3VD1A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
202
Chain Sequence
b'HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
molecule tags Antitumor protein/dna
source organism Homo sapiens
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
total genus 36
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd1A00
5KBDA 4G83A 1HU8A 5AOKA 1CO1A 2J1XA 1LJMA 2RMNA 3QYNA 5G4MA 4HJEA 2H1LM 2OCJA 3WU1A 2IOMA 3D06A 4L0ZA 4A63A 3Q05A 4GUQA 4IBUA 4IBTA 3WTTA 2BIQA 5G4NA 4AGMA 2WGXA 5G4OA 3D09A 2XWRA 3ZMEA 2BIMA 2J20A 1TSRA 2BIPA 4LOFA 2AC0A 2ATAA 2X0UA 2J6WA 1EAQA 3D07A 4QO1B 3TS8A 1T4WA 5AOMA 3D05A 1EAOA 5ECGA 4MZRA 2FEJA 4IBSA 1YCSA 3WTYA 4AGNA 1CMOA 2ADYA 3VD1A 2XWCA 4XR8C 2J1WA 4LOEA 5LAPA 2IOOA 1KZYA 2YBGA 2X0VA 4L0YA 2P52A 4AGQA 4IBVA 1HJCA 3EXLA 1IO4C 3Q01A 3IGLA 3KZ8A 2AHIA 3EXJA 4AGPA 2J1ZA 3WTVA 1HJBC 2GEQA 5AOIA 4MZIA 2BIOA 2BINA 3D0AA 2J21A 3WTWA 1GZHC 3WTUA 5AOLA 3WTXA 3IGKA 1E50A 5A7BA 2MEJB 4IJTA 2PCXA 3US0A 3QYMA 3VD2A 1TUPA 5LGYA 3KMDA 1H9DA 5BUAA 2J1YA 4IBZA 4LO9A 4GUOA 1GZHA 5ABAA 5AB9A 4AGOA 3Q06A 4L18A 4IBQA 1UOLA 4G82A 2IOIA 3WTSA 4IBYA 1EANA 4KVPA 3US1A 2VUKA 3D08A 3VD0A 4IBWA 5AOJA 4AGLA 2X0WA
chains in the Genus database with same CATH superfamily
3EZ8A 2TAAA 4KQ4H 4Y5VB 3W5MA 4HKXA 1ASPA 2CJTA 3BP6B 3KPMA 4IKLA 1YJDH 5KOMC 4A55A 1F3JB 2HPOA 3WNLA 3MHZA 2N0KA 3IETB 4FI6A 1NGPH 1XF4A 3QXVA 1U3HD 1OHZA 1NCHA 1V3LA 4LF3B 5BOPA 5HHXH 1MEXH 3MJ7B 4EUPB 1HHKA 4OZHB 1NC2D 4FQXD 3CVHA 4Q52A 4QXWA 2MCAA 4R4FH 4KKNA 1I75A 3KGSA 3HMWH 5D1ZA 1BYOA 2N56A 5EU6D 1QSFE 5KUMA 5IQMA 2DEWX 4FFZL 2BY3A 4BXVA 1WO2A 4V1DD 4HS8H 1TCMA 2ZWSA 2XQYG 4IOFD 4AYFA 4KKPA 1KMGA 3PIQB 2VDQL 4F7MA 1OB0A 2C9UA 1GIGL 4MA8H 4LLUB 2AKRA 3QFJA 1CFTB 4UTAH 5FO9B 2WXQA 4Y88A 1CE1L 3RRQA 3MLUL 2CH8A 4TYUA 4ILDA 4CNIB 4WI9A 4ATTA 3ULUF 4DO4A 3RJQB 5ACZA 1BQ5A 3P0GB 1G9HA 2Y3AA 2QVTA 2EO9A 4EKJA 4KTYA 1DN0A 4J23A 4L3AA 4HJTA 4P2QB 3QRBA 1QSFD 2AJUL 1KBGH 3JV4A 3WFHB 3G5ZA 4YR6A 4ZW6A 3QZWG 4LFHD 1LMKA 2QBWA 5I15H 5F96L 1SXNA 1TJGH 5G2NA 2XPZA 4J8QA 1V05A 3D3VB 2B4CH 1U3HB 4X9FA 2ZF8A 3H0TA 2BP8B 5C0BB 3RWCA 4LSQH 2LABA 3WELA 1GR7A 2VMFA 3BKCL 4LRNL 1EGJA 3BMWA 5T5NG 3IJEB 3IDNB 3ZRFC 2ORBH 2FATH 1DVYA 2CIKB 1JPFA 1JSYA 3MOAH 4ZZKA 5IV2B 1UM6H 4FERA 5E9DA 1X5YA 1TTRA 4WW1A 3MXVL 3VXPB 2D7QA 2P4AB 3WEXB 2NZ9C 2FYYB 1I82A 1XF4B 2BK8A 4APQC 1A7PH 4GMTL 4IQHA 1C16B 1TTAA 1I9RL 2EYRA 1XTMA 1ECZA 2YD7A 2YOAA 3MV7B 5D7JD 4Z78A 1EMTL 5ADOH 4X5PA 3VA6A 1SY6L 2Y1ZA 1RL1A 1ET8A 1SGKA 3RPKA 2F54E 3GZQA 4X6FB 4UMSA 4ALAH 2CO3A 1QBLL 3ZQ9A 3LYRA 1SF5A 4AYFB 4J3OC 1FAKT 2KS0A 3DUUB 1NKRA 2VRKA 4WWKA 5DC4B 2XVKA 3BAJA 4PLKD 2D7PA 1Z9SA 3UMNA 5GS2H 1ZT1B 2HTLD 5KSVB 2HWZL 1DLFH 1E5AA 2NTSP 4WW1B 4WJKB 4H20H 3OAWA 4W4OC 5L2KD 2YWYA 4P06A 2V9RA 1F5WA 3DX6A 2X3AA 3VE0B 1UM4H 4LLDA 4H26B 3ZYIA 1RK7A 1EAQA 3QCVL 1R34A 5IHUL 1SUHA 2VAAB 4N6RB 1BD2D 1WFJA 4YO0B 1ADQL 1NGXA 4F8OA 4RIRB 4MNQB 1FFQA 5BS0B 3Q2NA 1C8PA 2V7NB 4KUCF 4IHBA 3CMOL 4LQFH 1JWUA 3BPLC 5EEXA 3LPPA 2BSTB 4PYHA 4GQ9H 2QEJA 4W6XB 3KVPA 1J0ZA 2K7QA 1A47A 5D1ZD 5L2KE 4Y4KD 2AQ3A 5DHVB 1IGJB 4P2RA 3QUMH 2CGRH 1NBZA 3AABA 1EGJL 4G43A 5ILTL 2LOEA 4C4BA 2LFGA 5KZCD 5ITBH 4AQEB 4OM1H 1MFDL 4IW4C 4L4VD 3A4EA 3KE0A 4OUUB 1XH3B 2IDTA 1S8DA 5EBLA 3RDTD 4CGTA 4YEFA 1BD2E 1V27A 1XSOA 3A0OA 2C7UA 2DDQH 4MDJA 1RHHA 4U1JA 4ANVA 1OTTC 5DC0A 5KYYA 5JNYA 2P8PB 4QRTB 5FO8A 3GK8H 1IGML 3ULVF 1C16A 4UM9A 3ZL4H 4U33A 1MOEA 2Q7YA 4EI5B 3FC8A 4NJAL 4YDKH 1ERNA 2PCXA 5E2JA 3SSGA 35C8L 4JPSA 5EC2B 1OARL 4PWJA 1HK6A 3NCYS 5A2CA 5C0DB 2XWBB 5K59E 3CVIL 3STZA 1R3HB 4OFKA 4W6YB 4JDVA 2R2BB 4J3VA 4OSUH 2Z34A 1I8MB 1FGNL 3TNNB 2Y2TA 4M5TA 3IAPA 3UC0L 3LRMA 3D08A 4S1QL 1E28A 4AZUA 2GBTA 1QASA 2F8IA 5JW5B 4H0IA 4JM4H 3NJHA 3LEXB 4NENB 1TZGL 3QEQE 1MHHA 2VO8A 1K6QL 2V9UA 3DNKA 3ISRA 2NY1C 4M56A 3E6HA 3QJVB 5DSCA 1B90A 4LBAA 2HMID 2NTFA 3L9YA 2EP6A 3F2LA 3QBTB 5FYLD 5CWSA 3LH2L 3IPEA 5C08A 4XMPH 2FAUA 5I8OH 3OGCB 1G1OA 1OGAE 4YDJB 1KTLB 4U1NA 3VFTB 4HEPG 4UNUA 1HEJC 1GPOH 4Z76B 3MROB 2FCBA 1NCDL 4GXFA 2XKNA 4Y2LA 4BH7B 4GRMB 1GGTA 4HUXB 1PLBA 3K8LA 3THMH 3V6ZA 4JJ5B 2PF6A 4M6NH 3O3UN 4K8RD 4AJ0A 4JL2A 4L5FL 2NUTA 5C0FA 4I0KA 4LNRB 3BMVA 3KLHC 1JN6A 4QRPE 1IAKA 5ESAA 3GMLB 3DV6B 1TFHA 1MHHB 4JGJA 5DLMH 5IM7B 1KJ3H 4U1JB 4A7UA 4PRHE 2E6PA 5CJXA 1LD9B 2AK4A 1KGYE 2WTOA 1AG6A 1TPXC 2NY1D 3N0AA 4IS6B 3DX4A 3FCGA 2GAZA 1JUFB 2Q20A 4MCZA 3LKSB 2V5RA 2R2HA 3O4LE 4FFZA 1UD5A 3KPLA 3FU0A 5KVFH 1BYNA 2QADB 5GGRB 5AL8A 2XIDA 5I6KA 3G6JE 4TRPL 4HWBH 1BWMA 4YLCA 5EOTA 3DJSA 3VYPA 1XL6A 1DVFC 1BZ7B 2G5BA 5CZXC 4GEIA 2PXYC 1N12A 5D96C 5AOIA 5EZJA 3BC9A 4YK4C 1NICA 2GBAA 2NDGA 4B3VA 4WSKA 4NQSB 1WTLA 1BFOA 5I82A 4PRNB 1YUHA 4PJ8D 4NXSA 1YPZE 5CINH 5KJ4A 4B7LA 5AG9A 5F0JB 2NLJA 1TSHA 1X5MA 5IF0B 4B9CA 1EDYA 4UV7H 1UA6L 1MCOH 2FZ3B 3VTAA 1AR2A 1DVQA 2MCMA 1QR1A 1I85A 3QCTL 2C9VA 3IDJB 3SQOH 2L3BA 2V8MA 4QLWA 1A3LH 1NGYA 2IANA 3FFDB 3T0ED 4RWYL 2ZNXA 3KMDA 1BPVA 3F12B 4ZFGL 4UQ3B 2ARJA 1NA8A 1I7ZB 5CLWA 1NCAL 2WMPA 4HUUA 3ZTNH 3HC4L 1EJFA 3F7RA 1AKJD 1R5WB 4HEME 3AFLA 4TL4A 3EDFA 4MJ5B 3E3QE 1A6UH 1EANA 3SKJL 1N7MH 4AZ8B 3QULB 3WKYA 2X1QA 1OGAB 3I75A 3RTQD 3FQ4A 1QUPA 2Q8AH 1ONQA 1NMCC 3GSRB 4TPRL 3QDJA 2MOGA 3GSQA 4RISL 1RZ7H 4BK5C 1N0LA 4Q2ZA 3VG9B 3Q7JA 5T1LA 1TEYA 1OM9A 2GY5A 4GO8A 1YNTF 1J9CT 3P9MB 4WO4B 1IGYA 4XCNA 1EMTH 5ADOL 4NZTL 3X2QB 3DBXB 4I3SH 3FTZA 1QR1B 1T20A 4HAGA 2AP2A 3AB0B 3WNPA 2HKHH 3V52H 1T5XA 3V2AR 3ECQA 3VFMB 3HEIB 2EDRA 3RLSA 4XBMA 4DN4L 4TL5A 1S7QA 3AGVA 3RKPA 4BQBA 2F7RA 4TTDD 5K5YA 4BQ9A 3MACL 1OSPH 2ATAA 4XNUH 4MA1C 1OT2A 4P57B 3RIAK 2HRPH 5CEZH 1KYOJ 5HP5A 1XGYH 2FX7L 2CHWA 1ZT4B 4PBVC 3CDCA 2EVFA 2PPAA 2V9TA 1BF5A 4E41A 3QDJD 1S7VB 3VACA 2F5BH 3EG9A 2BCMA 1FL5A 2YMOA 5CCKL 1KYDA 5TPWH 4HG4J 4HSAC 4PRNA 2HKFH 4PS7A 5FUOH 1EAPB 2CDEB 5T1LB 2CCLA 3FU7B 4OZIE 1OF2A 1MCQA 4WI6A 3BT2L 4ZUWA 5AW5B 2P8LB 1UWYA 4N3UA 4OKVA 5EIIB 4N90E 3EDEA 2LVEA 2OXHA 3O2VL 4OD3L 2GB2A 4AENA 3Q6FB 5JHAA 1EHLH 2BHYA 1R47A 4OCYH 4JGMA 1M2OA 2FX9L 3L08A 2MQ3A 3QG6A 5EBGA 1Q72H 1TR7A 3U7WH 1KBVA 1CF8L 5GIRB 3MX0A 2QGCA 1IAIL 3CFKA 1S6NA 5T3ZL 4EZKA 2DMCA 2DI7A 4DNLA 1FLTX 3BO8B 1BM7A 3C5SA 1P53A 3BPCB 1BECA 5DGRA 4PW4A 3L3DA 2J8UE 2OSYA 3OX8A 4GRWE 2VN4A 2XYBA 4XN5A 3APMA 4ODHL 4WGWB 5FYJL 1J1OL 2YAHA 3OZ9L 3ZJAA 5TQ0H 1RZPA 2JK5B 2VLME 3AMLA 3FU7A 1SY6H 3SE9L 5LBSL 3Q43A 1NAKL 3MRMB 5KSAC 1UOLA 5F7KC 4ABUA 3C2AL 2EDQA 3QEUA 4QXGH 1CTNA 4JNXA 1VGEH 3V5HA 5EO0A 5CBAA 1JBJA 2NW3A 3K74B 5FFGA 5E95B 1A7PL 4U1KA 2YAOA 1QVOB 3GXUB 1SEBB 4PS4L 2PTUA 5I0YA 3SKNB 1OAUL 2ZYSA 5GISL 1SYSB 5IT2H 4P3CH 3BDXA 3T0DA 2QADC 4NPYB 1MAKA 1R9FA 5DVMA 4XT1C 1P4BL 5BRPA 4IOFC 3TBWA 4PI0A 2QZ5A 3BN3B 3JV6A 3K7UA 1JF1A 2NUPA 3MV7E 3WFDL 4PW9A 1RK1A 3FO2A 3OMZA 4E9TA 3KL3A 4KK9D 3K5RA 3JV0A 3OXRB 2DQHH 2IV8A 3NABL 2WSKA 4XRCA 1T3FA 2GI0A 4Y4FA 4XNMA 1BM3H 5AEAA 1BIIA 4Z7VF 5IQ7H 1A0QL 3R0NA 5E6IC 5D9SB 3D2TA 4JZOB 1T4WA 1SUJA 2YRPA 4JFQA 4OTXL 2CALA 4TRPH 4OH2A 2VXQH 3KYKL 4MA3B 2TRYA 2UZXA 1QVOA 3RWEB 1R3LB 2WXOA 3QYCA 1ULVA 4I18B 4DAGL 3GC3A 5KVEH 3WKML 4K9JA 4MYWB 2PTTA 2M26A 5IOPB 1BIHA 4NQED 1LEIB 4JFHD 2KHAA 4ADJA 3TBWB 1PY9A 4G1MB 3LQZA 2YSSA 4K5LA 3ROLA 1KJ2B 1PSKL 4GXUM 4X6DB 5I1CH 3NMEA 2HRLA 1CCZA 1L9NA 2VDLH 3EJQA 5FIEA 5LCVA 1D9KC 2DM4A 3BJ91 3A6CH 3HNVL 2H0FA 3O3EA 4OSUL 1JPSL 3KYOA 2ZKHL 3BJLA 4Z7QF 4G8EB 4FQXB 4IGBB 3HIZA 2ID5A 3D2UA 4H1LG 2GIXA 1G84A 2E7CA 2ZYRA 3LKNA 2OMYB 3FNKA 4X4ZA 2DJSA 2E4FA 4M3HA 4ELKB 2ATPA 5EULV 1MHCB 5L9DL 1Q8MA 3VRLF 4O5LL 3WFHA 4OIAA 5EF1A 1L9TA 4FXLA 4BZ1L 2DBLH 3BKJL 4GSDH 4WEEA 3A22A 3QDGD 5KJRH 4NGHL 1YRKA 1FZMA 4S1RH 1PX8A 2X88A 4W70A 4ZX3A 4Y4KA 2ZUUA 4JGNA 4NZUH 3D51A 4F8NA 2A83B 4D94A 3ME0A 1NCJA 4G9FD 4QKTA 3MC0A 2HLAA 1IC4H 4OV5B 3D7PA 5IW1A 1OTUC 1X6LA 4U4BA 4PGDA 4NZRH 5HDRA 3V4PL 5DTFB 5AOKA 1MIEL 5KYNA 1F00I 3F7VB 2GJ6D 4EI6B 2LV4A 3INUL 4Y4FB 1KPUA 2VXSL 1RCYA 4X8JB 5GJTL 5TE7H 4HJEA 1I7UB 3ZKXB 3UG3A 4YHKL 4HLZG 3WU1A 3B3IB 2F7QA 1CGUA 3EJZC 4KV5F 1B4RA 2ARWA 2RALA 4ZTEA 1CI5A 1SBBA 3RNKA 2FO4A 5DUML 2D7MA 4BRJA 3U4EA 4FFWC 3N40F 2CGYA 3AQXA 5EEYA 2VUOA 5LQBL 3ZT5A 4NQDD 3SJVE 5JHLL 3GSUB 3NQIA 1P7QA 4OQTH 3V4PB 1JVLA 3A5VA 1LP9F 2J20A 3FZUD 5AB1A 3M88A 1A66A 1QPPA 5IOPA 4XPFH 4XVTH 1TETL 5JHDE 5E2VH 1OP4A 1T2QH 2GJ6E 3ME0B 3ZDYB 4NNXB 3D4YA 3UGUA 3E9UA 4G1MA 3H4FA 3AUVA 3S34H 3UC2A 3CFNA 2CA3A 4MJ2A 4KZDH 3AZUA 1QHQA 1KTKE 4L3EA 4S1SH 1HHIA 4BKLB 3FQ2A 3SJVD 4BBWA 3I50H 5IHBA 2ZX7A 4GPVA 4P4KD 1OLLA 4IHOA 4QRSA 4QRUB 5IQ9A 4HOMA 2OJ1A 1KPVA 5ANHA 3RIKA 1P6WA 1G6RL 1CL7L 4X6CB 5JR1H 4XMTA 5AALA 4TVPD 4UWQB 3HB3D 3HFFA 4Q9RH 5EEUA 2XV6B 3N1MC 3C5XA 4QHLA 3D4GA 2VMCA 2DICA 4PYGA 2ADGB 1NIDA 2C34A 2J21A 2VR7A 5DDHA 2BVQA 3FHAA 3NFNA 4K3GA 1JXKA 1E50A 2X2UA 1C5BL 3SPVA 4OGZA 4H8HA 2Y6SC 1ZHBB 4PB0H 2DN7A 2E27L 3D3VA 3QUZC 1UURA 3RZCD 3ZUCA 3CVCA 3IFNH 5J0BA 1NCWL 2JB6A 4ONGL 2IAMA 2ZSVB 4AEIL 2VDOH 3Q5OA 3QJRB 3PGCA 4DP5X 3MODL 1XH2A 4BKLA 5LNGA 2N0MA 2YUXA 1L6XA 2IPTH 3DMMA 3WL9B 3OBAA 4Q0XH 5I1GL 5FO8B 4TOYL 1A2YA 2R23A 3LVEA 1I9EA 5KVGL 3P3YA 1D5ZB 3RVVC 4C59B 1JPFB 2K6YA 2W0KA 3UO1L 1YEGL 1VA9A 3TPUA 5FEBA 1B2YA 1E2ZA 3FB8A 4P4KB 4NGHH 1OZUA 1PD1A 5D7JB 3KDPB 2VR6A 1FN4B 1IC0A 1SN2A 3ABGA 2FDBP 2WLZA 1RJZB 3FO0H 4KO5A 2X2IA 3QXWA 4EE2A 1MPAL 1RIVL 2WVVB 1F58L 5D1QD 5CN2A 4WGKA 5EU6A 3TLRA 4HYTB 2EDTA 5BS0D 5BVJB 1T1YA 2QT6A 5TH2A 3MLZH 2IAND 4BH8B 1UJTA 1CE6B 1TPXB 4NYLA 1LILA 1FIGL 1AZNA 3QK0A 1YMMD 1UJ3B 3LEVH 3VQ1C 1MCRA 4KDTA 3QISA 1PKQA 4K3DH 4F9PC 5FFLA 2JIXD 4G5ZL 3VSUA 2ZF9A 1MZYA 4YDMA 5F1KC 2FIKB 1CLZL 2FLBT 4YDLB 2V6HA 2YEZB 4L8SA 3FTWA 5D1QE 5DQDL 2G3ZA 4LDCA 1GZPB 4WWKC 4KXDA 1VFAA 4GY4A 1DZBA 4RFEA 5E6SB 5EWIL 4Z76A 3RHWK 3MA9H 3IRPX 4LCIL 1TETH 1J87A 2DQJL 4N25A 3LNGA 3U2JA 1Q72L 4YO0A 3ZGIA 4P07A 1MJ7H 1YMME 2DL9A 2EDNA 5LKNA 4A7GA 1TJMA 1OE3A 1BOYA 4PJXF 4CVWA 1DQMH 1IO4C 3KPPB 5TH2B 2A9MH 3I9PA 3V0DA 1H3GA 3ZTDC 1DUYB 2IPUK 4LLWB 3S9DB 1VCBC 3M8OH 5E70A 4NRZA 4CMMB 1DDHA 1NC4A 5DR5H 2X2JA 1A9BB 3O3AA 1NIBA 1KB9J 2A9NL 2WVTA 5CUSH 2JCCA 1A2YB 5HGGS 5JXAL 5TDPA 5JO5B 5T1KB 4ZMWA 3I6LD 2LLGA 3LY6A 4N6RA 5KBMA 1NGXB 4OLUL 4U6YB 3IKCB 3TPUB 1E8WA 3BD4A 1CK0L 1I7TA 4NO3B 4BUGA 1S7UB 2C7UB 3EJPA 4MDJB 3RL1A 1DQQA 3PYCA 4I0PB 5EZIH 4ADIA 5CBEB 3OB0K 4OZIA 4BCYA 1V7MH 3SCMD 1OAUH 5GISH 2ZP0T 2F8VA 1AANA 2J1YA 1A1NB 2IALB 4I3RL 4NQSA 4EBQL 5D1ZI 1BQHA 4NLHA 4LSSL 2OR9L 4L18A 4AMWA 3LN4B 2ZG1A 1IGJA 3V79C 1WS8A 2F18A 2E46A 4JX0A 5EC2A 3KPPA 3O8XB 4DFIA 4J28A 5HI5C 1ADWA 3ECVA 4KK5C 1XF3B 5JYMA 1MLBB 4HJ0C 4YBQC 4JDVB 3W9DB 3BQUD 1DBBL 4JRXE 4CMMA 4PVMA 5HPMB 1ZS2A 1RHHB 3NFSL 3L7FA 2UXFA 5CHNA 3C2SA 5I26A 4QRTA 5MI0C 3GBMH 2ADIB 2VISA 4XWGH 4KUCD 5IEKA 3AUWB 1AHWB 1IC5H 3I6GB 3RX7A 1RLBA 3HG4A 5E0FA 4KXBA 5FYLL 3AT8A 3WFCL 4A63A 2XOTA 3LEXA 4NENA 4WEMB 5C0CD 5HGAA 3F6LA 1OQXA 3WTTA 3U2IA 1HL5A 5A6MA 3ZE1B 3X17A 4Y2OB 2J71A 3HS0A 4G3YH 1GYVA 3PQYB 2YGQA 3QUYC 4LHUG 3DGGA 1I3GH 3MJWA 1ZEAH 5GQBA 3BWZA 1S4IA 2BZ7A 5CGYC 1KTLA 3IM1A 1KZQA 4MKTA 1LO5A 2N3JA 3OTTA 4K7FA 4E41E 5C07B 3WTYA 4RFOH 2CIIA 5KVMC 4WW2A 3VFMA 2DQMA 5GGTA 1FAIH 4BFRA 2D31A 4MWFB 1H5BB 3MNDA 3RDTA 1P7BA 1ZMYA 3DJTA 3FBKA 1WCBA 5DS8B 3FKUS 4LCYA 5E8OB 1P2CB 4MQTB 4NT6A 4X5XB 1WWAX 3EYUL 1A5FL 1AE6H 4P57A 1CFSA 1KOAA 1IAKB 5HHOB 1E27B 5F7MC 4P59L 3KLKA 2C1PB 1IGMH 3VXOB 1AI1H 4UM9D 1KBGL 3MREA 3TXAA 1AZRA 1TJHH 4Y2OA 1CFBA 2GFBA 2MPVA 3LS5L 4JRYE 25C8L 4MCZB 3AREA 4E41D 4N2MA 1KBPA 1ID2A 3CH1B 3QPQC 4QGTA 3SKOB 3UTZB 4S1RL 1OWRM 3HC3L 3FQ1A 4XNQA 1KULA 4M8VA 2H6PB 1W8EA 5I5IA 1Z3GH 2MJWA 4K9EC 3FCUB 4KKZA 2QKSA 4R7DB 3GJFK 5TF0A 1R5IB 3O8XC 1KC5L 4FG4A 4P46D 1KLFB 1S7TA 4UZSA 1EX0A 4PS8A 1ZVHA 1W9XA 2H47C 1JPST 4K2UH 4CU8A 4UT9H 1KIPA 3RY5A 2AI0L 1M7DA 1XH0A 3HZYA 3CJJA 3RUGB 4PRHB 3VX0A 4PLOB 4I1NB 4Q9CA 5IF0A 1YN6A 2Z7UA 2XZAL 3WEAA 3V4PH 4M61B 1QSVA 2R7EA 4D0DB 1OCRB 4ODVH 2HTLC 4HIJA 1M6OB 2WZ6A 3C6LC 3K72B 3L95B 5EU6E 5T1LD 2UVFA 4BZ2L 2HA1A 2OR7A 3IFPA 1FWXA 4WFED 2WXRA 4I2XE 3MUZ1 4AUYA 2CDGA 4F37F 1BXUA 4XMPL 5JIPA 1G1CA 2X0WA 3UBXA 4MS8C 4JKLA 2LW3A 3IGAB 4FQJH 5BOJA 3ROOA 2VC2B 3DGGB 3HVDA 4JY6B 2Z92B 1OP9A 1JCVA 4RDQG 2HJKB 5LNDA 3U6RB 1FO0H 2C5DC 3US9A 3B9EA 3WY4A 4W1TA 5IMMB 2BNUB 4F15B 4K7FB 1UCBH 2RD0A 3FOMA 1AQKH 4XNYL 3F01A 5KAQF 1JNNH 3IJ8A 1NGYB 2IANB 3S7GA 4JFDE 2RFXA 4ZUSB 1NZRA 4PRHA 4TXVB 3GMQB 3O4OC 4WHCA 3RGBA 5MENB 1U8MB 1L3NA 2DQHL 3QQ9C 5FLUA 1PD0A 4GRLC 1KN2H 4X6BB 5AAWC 1YEIH 2XXCB 1JGEB 4QYAA 5MERB 3SE8H 3T0WA 2AXGA 2ENYA 3UPRB 5SX4I 3BT0A 2PO6B 4B96A 1HIMH 2VXQA 4ONHB 3P3SA 2YSTA 5A16A 2JJSC 1CJYA 4F2EA 3N3EA 1JF1B 1ZA6B 1RZ8A 4PJDE 1G9MC 4EIGB 4J4PA 1H0DA 2AABL 3CSBA 1YY8A 5LCVL 1G7HB 1GJWA 3BHBA 3GK8L 2QPSA 3AS0A 4FCHA 4G70B 1IBFA 4HCRL 1ZEAL 2A4CA 2WUBL 5E1AB 2QMKA 4XRCB 1KJ3L 2BRRL 4X98A 5IVXA 1LO3L 4PJFE 1BIIB 5IFJA 1KJ2H 1M9WA 4ZD3H 3L3JA 4A2DA 1MFBL 3GBNH 2DQIH 4DPBX 1ET7A 1YEJL 4TM9A 3NA9L 3RY6A 4Q9QH 1DSWA 4O2CA 2Y6SD 4TV3A 4X4YA 5H2BA 3PRZA 3OKLB 2CDEA 1XMWA 5BUPA 1QLFA 3ULVH 4WHDA 2DY2A 4M61A 2WIIB 5LLIC 1JGEA 4L37B 4JN1H 1A6UL 2Y7OA 3N85H 3PHAA 5JMOC 2MEJB 1TZ8A 1J9QA 2MOQA 5F21B 1BOGB 1ZA6A 4FG0A 2UY6B 5EU7E 5IQLA 3BIKA 3FO9A 3BKYH 4Z0XB 4Q9BA 1MJJA 3LMJL 3NJJA 1OTTD 5JHBA 1B0GA 5BV7C 3TV8A 3QRFM 4JFHE 2OZ4A 3K6OA 1OPOA 5K9KB 1GZQB 4PRIB 1IKFH 4N0UA 4G71B 2Y2YA 3L6FA 4E2OA 2BNQD 3NEXA 1V7ML 2X41A 5FA4B 3TOPA 5B3JF 2W88A 2EE0A 2QFRA 1UASA 2UZYA 1NDGA 2Q6WB 4KAQL 4AYSA 3RB7A 2XTLA 1Z9NA 4KNQA 1ACYH 2NT0A 1QLEH 2QSTA 3F8UB 3CFKB 4X6BA 3QEUB 3INUH 2AQNA 2GC7C 4X99A 4JLRB 2EVGA 1QEWB 5HYJE 3PS6A 1THAA 2WLNA 3NACH 4X5RA 1HQRA 1TCRA 2FJHB 2FQFA 4NC2B 1HNFA 4M48H 3G6AB 3U0TA 2WSPA 2XT1B 1AHMA 3OC8A 1HQ4B 1G7HA 1OWWA 2VO5A 1RUPL 2I85A 1B0GB 2G2PA 1AGFA 2V3EA 2EEAA 5BW7C 1RZKL 4PJIB 2MSPA 2OMWA 2A9BA 3LQAH 3MOBH 5GGSA 3VFUA 4JFDB 3L3JB 1L9RA 4OJAA 1OTUD 4OM1L 3GB7A 5D7SH 5IVZA 4UIKL 2VQ1A 2NY3C 1ZD6A 2UX7A 2WWOA 4J3OD 3ZHFA 3ZZQA 4YAQA 1VKXB 3QZOA 2GSIA 2XN2A 2UY7B 2Q6WA 4ZFOL 4ORZC 1YEFL 3Q9PA 4YN3A 2C3HA 1UWXH 2OP4L 6FABH 1I1AD 2HZHA 5FHBL 1L0PA 4ZDHA 1DANT 2VDRL 2Z8WC 5DR5L 4RGND 1HINH 2X53A 3OKMB 4P2RE 2WP3T 3G9AB 1JHLH 1MCHA 1N5AB 2J8UA 3Q01A 2DB8A 2W0PA 4JQIL 4YLQT 1I4FB 4IRJD 2WZ0A 4M8UA 2PN5A 2YC1B 2OLDA 4K0OA 2X4NB 1OEZW 5LHDA 5HGDB 4PG2A 5IROC 3CCHA 5E2WH 4JFPA 1JNHA 4BWUA 4KK8C 4RGOH 1DLHB 3K2UL 3VFUB 4J3TA 2AV7A 2DV6A 5ETUA 1EO8H 3MJ8A 3Q6GH 2NRDA 1MREL 3T04D 3KLAA 1FGVL 2XQYA 4OJCA 3VGHA 5IQ9B 2Q86B 2DQEL 2WLLB 4UV7L 1JYWA 4MNQE 1YY9C 2RGSA 3SDCD 1E43A 3H6JA 3NAAH 2JSFA 5I30L 3HG1D 4U7SA 3SDXE 4N2LA 4KGJA 5JIKA 3RBGA 2ZWNA 3L4CA 4YUEL 4ZAKC 3RVXD 1UGKA 4JLRA 5BOZG 5KYWB 3GTNA 1VDGA 3F65A 1MVUB 3L5HA 3VFRB 3ULUE 5D70H 4O9HL 3IVKA 4KVPA 4ABVA 1J05A 3DRQA 4YZFF 4XVSL 2WLKA 1AXTH 2H32H 3SQRA 5D6CA 4U1HA 1O5DT 4JM2C 2C4FT 2OMWB 2ESVA 2PCPB 4E9XA 1CXLA 4MZ2A 2HFFA 4PS4H 1TJIH 4GAJH 4DCQB 1ZT7B 5FFOA 4L0ZA 1NINA 4WU7A 5GGUB 4PJ5E 3O4LD 4PGDB 2Q86A 4MDRA 3ZQWA 4GAGH 4HALA 3CN0A 2AKRB 3QFJB 4YSAA 1JXFA 1K4DA 1KACB 3IS1X 5E51A 3H2WA 2IWKA 5G4OA 4KI5E 5DD0H 5EF2A 3FRPG 2VZTA 2KC0A 4UNIA 5EPMA 5IMLA 4TKWA 1J8HB 4NNPH 1G4MA 5EIQA 5ICZA 3B43A 1YEHH 3TM6A 4ZMVA 3MKGA 4KI5C 2D3LA 4ZPVA 4OV5A 1DFBH 4A67A 1KCWA 1VEMA 1T0NA 4N24A 1KENL 3NCJL 3FQUB 3MR9B 5IG7B 1HH6A 1OF0A 3RI5F 43CAB 5J4MA 2CDFB 1PMYA 4WK4B 2I9TA 4AWJC 1MW2A 5E2TH 1ZVSA 2ZXAA 1RPKA 3F6JA 4OFQA 3UCQA 3CDZB 3HI1A 4OQTA 2EZ0D 1JHKL 1RZKC 2AVFA 3BSGA 3KPSE 4WI7A 2D2CC 3VRIA 5J11C 1X5GA 1J48A 2VZ3A 3GEFA 4GMSH 5F9AC 1UXSA 2X7LA 4F80A 1I8IB 1J11A 1R19A 1JPGA 1QNZH 4N68A 2DJ4A 3D3VD 1WZMA 2J2ZB 4QTHB 2K9UA 3OZKA 4HETA 2EEXA 5AD0B 4LSDA 2ICEB 4PG2C 5IROA 1MVUA 3VFRA 1JD7A 1O6VA 2H32A 4F7EA 1Q4NX 3CFIC 3BDYL 5FWRA 4IJ3B 1R46A 3QZWB 5ESVA 3ZKXC 4UIMA 5EO9B 1TQSA 5SWZB 3MRRA 1BP3B 3N43B 2YEQA 2APSA 1FZOB 4JUSA 5FYKH 3NZ8A 5E00B 1YJDL 1VEPA 1ZXKA 4RGOL 1NC4B 1FVEB 1QSFB 1SXZA 4JFTA 1R75A 3TEUA 3HW7A 3ARTA 4HKJB 1JV2A 5AVSB 1NMAH 1MCDA 2JCCB 2Q7AA 3N55A 3UABA 2G60H 4BCZA 3OKOB 5HYJA 1Z9SB 3W38A 1PDKA 1T6BX 3BZEA 3DPDA 2JI1A 2BZDA 4HAFA 3FQNB 2A3TA 4XGZA 2LHAA 1INEL 4I0PD 4NSKA 3AMKA 4P2CG 3ELAT 1YMMB 3D5OF 4HK0A 2WY3B 3QDJE 4OM0H 5DK0A 1F2XK 3QNXA 5D7EA 2CLVA 4MNHA 4P3DB 3TO4A 4G8GB 1Y1UA 4B50A 3GRWH 4LHQB 2XFGB 1U2HA 1TKWA 1GHFL 3G6JA 4FHJA 5GJSL 1U8KB 4Z3TA 4OY9A 2F5BL 5KVFL 5D1QB 3TX4A 1BPLB 2V7NA 2BVOB 1KY6A 1PPIA 5J12C 3VFSB 3QJOA 1IBGH 2IG2L 5D6DA 3CIAA 1AMXA 1XB6A 4FTVD 1FVEA 4LGPB 2I07A 3DMMB 3WKMH 3T9WA 3WIAA 3W0WA 3WL9A 3NEOA 1BJ1H 2XG4B 3WDHA 1Q94A 2GK0A 2N7SA 3HHSA 4R3SA 1XWVA 1BF2A 1KN2L 2HH0L 2ZICA 4OT1L 4ZUTA 4MZRA 5ISZB 4U6XB 1WHOA 1MCOL 5HGAB 1SN0A 1F90H 1QFWH 2Z7WA 4ZUUB 3OKDB 4GLRI 3MNWB 1GKEA 1QX1A 2WHVA 1HX0A 3GXFA 1RZGA 4N87A 2WTPA 3KWWB 1HYSC 5GRVK 1N67A 1KB5B 2JKRM 3IDMB 3PQYA 1J1OH 1M05A 3G7TA 2DMKA 1QUNB 3KW8A 2FBJH 5IFHH 1RD6A 2FIRT 2DS4A 1HKFA 3APFA 4XZUB 4DEWA 4XXWA 1K3IA 3POHA 4NLAA 3SE3C 3PY9A 3W0WD 5IESH 1JF6A 4H5SB 3SKJH 3T77A 5CGYD 5DHVH 4HGKC 3HS0C 1MIMH 4GUCA 3ATFA 2CRMA 4XNXL 1TXKA 1I8MA 2DWEA 1DBAL 4AEEA 4RSYA 4BE6A 2OPCA 2VZSA 4LCYB 5E8OA 1X7QB 4KJPD 3LMJH 1RZIA 2WIMA 2WNXA 1OOWA 1SQMA 4X50A 3QRLA 3KGUA 2YR3A 2Y5TA 3EOAB 6TAAA 5HYFA 4WEBH 3LRKA 4U1MB 3O3DB 1E0OB 3VD2A 1PY4A 1DDHB 5EZPA 3VXOA 3T3PF 4LRIC 4PJGB 1FZKB 5MEPA 1WGVA 4UOW0 1E6JL 4J5VA 4ALAL 3GSNH 2UZPA 3BUTA 4UT9L 5BUAA 1DJYA 5D5ME 1EDQA 3GMNB 4M3KB 5INCA 1ZTMA 3T1FA 3CH1A 1T21B 1T6WA 3QP3A 1WWCA 2CHNA 5L8LB 3IKCA 2WXMA 5CJQH 3RX5A 3TT1L 5I30H 3MRJA 4X6CE 3CFTA 4LEOB 4XB7A 5CZRA 4DFHA 4IBLT 2QPDB 3GBLA 3GIVB 3NCCB 3P4MB 2JKJA 1CDIA 3FB6A 3BZFA 2I07B 5AW6B 2O6FA 1Q9LB 3BGFC 3W0WB 1CYWA 2I9LB 1N6VA 1XL4A 5IW3A 1RIHL 4N9GA 4PD4J 1AR1D 1GIGH 4HIJB 2RIKA 3BKML 4NQEE 4UDUA 2CBPA 2ZUVA 4TN9A 4DN3L 1DVTA 2ZXCA 4LARL 4X7DC 3O2VH 1UOKA 5DRXA 3ZDYE 3QHZH 2HP4A 2J1KA 4XOEA 2MQGA 2YKKA 4KZDL 3QJSB 4B9IA 3O81A 5LN8A 2OULB 1LO2H 1BBJA 2MKLC 3C5ZD 2OMTB 3GDBA 3NPSB 4XZUA 3FUFA 5F96H 4I0PC 4N2NA 1M1SA 5CLTA 2OSWA 1U58B 4OGXH 1CGXA 3KNBB 4LPUA 4W68A 2XNAB 2IBBA 3PV7A 4C83B 1BXAA 2K70A 5EBWB 4UIKH 2EIZB 1EFXB 4O2EB 2ICWI 2ENPA 4KKQA 5D2LE 4URKA 5J1SC 2NY1B 2KDGA 4G7YH 3L1FA 4PG9A 3QDGE 3UAJA 5CD3A 4GRWB 3T0BA 4NZDA 1INQA 3QWNA 4NWUL 2HG5A 5C0ND 4XPHH 5D1QC 4UDTA 5DFAA 1UD3A 1KXVA 4N6QA 4WI8A 4Q7DA 2WLMA 5DZJA 1BZ9A 2WMPB 5I1GH 3C5JA 2VYRE 3Q0HA 4FQPA 4Z7OF 2WD0A 3DC0A 4FQ2L 4WW2C 4NO2A 1B88A 3T71A 1KN4L 5IVNA 4U2YA 1UM5L 2HVJB 4OLXL 3S3CB 5EOCL 5HJBA 2DKMA 2AJVL 5ADPL 3HC0B 1OGTB 2CUHA 2PXYA 1D7DA 4AE1A 2FR4A 2XNAA 2WBJB 4OJYA 4S10A 4S11A 3AREB 4EPSA 5AW3B 4JKNA 2D31B 3RDTB 2Z4QA 2W60A 5D7LA 1XXDC 2APTA 4MCMA 3ZXAC 2XSKA 2CJSA 2A1WL 3CDGA 4FF9A 4AGOA 3PPEA 2YAFA 2VLJB 2Q76A 1AO7B 1NLBL 3PUUA 5KN5B 1DQDL 2D4DA 3QAZC 3X11A 5K9QG 1T89A 5E8DH 3MJ9L 3S5YA 5KW9H 3WFCH 2DW5A 4HH9B 3WGUB 2B4CL 2DIJA 1SHXA 3JWDC 3BAEH 3VGAC 4EDWL 5L2JB 3ULSA 3ASOB 5IHZB 4OBSA 4F7PB 3NA4A 5I17B 3G5VB 1WFMA 4FMVA 2V5SA 2EXYC 4HS3A 4Y16C 5CEYB 4DTGH 1HHHB 3RWIA 3MBWB 1AGEB 3PXLA 4PLKC 2FR4B 3L17A 4YBHA 2GT9B 5I8KH 3UTOA 1IFGA 1L9MA 3PGFL 3ZE2B 3P11H 1L9OA 2XA8L 4DO5A 2Z31D 3WKQA 4H7VA 4XBEH 3QW9A 2X70B 4JG1H 3F83A 2W65A 2OCFD 5F7YC 2PLTA 1GOFA 3I9GH 1E7VA 3CFQA 3PP3K 5HYQA 4FNTA 1O6TA 1IBGL 3F3HA 4ZX6A 3OPZH 1A25A 3ECBB 4Q74A 4OI8A 4J4PD 4NNPL 3M7FB 4Y1SA 3ARBB 4UAOC 2WAQA 5C0AB 1CMOA 4P4RA 3SBPA 3Q48A 3OC5A 3QIBA 5EG6C 5HVHB 2NZ9D 5LWYL 1KG0B 4ZMNA 5AZ2H 5DEJA 1JFHA 2LTQC 2L8AA 5KYUB 1NOFA 4ABWA 3JWNG 8FABB 3GTVA 5DD1L 2G2RB 3ZE0E 3M1BA 3RWFB 4ZQTA 2ZIDA 5FCUH 1HE7A 4FJZA 1CBJA 1A6AB 1FL6A 4KRLB 4ODUB 1F58H 3GSVA 4KJQC 3MNVB 4Z7QB 1IC4L 4JFSA 2R29A 4GMTH 1WIPA 4KK8D 2C3XA 1WJ3A 4G6AC 1BZEA 3HE6C 3A67H 4YDVB 4XNAA 3DYOA 3MRMA 2ZOLA 3BVNB 3EIFA 1O7DE 3H7BA 5F9OH 3SDXB 1AO7A 1PGRB 5AB0A 4HJGA 1EEZA 4NUJB 5AWNL 2ZCKL 3MRLA 5B1CA 4Z7VE 1KDJA 2VW7A 2YD8A 3QQ3A 5CJQL 4D8PA 3D25B 2E4TA 3TJHC 1YECL 2J8UB 5H94B 5D2LF 5C0AA 4YQXH 3ZKSD 1SHWA 3GBML 5HHPA 1AG0A 4ALAC 5A2KH 5KBKA 4DP2X 2OQJA 4LT7A 1CXHA 1VFMA 4P5TD 3WO3B 1IFHH 3NFSH 4L37A 4QRAA 3BP7B 5CSGA 1B4JL 4MRCA 3BESR 2XFXB 1NBCA 1NCDH 3CAFA 3FSAA 3CN3A 2QKIC 3O0RL 1CR9L 1JMXA 1DE4B 2ADJA 3GO1H 4HS3B 4UUJB 1GPOL 1CFVL 1U9KA 3OMIB 4PUBH 2WNWA 3MJ8B 4P2AA 3PLYA 4HVBA 4N9OB 2LFEA 1BHGA 5H2BB 3DVNB 3BVUA 4S2SB 3HR6A 3HAEG 3TYFB 1CS6A 1BQLH 2F68X 1ZY9A 4XC1H 4EVNA 5DD6B 3QYNA 4HISA 2GJRA 3ML9A 3PGFH 3K46A 4NPKA 1WCQA 4LB8A 5HDWA 2X1XR 2OCJA 4NO5B 2GKIA 4YSCA 2BY0A 3UYRL 2BIIA 1BWWA 3QCUL 4FI7A 2MWCA 3N42B 3JTTB 1F97A 4BYHA 1R24A 3ARVA 5T5FH 4YC2C 5JOFB 1FORL 3S98A 3FT2A 3QIBB 5ILTH 3F84A 1KGCE 1M71B 1RIUH 3IFOB 4EDWH 4Z8FL 3KBEA 4I3GA 4ZOCA 4CDHA 1BG9A 1F90L 3FU9A 4JG9A 4X99B 2C1OA 2GUOB 4P2YA 4NN5C 4U0QB 3V9EA 4PFEA 5T3XL 2FHFA 3ZPDA 3KPRA 3VYNA 3IETA 1EHXA 1J8KA 3EFFB 2E7DA 3VMNA 4F2ME 1MUJA 5GGRY 2AITA 4HIIA 2CG9X 4ODWA 3TH4T 3IDIA 5DMGC 2ERJB 2A0LC 2GTWB 1G9NH 2J1WA 3FN0H 4FCAA 3ARZA 3G5YB 3R06B 2WO4A 5LBGA 4XMLH 4AE0A 3UCRA 1U8LA 3D87B 3HC3H 1IX2A 1NDTA 5EZIL 1HZHL 4XNXH 1RSYA 3SDDA 3UTSD 4HCGA 4IBVA 3QQ3B 3VWKC 1VKXA 3MTXA 3TBCA 2XIBA 1USZA 1BQSA 2IGFH 4LSTH 3V4LA 5DC2A 4N0FB 4U1SA 2R9HC 4KI5D 4V1DB 3F85A 1AP2B 1UH3A 3FTUA 3QZLA 4E68A 4QXGL 2K8MA 3N6YA 2YUWA 1T04B 2COQA 2BOCA 4ABQA 5TDOA 5GSVA 5D7LE 3R7QA 2XZCL 5FGBC 4YHLL 3L3OB 2WWKO 1BBDL 5F7NC 3CQPA 4HCFA 3TA3C 4Z7UF 1N5AA 3GDCA 5CKGA 4FABH 4N28A 4ELMB 1BVKB 2FT8A 4YS4A 1M1XA 3ALXA 2CR0A 3JV4B 1JYNA 4Y19E 4RMUA 5C0CE 3RVXC 3O9WD 5E1HB 1FDLL 2HJFA 1ZRUA 3E8UH 1WZKA 2EKJA 1HCVA 4U6HA 4JO1H 1W15A 4UTAL 3IU4H 1MFAH 3NIDF 2JFCA 1U3HA 1R5VA 5F8QC 2H9GB 3RVWC 3BH9B 4IBQA 1UXMA 3OKMA 4Y1AD 5I76B 1JWSB 2IG2H 4LAQL 5L88H 5FUZH 5D7HA 4EN3D 1YEKH 3G6JF 5JQHC 4ICXA 4V1DA 3T2OA 3SGJA 5EUOF 5PCYA 3KR3L 3Q8FA 1T04A 5E6YA 2EKSA 1AFVH 2X4NA 4LL4A 4YNYB 5F1NB 5C0IA 1UWEH 1XAUA 1YSOA 1HT6A 2GUOA 3HNSH 5FYKD 5DGQA 2FGWL 4PJXA 5CS7A 3D4ZA 3HE6D 1O6SA 1BVNT 5E5RB 2NSMA 1H6EA 1VRSA 1T89C 2K0RA 4FGMA 4QRPB 2DWDA 4JMXA 3VNYA 4ELME 4PREB 1PDKB 4UT7L 4DGVL 3BZEB 3MTRA 4OCMC 4ACTA 1KELL 1JS4A 2WXJA 4LSPL 4NHUB 4NQDB 1CBVL 4DAGH 3G5YA 3R06A 4OZFA 4YEEA 3SDAD 2YO3A 4LQ1A 3U1SH 1IBBA 4TUOA 1QLEB 2KT6A 5IFAL 4JRYD 2W94A 1E8ZA 1TMCB 1W0VA 2JLLA 1DTUA 1RUPH 4FFVD 2ZXWB 2GHZA 5ABZA 3EGSB 1K5NA 5AW9B 1F1DA 5GS3A 1IL1B 3REVA 5IB2A 4H8PA 5F0MB 1NANI 3CFEB 4QHLB 4XAWH 3SDYH 5T3XE 2FHCA 3MV8E 1PLGH 3D39D 4XR8C 3EOBA 3ZR6A 1AD0A 1QTPA 1YNKL 1FYHB 2ESVB 3VGFA 4Z6AT 5ICZB 3A6OA 2WQRA 2O5XL 4H26A 3HC2A 4BFBD 1AH1A 5BQ7B 1IM3A 4B0MB 2PABA 3PL6C 4MMYA 1D6VL 2K4WA 2DJMA 3S6CA 1N8ZA 5E9DD 1TLKA 1G7LB 3RWHB 5C0BE 1CVRA 4OZFB 5BS0A 1MNUL 2CKBH 2G4EA 3CDZA 3WN5C 3KH4A 1CT8B 5T3XD 5LUMA 2Q5BA 1JXGA 4YZWA 1PJWA 2ZUTA 1P7KB 2WWMC 5CEXA 2VDRB 3IDMA 4KBPA 4K5MA 4A39A 1LYQA 2BSED 4B41A 3HZMB 4EZJA 3FPXA 1XCXA 2YPLB 3HG2A 3T4AB 3AY4C 3KPQB 1IAII 1NWOA 5FYLH 4P04A 1FSKB 4PVLA 3WFBH 3UFIA 2FEEI 4BK5A 1NFDA 2Y6TE 1RPUA 1KB3A 4LCCA 2MCG1 1RJZA 3WSQH 4L4VB 5KYXB 2FGZA 5IBTL 2H3KA 4NO0D 4WRLA 5E9DE 2NXZC 5C09B 3WO4B 1D9KB 2NY6B 2UWEB 2IFGA 1JGUH 1JZGA 1NAMB 2N1KA 2CD0A 1BAFL 1VENA 1MAML 2P42B 4IBYA 1PG7X 1IIKA 3VD0A 4MTMA 4GAGL 1E6OH 3GT6A 3PREA 1YMHA 3L3KB 1NLBH 5CAYB 1T7XA 2GBUA 1QR4A 3SGDI 1UJ3A 1ZLVK 1M7IB 8CGTA 5E6IA 5DF0A 1JK9B 1FVDA 1KB5L 4Y8AA 2FT7A 3IJYA 3VD3A 3OKOA 2LU7A 3RZCB 1IJ9A 2AABH 3M46A 5CZXD 4UQDA 3FB5B 1DVFD 3D06A 3P73A 4RAUB 5C07E 1JE6A 3OAYH 2GG1A 2QLVB 2F53B 3U79A 1HNYA 5EU5B 3W57A 1I3UA 4HWNA 1N59A 3VB9A 2AV1B 2BIMA 4W9FC 1HWGB 3G3LA 5DVLA 1ITBB 3QC5X 1EZSA 2ZG3A 3SE9H 4OZGB 5ITFB 4XAWL 2EINB 5C08D 4ZNEA 4YBQD 1XGTA 2QL1A 2X0UA 1KGWA 3LJ3A 4XPHL 4XWOD 1FORH 3FUHA 1M57B 2BVOA 1UXWA 3GJEB 4XGZB 5DD5L 3MJ7A 4EUPA 5J9PA 3NJLA 3PDOA 3I9GL 3CNKA 2F5AL 3QRGH 3QEGL 4LLWA 5M94B 4B6ZA 2MCPH 1C5BH 2WLIB 2A74A 4MJID 3V0VA 5E24E 3ZKMD 1A3QA 1VEOA 2BW5A 3FHQA 5F1IA 2QQKH 1U8HB 1PG7H 4OI9A 1R3JA 1T7VA 5JQ6H 1EZVY 1MFEH 1JGVH 3HPLA 4ZUTB 3L3IA 2Q8BH 4QRRB 1P0SE 4M1DL 3TBVB 3C5ZA 1KPRA 1DQQB 4Q6YA 4BZ2H 3PABB 4IU2B 4LVHB 5F7WC 4PPTA 5FO9A 3EXJA 1N59B 4WSGA 3KWWA 4JEGB 3NSFA 1H8OA 4PCKA 1KB5A 3HLAB 4FNSA 1QYGH 3C75A 2WWNA 2P5PA 5EDXA 5F1OB 5C8JA 5JZ7C 1G5AA 5TE6H 4BKTC 1OT1A 5LG1A 3PWPE 3VG9C 3EOTH 4CJ0A 3BD3A 4K23H 1YEDB 1E8YA 5CU9A 4WWPA 1EEUA 5EOTB 2G5UA 3BN9D 1WFTA 2WXKA 4XWOC 5FA3B 3BGMB 1TEGA 2BP8A 4QF1B 3WGVB 4FHKA 3LXAA 1MFNA 2AK4E 2OMUA 2APWA 3HA0A 1MFVA 4MRBA 3S3PA 1F11B 1GTFA 3FB5A 4D3CL 1YUHB 2L04A 4L8BB 5E6RB 5KSBB 1U8IB 2HVJA 3JTSB 3SKMA 3PJSA 5KBLA 2VDPB 4BFGA 3O8XD 4P5RA 3BVXA 2WBJA 1YZZA 4G6FB 4F91B 2QHLA 3IDYC 2DMBA 1FHGA 3D12B 1JZ6A 4JCMA 1UZ6F 3C8HA 2CHDA 2OI9B 1BD2A 1QAWA 2ARJB 1FP5A 1OSZB 2V8LA 4ZS6C 1B0WA 3EADA 3BQUC 1WBXB 3V0WH 1U93A 4ZW5A 3KR3H 1XGUA 5EZLB 3SO3B 5I1IL 1LO3H 1N9PA 2D3JA 5HI5D 3FB6B 3CU1A 2CPUA 4JW3A 2ZP8A 1ICTA 2XC8A 5EWIH 3KH3A 1WCBB 4XMZA 1ONQB 4RESB 3ESNA 4AIOA 1I31A 1FJ1A 4XBEL 1HYSD 4XXWC 1CDHA 3QPKA 3UGXA 1XF1A 2BY2A 3O45A 5JR1L 3LD8B 1E27A 3K2MC 5IK3A 2QGDA 3PV6B 3UEQA 3BWSA 3JTSA 5AVZB 3SKMB 3C5ZB 4QD2E 4BQCA 5IB4B 3AM8C 3C60C 3SY0A 3LDBB 4JFWA 3L4TA 3X13B 1WAAF 1X5JA 4OZ4B 1YAIA 3PNRB 1Q38A 3EO1A 4I48A 2D73A 3CWGA 1BBDH 3QJFA 1OSZA 3MRIB 4M43H 1NSNH 4EF3A 2P52A 3MRCA 4G2AA 1MWAB 1YECH 4L4TE 4WUKH 3QUZD 4G11A 3RZCC 4N20A 4OF3A 3NIDE 5HYQB 1E90A 4FP8H 4DKFL 4MNGE 2BWDA 4N2AA 1ID5I 1S7TB 2WAHA 5B7EA 1NIEA 5JHDD 4RRPA 2CUAA 1I9RH 5L7XL 3AY4A 4HIXH 3WY3A 2VLRD 1G1YA 3OLEA 4AGPA 1HJBC 3BPNC 5HHMB 1D3CA 4Q56A 3RG1C 4N8PA 5IB5A 2OR9H 4JM4L 2F58H 1ZLEA 4FZEH 1KG0A 1D2OA 1O7SA 1X5XA 2ODIA 3RUGF 3UDWC 3TT1H 4LK4A 5EEZA 3EYSH 2IQ9L 4NKDB 2IBZX 2K78A 4LEXH 5ANMA 3WY2A 4FMKA 3TH3T 4Y2DC 1FL6B 3O2WH 4ODUA 1S5IL 3PWVB 1JGDB 3QUZA 4L1TA 1QZ1A 2K9FB 2X4QB 4PRBA 4FABL 1JPTL 4M1CD 3K71A 3QJFB 4AG4L 1FE8H 2BFVH 3DPBA 3F58H 3ULUH 5DCCA 4JREB 2PXYB 1K5WA 1PIGA 1G9NC 2A6KB 4FQCL 3FTGB 4QYOA 4XPTH 5TF1L 4OFDA 3MJ6A 2G60L 1AO7D 4MS6A 4F57H 3D48R 4XNDA 4JQIA 4XNZB 1X4XA 4IKNA 3EFDL 5CIPB 5DYOA 2OL3L 3RA7H 3P3TA 12E8H 1UCTA 4OCWL 2J8UF 1KGUA 3ARXA 4UAHA 3FTSA 2AQ1A 4AOFA 2ZYIA 5J5EA 1IGFL 1CF1A 1IEBA 3KYMA 4NS0A 4LLAA 4N5UA 5HJ3B 3OB0H 1HS6A 4Q4IA 3MLXL 4QJ3B 5I73C 4XN8A 3UTQB 2VSDA 4FXGC 1AOZA 4XTRD 1EZUA 1DVUA 2YPVA 4APXA 5BV7L 5DVNA 4PRDA 3VXSB 3HAEB 1N7ML 2PYFA 3MBXL 2GT9A 1ZTXE 2A7BA 3AQDA 3BEVA 4ISVB 4EKXA 3MROA 4JB9H 4U1IA 2HH0H 3JV6B 5FUCC 2J12B 4R90H 2WBWB 43C9A 5CU5A 4XHQA 1YYMH 5L0QC 1T1ZA 1Z3GL 5L2JA 4IMLB 1THCA 1MCIA 2MFNA 2EIBA 2W9LA 1LK3H 1BOGA 4EXKA 4FADA 3QDAA 5DRWA 1UM5H 4WKZA 1KB9K 3K6SA 4GSUA 4BA0A 4FXTA 4KTGA 3PJNA 4MB3A 4OVUA 4ZAKD 3MNMA 5FB8A 3CHPA 3LPGA 3SGEH 2EDXA 2W65B 2YD9A 1A4KA 2X3BA 3KXFB 1AQ8A 3P4NA 1SF3A 1JPTH 2YPKA 5DJZB 3MV8A 2XWJB 2CRYA 1FFOA 1OAKL 1QFUL 3W3BA 3R1GH 4OGYL 2FD6H 4HHAA 1I3RA 2ENSA 1OLZA 4WEBL 1CD1B 2R0WL 1U92B 2X89D 1ILUA 4IMKA 3S96A 3NSYA 4BFNA 2IQAB 2HT3D 3D34A 1N26A 3EBIA 5FW7A 1YJDC 4AVJA 4DP4X 5KSUA 3J8F7 1ZJAA 4ZQKB 4HWEH 3VFWA 1QLRA 3PP4L 3BZ5A 5B38B 3GLAA 1HSBA 5CP3H 3GNML 2MNJB 4JDTH 1HQRB 1TCRB 2FJHA 3U0TB 2CR6A 4MKMA 3MYZA 4KFZC 1URIA 4L5FH 4OV6F 3AT0A 1HESA 3MNVA 1YEIL 1NUNB 3S5LB 5KUKA 4WTXA 1IIIA 1VFBB 1ZHNA 5DO2C 1SEQH 1D7CA 3V6BR 3N5AA 1QFHA 2BWQA 2XJKA 1RMFH 4UUJA 5C71A 1Z0MA 2FL5B 4HJGB 4GKZB 2AMUA 3K2IA 5C9KA 2VZOA 1PLCA 1V3JA 2Q0ZX 3GQFA 4OT1H 2EXSA 1JJUA 5DS1A 3TYFA 1ZSDA 3HE7A 1AAJA 1BREA 2HFGH 3ZQXA 4GMSL 5DK2B 5IMOB 5MEOA 1YYCA 4AMKL 4ZFOA 4WHTA 3T6VA 4ATWA 3T4AC 4JKMA 1QLRB 4M7JH 4LSSH 4ZDHB 4KHTH 3NUKA 4Y1AE 3U9WA 2QQKL 4P5TC 1IGYB 2ATKA 4XCNB 4DUWA 4LSVL 1IBDA 1MRCH 3UROR 4XE0A 1DFXA 3N1FC 2H4EA 4X8GA 3HB3C 4JFFB 1X5AA 3HG3A 4RA0C 4OZFG 3VXUB 1EBPA 4WKZB 1JWMB 4ZMPA 3PP3H 5AB2A 1JGLL 1ES0A 2OL3B 2YC1A 4RRPM 4CA4A 1F42A 1A6VL 3ALPA 1F0LA 5KVDE 5D5MF 5SX5K 3WIIL 4MCYA 2B08A 4QTFA 4Y5YA 4K3EL 4F9LC 4OGAD 1P7QB 2AJXH 2AI0H 1PAMA 2AXHA 4NCDA 1QQDA 4GW5A 4A2EA 2FL5A 5KTEL 3EFFA 3DV4A 3MPCA 2XKSA 3SDCC 1Z5LB 4ODWB 3TA4D 3CHOA 2H0PA 2ZPKL 1QP1A 2PO6D 3V10A 3U7YH 1ZSDB 3HE7B 4XNZC 1T6VN 4XHJD 5AWNH 2OYKA 1MCSA 4YBLB 3AADB 4E9SA 4YSQA 4JFEE 3UYOD 1R3IL 3RNQA 1PZCA 1QMUA 5GSRB 4OFVA 5DQ9B 1KJVA 1Q0EA 3V95A 5JORB 1NGWB 3OQRA 3OKKB 5E5UB 3VA2C 4AM0B 4M4RB 3MNZA 1T7ZA 4ODTL 5EUKA 1YNLL 3RGVB 2J5LB 3CHSA 5D70L 4MXWH 3A4AA 2F53E 3T8MA 3ERXA 4PMFA 2EXWD 1Y0LB 5F71A 1F4HA 1ETB1 1I7RA 4MMYB 1JXDA 2O5YL 4F24A 3J2PA 1QLEL 2NPLX 3VGEA 3POCA 4P9ML 3RVWD 1L7TH 1W72L 4LO9A 3UGEA 1CT8A 3EGXB 3LZFH 1F56A 4GW5B 1HXMB 1WG3A 1L0XA 3HRZA 4NERA 3ZDZF 1XZ0A 4GW1B 4XCFL 4KNTA 4ZFFA 5EFIB 4U6VH 1S46A 1OGSA 1EHAA 2IDCA 1QD0A 3QQNA 5DJDA 1UENA 4PJBF 4Z3GA 3MGOB 1FNAA 2PYEB 1YPZF 2VNCA 4AIEA 4YFEA 5I0DA 4ZMTA 5E9DB 3FPYA 5BV7H 3VXRD 2W8CA 1JWSA 1CE1H 3OKKA 3DWTA 3IN0A 3V5HB 1VGKA 3VG0L 5CLYA 3RGVA 2Y36H 5AVTB 2XV3A 2EVIA 2K4AA 1XIWD 4AI7A 4MAYC 2YPLE 1TU2A 4HH8A 2I7SA 4Z0BH 1T2JA 1D5ZA 3EHBC 1WQVT 1X9QA 2Q2EB 1QRNA 1SYSA 1PD6A 3APNA 4PRAB 2QKIB 2YQGA 4ODSL 5J1AA 4IIQC 4LASH 4X80L 4NN7B 3OHMB 3RY6C 2AC0A 4Y4HA 3H56A 4F7CB 3D52A 5KSBF 4XP5L 3VXRE 2A0LD 2E9GA 3MA7A 5D2NB 5E6ID 4P2RB 3KWUA 4BK4A 5I1KH 1MH5A 2JKWA 3MGOA 1AZBA 5I1DB 3PHOA 4X7SL 4FZEL 2R0LL 4XXDB 2ZUSA 2CO6A 3CSGA 3ZLQC 1AMYA 4TNGA 2PYED 5F9WB 4UIMB 4CDGC 2X40A 4RVBA 3B9KC 1OAKH 2VAAA 1XGPA 3NRPA 4ZXBC 3ESMA 3TN0B 4M48L 3WJLC 1J5IA 1NBVH 2EABA 2CHZA 2AJYH 5HGBB 2FB4H 3HUJF 2WQVA 1FIGH 2BSTA 2NY2D 4LBEA 3D0VB 2ZKWA 2A5UA 2YKLH 1ZHLB 4V33A 3HRZC 4ZPTA 3TBTA 4PRPB 3DI2B 3UERA 4GOSA 5ECJE 2LU4A 3LQZB 3CMOH 1KXVC 2WQXA 1I8KB 4JDZA 4LQFL 4PWIA 1ET5A 3LKOB 5GGQH 3ULUC 3S34L 4CADB 3C8KB 1W6LA 1CTMA 4XX5A 1PFCA 3IMBA 4HKXB 3IMVA 5AW0B 3MLUH 4NUPA 4D9QD 4XC1L 1DBJL 3HLAA 3LDBC 4NRZB 4XXDA 3WHE1 2P5ED 1KNOA 3C09B 1S7XB 1JNLL 5IIEB 2ICWA 5DZNA 3EHBB 5T1KA 4LPVA 4QHNB 4B9JA 1CFVH 4PUBL 1F13A 3TJHD 4JFZL 2PW2B 4ZO9A 1YVLA 1KCUL 4L4VA 3ZHDA 5F9DC 4AGLA 3U36B 4WNJA 5CP7B 1L7TL 1W72H 3GMOA 4DGWC 5D1ZB 3LOWA 3T3PB 4KTEL 2VC2H 2Y2WA 5HY9B 4UT6L 5DJ8B 1WTGT 1TNMA 2OMUB 1ZHLA 2XG4A 5CILL 4Y19B 4GRMA 2CNZA 2E8ZA 3F7KA 4YK4B 2DQGL 5K39B 5AVQB 2BDNH 1QATA 2WBXA 4JKWA 4MVBC 5KSBA 1WBYA 5I0WA 5DVOA 3KJ4C 3OHXC 5I15L 3Q3GB 3OKDA 3LRSB 1G4RA 4RH4A 5E94B 1DSFH 1LE9B 4PJEA 5JW5A 2D03L 2AQSA 3OR6A 4B60A 3QUYD 3FN0L 1J18A 3NH7L 3AROA 4K94L 1XCQA 1F4AA 5JW3L 5F3BA 2BSEA 3E6HB 4AL8C 5DFTA 3QJUB 3DA0A 1S5HB 4R7NB 4NNYB 3S48A 2HFGL 3IGUA 2IF7A 2D2OA 1VADA 3D0LA 4GSXA 2EXYD 4Y16D 1SFDA 3TCLA 3EH1A 4HEMA 5CJXC 2ZCHH 3FUNA 5F7DB 3L1OL 4OZGF 1DBKH 1ED3B 1KZYA 2ED7A 1GY2A 2RH0A 2VLKE 3O3BB 5JA9A 1ZDSA 2DLHA 1SHSA 1JGLH 2ZUWA 3IJEA 4J8RB 2P47B 5C9JA 4X5QA 4GAJL 4FKEA 5C0FB 2P7TA 3GKWL 4L3EB 2UX6A 2W0FB 2IH3B 4MZIA 4JDEA 2B20A 1T7WA 5F1IB 3JYCA 1YYLL 5E5MA 1BEYL 4JO1L 5ITFA 1E9OA 1T2XA 3IU4L 5HVHC 1H19A 4X8XA 4O00A 4Q14A 4XVSH 2ESVE 2PTVA 1KCRH 4JHAH 5DS8A 5AYUL 1P2CA 4NNYA 5IIEA 2NCEA 1CGWA 3TBVA 4ODXB 1FFTB 4XN1A 1SVBA 2LU5A 3WMQA 1UXWB 1DL7H 3GJEA 1LVEA 5J9PB 2YN3A 5JIMA 4PJ5A 3WHE0 2X1WL 3OD3A 4L1SA 4WCYH 4U6VL 4NN6B 3UX9B 4XWGL 5D1ZC 2X4OB 3N9GH 1IC5L 4I4WA 3MLSL 1CXEA 2VLLB 5BMFH 3OKEA 4O2FA 4PB9L 1KFAL 3AXLB 2ZUXA 1KXQA 4Y16B 3U9UA 1XSKA 3T3ME 3UACA 4AG4H 4MDIB 1WIOA 4MD4B 4XP9H 4YMPA 4PJ9B 3K4DA 4OJFL 2NR6C 2ZOKB 2VDPL 1LE9A 3FU8A 3N06B 1ZLUK 2ZUQB 3Q5TA 5SWZD 3CN4A 3KHQA 1G7IA 3ZL4L 1DO6A 2WO2B 3IJHB 3MOQA 3U1SL 2Z0UA 1LGVA 5IUCA 1MFMA 1DDTA 1S7QB 4Z77A 4GW4A 3INOA 4DOHE 2VL5A 4MNGA 3H4HA 4NP9A 1VADB 4ZYKA 3BWUC 5DD1H 5C0JA 4W93A 2VDRH 5JUEL 2R1WA 1E30A 4IRZA 3ULUD 2G75A 4ETYA 5I75B 1CI3M 1FBIH 3QQDA 2EUXA 3AREC 1TQBB 3Q8EA 4HKBA 5F7DA 3X3GL 3QDMA 4UT6H 3ZK0A 3EYUH 3FSZA 2H45A 3SDXF 1A7BA 4H8WC 5KTEH 5H4YA 4MMZC 4NZRL 3MKKA 3LNHA 4LCUA 4HS6B 4LLVA 5CIPH 3D07A 2IWEA 2BVEA 2OCCB 5D2LA 4Z7QE 4PGCB 3TS8A 2HJKA 3CZNA 2WUCL 2CJUH 1A9VA 3CZLA 3T0XA 5AOMA 4NZFA 5JQ6L 1RURL 3DBXA 5EIIA 4Z18A 2CLZA 1OAXH 4ZUVA 1GGBL 1WIUA 1BYPA 1KBBA 3MRPB 3VRLE 5KYYB 4PWEA 5E5MB 1E9OB 4I87A 3H85A 5KEZA 4LOEA 1VZHA 2P5WA 2B59A 3P0VH 4WFHE 1IQWL 4JRXA 4Z77B 4PJ8B 5C0EA 4BSJA 4AYEC 1HI6B 2DQTL 2R2EB 3QXTA 4HS8L 4PR5B 4Z7OB 4KZEH 3CXDL 1R33A 4FFYH 4TULH 2R1WB 2OV0A 2ZP9A 3WN6A 2NY5H 4XPAL 2UZIH 4XN7A 2DI9A 1CUOA 1N18A 2H6UA 3A6BH 2FRGP 1WWBX 1RZ8B 4ODVL 1IC1A 5F44A 3STLB 4TPRH 3CDGB 5F7FA 3LZFL 2BIHA 4PEEA 4MDIA 5J57B 4U4IA 4NFCA 1JTPA 5F7HA 3C6SA 4RLDA 4UZGA 1QPXA 4ZG1A 5L88L 3EJCA 1E28B 3LQMA 5F0LB 1DQDH 4J6RH 1E5YA 2R2CA 2XBDA 1IAOA 3BQUA 3G08B 4F33A 3KS0H 4X0KB 3WJJC 3US0A 4XMVA 4AITA 1G1KA 5I8OL 4ODTH 1PNCA 3QI9B 6CGTA 4F2MB 5AKTA 3CBJB 4AENB 2CZNA 2AAVA 2HMIC 4R2GD 4AEHL 5IEHB 1P4UA 2P5WB 4FQ1L 2DDQL 2WYIA 4JRXB 4P48A 1H8SA 3L3OC 4K71B 1JL8A 3BAXA 4JN2A 4LRNH 3VXUE 1RP9A 5LVEA 1QACA 2UYLB 2FATL 3VWJC 2OJEB 1U33A 1CD1A 1KCLA 2R4SL 3DX7A 3PE9A 1Z9LA 4H8UA 1NGQL 1G9MH 5IB5B 3VWKB 2KH2B 3MV8D 4PJ7B 2J25A 1QKZL 1IKOP 2LQRA 2PR4H 5C7XH 3VFWB 3OXRA 5D7IF 3N42F 5FUOL 1CGSL 4QNPE 4ZMOA 3N91A 2ZNWA 3D6GA 4JZNA 4M93C 4HWBL 4WV1B 5FC9A 2AJZA 3FQXB 2KZ1B 3GZKA 1CFMA 4KK5D 4HUWB 2XN0A 4KX7A 2WC7A 4JZOA 2IXQB 2WUBH 2CE6A 3P2BA 5D4HA 5H35A 1EXGA 1MRDL 4XB8A 3N44B 1CZ8L 5FOBA 4NWUH 2VQ4A 4FYTA 3UIZA 4QAWA 4UOJA 4M7JL 4YHOH 4QHUB 1HI6A 2R2EA 4PR5A 4TSBL 1AJ7L 1YY9D 3ESPA 3SCMB 5E08L 5DRNA 3KDMB 3P54A 1EO7A 2P49B 4LLQA 4KXCA 2Q10A 4G6ML 1J9SA 4WUKL 1L9QA 3HS0B 3WIHL 4UM8A 2W07B 1ZGLB 3GIZH 2VDNH 2B1HL 2YMXH 2WWMD 3FQTB 4L8DB 3UJIH 1FO0B 1N8OE 1ILSA 4PV9A 3SEPA 2FB4L 1QFWM 4NQQA 4WV1A 1NLDH 1LO5B 3OXSA 1B0IA 2FECI 4U1IB 5LDUA 3MLWL 3FS9A 3NJVA 3V0IA 3WNMA 5IUSA 4X4ME 2BERA 1F3DH 1VIWA 3FFDA 3CZSA 3HNTH 5BNXD 1NJ9B 3JZ7A 4HW6A 5J13B 5FOBB 5JXEC 4M6OL 4E0RB 1W16A 5ALBL 2A1WH 4JANB 1MCWW 1ML0A 2NY2C 5I5RA 5DUBA 2WQSA 1JI2A 3ZRCC 1MHEA 1F3JA 3DOHA 3QWRA 5D7JC 2JLPA 4FA6A 1FZMB 1O9VA 3NCFB 5DLML 3NJFA 1R0AH 4NQEB 3MREB 3VD9A 3GZPA 5F3FA 3DUSB 3MMEA 3NN8B 5LBVA 4QJ5B 3Q1EA 1KLUA 2EIKB 3TU6A 3DX7B 5FDWB 2GJ6A 3ZIYA 3IE9A 3VWKA 4IYKA 2ERJC 2IO5A 3B2VL 4JFFE 1USQA 2XTJE 1B2WL 3W0WE 5GS0H 2CLRB 3KBFA 3QZBA 3TYGL 4TNVF 1I9IH 1JNHB 3M8OL 4HEPA 2APFA 1KPUB 1TT6A 4GSQA 2AV7B 2QSVA 3MLSH 5ETUB 4I77H 5FV1L 1M3IA 3L3GA 3FL7A 1MFEL 1VB9A 2FO4B 4QY8A 1BZ8A 3SOBL 2DQDH 1UB5B 3EDKA 5IGXH 4JG1L 2FJSA 2EDWA 3ATAA 5E8PB 2F1AA 3ATEA 5AVYB 5D71L 1U8CA 2D03H 4BINA 3QIUC 4JFFD 1DJXA 4JPIB 2YPKB 5DJZA 4P5MA 3KEHA 1NKGA 5FYJU 3JVGA 7TAAA 4L8CA 4JM0A 1PLAA 4O4YL 4P3WA 4RZCA 1UKQA 1KIRA 4YDNA 2Q3AA 4KROB 1ORSA 1P4LA 5DA0B 3DSNB 2BS9A 1X7TA 1CIUA 3ZSTA 2BJML 2CLRA 3QS3A 4U1HB 2XJLA 4LLUA 3A6CL 1FFNB 3HNVH 3D69A 1FFPB 1V5JA 1U3YA 3ASNB 4C8XA 4EI6A 3SJVA 2WOBA 2EIEA 3B7UX 4G7RB 3MO1B 4IKKA 3TIEA 1NL0H 1ZKAA 3MZGB 3D39A 5L6YH 4UANA 2VZUA 1D7BA 4GFXA 1DUZA 4X6CF 4XN9A 2Y3NA 5HHQA 3K1DA 2P8MB 3NEEA 3WLWD 1CICA 4YH6A 5JPNC 5GIRA 3UZEC 4KX9A 2QKIA 3WEXA 5B1AB 1RUKL 5FM8A 3C08L 2X0VA 1C9SA 2I7OA 3GHBH 5CJ5A 2ZX5A 3UTSB 4ZZFA 4F7CA 1CG9B 3S36X 3LCYA 4PTTA 4AKOA 3VTTA 1U30A 3C9NB 5EZOL 2EYRB 3DSFH 5BRZD 2WKOA 4NRYB 4PCSA 5HGHA 1T66D 2GJ6B 3ZO9A 1UOWA 5DHYA 2I24N 4BZYA 1N64L 1QQDB 1P84K 2NXYB 3QDGB 5HJDA 4F7TA 1BQUA 5J6SA 2G0LA 3SJVB 2CO6B 4JM2D 2OBGA 3B2VH 3DX3A 2Z65C 3TZVD 3IXTB 1ODAA 3VXUA 3NIDB 5LO7A 1E5BA 2PCFA 3W39B 4YC2B 5I6XB 3EYSL 5HHQB 3B2XA 4JFUA 1UB5A 1F41A 4DGUA 1SDAB 1E7UA 1LO0H 4RX4A 5KSAD 4Y5YB 1SY6A 3OKNB 5C2BL 3BIAX 4M4RA 4A6YL 1A6TB 1CU4H 4R7XA 1D5MB 2CO7B 3D0VA 3ESVF 3CPLB 3D9AH 1EBAA 4QRFA 2OXGB 4YGVA 3P11L 1CN4A 3D1MC 3HBQA 4J4PC 2XWXA 3L5XL 4H2AA 4XP9L 4K94C 1OCWH 4DKFH 3CZKA 1RK0A 2E7HA 4M02A 3RNQB 3HVNA 2V4LA 4W81A 9PCYA 1WAPA 2XZZA 2JB6B 5KSVA 3WEOA 2OSLB 2EYSA 1NGWA 4WTZG 2HX8A 4MASA 5B8CB 3BAWA 1PZ3A 3MNZB 1E3FA 4FHBD 2VSMB 2F19H 5MP6H 3ARDB 3D39B 4DEUA 4ZMYA 2VDKH 3LHAA 1T1XA 2NNFA 1EXHA 3VCLB 1IAIH 3KYAA 1YNTB 2WJ7A 1N3NB 3OKNA 1WH0A 2VLRE 5JHMA 2B4CC 4GS7C 5DURB 3HTLX 4FG6D 5ACZB 1FNEA 4R2GC 2GVYA 3GKWH 1E3XA 2WKLA 4FTVA 4PHXA 3UTTE 3CLWA 3II2A 1XD1A 1RUQH 5GRXG 1HQ4A 1FC2D 3VW3H 3KPSB 1EHNA 5DJDB 3X12B 3TVMB 4XP6H 3EJYD 3I3EA 2I60H 3DOSB 1QBLH 4PJIA 1XH3A 2VXSH 5F7EH 3IDXH 2VDOL 3BAKA 1MEXL 4P9HC 1MG2C 5B8CA 1RU9H 3HG1A 5MEQA 4WTWA 3NABH 4L3CB 5JQIB 5JNYB 4FZ8H 5SV3A 4DH2A 1HEZB 2BWIA 4NM4H 1OIOA 4AYBA 1HJCA 1MVFA 2C3WA 3FCSB 4HOXA 1GS8A 2XWZA 5F6IC 4RAVA 3B5TA 3GM0A 1U91A 4M7ZC 5EEVA 2D0FA 4C4KO 3WKPA 4A7TA 3HMXH 1NMAL 1MF2H 2CMRH 2BIOA 3ILQD 1I7TB 4NO3A 1N3NA 1J1XL 4Z7WF 2F08A 4L23A 2YRZA 5FKAA 2CO7A 4PU2A 1JZFA 1CBVH 1U95B 3QUYB 2A83A 4P9HL 4YHYB 1A1NA 2IALA 4MAYA 3LVTA 4BEIA 1BAFH 3WHXA 1OQOA 4EUPG 2Q7NA 3ESOA 4IRZL 4MBRA 5DURD 1H3VA 3CX5K 3X12A 3H9HB 3T2NL 5HGBA 3MBXH 5FHAL 1MZZA 1RMFL 3WOVA 1TNNA 3HNSL 1J0IA 2FGWH 2Y06H 4R5XA 1HILA 2XN9E 3VYOA 1IKNC 4MJ6A 1WVZA 1OCWL 3HN5A 1GJIA 3QB7C 2AEWA 2GABA 2P5EB 2VXUL 1ETJA 4RMBA 1LMIA 1WAAA 2J73A 2ZWKA 2FX8L 3HI6L 3U4AA 3BCFA 4MXQD 5FYJH 1WRFA 4I9WE 4MJIA 2J56A 1Z3RA 2L7QA 4E9YA 3C5ZC 1SMDA 1S7UA 2APXA 2HJLB 2QADD 3FB7A 3GSNB 2MH4A 4UB0L 5HDBE 3RL1B 3T65A 1EO8L 3Q6GL 5C0GA 2KLTA 2VJXA 3PWJB 2F7IA 4N2KA 3QUYA 15C8L 2GAZB 1IC7H 1RH8A 4WK2B 4B5ZA 1CDJA 2LR4A 1OAXL 3SQOL 3PG2A 3HG5A 3NZSA 2Y7NA 2OMBA 4NO0B 4XVUD 2AERT 3TVMA 1QO3A 3ASWA 3QWOB 2HTKD 1OTSD 4GRLD 5GS0D 5FO7B 1U8QB 2WTRB 4NQCA 4WW2B 1IGCH 2W91A 5EH1A 3MU3A 4WFGD 4EZMA 3QUKB 2JKLA 1YN7B 1DVFA 4TQHA 3FCBA 5GGUA 2Z0BA 3H3PH 2AK4B 1H3XA 1ZTXH 2E3VA 2ZWZA 1MCNA 3HUJE 3L3IB 3RAJL 4HJUA 3Q2WA 5J06A 3CBRA 4NT6B 3CFUA 2D0GA 1S9XB 4OCLC 3BE1L 1KIUB 5CFAA 4UDUB 4A7SA 3HN3A 2G75B 2BNRE 2G5BB 2NCMA 3ZT7A 4BV1A 2VR5A 4JREC 4KKAC 2ZD0A 3OR7B 4W9IC 3W56A 5JHLH 3QO0A 1GXEA 2BVUA 1QSED 4MS8D 1I8AA 4HUUB 4NAMA 3U30C 1YG9A 3ET9F 2DLEA 4U7KA 1OTSC 2Q7YB 1U8NA 4EI5A 1G7MB 4LKXB 3ORJA 4CRPA 4F93B 1UA3A 2ZX9A 3VGAB 4AZ8A 4HXAL 4CVXB 4PGEB 2J88H 4DGVH 1RZQA 1BXXA 4WO4C 4WJG3 4ZUVB 3O3BA 3OPUA 4PJIE 1N10A 2R8SL 1T4KB 3IXAB 2ZZUT 1D5XA 5E4EC 1XCQB 4MWFA 4P9MH 5JW4Q 1YEKL 1X4ZA 5D1XC 2B59B 3PJSB 4GRLB 4HSCX 3RY4A 4P46C 2XPGA 4BDVA 4IU3B 4JHZA 5D4QA 2JJTC 1JGIA 1R5WA 4H8QA 3PHSA 4NKOA 3FB8B 3BI9X 2BVTA 3QULA 5CP3A 4ZTPL 5J7CC 3EZJB 1M56B 4KDWA 2D7TH 5E2VL 1JZ5A 5FCSH 5IVXF 4FN0A 4DP1X 1AKJA 5FW8A 3GBEA 4XMKH 1J5CA 1FNFA 1WD8A 1X4YA 3L81A 4XNQB 1VCAA 2FSEA 4A2MA 4HG4K 4Q9RL 3BPLB 1U2CA 4OLVH 4QXVA 1LO0L 2F7OA 2FHBA 1R5IA 3VRJB 4MB4A 1S9KC 1VZGA 2CA4A 4U1NB 4WO4A 3S4SG 3VFTA 1CLCA 4WU5A 2MOVA 2W0FA 2XX0A 2E86A 1EIBA 4BZ1A 1X5ZA 1KLGA 2A6IA 4HK3J 5E6UB 2R15A 1UB6A 3H9SE 3QUKA 4L9DA 4TNFA 6FABL 5FHBH 4MB5A 5E5LA 4IMKC 4KOBA 4AEIH 5E4AA 4PRHD 3GMQA 2V17L 1OCCB 4H4NA 1F2QA 2JJTA 4F20A 1HKLH 3FQNA 1Z2KA 3L9BA 3ARDD 4OFYD 3V5DA 3QNZA 1FZJA 3X11B 3ZL1A 4QRQB 2R0LH 2VKXA 4I4WB 4RFEB 1X5HA 3OJDB 4HULB 1ACCA 1MCPH 5MEND 1A02N 3QG6B 4HH9A 4CC0A 5D1XE 1FL5B 4K15A 4LRIA 2R2HB 1S78D 1TKWB 2HLFD 1IEAB 4XO5A 3AS3A 4JY6A 4R5TA 2QTEA 3HNTL 1ZK9A 3KM1A 3MLTA 5I17A 3TT3L 4JY4B 1LTXA 3S3JA 4JPKH 3WV0A 2P9RA 5GRVL 3VM5A 2NR6A 4I3SL 1E4XL 1JRHI 2K3TA 4XN2A 2M1KA 4AIZB 2W5PA 4K71C 3Q6FA 1BFOB 2XXGA 2JK5A 3T0EE 4GG6F 2F8OA 3RIFK 4W9ZA 2VWEE 4HJ0D 1JK8B 1W2KT 3EGDB 3FF7A 3BN9C 3GTTA 3DHUA 2Q8AL 3FULA 5J6HA 2Z64C 3BGFB 3MUJA 5HD8D 2DYSB 1ADQH 2X4QA 1DQJB 4LARH 4FXGA 1MQKH 4PRPE 4ONHA 3FT3B 3ISYA 4JPVH 2R0KH 2VN3A 2BOBA 1EK3A 3QJHB 1YEEH 3IF1A 1NCBL 4HMEA 2E75C 4TTGA 4V1DE 2JI2A 2Y7SA 3NCYP 4ZTPH 3V55A 3JUZA 1JVKA 2DTSA 3KYNB 3QCTH 3T77B 4HLEA 2DQDL 5IGXL 1S3KL 1G6RA 3EKCA 5GPRA 3T6XA 1QNIA 3P2DA 1HC1A 1Q0YH 4YXHL 3VJ6B 4XP1L 3WI9A 2OMVA 1NDGB 5HYSA 1PFOA 5C6TH 1DP0A 4F58H 2VITB 3TA3A 3W2DL 1KCKA 1YQVH 3VQMA 4X0KA 1UH4A 2ZXDA 3ZN6A 4FFWD 4L3EE 2G3XA 4NQDE 4YDLC 4A37A 3US1A 3QI9A 4L9LB 3JZYA 2AQTA 5B1JC 4NPYA 3CMGA 4F5CE 4PBWD 4BGLA 3PU7A 4GIOA 3VXTA 4AQOA 1ETZB 1IQDA 4EI0A 3U82B 2K6WA 3RKDC 2AEPL 5AENA 5FDWA 1AY1L 1N2RA 2O1AA 3FMGH 3FO9B 1WUZA 3ESUF 4FQHB 4KNSA 3RUGE 4PWKA 4TSAL 3HAEA 4LEOA 2QQLL 4FS0A 3SKUD 5K9KA 2F1EA 3FFCB 5DT1L 2NXYC 3H6AA 3TP4A 3RWGA 4P2OC 3UPCA 3ZE0F 5CKAA 3BLKA 5AZ2L 2FNBA 4X6DA 4YGAB 5F7EL 2VRQA 2LLNA 2OMNA 3TA3D 4P46B 5CR1A 2WVUA 4YDZA 1BAWA 2WQ8A 1JOIA 4RNRA 2C26A 5D1XB 1FHNA 3GJFH 3ZE2F 2FQEA 3Q2LA 1RZJL 4OVVA 4X9BA 2DTML 2OMYA 3NVQA 2I26N 1QSZA 1Y6NR 3CXDH 1GS7A 4TULL 2EXWC 2ZKYA 4IDLA 1KFGA 5HHOE 2EO7A 4YBLC 5DEFA 2WN2A 2F54D 1V7NL 3UTZA 3V4VB 2WLYA 3IF1B 5JOFA 1QI5A 1KJ2A 4XOAA 4FFTA 2F2HA 3RZWA 4L1LA 1YAZA 1UKSA 4QHUA 2TRHA 1GGBH 4ZXBA 3HKZA 2O6CA 3KNBA 4NDMA 5K69A 1F1GA 1CLZH 1SYVA 2HLAB 1EJ6A 4LP5A 5GRUL 1Q0XL 4YXLH 3L8QA 4P5TA 4YSPA 4N0RA 1KIPB 2VIRA 5HPOA 5D2NC 2BZCA 1XSJA 1FO0A 4F7MB 4YPGB 2OFQA 5TQ2H 3CXHK 1IILE 2IPKB 3GO1L 3QA3A 4P46A 4MHHG 5I71C 1FE8L 4JFEB 4KAQH 3AG4B 2IH1A 3QIWA 2Y72A 4APQA 5EOQL 4H0GA 1GKOA 2Y06L 1U8LB 3Q44A 1WEJL 3BAEL 1PCSA 3QZNA 4LCWA 1A7NL 3KPRE 1DBML 3PL6D 1QFPA 4IRSB 4UMGA 3RNKB 1RPQA 1Z5HA 4E0RA 5C70A 1G6VK 2BRRH 5ICYA 3L4YA 2EE2A 5E6ZA 3V4PA 2HX9A 3VXME 1KEGH 1KUMA 3H9ZA 3PXJA 4R7LA