFA 4FLQA 4MAYA 4H8WC 3Q5YA 1JJUA 2JKIS 3CLWA 3P77B 3TWCH 3NPZB 4OCYL 1KUMA 4I18A 2G3NA 3QHFH 4FG0A 4RBPK 2VR7A 5DVPA 2H3KA 4JRWA 4XX1G 4XXWA 2ZONA 2AEQH 3X3GL 4LCWB 1M3IA 3RGBA 3V2AR 4HIEB 2E7BA 1QQDB 1F3JA 2AJSH 2AXFB 1RMFH 1HILB 5L9DH 3D2TA 3KS0J 1J86A 4DCQB 4PJGA 4B53A 1UKSA 3CN4A 4P99A 4ANKA 3INUH 2Q8AH 5ADPH 3CZFB 4GO9A 2R0WL 5I66A 2A9MH 2TSAA 5BV7C 3OMIB 2H2PC 3BT2H 1M7IA 3Q5OA 4MNHA 2VLJA 3WN5B 4PEEA 3NGBC 5I0WA 2VXQH 2B5IC 1SDDB 1BVNP 1I3RA 3CX5J 5FFLA 1NIDA 1CFBA 3LVEA 4HAGA 3VFVB 2DKMA 2YD5A 5HGBB 3MOBH 5I8CB 3CFQA 5IHZB 3C8KB 3NSFA 1FF5A 2R2CA 3GRWH 3CUPB 3PFUA 1BVOA 2WLZA 1YEDB 2DZEA 1MCJA 4X80L 5D2NA 1KEGL 2CD0A 4Y4FD 1AZCA 1I1YB 2QADB 2Q8BL 3SB3A 3WELA 2I5YH 1VADB 1W0WB 3BOVA 4V1DD 3DVGB 3ES6B 3QUYD 4WU7B 3MOQA 1SDYA 4UT7L 4D3CL 1XF5A 4G7YH 3KJ4B 2R7EB 2CR6A 4AQEB 3STBA 1Q9OB 4NAJA 4M29A 1A7RL 4AK2A 4B5ZA 4KMQA 1PKQE 3C60C 4FYTA 3LQMA 4NQDD 4N0CD 5GSVB 3EO0B 1NGPH 4QKXB 1D6VH 5DU7A 3OF6A 5E2VH 1BQRA 4KJYA 3RUGA 1VEPA 1SHXA 4O2EB 1A6WL 5FW7A 2X4NA 5D7SL 4WNJA 3EGDA 2A9NH 2P8MB 4K7PX 5I8EB 2VLKD 2Z93A 4I1RA 4KK8D 1GOFA 3HE6A 1AHMA 1MVFA 3KPNA 2OSXA 4Z0BH 1OCWL 3SD5A 3B3IA 3TA3B 5CEYB 1FAIL 2XYBA 4EDXA 3SKJL 3FFCD 2VW4A 4XZUB 2PYEA 1KV3A 5JTWA 2A99A 5E1QA 3DX1A 3MRCA 3MLRH 4E42B 1A66A 1L6XA 2CM5A 5E9AA 5JA8B 3ZL1A 1OARL 2AC0A 2FDBP 3BE1H 4HZLA 1PPIA 4JHUA 4YHYB 2FH6A 4CVZB 2LU3A 1OB0A 2XFGB 4ZFOL 1A0QH 3NYKA 3OKDA 3RWIA 3UTSD 2R56H 2E9GA 4IKJA 1PIGA 2DI9A 3RVUC 3UYOD 3KWWB 4RAVB 3UGEA 1L9RA 4IIZA 1KTDA 1OK8A 1U58B 4EXPX 2UZXB 4NM4H 1M4KA 1IEAB 3O4LE 4S1QH 2DQUL 5DC0A 2GITA 2YUVA 3KGTA 5FX3A 5GQBA 3BP6A 4G8GE 2DQGH 2V3FA 3ROOB 4L3CA 3GMRB 1W80A 1AGBB 2B7DT 4PB0L 5C0IA 4GRLC 1YY8B 4HPYH 4KJWD 2YN5A 2BW5A 4N5EC 4E36A 2I9TA 4Y4HC 1TMQA 3NDYE 4DWHA 1BJMA 4OCRH 3S37X 3ZE0B 4K8RD 2I9LB 1PZDA 5FB8B 1IGJA 3OZLA 2YR3A 2BNRA 4XB8A 3HTLX 4NYLA 1IM9A 2AI0H 2EH7H 1RULH 1AGFB 3DECA 5HYJA 3W56A 1KNOB 2K45A 4OJYA 2QGDA 3QULB 3Q8FA 3DOIA 4NRXA 4LF3B 4MDJA 3FAXA 1MCRA 1IRAY 4L2YA 4XNYL 3IDJA 3CN2A 4PGDA 3WIHH 1WJ3A 1HFUA 5HI3D 5MERB 3RTQB 3KMDA 1S4IA 43C9B 1BJ8A 1NGPL 5FF6A 4M43L 8PAZA 1MEXL 2OSYA 5CJXA 2XQBH 5D7LA 1JOIA 5DDHB 4ZSOB 1SEBB 4F2FA 5HGHA 3P9WB 3LZQA 4HUXA 3DRQB 4ES9A 4K2UL 4MD5B 4E9QA 2XTJB 3DXAB 5IJDC 5EUOB 3JWDH 5LQBH 2BK8A 4QRRA 4HMCA 4OT1H 2AEWA 1HU8A 1TCRB 1SXBA 2OMXB 2O5YH 3RVTD 4EI5D 1MI5B 2D03L 4HUCA 5J12C 1TYEB 5EZPA 4O4YH 2OYKA 4WDIB 4J3OG 3LXAA 1RZ8A 5ID0B 4DP4X 1ACXA 4JM0A 4OAWB 3D39E 3K5SA 5EO0A 1P7KB 4MXQD 1KBGH 5IVZB 3TZVA 2VH5L 1UB5A 4IRSA 4NC2B 1PIFA 4OFKA 2OW7A 3P02A 5T5NF 5B3JE 1RUML 3ZYIA 2EDMA 2VLME 3A6BH 3F00A 3UAJC 4QOKD 3MUY1 1T03H 5ICUA 4WI8A 3GSUA 4OCSL 5C0CD 1H3VA 3JWOL 3WCYA 1AR1B 2H2SD 1YVLA 3L48A 3U4EB 3FQYA 2OTUA 3QZLA 3VXTB 5BMFL 3JWNC 3ALXA 3O4LB 3QUKA 4JDEB 1YEGL 3RGHA 2C7UA 2X53A 3T8XA 3EFFA 2KHAA 5E5RB 2VXVL 2XWEA 4YFDB 3GB7A 1G7QA 3U25A 4L8DA 3TN0A 3MV9D 3Q2VA 4PJ8B 3L3OC 5HHQA 2BDNL 1G9MC 2M26A 5AG9A 5CU9A 1ZGLM 1LO3H 2NY5C 4RWYH 3ILPB 3KWXA 4P59L 4H44C 5HSFA 4PGJA 3KS0H 2EDBA 5IQ7L 4U4BA 4D0CB 3IDIB 3W3BA 4OGYL 1QFPA 3GC3A 1DBAL 1GYUA 2WNWA 1A6VH 1XGQB 3N43F 3KW7A 3AQXA 3J8F7 3T71A 1OGAB 4F7MA 3RBSA 3TT3H 3GKWL 2IH1B 4MNGB 2NTSP 3KD4A 1WUZA 2B15A 5MP6H 4E42A 5I15H 1IT9L 2VT0A 2IBGA 4PW3A 3VD2A 2G2NA 4HZLB 2O1AA 4HT1L 3VWKD 2V3DA 3ZKMC 5IHZA 2NCMA 3N1QC 4XMLL 1CI3M 2NMSA 2XT1B 3MRCB 5T3XL 1ZANH 4N4YB 1A4BA 3BKCL 5F0MB 4JJ5B 3OZKA 3DV4A 5HVHB 5J9PB 1I9JH 3P73A 5A2IH 1MRFL 1TPXB 2X4NB 4GEIA 5JZ7D 4NQTA 1PJ9A 3SGEI 4BXVA 5FOBB 4BELD 5L9DL 2Z93B 5T3ZD 1SMDA 2CDFB 2WZ0A 3OKMA 5GGSA 5HGGS 1G7QB 3SYAA 2HKHH 3HC3H 4ODWA 2XY2A 3SE6A 4OJCA 2Y4SA 1W16A 2ZKWA 4DUWA 3CNKA 1HOCA 2FWSA 1BZDA 3MBED 3HJEA 4JKKA 4KKAC 4XP6H 1A6AA 5AW7B 1KJVB 3GXTA 2LE9A 2EJ1A 4X6FB 4WFGE 1CL7I 2BCMA 5DVOA 1GZPB 1MHHA 2X09A 3ULUF 1AZBA 2Z7YA 1UFUA 3C75A 2V0AA 3NA9H 1FFPB 2FL5B 4LMQI 2OR9H 3QWNA 4TL4A 3FQXB 2EYSB 3ILQD 3QQ9C 2E9JA 3RWFA 1LO4H 4IRSD 3IXAB 5L7XL 4TQHA 5JW4M 2BP8B 3NJMA 3VFPA 2H1XA 1XAUA 1W0WA 3AG1B 3HE7D 4Y5VA 2C1OA 3D85B 2WSKA 3EO1A 4NZDA 3SDYL 4FDWA 1P6FA 1SEQH 1ETA1 2VXVH 3EZJB 1GW6A 4YHML 1FNHA 3GMMA 4WFHD 3CFBB 2CBPA 4YWGL 3MOAL 2P5EE 2V5MA 5B4MD 4PJBF 2AQNA 3CFJB 3O6KH 3DV6B 4TSAL 4R0LA 4BDVA 4YGAB 3CSTA 4R96B 4JDTH 3NEOA 3SBWA 4JB9H 5FHAL 1F42A 1H8OA 1XGPA 2FIKB 4UZSA 4S1RH 1G6RB 2ZCHH 4YSQA 3EDEA 4YDMA 1QRNB 4JO1H 1DL7L 1R19A 4HDIB 4LSSL 4P5TA 4ZS7L 4A04A 1DO5A 4WFFE 3RVWD 4I4WA 4P48A 1IFGA 1QW9A 4OQ1A 1RZ8B 3OLDA 4E41B 2Y5EA 5JOEA 5I1EH 3GS0A 4JR9H 2DDQL 4MVBD 3SPIA 4S1SL 3L81A 4WWNA 3U7YL 3VD7A 4RAUB 4JM4H 1JPGA 4DP0X 4U6HA 3ARQA 1ECYA 4UTAA 1UXMA 3BZFA 2YKKA 4MDIB 5D1ZI 1R24A 3SODB 4HHAA 3AFLA 2BLFA 3UADA 4ELKA 2GC7C 3C5ZC 4GXUN 4HS6B 4PGZA 5HYQA 3ETBF 5L2JA 1AKJD 1TQBC 3CVCA 5H8DA 4ZAKA 1ZOXA 3PQYD 3A6CL 3KYNB 1QTSA 5GSRA 5IUCA 2YEZB 3K6FA 5LWYL 4FXTA 2HYMA 3RVWC 1TVDA 4NQEE 3WTVA 4FNPA 4M7LH 5F9AC 4EN3C 4PCYA 2CUHA 4BQ9A 2FT7A 3T4YB 2VLRA 2DW5A 4JANB 3EOYG 1PCXA 5TE6H 1BGXH 1UFGA 2AMUA 3OXSB 4UNVA 4PB9H 2ZCLL 6PCYA 1E65A 1I1AA 4MYWB 2D31B 4KK5D 2HJKB 4CJ1A 4FGMA 2NUTA 5C2BL 3PL6A 1UH4A 5CD3A 1YYML 4YIQB 2NLJB 1T7YA 4NCDA 5TF1L 2GY7B 3L2NA 4BFGA 3F7KA 4Z23A 3O45B 4OZ4A 1E67A 4M6NL 1IZKA 4LNRB 4PJ9A 2XZAH 3FQRB 1OM9A 5BO0D 1MLBA 4ONFL 2KDYA 4ICWA 4PV8A 2OS7A 4ZYKB 4UYQA 1J05B 2OV0A 2OX5A 4F7PA 3NCFB 3Q9QA 3QDJD 3MRGA 4GIAA 1HH9B 4E9TA 3TEZA 1CDBA 1TVHA 4BA0A 3QQNA 4PS7A 3UGUA 4LVNB 4CW1A 4F33B 5IMOA 2ODIA 1VERA 5DK3A 5CLTA 5EU6D 5AVRB 5I18H 2C3VB 4IGBB 1OAKH 3CVHB 4M5YL 1P6AB 2Y5QA 4HJIA 4MQ7A 3DTXB 2EE9A 3ILEA 4F7CA 3R8QA 1HXMB 2VC2H 5LDUA 2X6BA 1N5YL 3K6OA 3CVIL 3U4EA 1HESA 1NCWH 3T2NH 2PN5A 4LSQH 4JJ5A 4BGLA 3D34A 1UB6B 4F3FB 4OLEA 1Q0YH 5EZJA 3NCBB 1N8ZB 4PHXA 4K7PY 3DXAD 2I24N 2UUDK 4AQAB 3D0VB 5IVXA 3MKKA 4L3ED 1X6LA 2ZWYA 3KG5A 4AEFA 1UZ6F 2DLIA 4IU3A 4WJ5A 2ORBL 2IPTH 5AVUB 4GO6B 2ALAA 5DGRA 2UZYB 4G70B 3QGVA 1MHHB 2XVLA 5K1VA 1TZOA 1W72B 2YGQA 5FYJH 4U1IB 1MCOH 5FFOA 1GC1C 5JO5B 3Q1EA 4OLVH 3QDMB 2FHCA 5DD1H 2PCPA 4Q9CA 2FK9A 3BPOC 1CFSB 3LNIA 1HIML 3S8GB 5JW5A 2NY5H 1VZIA 1BQHA 1E6JH 5C1MB 3MRJA 2YLKA 5E00A 5L2KD 4RFNC 2LFEA 1GY2A 5F71A 5GZNA 1AO7B 4NQEB 5A2FA 1GGYA 4RSVA 2OMUA 2WMPB 3HS8A 1GHFL 1FWXA 1SXSA 3P3TA 2D9CA 2E6PA 1WAEA 3TA3C 2H6PA 3QFDB 1QEWB 1I3UA 2W9EL 1HXMA 2C7UB 4LLVB 1EZVX 2WWOA 4ZNEA 2P5WE 1XB3A 2A6JB 1M2OA 5DYFA 5GRUL 2JXMB 4Q6IA 1N3NB 3TPKA 3T6ZA 4A39A 2Q2EB 3MCKB 1G7JA 2HSIA 5F3BB 4GAYA 4LFHG 1RHFA 4F58H 3CCHA 4NKOA 1U4FA 3DUHA 2KC0A 3FFCB 3V5DB 4HBCL 4LPTA 4PRAA 4EQ2A 5BJTB 4NN7B 4PP2A 1WCQA 2JMRA 3FK3A 4OFVA 1YC8A 3QUMH 4RSYA 1DBAH 2XV0A 4MRBA 1LLAA 3OWRA 1GJIA 1E8ZA 2DBLL 2VJXA 5F7KC 1BVZA 4GQPH 3POCA 2RACA 3ZHKA 4RLDA 4XNXL 2QQNH 5J6GA 5CHNA 1PFOA 3HZKA 4LOUD 4BCYA 2QT6A 2KLRA 3NA9L 2NY2C 3QZOA 4TQEL 1HC1A 4PG9A 2WNGA 2F18A 4WEMB 1E8XA 3NBNA 3HZYB 1MHEB 1D5BA 2EZ0D 1F13A 4BA8A 4IMLA 5IB5B 1XBDA 4N0YH 1A6WH 1T1XA 2CBQA 1T6WA 2XJLA 2J88H 3WI9A 1KWGA 5JOPD 1JRHI 1LYQA 1X9UA 4P4KB 2CRYA 2IDCA 1DUZA 5T3ZH 1OP4A 4JNXA 6CGTA 4B9JA 2AJYH 2QVTA 3G6JE 4IBSA 1FYHB 3P69A 3U2SB 5HYJD 4MA3B 4G3YL 3BI9X 5L4IA 3BH9B 5GRXG 4LZKA 3IFPB 1A6AB 2IAMD 3N1GC 4YHYC 2NY5L 4ILDA 1FH5L 4YLBA 4HCIA 4JFFA 3W39A 1KYFA 1MJUH 3KXFE 4LSSH 1E2WA 2P24A 5C0DB 2Y07H 1HL5A 4OGZA 4AWJC 1HEZB 4MKMA 3MRIA 1N4XL 2BXYA 3WFCL 4R26L 4ESKA 4W9IC 1RSYA 1SJXA 3OB8A 3TH4T 3X3FH 5CZVH 3MRGB 4DSYA 5BS0D 1S78D 3EH4B 5I1CL 2AS5M 2D0HA 1CE1H 3PDGA 1ZD6A 4F9PC 5FO7A 5I1IL 3ZDYE 3MROA 4NZRH 1AS8A 4FQJH 3U9PL 1VPOL 5IMLA 2YPLA 1EFXB 2QQKL 1A3LL 4GFXA 4U6VH 4JGNA 2FWOA 2W95A 1T66D 5D5MF 4RRPM 4JDTL 3O6LH 3BP7A 1A9EB 4M5SA 3DX8A 1BSIA 2HJFA 3CDGB 4NNPH 2FE0A 4XPAL 4IGBD 4IIQA 3UFIA 2IQAA 3HG1E 3PS6A 1AHKA 3KHOA 4LLWB 4N9GA 2K70A 1RD6A 3T0EA 2IPUK 2P8LA 3K72B 3BEWA 4O02B 3T3ME 5IESL 4JG9A 4YZFF 3V9EA 2QSQA 3PHAA 3TA3A 4KKLC 4W68A 5CR8A 1KXQE 4P3CL 2BIOA 2MCPL 5EOTA 4J3OF 2KL6A 2QZQA 3H2QA 1YPZE 3PDOB 3RHWF 4YJZL 4D0DA 4FFYH 5TDNA 4PJ8C 4NN5C 2EKSB 4YHZL 1S3KL 1UVQB 2WM0A 3BVNA 4MCMA 4CMMA 3IGAB 1NEZA 1GYCA 1WZ1H 3P54A 2VN6A 1HX0A 2O5ZL 1KN4L 2FT6A 3DX9A 1Z66A 3TC9A 1NGYB 4KUCF 2DWXA 4HIEA 3C5JB 3U36B 3V4VA 2O93L 4WO4D 2XVGA 3PNWB 4PI0A 4WENB 3RY6C 3S0PA 2UZIH 1OT2A 1DJXA 5I30H 5E6RB 3RNQA 1TJIH 1UURA 3DVFA 1KLUA 4R4NC 1AGEB 2VDKB 1OSPH 3GINA 1CDCA 3C2SA 3P0GB 4KKBD 4MAYB 5E8DL 4W9HC 3FSZA 4C56B 3FYEB 4E9SA 5AD0B 5DQDH 3KR3H 1G9NH 1AHWB 2G3ZA 2YJLA 1J0ZA 1JGDB 1SDAB 5M7QA 1VDGA 4JFQB 4PJXA 2F5AH 4WJKB 1NCBH 2AJXH 5I1GH 4MX7A 3UC2A 4RFOH 3BZEA 1MJ7L 4XOBA 4ZPVA 4UOW0 2EYTA 2B2XH 2UY7A 3FCSA 4EE2A 1R3KB 3LS5L 1UQSB 2O6EA 3PABA 1Z6JT 1SQ2N 3TX4A 5BUAA 2AKRA 3BSZH 5BVJB 5CCHE 2Y1VA 5KSVB 3WSQL 2FT8A 2Y2YA 4FADA 3D39D 3LB6D 3MLPA 3LIUA 2I85A 2QPEB 4UANA 3SE4C 3TP4A 2D2CC 5F6IB 1S46A 4I0KA 2J21A 5CCKH 4Z3JA 3VGDA 1SOSA 3EJYC 2OM5A 2R8SL 1KJ3L 4XXDA 5FYJL 3X11A 1TTFA 3ABMB 1Q9OA 1NEPA 2AK4E 1C9SA 4PJFE 3DBXA 1NGWB 3U6RA 4BSVB 1KZYA 4LP4A 4I85A 4HA1A 5ICZB 3W82A 1U8HA 3OHXB 3PV6B 3FRUB 2OL3B 4NIKB 3F2LA 2PP8A 2ARWA 4RGMC 5IW1A 3TCTA 5T1LD 3ES6A 1AXTH 2R4SH 1QP1A 3EDFA 3MMEB 2WMPA 4LCCA 1ROWA 4N22A 5AVSB 4NYLB 4U1SA 1EO7A 4UUJA 3GHBH 2NY7H 5IESH 1CGTA 2OP4L 5F89A 2E9WA 1IC5L 1ZVYA 3ZE0F 3TVMA 2OMVA 1G7PA 4JFOA 2I7OA 5CJQH 4R2GB 3V4PH 3VI3B 1CUOA 3SOBL 5DYOA 5GPRA 4JHWH 1P4IL 2LT9A 1FYTE 3VRJA 1MG2C 5SWSA 3QXDA 4AGNA 2R4RL 5GS1C 4AE0A 3L5XL 4AVJA 5I1LA 1QR1A 1E42A 2VSMB 5CFAA 2RGSA 3VWJB 3WUWA 3CGTA 4J3XA 5FYJD 3VFUA 4EI6B 4FFVC 4MS8C 2DJUA 5ACLA 2OMTA 2BVPB 4OZIE 2W9DH 2EDOA 5I71B 3NIGE 3IDYC 3OR6B 1ETZA 3GMLB 1VIWA 3O2DH 2L4OA 1AE6H 1Q9WA 2OJZH 1CIUA 1NANI 3L7EB 2XN9A 3PU7A 1F3JB 2NOYA 3R8BB 1YQVL 4IK7A 3RL1B 1IKNC 3RG1C 4MAUL 2R23A 4ZX4A 2G4GA 2WK2A 3FFOA 3QXUA 5EA0L 1NOLA 1N7ML 1H6UA 1DQKA 3WFHA 3BUPA 3AGVA 2WC7A 5F9WC 4N2DA 4GUOA 4PGCA 2YPLB 3K8LA 4XMUA 1DCEA 4WK0B 5HY9B 1OQOA 4X8JB 4JFXA 3IFLL 2K3TA 2BY1A 2JCCF 4LGSB 5JPMA 4QHPA 5IQLA 1KB5A 2HLEB 4AYDC 4CC0A 3QSKB 3SCMC 3LKOB 5EU5B 4PLOB 3ARED 4FG2A 2EXSA 4UWQB 1JPTH 4L48A 4BGDA 3A21A 3W9DA 5JXED 2XV6B 4B9FA 4PP2B 2RQEA 4F93B 2DEWX 4FQHA 4Y16A 3B1TA 2F0CA 2W65B 4GNKB 3LHPH 1SVBA 3RA7H 4E0RB 3RWDA 3FQTB 3IFPA 2ARJQ 5F9DC 3A4DA 4CL7A 3I75B 5H94A 1HOEA 4PN6A 4K0OA 4Q2ZB 3IKKA 2CLRB 3TH2T 2BP3A 4D0BB 5BVPL 1TZHA 5A2LH 2KKQA 1R3HA 3LKSA 4YNYB 1OF2B 4V1DE 4P2OA 2N7BA 3DDFA 1DBJH 4WI9A 4YK4B 1CFVL 4W6YB 4AM0B 1T6VN 1CD9B 2ZUSA 3F7VA 4B9PA 5MENA 1BPVA 2AV1B 4R26H 1EHKB 3QK0A 1BPLB 4PBVC 2GBTA 3BQUB 4MQXC 2NCEA 3OKLB 3CZSA 1E40A 3FSVA 1DDTA 3IDGA 3BLPX 4PJGF 3K0WA 4JHWL 3N50A 2OCCB 3PAZA 2MEJB 5IHLB 2ATAA 1XIWD 4L3EB 1ERNA 1UXWB 2HUHA 5I19L 5BOZG 2L3BA 2VABA 3HS0C 1BZ8A 4QOKB 2YC1A 1CXLA 1DVXA 1TYRA 4HUXB 3GXNA 2E6QA 4RZCB 1KDJA 5DZPA 2R51A 1YJDL 3ZL2A 4NDMA 5HGAA 3HRPA 3EJZD 4A7GF 3CHSA 1JK9B 4JQIA 3SGKC 2JJWA 3Q8EA 2ZOLB 2BHYA 4U7KA 5I8EA 4FQCL 1AGDA 4XH2A 4JFEA 2FH8A 5HYJB 2B59A 2HVBA 2N1TE 5C08E 3MFFA 4HOWA 1CN4A 1A6UH 1P1ZA 3O41B 3EG9B 3ZKNC 1T1ZB 1GGIH 1A6ZA 3TYFA 1Z9SB 1VGEL 2Z8VC 1E30A 4PRHE 4OLZH 4QY8B 3KLDA 4N2GA 2BRQA 3UPRA 1AZVA 3H8NA 3RGVC 5AWNL 3HMWL 2ZXDA 1U8HB 3OHXA 4L3CB 4Q89A 4JFSA 4AVIA 4YE4L 5GRVK 4AT6A 1NL0H 2ALWA 3EO1B 1XMEB 3ZW3A 3SDXF 1LNUB 1C7TA 2E46A 4M6NH 4OZGA 3WDJA 1JHKL 5L88L 1U8JA 5KAQG 4FYRA 1WT5C 4OCXL 2P5WA 1L9PA 4N0CC 4A37A 1L7TH 2AFNA 3D05A 4K23L 1IGYB 1NEUA 4NKMA 3UZEC 5KYWB 5MHSE 2DYPB 3PCYA 2V7NA 2AJ3A 3S88H 1SYVB 1OAKL 3D2UA 3RGVA 2C3HA 2JQMA 1QSEB 3BUYB 3HHMA 3V4LA 2JLLA 3D4CA 5I73B 3SYCA 5EUKA 3PP3H 1IC7L 4C57C 5DXWA 1ETZB 3GMLA 3PV6A 5KVEH 3BYYA 4KV5F 3SKOA 1KN4H 3EJJX 2IANE 3RAJH 4WTZA 1NEZB 1XD0A 3MTRA 5FM5M 3PJSB 1J0HA 4RVBA 4EXKA 4AKPA 3QR0A 2PW1A 1G9HA 3WS3A 4L4TE 4NS0A 2NT0A 1C08A 5B7MA 4YSTA 5EOCH 3LIZA 4ZJ9A 5E6UB 4GRWB 2VXTH 3SE9L 1QLEB 1L0QA 3NH7H 1QRND 1XHHA 3ELQA 2DD8L 4ABUA 4YX2H 1ACYH 2D7TH 5AYUL 2DIJA 2HRPH 1EUUA 2VJ8A 1KIUB 3DRTA 4UBDC 4BUGA 2F54D 5C0RH 1KGJA 2C9SA 4L23A 1QNIA 4V1DA 5J8OA 3OVUB 1LEKB 2EIEA 3TBWA 5BRZB 3QYMA 2W0LA 5GZOD 4TUKL 1GZQB 1PYWA 1D7CA 1FNEB 1UADC 3DJZA 4PJ7B 1DQVA 4Y9EA 4WW2A 4TNFA 1NWPA 3H0TA 2YK1H 4Z77B 3V6OE 3UG4A 1TSRA 1LJMA 1MUJA 4IBWA 5I1AB 1VFOA 3QUZA 2WQXA 4GSUA 2BOCB 4URKA 2YO3A 2A9CA 4M8VA 5CD3B 2AK4D 3OXRA 4FNTA 5IBTL 2MFNA 1SRDA 3BLKA 3UH8A 3KLHD 3WNPA 4X7DC 4FI6A 1FDLH 2ZF9A 3TIEB 4L8DB 3TN0B 3CVDA 4HWBL 3RTLA 5GHWH 1XR9A 1FLRH 4APQB 2ZP8A 4QLRA 3JSSA 5F7LB 2FQFA 5AVVB 5IJKC 1TQBB 4XP9L 2DWSA 3JTTA 1C5BL 2EE6A 2IAMA 3PYCA 4M5TA 1TTBA 4QRUB 2AQPA 1TSHA 4XAWH 1DANU 3KYNA 3Q2WA 4M1DH 3S6CA 1S7UA 1BQKA 4JREB 4A6YB 4ZMQA 3B9KD 3D06A 3O0RL 2NY6C 5HGDB 4C4KT 3JT0A 1X5XA 3KCPB 5EF2A 2OZ4H 3HI5L 3D8MA 5HY9A 3BT2L 3B5TA 1KCLA 4PWJA 3LH8A 4Q9QH 3P1VA 5A1AA 1LK3L 2YBRA 4XI5C 3RL2A 4X9BA 2XETA 4YC2C 1ASPA 3MJ7B 1E6OL 4QD2E 2HMIC 4D9LL 5LVEA 1KB9J 2GJJA 4K3GA 4PR5B 4FTVE 1IC1A 1NLDH 3FH5A 4ZZFA 1TLKA 4LLYA 2XFXB 2V17H 5DRWB 2VR3A 4A7QA 4E41A 1WFNA 2MQCA 4OD3H 2J1XA 5D7JD 4YHNA 1HL9A 3BFWA 4PRIA 2C1OB 1N6UA 5F6HI 2OJZL 3I02A 3HZMA 4O5LL 2NYYC 43CAA 1RPUA 2RALA 3BCFA 3GJFH 3IFOA 5D7JC 4ISVA 4JHAL 5HVWA 3II3A 1HSAA 1MHPL 3ARXA 3ZDXE 4ADGA 4G11A 2WAQA 1BQLH 4PJDE 4PU2A 4UIKH 3VCLA 2EH7L 1H3XA 4NQDE 3IS0X 3QCUL 3BGMB 3FCTA 5FGCE 1A7OL 3L2LA 1HINL 4EI5A 1KFAL 2A4EA 4J39A 3QFJA 5IHUL 1TZIB 3CFNA 2WPGA 3MLSH 4Y1SA 5HDRA 4TUJA 3H3BC 4U1KB 4YXKL 1NTDA 4P2RE 4R97B 3HG5A 3CH1A 1OAUL 2OMNA 5BZZA 4DO4A 5D9SA 1LNUA 2VDKL 5GRJH 1QHQA 1SLUA 1ORSA 4Y4KB 3WLBA 4JO1L 4ZS7H 5EIIA 5JR1L 5KVFL 1ZTMA 3H6JA 3L9YA 3DGCR 5I9QB 3BQVA 2DYRB 4DK6A 2A9DA 1RJYA 3I50H 2COVD 2CCWA 3CLFL 1INEH 2GBUA 1NM9A 3ECWA 2J57A 5JQHC 3WYRA 3SDXE 4JZOA 4LSUH 2JKLA 3ET9F 4LEOB 5FYKH 3VXNB 2KLTA 2MOVA 3SDAD 2GEEA 3A4FA 2NLJA 4ODVH 2XBDA 4UZUA 5E8OA 5TE4L 1QBLL 4IW4C 4MJHA 2JJSA 4AVHA 4JFPB 2GTWA 1HNYA 2IAND 5B39A 3BWAB 3C12A 1IGFL 1IVTA 4E2OA 3S9DB 2IBBA 3U6XS 1A6UL 2VZSA 4KQ3L 3QQ3B 5A7BA 1XX9C 2VDQH 3GMMB 1NLBH 4OBSA 3L3HA 2BNQB 1KELL 5IMOB 2HWZL 4RRPG 2VN3A 1G9ML 5DHMC 3QE5A 1FN4A 3OQ3B 4JZJA 4QOKA 2EEBA 5JIQA 1QRNE 1J12A 1JV2A 4NO0B 2ICWI 1XIWB 32C2B 3OWEA 1K72A 1H3PH 4PB0H 3KCWA 4ZPTA 4A1RA 2EVJA 3EOBB 1GGCL 5K9JL 1DN2A 1RVFH 3D6GA 2VDPH 3P4OB 3EAKA 1XCWA 1QW8A 4OD1H 4JRYD 3IN2A 3EF4A 1MF2L 2AXWA 5I6NA 1NBYA 4UIKL 3RY6A 1BLNB 5IEKB 3GSNB 3OZ9L 1Y1UA 2DM2A 1E9OB 1F4HA 2GPZA 5D7JA 3I9GL 1P1ZB 2HFEA 4PTTA 2X4TB 4P2RD 1MCPH 1Z0MA 4J7RA 4W9DC 1HZLA 2XUWA 3MFFB 1M7DA 2DI7A 2N59A 1ZTXE 1FJ1A 4KU1A 1X5FA 4LHQB 3DJRA 5FF6B 4MQXD 2VLJD 2EABA 4HH9A 5FK9B 2P24B 5EO1B 4M7JL 2IAMB 1X7SA 4QRUA 4KK8C 4N0YL 1FC2D 5T1LB 1DN0A 4OM0L 2ENYA 5D4IA 4B50A 5BZWA 1ZANL 1Z1WA 5EBWB 2YPLE 1A7QH 1J9RA 5FCUL 3RWHA 2AJVH 4U6XA 4XC1H 2ZUXA 3DO7B 3GMPB 5CJOH 5DA4A 3MJ9H 5F7EH 1JGLH 3MRKB 1KF9B 5E6IC 1V3KA 1PQZB 4I0PB 5LCVA 1B2WH 1F1AA 3JVFC 5KJ4A 4ODSL 4CGUB 4B9ZA 3U4KA 1JZ7A 2FJHA 5AYUH 4AV4A 2B4CL 2FECL 3AAZA 1LEIA 2TRHA 2CO4A 1ZHNB 4K9EL 1N64L 3KPRE 3ZKND 3OD3A 4BQ6A 4A7TA 2W81C 1DQQA 1AGFA 3AS0A 5K9KB 5D7KE 3DJTA 3VXUE 4OGXL 1S9XB 4OZFG 3VRLF 4Q52A 3ALPA 1JD9A 4GG8A 5CGYC 4PJDB 1YAZA 5D5MB 1F11B 3T8XB 4M48H 4DW2L 2QVKA 3FUIA 4A6YH 2DQCH 4MA7L 4EZJA 2IPKA 4OSUH 4AL8C 2XXCB 1A7NH 4N5ED 5FK9A 4MA3A 3X13B 3NJGA 1EAQA 3MFGB 1GGCH 2K7QA 4UYPA 3RURA 5HPMA 2F7PA 3Q8BA 4YXLH 5FO9A 4EVNB 2AEQL 1K2DA 4OIIH 3MRPA 4Y8DC 4R7DA 5INCB 3DO4A 4FTVB 1JZHA 5LNEA 3ZKXB 4YDLB 1E28A 4JB9L 2BNUA 5FHAH 4C4BA 4OUOA 3KPQB 4P2RB 1BM3H 1NCNA 2WXMA 4G8IB 2XBZA 1ZA6A 1UD6A 3MRDA 2BVTA 2XPZA 4Y5XA 5BOPA 3S5LA 1LMIA 2GJZA 2NY0C 1SHMA 2R0WH 3D3VA 3OMZA 4P3CH 4YHLL 5KSBF 1M7XA 2GTZB 5F6IC 2CK2A 2Q8AL 3BP4A 1I8IB 3PQYA 3KDMA 1ZY9A 4ZS6C 1UXLA 4YHZH 4MHHI 4N8VB 1U8PA 4EI5B 3NSCA 2KS0A 1NCWL 4XMLH 1MCHA 4EEEA 1CF8H 2ZKHH 3PHQA 1CIDA 1FSKB 1ZVSA 1CDJA 4YSOA 1TEFA 4DEPB 2YUZA 4KX8A 2VO8A 4EUPA 3HZMB 3I02B 5DUPH 2R69H 3CHOA 1RUAH 4WI4A 2W60B 1MFBH 1Q9LB 3CBJB 2YQBA 3D39B 4UU9B 3UO1H 1J9SA 1ORSB 4Y4KA 5EIIB 2HRHA 5IB1B 5IJKA 4BZ1H 2XTLA 3P11H 1QBML 2XC8A 4KK6D 1MN4A 5EC2A 2XPGB 1JSYA 2HTLD 3UZEA 5K39B 1KNOA 3HC3L 3B1UA 2ITDA 2Z0UA 5DYOB 1H8NA 3P4MB 1KCRH 2BWIA 2YBRB 4ICXA 3ZE2E 5KG9A 3ARZA 5IW3A 5ICYB 4FTVA 1KJMB 3BSZL 4XZUA 4JRXD 3LNDA 1JGEA 3EFOB 4EMZA 3IMWA 5IZ7A 3NP3A 4JMNA 3TZVB 1XGZA 4PJIF 1EHNA 1MNUL 4NKIL 5I6XB 2GJ6E 2FO4A 2MPAL 4WW1B 1K4DB 2R27A 4IMLB 5GZNC 2Y07L 4G72B 1XEUA 3PPEA 2KQNA 1JCKA 2XZZA 2RMNA 4XO8A 4BK5A 4LVEA 1A5FL 4YOKA 5MP6L 3SO5A 1FAKT 3GSNA 3HZ3A 2HZHA 3STZB 5DD5H 5KVGH 2DWDB 3DGGB 3ETSA 3WD5L 1YEJL 4HOZA 2ADYA 1K4CA 2AEPL 1B3JA 5J6GB 3M1BA 1GC1H 3DC0A 1JV2B 1KYAA 3MLRL 1O7SA 2CBTA 5IREA 3OAWA 3RY5A 4D8PB 5IKCB 4H2CA 5TDOB 4JX0A 2R7EA 5J89A 5KS9F 1MRDL 2A6KB 4HJSA 4PJBA 1RZFL 4DTGH 2FUQA 1YJDH 3APDA 4Y0GA 4ABWA 2FIKA 3CPLA 2A74C 3FU0A 1U8NB 5JQ6H 3A23A 4XCNA 4GG6B 3B37A 2XOTA 3WHXA 5JHLH 3IBEA 1HOCB 5EU6E 3MV8E 3N1MC 3DO7A 1RAMA 4HPOH 3TH3T 3TV3L 5F7HA 1T7WA 4P8QA 2A9AA 3H9SD 4GRWE 4OV6F 4X8CA 2NW2A 3QIBB 4TNEA 1H6EA 1QFWL 3I9AA 3NCCB 3C6LB 3D3VD 4JG1L 4KPHH 5ABDE 1JZ5A 3VQMA 1KIPA 4WY7L 1DBKH 3TFBA 4XXCA 2CUAA 3WGVB 2VQUA 3MJWA 2APSA 4YHOL 1G1KA 3ARWA 1XSJA 4HLZG 3U36A 2WJ7A 4ORZC 4DKTA 2BVUA 5FGRA 3RYMA 4JMXA 1P7BA 1PZ5B 1NH6A 4WK2B 3HG1D 3V0FA 4HUWA 1E9PA 3W0WD 2ZQKA 1KXTA 3VDBA 4PHZA 2E74C 5EIQA 3QHTC 3QAZB 5E1AB 1F11A 3KWWA 4RAVA 2H0EA 5J11B 2I69A 4FQIH 2ARJA 5KBPA 2ISDA 1V05A 2OSLB 3KR3L 3QCTH 4MWFB 3KVDD 3VI4F 2BP0B 2W9EH 2EO7A 3F04A 1BCIA 1M3JA 4J4PC 1G4RA 3ML8A 3B2MA 3F05A 2EH8L 2ZXGA 1YRKA 1G7IA 4DJMA 4RMBA 5JOPE 4JY5L 5JPMC 4MJ5B 1L0XA 2HJFB 1B4JH 5L8JB 1YY8A 2DTSA 1IILE 1D5ZB 1NANH 1PFCA 1Z3GH 1Z9OA 2ZXAA 3B3BA 4G8EB 4LNRA 4K5PA 4MGXA 1YUKB 5K1JA 5CZVL 2FNWA 3EYOB 4Z3IA 3LS4H 4FE9A 2VLJB 1M9WA 1ZK5A 4TLSA 5BOJA 4KFMA 5IJBC 3VFRB 3U7YH 5E6YA 4UTAL 2Z7WA 4UQ2B 1OARH 4ELDA 1MCPL 4IYKA 1OE3A 1ND0B 1BBJB 1YYLL 4JFEE 3KPMB 3G5WA 5H94B 4GOSA 5JHDE 5DTFB 1OE1A 3CC1A 1OT4A 4YHKH 1N6QH 4MYPA 1K2DB 3EBIA 1GA2A 2BSCA 4PIRF 2FAUA 1QACA 1FFPA 1IBDA 1OGPA 1P9MA 2FL5A 4PSRA 3S3BB 5I0VA 2VITB 4JFEB 3R1GL 4J2XA 2XDHA 2ZYRA 5JIKA 5K9QI 4AEIH 3FTUA 1YA5A 4D7BA 1QABA 1F8TL 5C08D 4AGQA 1B90A 4BKLB 1QFWH 3H3PL 4L4VE 3RDTB 1R34A 1ZV2A 4K8RC 4OSUL 3N0PB 3WDIA 1UWEH 2LTQC 2Z7ZA 2MRYA 4JFXB 3RVVD 1MELA 2B3IA 4FXGC 5BPPA 1HH6B 5LXGH 1FIGL 1SMAA 1WO2A 1SJMA 2VW7A 1FCGA 3DV6A 3GO1H 5F7DA 5IB3A 4PGCB 4R3SA 1ZE3H 5ESVB 4RDQF 4H8VA 1CXKA 2FNBA 2XQYA 3GLDA 1NCCL 3HNVL 3JQOB 1P7QB 4OFIA 3VI4B 1A7PL 2OAAA 2YD8A 1BXVA 2FEJA 4EO5A 1DQLL 3TO4D 1XGYL 3GNMH 3AU0A 4K9EH 1U2HA 3TTSA 5DD6A 2EXYC 1IO4C 5E00B 5HJDA 5B1KA 4FQXB 4ELKB 1CC3A 4H0IA 4XH2B 4JREC 2EUZA 3B2VL 1RUKH 1WA1X 3NPSB 4AV5A 3BVVA 4H0LC 3C8HA 3G6DL 2VRQA 3IAPA 3IPEA 1F4XL 3GJFB 4LEXL 4Z76A 4GIPD 3WTTA 3EJTA 2J56A 3PGDB 3NFPA 4Y5YC 2PCFA 4QTIL 4XXCC 4XWOC 4PJBB 5HXMA 3NJXA 4NNYA 2XWXA 3K4DA 4FLHA 4PJ5D 4RZCA 3MSPA 2JNZA 2WB1A 1R17A 4BZ2L 1YSOA 2VDOH 2HX9A 4UZGA 4JN1H 1CU4H 4OT1L 5I8KH 1O0VA 4GP8B 4KITB 1XZ0B 2X41A 4HU8A 1SF5A 3MV9B 4BQCA 1K4DA 3DSNA 1NSNL 3CBKB 2J2ZB 2YGVA 2FO8A 4NC0B 2I60H 2H3XC 5IBUG 2ZKXA 4NCC2 5C09B 4AQ1C 4WO4A 3DPDA 4PJEB 4NRYA 3O2WH 2X4UA 2AQ1A 1Y1DA 3GSOA 4ZO6A 1ECZA 2E7HA 1QFWI 3UDWA 2YD3A 4ZMZA 1KJMA 2F53A 4KFZC 4OCNC 4QYAA 2X12A 4H88L 2G75B 3AROA 4I3RH 2X1WL 4Z5RA 3WIIL 5JDSB 2E6JA 1PL3A 4HG4K 5BRZE 2CCVA 4MLSA 1H3WM 4IGBA 5F6HJ 4XCFL 3GSRB 4XX1E 2Q76B 2HT4C 3RAJL 4TXVB 4DO6A 2IH3A 4N2KA 3GPSA 4DK3A 5L6YH 3V4VL 1GH7A 1UOKA 2OYPA 2B59B 3GSQA 1KYUA 4Q9RL 3IBOA 2Y5TB 1L6PA 1YAIA 4UU9A 1U8JB 4B0MM 2A0LD 4LCCC 3BQUA 1AGDB 3AJ7A 1MUJB 2C8NA 4F2ME 5EU7E 2J71A 2ZSVB 3MUGB 5DD5L 3MA7B 1IGYA 3D39A 1NFKA 3HKZA 4UQCA 4KK9D 1JDCA 4TUOA 5A6IA 5IKCA 5J3HD 5LN8A 4HWZB 2ZUWA 1NDGB 3UPRB 1SOXA 5C08A 3T0EC 2GJ6B 3CPUA 4WJ5B 5C0AE 4CVXA 4LDOB 5AOMA 2F1AA 4W6WB 2CKBH 4TTDC 4IEFB 1DSFL 4G3YH 4F8TA 4MD5A 4ACPA 3EO0A 4F58L 1XF2B 2AABL 3OC8A 2VMJA 5AYQA 2P3YA 3JWNH 3LRSB 1AKJB 4OCWH 4S1RL 4XPTH 2VDLL 5L2JB 3V95A 4LIQL 1UCTA 4U3HA 2A0LC 2WN3A 1UYWL 1E2ZA 4G6KL 4FERA 2X28A 4ISVB 4XNAA 3AITA 1GGUA 1NGQL 2V2WA 5LGHH 2EEXA 2EDWA 5E6IB 4WWKD 1UB5B 3BMWA 1G9MH 1IM9D 1EX0A 4O58H 1QFOA 4NZRL 4LSVL 1I8KB 5EBLB 5DHEA 2YAFA 2W38A 1YEDA 2VLLA 3KGRA 4Y88A 5GIRA 1I9JL 2XKNB 1UXSB 3IDMB 3QJVB 4DPBX 4H25A 1WFOA 1ADQL 5CO1A 4ODBD 2XIIA 2X89D 4HF5H 2DQTH