3VD2A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
203
structure length
203
Chain Sequence
HHHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
molecule keywords Tumor protein p73
total genus 32
structure length 203
sequence length 203
chains with identical sequence B, C, D, I, J
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd2A00
2J1XA 5AOIA 1TUPA 2GEQA 4G82A 4A63A 3D09A 3VD1A 2XWCA 2RMNA 5AOJA 5KBDA 4AGNA 3D06A 3KZ8A 2BINA 1HJCA 4G83A 2AC0A 3D0AA 2P52A 3Q01A 2J1YA 2XWRA 3WTYA 4IBWA 5ECGA 3ZMEA 2J21A 2J1WA 4MZIA 3QYNA 4IBYA 3Q05A 3WTTA 5G4OA 1HU8A 3WTVA 5AOLA 4LOEA 2H1LM 5AB9A 2IOMA 1YCSA 5G4MA 4KVPA 4AGMA 2OCJA 2BIQA 4XR8C 5A7BA 2MEJB 1CMOA 2ATAA 1EAOA 1T4WA 4GUQA 4L0YA 5AOKA 1KZYA 3WTWA 4HJEA 3US0A 1LJMA 4IBTA 3US1A 1TSRA 5LAPA 3KMDA 3WTXA 2IOIA 2J20A 4LOFA 3VD2A 1IO4C 2IOOA 2BIMA 3D08A 2AHIA 3WU1A 1H9DA 4IBVA 3IGKA 2J1ZA 2PCXA 5BUAA 4AGPA 4IBSA 4L18A 1GZHC 2X0WA 5ABAA 2BIOA 2X0VA 1CO1A 2YBGA 1EANA 4L0ZA 2WGXA 3Q06A 1HJBC 4IBQA 4QO1B 3D05A 3QYMA 1UOLA 2BIPA 1EAQA 3WTUA 4AGLA 2VUKA 3WTSA 3VD0A 4LO9A 3D07A 5G4NA 4IJTA 3IGLA 2ADYA 3EXJA 2FEJA 4AGOA 4IBUA 4IBZA 2J6WA 5LGYA 3EXLA 3TS8A 5AOMA 4MZRA 4GUOA 2X0UA 1GZHA 4AGQA 1E50A
chains in the Genus database with same CATH superfamily
2B1AL 3QDGD 4A37A 2XI9A 5E94A 1M53A 2EIZB 1EJ8A 1PY0A 3BP6B 3R4DA 4JDZB 1P4BL 3WEXA 5EU7E 1HKFA 1H3PL 1T04B 3MTXA 4ZX3A 1RZ7H 1EGJA 1GC1L 1SXAA 3OLIA 4N0YL 4N85A 3VM7A 3E1ZA 3SDCB 1BXXA 4FTVD 4PJAE 4X5XB 3SGJA 3WNMA 5BMFH 3PWPA 2UWEE 5D5MB 3AACA 4YVNA 3BH8B 1P53A 5DQDL 4A2FA 8FABA 5C70A 3JSSA 2XG5B 3FQRB 1AFVL 2VNCA 3EDDA 4RWYH 4KDTA 3CSPA 4WDIA 4D0CA 1MFBH 3FH7A 5DJZB 3P1VA 2PYEE 2V9TA 4MCZA 4X5WA 5J6HB 3GO1H 3N1FC 4KI5C 4P57A 3S3CB 1JOIA 4LOEA 3OZKA 1KB3A 2B2XH 1AR1C 3MMEB 5T3XL 4B9CA 5DZNA 3JWNH 2YAHA 2YWYA 4HIEA 5JXED 3IFPB 1A1NA 3IBOA 1YEHL 5CEYB 2FLRT 3TEZA 5DRNB 5FO2A 2BCMA 3FFDA 3NP3A 2B77A 5F72S 2WXMA 5A2AA 2H0JA 3DO4A 4S2SA 3X13B 4AIXA 5FF6B 4J6RH 3AU1B 4PJFA 3SCMD 4GH7B 1BQLL 1G5GA 1K4CA 2GAZA 1UA3A 4MQXC 3QZOA 3T0EC 3X12A 3ZK0A 3WTXA 1PBYA 4I18C 5CMAB 2PYEB 3L1GA 3RWFA 2B08A 5DGRA 4DTGH 1EZLA 4M56A 4XNQA 1MW2A 4MMYA 4EKJA 5FCSH 3IFOB 4HKZA 4G1EB 2BP8B 3WFBL 3WSQH 4ETQA 2K9UA 3FUDA 5JPNA 5D5ME 3WAKA 4OCXH 2G0KA 1A4AA 3LVTA 1WICA 2P44B 3SZ6A 4ENZA 4JQXC 4QTHB 1INQA 4FS0A 4D8PB 4M7JH 5D7JB 4HUUA 1DQIA 5FECA 5DVKA 1O7DC 2Y7SA 3QXUA 3S3SA 4ZO7A 4LAQH 1JGVL 2Y07L 4X7SH 1E4KA 1OXYA 2ENQA 3LY6A 1SOQA 3HZYB 1C12A 2C3HA 2X1XR 2WTRB 5HDQH 4JRXA 4XO9A 3ULUL 4XP6H 2PP8A 5GGRA 2K6ZA 3O6MH 1G0YR 2CXGA 1CU4H 3MRNB 5F7YC 4IHOB 4WW1B 2DEWX 3BAKA 3HB3C 4EXKA 3AG4B 4BIKA 2VOTA 2O30A 3IJEA 2YD0A 1GC1H 4TNWF 5A7EA 1CD1B 2JKXA 2YQ2A 3WDJA 5C0CD 1NAKL 2H26B 4X42A 1YUHB 4P46D 4RFNB 4YHMH 5B21A 4C83B 5J6SA 1QNIA 2CNYA 3FQWA 1NFDE 4PMFA 1CLCA 4Z3TA 1U8HB 4LB8A 5KN5B 3EJJX 1Z9PA 3G9AB 5EORH 1KGIA 4F8LA 3FQNA 5KVEL 3Q01A 1JZEA 4EXPX 2BP0B 1LHZA 4CNIA 1RJCA 5KSAD 3F62A 5BZWB 2G4GA 3WXWL 2ZWYA 1IFHL 4Z7WA 5BVPH 4WO4C 2WLJA 2J57A 3B3IA 1L0QA 1GL4B 2OULB 4X9BA 3OLGA 1BECA 4LXFA 2W9EL 4NWUL 3SGKC 4LK4A 1R17A 4QAWA 4YFLF 1BQHG 2C4FU 1AFVH 4QRQB 5KVDL 3SKNA 2K4WA 4U6VH 7CGTA 2CHDA 3O45A 1C5BL 2EUZA 4PJBF 3EYVA 1JVKA 1IVLA 4ODUA 5DMGD 4NQXA 4QHPA 2P5WE 4ZUWA 1GY1A 3U25A 1YEKL 2X70B 1YEHH 3NJIA 3C5SA 4DP7X 5HHQB 1UM6H 3JVGA 4F80A 2YA1A 2ZUYA 2VQ1A 3JVFC 1S46A 5EIIG 4I5BB 2XG4B 2OK0H 5JHDA 3RFRA 3VXRA 1CZ8H 1G94A 2O6FA 1CGSL 2J20A 2IPUK 2XN9B 3IWUA 2C3XA 2GIXA 2HN7A 3UZEA 1MCKA 1NIEA 4AE0A 4AW4A 4M43L 7FABL 5EEYA 2PN5A 5KSVA 3GB7A 3QIBA 1WDAA 1IC1A 3QORC 4XXCA 5C0RL 1H0DA 5ABAA 4LF3A 5JHLH 3WNNA 3PPSA 2BXYA 1INEH 2VIRA 1T6VN 4YXLH 5E6UB 4C4BA 2EDLA 2X6UA 1MCSA 2OX5A 4N1HB 4OCSL 4M7JL 4WJG3 5EA0H 4PWGA 1JMXA 2Q76A 2E76C 4Z7OB 1F4YL 3S3DB 2J8UB 2CUMA 4ZDHA 3MBXH 4HU8A 1IC7L 2EUXA 1U2CA 2YK1L 3QIWB 1TZ8A 5E9DB 5KTEH 1N4XH 2YQGA 4QHLA 1NGZA 1R3JA 2MNWA 1WAEA 1Z6JT 3TWCL 3VGBA 1SJEA 3KHQA 1BEYL 2Z35A 5L8KB 3HG5A 3D2UD 4LEEA 4OAWB 4I2XE 2CPCA 3OLDA 1IC4H 3C5XA 3VI4B 2G3MA 2R0ZL 2C7UA 1CGTA 2VXSH 3NCYS 4DP2X 3UPRA 5E6ID 2Z93A 2FJFA 1M7UA 3N41F 1P7HL 1XIWB 1MFEH 1OAXL 1JWMA 8FABB 1KMGA 2QGCA 4DK5A 2JVUA 2D7TL 1PEWA 4KPHL 4WJ5B 3G5ZA 4MD0B 5BV7C 1F90L 1XGTB 4WWKC 3MV11 2BZDA 4P5SA 1OK0A 3HC0A 3BW9A 3CZFB 4JFOA 4QRUB 4KHTL 3ZE2B 1QFOA 5C0JA 4W9IC 3QIUB 3FQTB 3D3VA 1D5ZB 2JI3A 1JJUA 1K3ZA 2P80A 1S78D 1RZPA 3ZBMA 2RIKA 4LCWE 1E9PB 3DX6B 3VNYA 3HAEA 4NPJA 4JKPH 3QFJE 2WXPA 2VL5B 2Y7NA 3LEXB 3SDDC 3U0PB 1AO7E 4NQQA 3E8UH 4RAHA 4DK6A 5JHAA 1ETA1 3WNJA 5ADOL 1ZEAH 3ZZLA 3D6GA 3KHOA 4HPHA 2B1HL 2DPKA 5BVJA 4HLZH 1AHMA 1WAAF 2XA8H 3H9SB 3HN5A 3HKZA 4FCAA 4JVUA 2EDDA 2V2XA 3BHBB 3NUKA 4NIKB 2IAMD 5F93C 4QTIL 5DD6B 4WCYH 4ODHL 4BH7A 4X8JA 4EVNA 2HMID 2FL5B 3BZEB 3KLHD 3BUTA 3BN9C 2VLRA 1Q9OB 3M1BB 5IFJA 2QQQA 5I1GL 3SOBL 1H0DB 4K9EL 4FF9A 3FOMB 2CR3A 1LQBC 4DGVH 1UC6A 4JM4H 5E1HB 4U1GC 4TUKL 4BUGA 3EDFA 4N0FA 3P0VL 1IO4C 1XTLA 3H1ZA 3FO1B 3NGBC 3K8MA 2DWDA 4M48H 4ZFZA 3UJTH 2J5LB 3QZNA 4Y5VB 1MLBB 3QDJB 4L48A 1T2XA 3ZN6A 2JIXD 2JIXB 4P23A 4I1NB 4QHLB 3BAJA 3QYCA 4K3JL 1FVCB 2Q8BL 5EU5B 2CM6A 3FU7B 3D2UA 3WIIL 1UB6A 1KWKA 2GJ6E 4M62H 4E68A 5IM7B 1UHVA 2G5UA 5D96B 3AXIA 4JFEE 2Z93B 4KRLB 1CLOH 1NPUA 1BD2D 4R8WH 2PO6B 4QTFA 1NJ9A 2VRAA 4HS3B 5FGBC 4UOW1 4AIOA 4X6BB 4WEBH 2HJLA 1SLWA 1MKFA 5JUEL 4KKLC 5ICUA 4Y9FA 4H20L 2EEFA 4M6OL 3N85H 1FRGL 4PJ8B 3ZO9A 4AQEA 4HAKA 3N44B 2UZYB 3IJYB 4HKJB 5SWZB 5T1DL 3V6ZA 1ZXQA 4MTMA 3D3VD 1U8LB 2ZP9A 5FW7A 3BH4A 1O7SA 3J7HA 3TA3C 1J11A 1SEBB 2JNZA 2P80D 2UWEA 4PSRA 4XOEA 1KOAA 2YR3A 1DVSA 5CINH 1A6UH 2GC4C 5DVPA 1WV7T 1CYGA 1XAUA 1UCTA 3LD8C 3BAXA 4GI6A 3MPCA 3P0GB 1DQJB 3GDBA 4HT1H 1CDCA 5CLTA 2G0LA 2K0RA 4UTBA 4XMWA 1NBVL 5B1AB 5E95B 1IC5H 2A2QT 4FXGB 3L3IA 3F7RA 2WVVB 3KWWA 1BJ8A 3DX2A 4P5TB 1EJFA 3F12A 3OR7B 5T33L 3QYNA 3K2UL 5IVNA 4OF6A 4X4KA 5IVXE 3DUSB 4NNYB 5LGKA 4NQEB 3MRFB 5HHNB 2BOLA 1QR1A 5CJQL 1G7IB 3CFJA 3TBVA 1BM3H 2A4ZA 3DOHA 1ZWIB 4FQXA 3BGFC 2BNUA 3QUMB 3JWNC 2CPUA 3NCFB 4PI2A 4OM0H 3FHEA 3C8HA 1M05A 1ET5A 3HUJA 4IRSB 3V8OA 4IRSD 4CRPA 1FSKC 2WQAA 4YHYB 5DJ2A 3SGJC 2R39A 3FCGA 3WEOA 4DJMA 5E2TL 3MXWL 2XQYG 4NGHH 5TDNB 3ARQA 3QI9D 4P4KA 2G75B 4U1IB 4BZYA 2VDPL 3PGCA 3IEAA 1FE8H 4HKJA 5C0AE 5SWZA 3V6ZB 2Q2EB 4OUUA 4S1RH 1RUKH 2E75C 1OGSA 1KLUA 3DROB 5DEJA 3WBDA 3OKMB 1MCIA 4NQSB 4QHNA 3CVHB 3IK2A 5E51A 3O2VH 3UDWC 2VKWA 3KGRA 1MXGA 3OHXA 1KYOK 5E6RB 4Z6AT 2EDMA 1E5ZA 1KPRA 4FNQA 4S1DD 3ZQ9A 2F54B 3HG1A 2OXGB 5T33H 1JNHB 3CC1A 4XPHL 5IG7B 5C1MB 2QKSA 3O4LD 4NAMA 2XFGB 3NA9H 5I5IA 5D5MF 1A6VH 1IARB 4XT1C 1CR9H 2UZYA 3KPOB 2JJTA 2EYTB 3MRPA 4PFEA 4PRBB 4HPOH 2ADJB 4PVBA 2IPTL 2EDTA 1FNAA 4X99A 4D8OA 2KL6A 2VR5A 3FQTA 4DVRL 1BGXL 4NDMB 5JIIA 1UXWB 2D7QA 2H47C 3TTYA 1DQJA 1CGYA 1NCCH 1B0RA 4TQHA 4XMZA 5C2BH 3OG4B 1NWPA 5HDWA 3CFKA 2JB6B 4GT7A 1M05B 3HUJB 5DK0A 1SUJA 5GGVY 3L8QA 1LO2L 3X1EA 1RURH 3DSFL 3VXMA 2AQQA 4LHUB 4I1PA 4NUGL 4HEMA 1A1NB 2VABA 2EEAA 3K6DA 3RU8H 1AQKH 1E5UI 5EZLA 3WIIH 3BAEH 1ZV2A 4Z7OF 3VRIA 2Q3ZA 1D5IH 3DOSA 4H0GA 4L0PB 3HE6A 1RY7B 1MJ7H 3WV0A 2VLRB 4FYRA 4XMKH 4J8RA 1CICD 1O9WA 3LRLA 3I6KB 4GINA 4X7FC 4N1CA 2PW2B 2MFNA 2VR4A 1YNTA 3CCHB 3VI3A 2UZXB 5CSBA 5MENA 2WXQA 5HVHC 4JKKA 3IFOA 4PHXA 4EDWL 4FHBD 1MRFL 3AGVA 1MHEB 2GT9B 4P4KD 4LLWA 4EE2A 3Q1SH 3GJFK 4JR9H 3C9NA 5AAWC 3F65A 5D4IA 1HHKB 3BSGA 1KJVA 4OFVA 3NYKA 5CZRA 3RPIB 4WI3A 1ZKAA 3VNZA 4YDJB 1I85A 2VLKD 3ULUF 4I0PD 1W6WA 3UC0H 5F0MB 1K4DA 1JDAA 5CD3A 2F53A 3TIEA 4PJ8C 1MI5D 5HY9A 4L1SA 2VMJA 3P30L 3KPMB 4C56E 3QQ3A 1KIUB 4JANB 4PWEA 2X2YA 4N9GA 2AJVH 2XTJE 3K3QA 5BXFB 3MO1B 1OEZW 1JPSL 4G8FA 1DBKL 5E8NB 5BPPA 4XHJD 4N2FA 1KBGL 2A83B 1N3NB 3Q8BA 4JKLA 4IBQA 1KXTB 3K7UA 4Z7QE 4N5EC 1MJ7L 2R7EB 5TGBB 3I84A 1UOLA 1U9KA 2FGZA 4NQVB 4P5MA 4YBLB 4R7NB 4J23A 2VDOL 5CINL 1L7TH 3LN5B 2GTZA 3GS4A 2VDQL 3BDYL 3LEVL 1PZ5B 3BN3B 4NQCE 4UNIA 1N6VA 2VR8A 1YVLA 1OAQH 3LNHA 3QDMA 3GIVA 1MNUH 1AZBA 3A4FA 4ZPTA 2GUOA 4F93B 1N64H 4LIQH 1ZTXL 1MI5B 3TEWA 3AMKA 3ABKB 3QR2A 2GTWA 3HPJA 5KSUB 4PJBB 1A7BA 1VGKA 3HZVB 2XWJB 5E6IB 2X1OA 3TYFB 5I74C 5C9KA 1UZ8B 1OTSC 1OAYL 1CGWA 2XC8A 3WY3A 4AJYV 5L7XH 2Z7WA 4KQ4L 2X4RB 3WE1A 1GS7A 3NCBB 4MJ5B 4HCFA 3BSZH 5JQ6H 4FQHA 4LSVL 4XPFH 5FYJE 4GKOA 5L8LB 5H37G 4FJZA 4BD4A 4WI4A 1VPOL 5LO7A 2KPNA 1E6JH 1RUAL 4IBLT 4Z95H 3T0EA 1KTJA 1KLFA 4DNLA 3CFNA 4OZFA 2MJWA 2P52A 3RGHA 3EYVB 5FYKU 3DX9A 2ZUWA 1F0LA 1YEFL 5KVGL 3EGXA 1BFVL 1B90A 4P2QA 1MJUH 4N87A 1HEJC 3W2DH 1T1ZA 4JRXE 2OMWB 4NOFA 3X3FH 5FM5M 5EZOL 3RGVB 1OCZB 3HG0A 4G9FB 4BGLA 2VQ1B 2NT0A 3IJSA 4Z7NE 2QV2A 1THCA 1KPVA 4M7LL 3RZCC 5B39A 3RI5F 3KPQB 4Y2OA 1GH7A 4PRPE 4Z0BH 2HVKA 3CFBB 3PP4H 4RIRB 1I8LC 4Z3GA 5KW9H 2ZUXA 3MCKA 3QQ9D 2WD0A 7TAAA 4CMMB 3NSCA 4ZAKB 2IVFC 3BPCB 5AVRB 4MDJA 4QHUA 4DGYL 2J8UF 1R3IH 1QWNA 4JRWA 4M8QB 2J3SA 1MFUA 1NAML 3ARXA 5I1DA 5DZPA 5KYNA 4LRNH 5I82A 3VXUB 1VZGA 1YYML 1FN4A 1UA6L 1OM9A 3F7LA 2L4OA 4TQPA 3Q5OA 3UERA 1RLBA 3VI4F 1Q0XL 4WWPA 2H45A 1U42A 4FCHA 3LX9A 3A23A 2OX5B 4W9HC 3N41B 1M42A 4OZGF 4W9DC 1J48A 4WFFE 3OF6A 1FNEA 1WT5C 1IZKA 2J55A 4MCMA 1H9DA 2EE2A 4QDGA 4AMXA 4KK9D 2DTMH 4N2EA 3VXPA 5I19L 2L04A 3EJYD 4LPWA 3NAAH 2GBVA 2PW1A 3KYMA 3RP1A 3UTQA 3ZE2F 1YMMD 2FEDC 4XMTA 35C8H 5J56B 4UU9B 4EKXA 2Y24A 3DETC 3PWVA 1I8MA 5CLZA 1AKJD 2F1BA 3VD0A 4U2YA 3V4UH 5JO5A 1JHKL 1P5VA 1D6EB 1U30A 1ZHLA 5INDA 4UOW0 4ZQTA 2JB6A 1S9YA 3KLDA 4JFFB 4G2AA 4GP8B 2OJEA 4OCSH 5ITBL 3QUYD 4WUKL 2VLJB 4K5MA 1YC7A 1DLHA 3HC0B 4QRUA 1K5NB 2IBGA 2SEBA 4AQ1B 1TT6A 3NCXA 3QR1A 1I3VA 4QOKD 4WNJA 1V5JA 5FC9A 1DE4B 3BFOA 5TDOB 4MNHA 4PJ8D 4YR6B 4FADA 3WEMA 4AUJA 3T0ED 1CLYH 2MCAA 4JY6B 2CA4A 4YHOH 2AXGB 1CFMA 1D7CA 5ICZA 4OFDA 2YJLA 3CHOA 3RNQA 3KCPA 1NUFA 3T3ME 1L4IA 3HS8A 5E1QA 3OMZA 1NDGA 3ES6A 3GMOB 4XP4H 4TTDC 2IQ9H 4P4KC 2F6AA 2XVBA 3O9WA 4NQDD 4XE5B 2OMTA 1AR1D 3QXVA 1IRAY 4YHZH 4Z0XB 4H88H 2XXMB 4RSVA 1HXMB 2J2ZA 2AQ1A 3P3TA 5E1AB 2Y1AA 4TSAH 5DK2B 1N8OE 3WS6C 3W0WE 4RZCA 3ROOB 3NA4A 3US9A 1QSFA 1A4KA 4KQ3H 3U1QA 5AVQB 1WUNT 2B3RA 5EC1A 4DEPB 3DECA 1K2DB 1O6SB 4KI5E 4C54A 1OHZA 4NPKA 1H9VA 2HFEB 3O2WL 1VPOH 4L3ED 3KPMA 3ZW3A 1AIFB 1AQ8A 4MNQA 3B7SA 5KANI 3ASNB 5BZWA 3MNVA 5D72L 4DK3A 1ZT7A 3MJ7A 1BEXA 4XC1H 3Q13A 3V95A 5ENWB 3SE3C 1BQKA 1RHHB 1A8JH 4RMQA 3X3FL 3VE0A 4I4WB 5FHBH 3D2UB 5D1XE 2BCKA 3MV7D 3LN9A 1GGCH 3MLZH 4PREA 2ZOLA 3LVEA 4POZD 3PWPB 4M1CD 1GA2A 1HE7A 5HGBA 4YZFF 4KTEL 3D08A 3LN4A 1PLGH 1PZ5A 4ODUB 1NJ9B 5KS9B 1JHLL 3UFIA 1RUQH 3GO1L 4UILH 2BRRH 4M5TA 4NUPA 3DIVA 4D0CB 3MRCB 4ODTH 4JY5L 5KN5A 1KB5L 1PKOA 2BSSB 4OIAA 3BEWB 3QUYA 3J8F7 1NANH 3ASWA 4XMUA 4NENA 4PGDA 4WSGA 4PJ9A 3SOTA 1DE4A 2C3GA 4MJIA 5BMFL 4BM7A 3Q6GL 3PWUA 2O72A 3GI9L 2VDML 4QRTA 3D0VB 2E7CA 1PCXA 4HEPA 2KS0A 2LU7A 1IMHC 5ANHA 2EUWA 3DTDA 4LBEB 1R6VA 3GGWB 2FWSA 4YDVA 3DRTB 1OWWA 2HJFA 2J88L 2X2UA 2CSPA 1ZK5A 1RZGB 2XYBA 4YHNA 3OJDA 3ZZSA 3CLFH 3O9WD 1AXIB 4PRIE 5J9PB 4ELKA 5AZ2L 2I9TA 4OJFH 4MS6A 1CYXA 1AKPA 5KYYA 4BSVA 3BCDA 3FO2A 3TO4A 4XNMB 4WW2A 1IT9L 3VMPA 3RY6A 1AAJA 1QSEE 3W5MA 3BKJL 3T2PA 3LPGA 3QO1B 3V52L 3DGGB 3T6WA 4G83A 1FZKB 3GMLB 2NCMA 4E9LA 2VXVL 3T71A 5HHME 1QSVA 3LPOA 1OF2A 1TJMA 3ARGA 3Q2VA 4QRFA 5AVVB 4HCRA 3VWJA 5I1KL 5CEYA 3SJVB 4XCEB 2KLSA 5DDHB 2HFGH 3D12B 4EUPA 2EYRA 2CALA 4EIZC 4PJHF 2GW5A 5B7EA 1CLYL 1JF5A 4Y19B 5CF3A 2EC9T 1ZT7B 4LSDA 1F97A 5K59E 2Q5BA 2NYKA 1DN0A 3ARFC 4BFJA 3GSNA 1TXKA 5DJ8A 2FWOA 1MOEA 2J25A 2OCCB 3CZFA 1W91A 4JFOB 1QHOA 4UQEA 3A0OA 2QVIA 3BRDA 1KLUB 3MA9L 7FABH 1CD1A 4N0UA 4EI0A 3RL1B 1FNLA 3QJZA 3AS0A 4M9OA 5FEBA 1E9OB 2NT1A 1BM3L 3P4NB 4GIOA 4KJYB 1VADA 1JTTA 5E99L 3ZLQC 2AANA 4QHMB 1AMYA 5I2IA 2EC9U 4ODXA 3DRTA 3LMJH 5F9AC 2WSKA 1QI4A 3L3GA 5IKCB 2F5BH 3FOLB 4G43A 3NTCH 1E4WL 3CBRA 4K07A 4EI6B 5DWPA 4QGYA 1NIAA 3O11A 4KKLD 3EJYC 1EIBA 2ADJA 4R6UA 1X7QA 3HRZC 4NC2B 3QDGB 3HUJF 4PYHA 4U6VL 4QR7A 5EZIL 3WFEL 2XZAH 3RWJB 4NRZA 1DFXA 5C08E 5KOVC 4M8UA 1U92B 2V9QA 1A3LH 3N3EA 5ADPL 2V2WA 3LS4H 3SBRA 4W4NA 2W38A 3MRDB 3G6JB 3SPGA 1B9KA 1MRDL 2IH1A 3K5RA 2HKFH 2I9TB 2NX5E 1AHWA 3HA0A 4GW4A 1QRNA 4HG4K 2I32A 4L8DA 5PCYA 3CTTA 4KOBA 2WJ7A 5IK3B 2XZZA 3WY4A 5GS0D 3DYPA 3P2TA 4UDTB 5I6OA 1GGIL 2EH8L 5EZJA 4MZRA 2CBOA 1U8KA 4OLWL 2F61A 3MUGA 5CBAA 2YUWA 1U3NA 4J7RA 2R56H 4WTZA 2VDPH 3VRIB 1R0AH 1KTLA 1EO8L 4JRXD 2JI2A 2CQVA 4OCYL 2CHXA 2AQ3A 3O3AA 1RJLA 4FOMA 1WT5A 3KYOB 5DDHA 4RDQF 3GMRB 4OCRL 1JPEA 3MXVL 1A1MB 2R2EA 1SVBA 1D5BA 3FFCD 2EQDA 3PV6B 1BAFH 3GI9H 1XH3B 2OSWA 4G8AC 4HMCA 2V33A 4GLRI 4TVPE 3B1UA 2RCSL 5DURD 3VYPA 3GXFA 1R4XA 2V9UA 3AM8C 3D2TA 1NMAL 4J4PA 1CFQA 4N26A 3LV3A 3IDJA 3MTRA 2VXQA 3WCYA 4Y0GA 5DJYB 2GBUA 2VWEC 5KVDE 3L4TA 5F3BA 1S78C 4DGVL 1JPTH 3NZ8B 1I8AA 4JDZA 2P7TA 2IPKB 3KPPA 3TZVB 3L3OC 4RLDA 3WENA 1KGJA 1XEUA 2ZYHA 1AG0A 1XIWA 5DUJA 5C0GB 3UJTL 1E27A 4RX4D 4CVZA 2X9WA 3P3YA 4H1LH 2ZCKH 1OSPL 3H8NA 4MX7B 4R96B 5CJ8A 3EFFA 5TTRA 1GGIH 4MAZA 4B5EA 1UWGL 3R06A 1OTUD 1I7RA 1NAMB 5F1SA 4FQCL 3U2IA 5EIIB 3F7VA 3SE6A 2CBPA 2PXYB 5E2WL 4P2QE 3LZFL 2X41A 2H6UA 1SEQH 2CLZA 4NENB 1J87A 4N5ED 4KOCA 4PGDB 4GI8A 3QORB 3L2LA 4U1JA 4EI5B 4RRPA 3FQYA 5G55A 1ZMYA 2FSEA 4NPYB 3A6OA 1LE9B 3PY9A 4PLOB 1AD0A 4QPEA 5ACZA 5IJBC 1WIPA 3MDJA 5JUEH 2ESVB 3RILA 3PAVA 4YNYB 4M6NH 4JFDD 3WFCL 1IBYA 3VSTA 4IU2B 3SO5A 1NICA 5EFIB 3AQYA 1H3TA 2KERA 3UH8A 2D3NA 1SLXA 4V2BA 4NQDB 2XACC 4NZTL 2CGRH 4HXBH 3GBNL 1SJHA 4LSTL 1ICTA 4RAVB 4TM9A 2K4AA 5ANMA 4XCCH 2LGNA 3UTTB 3DPDA 2NMSA 3ILQC 4O2EB 3KM2A 3GWJA 2BS71 2MRYA 2PWGA 2HKHH 5C9JA 4HHAA 5DD0L 3DHJA 5FFOA 3VFRB 3L95A 4KKZA 4WK0B 2ZOTA 3P9MB 4V1DB 2Q86B 3MUJA 4B41A 1H8LA 4DKEH 2E6JA 1X5LA 5DHVB 5C0EB 2K6WA 1F6AA 2DWXA 4PJHA 1EEZA 2PUQT 5I30L 2Z8RA 3X1FA 1P7BA 5LXGL 3PGFH 3QCUH 4ZD3L 1ODUA 4PIRF 4UOQA 5F7UA 1XH2A 1WIUA 1AGEB 2UVFA 3DIFA 5IOPB 5LG1A 1DANT 3CVDA 1QUNB 4OZGB 2GK0A 3ZL2A 2X6MA 3IGUA 4HPYH 4POUB 4TUKH 5IVZB 2J6EH 2CR6A 1HSAA 5AZEL 4N6RB 1XIWD 1QRNE 4UOZA 1AD0B 1BD2A 2YAMA 3QPQD 3TYGL 5GS2H 3UCRA 1QA9A 5K9KB 3IFNL 1S9XA 3DRQB 3TFBA 3NTCL 3ATBA 4HK3J 3NIFB 1BPLB 4PUBH 3MBEC 5D2LE 4ZFOA 2CHNA 4P9HL 3VCLB 1MF2L 4Q9RL 3PL6C 2X44D 3LZFH 1GGYA 3GSUB 3RKDC 4JGNA 1U95B 3H2PA 2GSMB 9CGTA 2PXYC 4RMUA 3VQ1C 4X50A 1PPIA 3RJOA 2QGEA 4LCIH 5HI5C 1SJHB 4P9ML 2H1PL 2A0LC 3S35L 3TXAA 5L2KA 3CBJB 2WTOA 2ZCKL 2VM3A 3QZWA 4JKMA 4O51A 3S36X 3QFDA 3DSFH 3IS0X 1S7XA 4G9FD 4FQXC 1JAEA 1AANA 2C1OA 1YDPB 4JHZA 1TSRA 5EMYA 4PJ7F 3QA3B 3GHEL 1Z5YD 2VAAA 5CHNB 3SKJL 4LLVA 1FRGH 2AEQH 1LD9B 5CR1A 3TCXA 1MHEA 4ORGA 1ACZA 4KJQC 1DVFB 4ODSL 4XN8A 1I7TA 3NFNA 4PJHB 1KNOA 5F2FA 1AMXA 4RFOL 3BKML 1C5DB 1E8YA 3SB3A 3F7YB 3U7WH 1EVUA 3B56A 4L1LA 2VDNB 2GJRA 4XVUC 3UTTA 4N2DA 2RALA 5AW1B 1F4YH 1IAKA 4Z76A 2C4FT 3QCTL 3SKOA 1UKSA 2ITFA 1G87A 5AKVA 2DEYX 3IMWA 2V5YA 4X9YA 2BHUA 1QLFB 1RFDL 4CL7A 2AEPH 1IGJB 3O3AB 2WQ8A 3NABL 4P23D 4FD0A 4AEFA 4AL8C 4JY4A 3X1BA 1I1FB 2IGFH 3CFIC 4NO5A 1VSCA 2ZXCA 3NSJA 2JTYA 3EG9A 3ZKMC 4YMPA 5I0YA 5EF2A 4CKQA 2Y3AA 1N7MH 1Z9NA 3UGEA 3VCLA 5I1IL 3UBXA 3B8YA 3PGCB 1DVZA 3SDCC 2VB5A 4RMRA 1UB5B 5IFAH 4L37A 1AJ7L 5I8KH 3ARZA 3CLEL 3Q8AA 4R7NA 3SCMC 3DO7A 1EGJL 2V7NB 3OKLB 4CMHB 4Z3FA 1FAIL 1RMFH 3CX5K 3I6GA 2CCVA 1E28A 1SN5A 3KS0H 3V6FB 2VN3A 1IC0A 2ZE0A 4ZQKA 1FO0B 4WI0A 3X14A 3WDIA 4HZLB 3ZIMA 5E70A 1PZSA 3B83A 4PBVC 2VR3A 2CAKA 1FFTB 4M7LT 2VDKL 4LSSL 1O5DT 1IB5A 1UGNA 1QBBA 2WUBL 1C16B 4KTEH 3PL6B 3R06B 2X4RA 3P3RA 4PM1A 4FFYH 4OZIE 1T04A 2HTLD 1CL7H 2DWTA 4PI0A 2R29H 2ORBL 5EU6E 3UTZB 1P4LB 1U3HA 1MCCA 2Z31A 2ZWKA 1ODAA 2PR4L 3T6VA 3UROR 5IUSA 5JYMA 2RR3A 2QSTA 4B3EA 4F33A 12E8L 1MQ8A 2NLJB 3FCSA 2K3HA 1NMBL 3BO8B 3WFHB 3KAAA 4AW7A 1TNMA 5CEXA 1T3FA 4KDWA 2I26N 3QNXB 3ARDA 1KJ2L 4Z7UA 3GXMA 3BGMB 4HCIA 1AZZC 5F96L 5I1GH 3RVTD 5EDSA 1YMMB 1MEXH 3SO3C 3IAQA 5E7FA 4NZTH 2X88A 2OXGA 3V4PH 4DPBX 4OLUH 5J3HC 4LMQI 1OAXH 3QXWA 5I8EB 3O0RH 2LU5A 5JDSA 3X3GH 2X4NA 1OAJA 4KY1H 5IHZA 5D8JH 4FG4A 3ECVA 4HD5A 4B95C 4PR5A 1AZCA 1I3GH 5F7MC 4NKMB 4K8RC 1H5BB 1EFQA 5DD1L 3EJZD 3V2AR 3QP3A 1CICA 3I75B 3BKJH 4Q9QL 2C8NA 3D25A 2YC1A 2OMVA 4GP5B 1YSOA 2DI9A 1B88A 1PLAA 4PP2A 5F9JA 2F8VA 3QQDA 3ZU8A 3T09A 1ZS8A 3QXTA 3HNSL 2DZEA 1IJNA 1E5AA 2Y7LA 4DEWA 1MZYA 3T3PE 5JPNB 4JS7A 2HMIC 4ODHH 1ZLSH 1YNLL 3WOVA 4ZSOE 3EOAB 3HG1D 1OV8A 1G7PB 1TVBB 2YEQA 3DXAE 4FJYA 4PJCE 4UV4H 4IRJA 1A7RL 3V6FA 3VQLA 1OSZB 4TUUA 3OKKB 4MCYB 1LO3L 2W95A 4HUVA 1P6AB 4UDUB 4E41B 4AKPA 2WM0A 2MOQA 4XXWA 1C12B 4AQ1C 5GIRA 1TUPA 5DC0A 1CF8H 5L9DH 3HE6B 4C4KT 1TFHA 2MSPA 2XWCA 2VMDA 1ZS2A 3PIQB 4JFZL 2BSDA 3FT2B 4IDLA 4GAAA 2YGQA 1GW6A 4N8VA 4PBWD 1YPZA 3I9GH 1UZ6E 5HDBE 1U91A 3UC0L 5C0NC 1EH9A 3BWUF 2R7EA 4QRPD 3I02B 4RGOH 3T2QA 2PR4H 4P5RA 3C8KB 1WIOA 4OQTA 1Y18B 3L9BA 4Y7OC 1KENL 2AITA 2R8SH 1S6NA 3UGUA 3CFUA 4ZXBD 3T77A 1JIBA 1XXDC 3H0TA 3TA3B 1ZHNB 4WUKH 1JRHH 1TFPA 3WTTA 3B5TA 4G6KL 4NO0A 1S7XB 3MOBL 2BNQA 4PJEB 1Z3RA 2F54D 4D9QE 1KXQE 3RY5A 3TIEB 3HB3B 4OLVL 3FN3A 5D71H 2E8YA 1HT6A 2H2PD 4AMKL 3RVXC 2AXFB 5GS0H 1HC1A 3B9EA 1CXEA 2JXMB 4DEPC 2H41A 4DUWA 3IDGA 1JVOA 3CK0H 4M5SA 5ERWA 2WBJA 3PJLA 4X7EC 2IFFH 1TTAA 1VZHA 2A9AA 3DUSA 4UM8A 1TZOA 4YGVB 4LZKA 4K5OA 1YN6A 2PYFA 3WFEH 3WSQL 4HUVB 2C1PA 5ETUA 2R0WL 5T3XE 4Y4KB 5T1LA 2AJXL 2ROXA 1L9PA 1I1AB 3K74B 3PIQA 3QUXC 3KE0A 3REWA 4B3VA 3LKPB 1UEMA 2APSA 4NQDE 3KGTA 1RUAH 3N0PB 2CJUH 1XD1A 3H9HA 3MC0A 1SYVB 3PHQA 4L2YA 1KWGA 4FLSA 5D7LD 4WWNA 5T8IA 1FFPB 5F7DB 1UZ8A 3FN0L 1I1RA 4HPOL 4PLNC 3KJ4B 3GSXA 2UYLA 4HUWB 1MJUL 5ADPH 1YEGH 4XN4A 3O0RL 5DK2A 4KY2A 4YIQB 1WWAX 4U33A 2BNRD 4M1GH 5JNYA 1FWXA 2RD0A 3MA7A 3V4PB 4XOBA 3BKCH 4HZLA 5GGRY 4DN3L 1PW3A 5C7XH 2FR4B 1VACB 3QQXA 4FFVD 2PYEA 3EGXB 5HI4D 3VWJB 4Y4FD 2QADD 4BV1A 3I02A 1BW8A 2A6JB 4JL1A 1OE2A 4L1TA 3BOVA 4LLQB 4TLKA 4FN0A 1J0ZA 1I75A 4A6YA 2YAPA 5TQ2L 3E1F1 1KB5B 2ZTBA 5KVEE 1WJ3A 1HZLA 2Y2TA 3OQRA 2KQMA 2A6IB 2GEEA 3LIUA 3L08A 3O3UN 1ZLVK 3LOWA 3FRPB 3A6BL 2BFVH 2NNRA 3FULA 2AP2A 1E65A 2WWOA 1T3FB 2IMMA 3OJMB 5IVOA 1KG0A 3L3JB 5JPMA 3IXTB 2F7IA 5IW6A 1QKZL 2VH5L 4JHBA 4P46C 1DHKA 1L7IH 5CAYB 3ZHFA 4FLRA 2E9IA 4KO7A 3WIHA 1XMEB 2YSSB 2I69A 4FP8H 3RL2A 4KO5A 3VDAA 1BAWA 1TJIL 4PVMA 1A0QL 2EZ0C 2B20A 1SN2A 3UBGA 5GRVK 1KCSL 3O8XA 4LOUD 5DQ9A 5FGRA 4FMKA 1NCCL 4UOJA 2O6CA 5GS1C 5HDQL 2FYYA 1D2PA 5LN4A 4F8PA 5AAWA 1J8HE 1WPCA 3ARUA 4X98B 4FA7B 1R3LB 1G9EA 3FB8A 2IBZX 2E59A 4KNUA 1T5XA 1KBPA 2ADFH 4PRPD 5C8JA 1EFXB 1QLEB 3SDCD 4YHNB 3IN2A 4CAGA 2OXHA 5HVHB 4CNIB 4N0RA 4M5ZH 4E42B 2WLHA 3VD2A 5EU3A 1YQVH 3DX1A 2WBXA 1FFPA 5F7DA 3GEWB 1AZVA 1OANA 4BK5C 4Q9CA 4KRNA 1FZJB 4LLDB 1NGYA 3HE6C 4FKKA 4XVSH 5I30H 4NUJB 2O93L 5G2NA 3Q43A 4QNPF 1RVFH 1U3YA 1DCLA 2A6IA 2COQA 4UM9D 3TZVC 1NGWA 2NZ9D 2BY1A 3L2NA 3RWCA 5DWUH 5B1JA 4HV8A 3WFCH 5JMOC 2OMUA 1D5IL 3MLXL 4XAWH 1NLBL 1QW8A 1UD6A 2IWKA 2LOEA 4OD1L 4NAQA 3D39B 1EX0A 1JF6A 4XTRD 2R51A 5EPMB 3FSAA 3FT1A 3RUGE 4KU1A 4NO3A 3NIFF 2YRZA 1JZ2A 4AMWA 3M17B 2PWHA 1UWXK 3BH9A 1WFUA 4GKSB 4X9IA 2OL3L 4P2OA 1HHGA 5CZKA 3O8XB 3VXME 5CP3A 3MGOA 5KG9A 2DI7A 4W6XB 3JWOC 3EFDL 2XN9A 4ATWA 1NGQH 1HNFA 1FNGA 1PVHA 2C3WA 2DQIL 5I1JH 2F68X 4OF5A 1M57B 1M7DB 4BA8A 1IQWL 1C08A 3FUJA 2GTZB 3QBTB 1O75A 5DQDH 2CUIA 3KXFA 1XB6A 4PRAA 5JIPA 3QJFA 4YL9A 3B2UD 2Z91B 5KTEL 5F7NC 1U21A 3GSQA 2DMCA 1Z9LA 5KSBE 4QRSA 5CJXC 1ZHBB 3SE9H 1BIIB 2EDFA 3C5JA 4K9EH 4MJID 4U1HA 4HALA 4Y19E 2FIKA 2BSCA 1KY7A 1TPXC 2XUWA 4IIQA 3VFMB 4C56D 4NCC1 3H85A 1DL7H 1T89C 4BFRA 4XP1H 3NIDB 5E94B 2B1HH 1UOKA 4HWNA 3HI6H 5KVFE 2A77L 2QQKH 2E7LA 4F58L 2YSTA 1FIEA 2V3FA 1T2QH 4P2RE 1T5XB 4GQPH 3HAEH 1JRHI 2OI9B 3SDDA 5AB2A 5L6YH 4XC3L 4FL4C 3NVQA 3SDXB 1H3UA 3TO4D 5C07E 4H1LG 2R4RH 2OMZA 2ZXGA 3WY1A 3CFEB 2VZ1A 4WZ9A 3NCJH 2O6EA 3GF8A 2H2SD 4A7TA 3R18A 4ODSH 2CO6A 1MJ8L 2H0FA 4OQ1A 4J3OD 1A3LL 1JNLL 5GSVB 5F6HI 1S9WB 2W8CA 5J12B 4GXUM 4UM9A 2O5XH 3RX9A 3EKCA 1KEMH 4X9GA 3SJVA 4JDVA 4KUCF 4HV8B 2KPWA 4JLRB 4Q0XL 3NACH 4WI6A 1VERA 3UAEA 4HIEB 3INUH 4R26H 1EQWA 2DQGH 4JHAH 4PGBB 4XCFH 1Z1WA 1KV3A 4Q97A 1ZTXE 1GZHC 2HJFB 4RH4A 4ZK8A 3DJTA 5EOCL 4HWZB 2DM3A 1AP2A 2MTPA 3VW3H 2DWYA 5K69A 4LOVA 4TNEA 5B7FA 1QP1A 3H3BC 1GZPB 3V0AC 5DS8A 1EBAA 5J1AB 32C2A 5DFWH 3CMGA 3ESNA 3AQZA 3IGLA 5KS9E 4J6IA 2JLLA 1XCWA 4O58L 5HYSG 4AV0A 3N85L 5J1TC 1HXYB 3RWGB 5KW9L 3PWPE 1U3ZA 4YDIH 3L4WA 4IBZA 3P30H 2HCZX 3BVWA 3IXAA 3O2VL 2PKDA 4N5UA 2R23B 4XO4A 2NXYC 3PJSA 1O0VA 4QO1A 4N0FB 4CGUB 4CADB 5EZOH 3M88A 3MNZB 4ODVL 1N5YH 4XPHH 2B7DT 5E8OB 1OTUC 3U7YH 3BLBA 3JBG7 1TENA 5DZ9A 4OY9A 5DJ8B 4KRPB 3OB8A 4LVNC 4MJ6B 1I7ZB 4DGYH 5LBSA 4IBWA 4PLKC 1JGDB 4LCCC 4XAWL 4MQ7B 3W0WB 4XH2B 5GRUH 1A21A 3IDXL 2Q8BH 1EEZB 1JPST 2A9NL 2CDGA 4JZJC 5FO9A 4GLRH 4M7ZC 4UIMB 3D18A 1DZ0A 4JFXA 1ACCA 4F37F 2NTFB 1L6ZA 2APFA 2ITCB 4KVPA 4XCNA 3TV8A 4BKLA 1O9VA 3JV4A 2BIQA 4QRRE 2ED8A 4LDCA 4HIHB 2H6OA 3PLYA 3U4KA 3QDGA 4G9DB 4WU5B 4NZFA 3ZXAC 4K2UL 4H44C 2AS5M 2UXVA 4XNYL 3W39B 1A1MA 2D73A 2R2EB 3MJWA 4M4PA 4YQXL 1BYNA 4Z23A 2CR0A 2AK4E 1ZRUA 3ESPA 4PTUB 5DVLA 1KXVC 5DO2C 3ATDA 1T1WB 2BMKA 1ZS8B 2ZOUA 2BHFA 2NY6B 2VXUL 3COOA 2YEZA 3GPEA 4KZCA 4XNUL 4YHPB 3ASOB 3ZJAA 4QRQA 3DLQR 1K8IA 3UTSA 1MFDL 3LKRA 4WUUA 3VXTB 1R5VB 5IUCA 5T3XH 3GD1C 2TSBA 2WVVA 4P5TA 1ERNA 3AWGA 4KVCL 4HJJH 1R75A 3ZT5A 1T7XA 5C07D 4KQ3L 1FFNB 2OTPA 4GUPA 1XGYH 2YBGA 4QLRA 2L8AA 3VA2C 5HY9B 3GRWA 3MLPA 3D69A 3GMMA 2DLEA 5B1KA 5CD3B 5IHUH 3IXAB 4IKLA 2NX5A 2NY0C 5B3SB 1A66A 4YEFA 5KYUB 5AOZA 3UPRB 2KYIA 3DYMA 1C08B 2UX6A 3UZEC 2IIJA 2AXWA 1UA6H 2FWLB 4BJLA 3LN4B 4F91B 4N9GB 1WCBA 1CVRA 1T0OA 4AGOA 4J2QA 4Y19D 4ELMA 3UADA 1UADC 3PJNA 3K91A 4H2CA 1WBXA 5E24E 1T83A 1JPSH 1ZA6B 5MP6L 1BMGA 4LNRA 1ES0A 5DZJA 5TPWH 4BKLB 4OLVH 4AH2B 1QWUA 3P40A 3QIUA 5AW9B 1U95A 3VXUE 1LE9A 5HYJB 2H32B 4OLEA 3OKOB 3QDJD 3FPXA 3C09B 3MR9A 3ZSTA 2RH0A 4FFZL 2BNQB 4RMSA 3ARED 3ETSA 3HS9A 1JF1B 2R2BB 4OT1H 5M94B 1A1OB 4MBOA 1NBZA 4DESA 1U8JB 3AADB 2EXWD 1HVXA 4OGXL 3VXNA 1L6PA 4X0NA 4I1RA 3AZUA 1RHFA 1CI3M 1OLLA 1JERA 3H9SA 2DM2A 1G43A 4MHHG 1H15B 4AOFA 3T0WA 3D9AH 3I6GB 4NHUA 1ACYH 3NJLA 4GS7B 4PD4K 3CZEA 3GXNA 1XGQB 3K6SB 3AGWA 1GKOA 2CBQA 3S3JA 2XX0A 5C0RH 1Z3GL 2YD5A 4BELD 3O6FC 2QQNH 3PQYD 1RZJH 5KBPA 4L8SC 2IC2A 2AI0L 3ARGB 3FJTA 2CJSA 1IAMA 3QUZC 1BOGB 1NL0L 2X4SB 2YAQA 3UTSD 3VQ2C 4G6FD 1R3HA 3HE7B 4ATTA 1LNUB 3FO1A 4C57C 1M1XB 2Y7QA 3Q48A 4LQFL 4YBQD 4BRJA 4QRRD 3BDYH 1E5CA 4EIUA 1MCRA 1UM5H 1WC7B 2OTWA 4I9WE 4MS8D 4LAJH 1UACL 1QG3A 4DKFH 4GUPB 4PJBE 4Q9BA 5AYQA 2JELL 5I16B 1LEKB 5GSRB 1G9ML 3ZE1B 1A6AB 2DQJH 2ITDB 2NR6C 4AQZA 1DQLL 5E2VH 1HSAB 4GSDL 1I82A 1Q8MA 4Z0BL 4PLJC 4F7CB 5D7IE 1MFDH 2W9DH 3ML8A 3RGVC 3HHSB 4HJIA 2E74C 4HBQA 5HDOA 2GSIB 5EO0A 1VADB 2AQNA 1IU1A 3FFCB 2VR9A 2XY2A 3SKMA 3W1ZA 4FNLH 3PWJB 5T3ZL 2DBLL 3MA9H 4A2LA 1QFWH 1WHPA 4QRPB 2PABA 5AVWB 5C08D 1YYMH 4IRZH 3WO3B 1TG8A 5IHZB 5BUPA 1BQRA 3W81A 3FTXA 3Q44A 3JWNE 5L2KB 2CIIB 4U6XB 4N2OA 4FABH 1D9KC 3FSZA 1ESOA 2G3XA 2QGDA 1O9ZA 2WVTA 2AERT 4ZS6C 2XVLA 2OAAA 2X4OB 2YGOA 1BFOA 2B3IA 5GXBB 4POZC 2XJLA 2YHGA 2GK0B 2OQJA 4M7LH 2K78A 5IHWA 1FVCA 4F9PC 1OE1A 4YXLL 1OGPA 1RZFL 3OHXC 3CIAA 1OGAD 3KWUA 1JK9A 3GM0A 1ONQB 3GMNA 2ARWA 2R29L 3JYBA 4Q4EA 3V4LA 2B5IB 2KUTA 4XI5C 4N8CL 1H8SA 2EXYD 1ZJBA 2IGTA 4YR6A 3U83A 4CJ0A 4M7KL 3II1A 4DIXA 1MQKL 3UG3A 4JAMB 5DJ0B 2KLTA 3S35X 2YO3A 3B9KA 4GFXA 3WTYA 4U7MA 1A2YB 3WFBH 2FT6A 2VLRE 5IB4A 2P3YA 3PQYA 3QZBA 2ZUQB 3BVNA 1JFQH 1G9MC 4GRMA 3UGXA 2AI0H 4WW2F 3WO4C 4R90H 3K81A 4B96A 4IKIA 5L7XL 3Q05A 1I9JH 5DC4B 3FZUD 2WXJA 1WFOA 2HKAA 1AQHA 1CICB 4XVTL 5HPMB 3HFFA 5H37H 3LIZA 2OSLB 4H5SB 3MJGX 3GKZA 5IFAL 5JW4M 1F58L 3GBLA 2J2ZB 1IKFL 1FDLH 4FEMA 4IOIB 4PRNA 3QJTB 2JKNA 5SX5K 2X4TA 2EINB 2ATAA 1RZKH 4EN3D 3KD4A 3QZLA 1CL7I 5BZDA 3BP5B 3BXNB 4P8QA 5C0BA 1DBBL 4GSQA 1HCFX 2YAEA 1MHHB 1RH8A 2YPKA 2AQPA 3UTPD 2P49B 3I3DA 3OR7A 4QF1B 3UZQB 4LNVA 4OLXL 1GYCA 5C2UB 4M5YH 3THMH 2J6EA 5LAPA 3W3BA 1E7UA 1CTNA 3OL2A 2OZ4H 2OM5A 4Q58C 1IGTB 1PTZA 1XH0A 4UV7H 2CWRA 1UD5A 2DW5A 5HHOD 5TK4A 4M1DH 2D7NA 4Y88A 5DR5H 3REVA 1J8HA 2XVKA 3ABGA 3G5WA 1NCWL 2FO1A 4XGZB 1TZHA 2GJZB 1NC2A 2X7LA 4JFQA 4OD1H 5C6TH 3UAFA 3KBFA 3U36A 4GAGH 1J9SA 3DI3B 4FX5A 4OF8A 1FBIL 1N9PA 2D0FA 1UCBH 4WEUD 1DANU 2VDQB 3KPQA 2WGXA 4Y2OB 1T03L 3IJ7A 2YN5A 1IFRA 3IB4A 5F7EH 5J1SC 3DETD 4G1MA 3TNMA 3VU2A 1S7QB 2B9AA 1F11A 2B2XL 2F54E 2WIMA 3DYOA 1KLGA 3OZ9H 4I3GA 5HGDA 3VAEA 3EBHA 1BQHB 1D6VH 3FTWA 1UXWA 4ADJA 2E9WA 4NXKA 1ZLEA 2LHAA 3KYMB 3RIAK 3UTQB 5E9DD 3M1CA 2G60H 4UYQA 4N0CD 5FYLE 3RG1C 3OHXB 2OJZL 4HQQH 4PRHA 4EPSA 3K71B 3QXDB 1YA5A 1S5IH 2AK1L 2WBJC 4GEJA 3TS8A 4R3SA 3D0LB 4QMEA 5D1ZC 1A7OH 4U1KB 3NT0A 3U48A 1D5MB 1F2QA 2XQBL 3KVQA 4I7ZC 3BWZA 3BAEL 2VJ0A 4CSPA 1QLEL 2WBKA 4P48A 4AENB 4AGNA 1RULH 1RZGA 2QBWA 4YSAA 5CCJA 4S1SH 2D9QB 1G1KA 4WGKA 4Y5XA 2OR7A 5EO1B 3DVGB 3K2KA 5IQ9B 4MJJA 1XGUB 2JWYA 2NYYD 3FFCE 3O3EB 2PW2A 3CCHA 5HHVH 1F41A 4RRPM 1WS8A 3S34H 4HKBB 1TVHA 4KY1L 3QNYB 4HAFA 3NCWA 1ZSDA 5D7IB 4F57H 1B0RB 4JHWL 1A5FH 2VKXA 3HMWL 1FZKA 4R7LA 4EN3A 1D6VL 1XCTA 2XSKA 3GBML 2ZKYA 2ZXQA 1BAGA 3UAJD 2B0SH 3M8OH 4ZBJA 5I8EA 3GT6A 4ESKA 1HXMA 4PVLA 2WNXA 4W93A 1LO2H 5F3HB 5IGXH 3QNZB 4U3SA 3L3KA 1PX8A 1UJTA 3TM6A 3QJUB 2G30A 2EABA 5FYJH 1GPOL 2Z31D 3O2DA 2RACA 1A6VL 5J5EA 2FECI 4AV4A 4K94L 4YOKA 3GSNB 2Q8AH 2DMKA 4ZMVA 3MI6A 3US1A 5IEHB 2ZUSA 1FVDA 1I8IA 4ZUSA 2ZKMX 3MRKB 3SY0B 4CW1B 1XF4A 2HAZA 1RL1A 3LZPA 3TLRA 2FYYB 4IBVA 3CXHJ 4NP4H 4OTXH 1ND0B 2ZCHL 1AY1L 3S34L 4HIIB 4KJYA 2HJLB 1WEJL 1CIUA 2BNQD 3CU7A 2IADB 5EC1B 2H5UA 2LLNA 3GMQA 3DO3A 3KPRD 4GOSA 4N2GA 4UT7H 5D1XA 3V5DB 3VFGL 4PTTA 5DCCA 1FGVH 2DD8H 2KI6A 2Q6WA 3PHOA 3QHZL 3QXDA 1U8LA 4JFYA 4YXKL 2BNQE 3QJRB 4OV5B 5EU3B 1NCNA 5AL8A 4BUQA 3DJZA 4FZEH 2OL3B 3GM8A 4TUJB 1LVEA 3BZ5A 1X5JA 5HYJE 1UGKA 2KH2B 1OIOA 3MO1A 4G8FB 1HOCB 1IE4A 3T2LA 3OKYA 1UT9A 2NXZD 2MNUA 2HYMA 5K9JH 4IGBD 2LW3A 3LZOA 4Z77B 3QWQB 1Z5LA 3PXHA 5D6CB 1PIFA 1UEYA 4Z18A 5DF0A 1RZIB 5HHXH 3V7MA 2Q8AL 1JWSA 4XTRC 5IQ9A 3QAQA 5I1CL 1QKZH 2VH5H 4UQIM 4AEIL 4BFFA 3S4SG 5JXEA 5JXAL 3BVNB 3IWVA 4GRMB 1OB0A 3MRGB 3T65B 2VO5A 1OVZA 2DEXX 1MSPA 2AFNA 4NJ9H 3KYNA 2PNDA 3IFLL 5DUML 4QT5B 4L4TD 2BSSA 3MRFA 1JPFB 2YD8A 1XV8A 4I89A 3CSTA 4ELKB 4PY7B 3V0EA 2I60H 1HINL 3UAJA 1DDTA 1HZKA 3PV7A 4M61B 2UYLB 5BZDB 2VDNH 4G42A 1AIZA 5FKAA 4E41D 4ANXA 3TPKA 2VLJD 3TJHC 1TCRB 2QHRH 4CC0A 1SZNA 4ONGL 5JW4Q 2NYZA 2QTEA 3WTVA 3VGEA 4KTDH 3CMOL 3W11D 1EZUA 1A5FL 1W8EA 1J05A 3LRMA 1TZIA 3K6FA 4KXZI 2OCJA 2YXFA 2EJ1A 5FECB 4V11A 4J3TA 3WKMH 4F7KA 1P84K 2N0MA 2EE9A 3CVHA 1R46A 2YKKA 3TURA 4L3AA 5HHVL 5DT1L 4CU7A 4ZXBB 1N26A 4L4TB 5D9SB 3T4AC 4AXWB 3EADA 5FUCC 3GHBL 4J1UA 2EIEA 3IGAB 3IVKB 3G5XB 4RGMC 1ZOXA 5DHXB 1QD0A 3P02A 4R96A 4JPIA 3QUXB 4ZFGH 3VFGH 2G60L 1XF1A 3KG5A 5C0GA 1UYWH 3IXTA 4X8CA 1MFAL 4D3CH 5IW6B 2X10A 5DI8A 3FUMA 2ZG1A 5E9DE 5AWNL 4MDJB 2YD2A 1JDCA 4J27A 5DJAA 4AGPA 1TMCB 4CC4C 1E40A 1G4RA 2CRIA 3FQWB 1EHAA 1YHPA 2KT6A 3STZA 3MLRH 1WBXB 3KYNB 1JUFB 2AJ3B 1MCPL 3UJIH 3GTTA 1N5AB 3EFDH 1QX1A 1WZMA 3L48A 5MEND 1QBML 3WDHA 4AKQA 3RAJL 2FWUA 1EAQA 4A38A 4FQCH 3T6XA 2F5BL 2DM7A 2EDOA 4M8VA 4LLQA 3IRCA 5F9OL 4LLYA 1JWSB 1O5PA 1YMHA 2RCSH 2XV0A 1JHTB 1E3FA 5CLXA 3GINA 3MLTB 4H8UA 1CFSB 1XR9B 3C6SB 4K3HA 1NFKA 3U4EB 4FXTA 3SE9L 4XN7A 5FGSA 3LIZH 5IJCC 5CEZD 1GIGH 3QI9C 3UC2A 3H3PL 4U1GB 4P5KB 2ICWB 4KKAD 3DUUA 2EE0A 1WFNA 4OCYH 5DQJB 1CLVA 5FYKD 5ACMA 3W0WD 4X2UA 1MFCH 2CGYA 4BK4A 5T3ZE 4HK0A 2BNRA 3LHPL 1KJMA 3KLAA 5E8PA 3V8CA 4MMXA 3ZVVA 2J1KA 2P5WB 4GAYB 4GQQA 2RQEA 3SGEH 1NQBA 1TJHL 4MA7H 4WFGE 1EHNA 3BWUC 1NMBH 4HKXB 3DVIA 1RIUH 5IREA 1CG9B 4PWKA 2IXQB 2QTVA 3LH9A 3DPBA 3QT2A 4FQ1H 5I9QB 3VXSD 1G7IA 4MXQD 3TBVB 6FABH 4UTAL 4XP5L 1OWRM 1ZWIA 5DUMH 2ADGB 4MNHB 3PJSB 3VWJD 2G5BA 4V1DA 3VD5A 2LV4A 3IRPX 3WKQA 2DOCA 2FLBT 4E9QA 3TBCA 3QIBD 4S2SB 3X13A 5DJ2B 3CUPA 5DFVC 3WJLA 3BQVA 3FRUA 5F1IA 1A64A 2ROYA 2VQUA 2CBTA 3I6LE 2O5YL 3NSYA 1HS6A 4HFUL 1JUFA 3R4RA 4L5FE 4MXVF 4MZ3A 2QJDA 4WEMB 2NY2C 1U4FA 4P2OD 1OSPH 5I15H 3QARA 3U4AA 4J2XA 3ARBD 4OZGA 3ZDYF 3INUL 3G5VA 1NCIA 4R26L 4WSKA 3NZSA 4JANA 4JM2D 4TN9A 3T0BA 3VVWA 3RFZA 5EEXA 5BXFA 2NW2A 4XOAA 1JGDA 4DZBB 1NGYB 2LQRA 5GGVH 3MRQA 1QHQA 5ICXB 4LCCA 4J3UA 4OKDA 2OA9A 4QI3A 1PLGL 4IRZA 1OGAE 3FT9A 2EILB 1LJMA 2WLIA 2HX8A 4NIYE 1KPUB 3LAFA 2EDWA 3U6RA 3VGDA 4OAWA 4I3RH 2X09A 3D18B 4JFXB 3ARPA 3L81A 5EU6D 4PB9L 5GGQH 1AS6A 1I3RB 3DUUB 3C5JB 5EWIH 1X5YA 3GSUA 1EA9C 4P2QD 5IP4A 5GRJL 4HETA 5IVXF 4GRLB 1P7QA 4GRLD 1MQKH 4TUJA 4A2GA 4NOBA 2E46A 4C56A 1P5UC 5IB5A 4TSAL 4X99B 2VERA 4NO3B 4QAMB 1PU0A 3MOBH 4ENED 4XNXL 4GW1A 2CLZB 5KJRL 4FABL 1EANA 4G8IB 2OPCA 2FX7L 43C9B 4ZMWA 3L5WA 5LGJB 3QA3A 4UM8B 4YGVA 1EEQA 4JB9H 1CIDA 5LBSL 1PDKB 1O6VA 4G7VH 5TE6L 1QLRB 2FUTA 1QEWB 4Z7AA 3SDAD 5DYFA 3SDAB 2WMPB 5IMKB 5EORL 1KTKE 5E4IA 2Y9RT 3IF1B 4OD2B 3M45A 4HWEH 3TBWB 3VXMB 3ZKXC 3CDCA 4IBUA 2DTML 4GJTB 3V52H 3KYKH 1KIPA 4CSTA 1UACH 2BZ7A 4OJEH 5CO1A 1BIIA 5FUOH 4GBXC 5HTSA 3TEUA 4O5LL 5BW7C 4ZW3A 1ASOA 4ZUVB 3RUGB 3PQYB 3UP6A 2WP3T 3ROLA 2VC2B 1MVYA 4PJ5B 2Y1ZA 3FH5A 2IAMA 3D39E 1SN0A 3E8UL 1G9NH 3D39D 5DA0B 2FL5A 4F1SA 3ZTNL 1R33A 4GBXD 3BGFB 3GLEA 3MRJB 3TBSB 2Y25A 4LU5L 1EWHA 4JPSA 2WXLA 1BX2A 2AABL 5FK9B 1OF0A 2V7NA 4WTQA 2BOBA 1JPGB 2BW4A 2FQDA 3IS1X 1XGPB 2D2CC 3T4YA 1ZXKA 1WGVA 4MYWB 5ANME 3VXOB 2UUDK 4CU8A 4JM2A 1T7YA 4GAJL 1F5WA 1FO0A 3EYOB 3SO3B 3VX0A 4QYAA 2M83A 4TUOB 5J3HD 4ZI8A 4G3YH 4OI7A 1DJSA 2J88H 1F45A 4H7VA 4AKOA 3SGKA 3B37A 1U8CB 4PJ5D 3QPKA 4JZOB 3F58H 3Q3GA 4N9OB 1CQYA 1RQ5A 1SDYA 2G2NA 3QQ4B 4PGBA 3WJJA 3CVCA 5FUOL 2DY2A 3AW5A 3RVUD 1OP4A 4KROB 4GB9A 3QPXL 5CSGA 4F33B 3F7PC 1AP2B 5CJXA 4WDIB 4BFBD 5CGTA 1WAAE 5T5FH 3EO9H 4JJHA 4WKZA 2O1AA 1DBAL 4DP9X 1UCBL 3QI9B 4H25A 1DP0A 4PCSA 6FABL 2UXFA 1VFUA 2I9LB 2GITB 12E8H 4FGMA 3GNMH 4NZ8A 2KLRA 5I75C 1OCOB 4JFED 1QSFD 1KGYE 4NLAA 2Y72A 2ZKHH 3DI2B 3PG2A 5A6IA 2X4NB 3LQZB 1YN7B 3QIWC 3P0YL 3JV4B 1F4WH 5AW4B 1MHCA 4F8NA 1WTGT 1KJMB 5E8PB 3W37A 4G3YL 2YS4A 3ISWA 3MFGB 1R47A 4FNTA 3HC3H 2ENJA 1H6TA 1HHJA 1RZKL 3OZ9L 4G1EA 4XAKE 3V0IA 3RTQB 1MF2H 5HYSB 4Q9RH 2XRAL 1A8ZA 2YMXH 1TEGA 3ARRA 1WLHA 4IU3B 3FMGL 4Y2NA 4PJDE 4LFHD 1CT8B 4IK7A 1B2WH 4L9DA 5AW0B 1J9QA 3E6HB 2KKQA 3QO0B 2WINB 3G08B 3LZLA 4O02A 1IGJA 4U6HB 1INDH 1SQMA 1VA9A 4Y4KD 4WFGD 1CDIA 1NUDA 2DAVA 3MSPA 3B2VL 3TWYA 4LLMB 1F2XK 1MIMH 3EO0A 4RGNE 3K6NA 3G04B 1X5XA 3HC2A 1WWCA 3AG1B 3O3BA 2VXQL 3LKOA 5IW1B 3SQOH 2K7QA 5I0ZA 2H3NA 2JKIS 1T6BX 3M17A 1RZQA 5ISZD 1H3PH 4JZJB 4X9FA 5CNHA 4NQTA 2X1WL 2GY5A 3KPSA 5IBTH 2XCMC 3UO1H 3VO0A 3PHAA 5DD5L 1RJLB 5DSCA 3FU9A 4QOKB 2Y6SD 3FT4B 5KSAC 1YUKB 5CGYD 2QSCH 3IDIA 5E2VL 3TH2T 2R4RL 2HUHA 1BYOA 1B2WL 4WO0A 4NNPL 2WXIA 3FTGB 4XVSL 5DJCA 4P9HC 2FJGB 2I24N 1RPKA 4I87A 3ZR5A 1YZZA 1JNNL 1VESA 2HXAA 3VXQB 4PJEA 5JPMC 3Q7JA 4IIQB 1ZANH 4QHNB 5CGYC 4I0PB 3B2VH 2JKJA 1WA1X 1G9NL 4G7SB 1ZLWK 3FQXB 1DVXA 2X4OA 4NN5B 2DLGA 2NY7H 3MV7E 4OIFA 4LAQL 1BMZA 2AKRA 1OD7A 3H7BB 1PD6A 4HS8H 2HVJB 3UO8B 3B4NA 4DPCX 5EOQH 4XVJL 1E27B 2WXRA 4HWUA 1TQTA 4LBEA 2WBJB 3KYKL 5D71L 3GSWA 1HOCA 4QCIB 3HC3L 1A6TB 1FVEB 2HZHA 2FT7A 2D2OA 1BBJB 1GTFA 3JTTB 4L23A 3TV3L 1HYSC 3FO9B 3TN0A 5HDBB 3U2JA 3BI9X 4FG6D 4KITB 3CSGA 1RPQA 5EOTB 5AAMA 1AGDB 3MV9A 4Y16B 1CL7L 1AHWC 1FCCA 1FL5A 1NOFA 2F0CA 3LRSB 5ESVB 1R3HB 2QLVB 1NFDF 3HE7A 3PHSA 1WVZA 4KGJA 5IHHA 2R0LH 5GRYA 4NB7A 1DBML 1PQZB 5DD3L 1HK6A 4XGZA 2PCYA 4E41E 4QRRA 4JG0H 1A6ZB 1M4KA 5AAMC 4BRVA 3T4AA 4A6YL 3CDGB 1AQMA 4HEME 1E2VA 4X6DE 3EO9L 1CF8L 4PJCB 2EDNA 1GSMA 2W9DL 3UBXI 2F58L 2PCXA 3M7FB 4P4RA 4IYKA 3FU5A 3NCEB 3S36H 4ZSOB 3ZO0A 4Y19A 2OMNA 5KBDA 4TUOA 2APVA 3I75A 2NY3B 1UUNA 4FE9A 5ID0A 1KCRH 1B4JL 4KNSA 4ONGH 3IJ9A 2DKUA 1FZOB 4P2RD 3VH8G 2X4PB 2PCPB 4P0DA 1LMIA 5C0IB 2DI8A 4UNVA 1IGTA 3KPLB 3QCVL 4MYPA 1H3GA 1IM9B 3Q9PA 4A6YB 2WQVA 2IPTH 3VGGA 3CH1A 1CE6B 2LVCA 2X53A 4R2GD 4FI7A 1CWVA 2JKWA 2F1EA 2H9GB 1G7PA 1TVBA 3AFLA 1F6LL 5B8CC 4RESB 3GQFA 4J1UB 2HFTA 3H6JA 3ERXA 2E4TA 4Z3JA 4WNQA 5DHYB 3MKGA 3VFTB 5HGBB 2C1OB 3TNMB 1RZKC 2P42B 4NKQB 2I9LA 4Y1AE 3H0TB 3RAJH 3KPRE 1YMME 3N9GL 3MNMA 4QWWC 3BJ91 4UIKH 1T66D 4ZYKB 3QNYA 2WVUA 3SN6N 1O7DE 3APCA 4K55A 3W57A 1B6UA 1P69B 5F1NB 5IMMB 2V5RA 4MKMA 1L9NA 2W92A 4FLQA 3IKCA 1TU2B 1SMDA 3VW3L 4WKXA 4LSUL 4NRYB 1CB4A 5AZEH 1JRHL 4DP6X 3C5ZD 2D31A 4Y9GA 1CR9L 1XF5B 3FS9A 4TSBH 4WI7A 1TF4A 1OB1B 1KJ2B 1AH1A 3GSVB 3IFPA 1EBPA 4B97A 2IOIA 2N3JA 2NY5H 2IQAA 5EU6B 3ABMB 1OCWH 3ARSA 1Q90A 3D50A 1A2YA 4DGUA 1FL3A 2FQFA 3FU0A 1J5CA 2ZIDA 4HJTA 1OQOA 2JMRA 4OZHE 3UABA 4XBMA 4DAGH 3GTNA 3VA6A 3POHA 5TH2B 3F3HA 2CJTA 4MD4B 3CVBA 4NKOB 3GUFA 4PJXE 5BOZG 4KO6A 5TE4L 2R1XA 1MY5A 5HJDA 2X6CA 4E42A 4GO6B 3IMTA 4FQ1L 5FAAA 4EI5C 4APQC 4ZMOA 1FNSH 5KYYB 1YY9C 4LLVB 3DX7A 3EJTA 5C6PB 5FGBA 4MNGE 2BRRL 2V4LA 1JV5B 3GHEH 1ASPA 3NZUA 5DEZA 3WE6B 2Q7NA 1KNOB 4MNGA 1D7DA 4RCAA 5B39B 1FF5A 2XTLA 5LGYA 1P2CA 1W8OA 2ZSWB 4HBCH 4I18B 4M3HA 3ZDYB 4D94A 3ATFA 4F7PA 5I15L 1WAPA 4GKLA 4YEEA 5DZOA 4EUPB 1BA9A 3L7EA 5CR8A 1ZVHA 5F3HA 3VFUB 5GRUL 2J1XA 1J8HD 2X4UB 4JM4L 1H3XA 3B7UX 4TNFA 2V2TB 2R1WA 1KBVA 4ZMTA 2A74C 2Q7AA 4L2LA 1T6WA 4R4BB 4M29A 3D06A 5D2NB 1HQ4B 4AJVA 2HG5B 4XWGL 5I5JA 1AI1H 2ZX8A 2K7PA 3PABB 2Z8SA 5IEKB 2ZXEB 2OJ1A 2AJXH 2QDWA 2MKWA 4UTAH 2VSMB 1DFBH 4PJHE 1MDTA 1W9XA 4FYQA 3LKSA 4A2EA 2Q87A 1W72B 5CEXB 5IHBA 2YAOA 2TAAA 1L9SA 4Q4IA 1T20A 5T5NG 3MN8A 4S0TD 4F3FB 5L4JA 3CZSA 4N0UE 3IKCB 2JH2A 5BO1L 4R4FH 1MCEA 5IB3A 4FI8A 2ZSVB 2D4DA 4K5LA 3VXNB 3REVB 1ORSA 2CKBL 1E4WH 3DX7B 3WS6A 1T1XA 2YN3A 5ALCL 1FL3B 4JM2C 3MLXH 2IBBA 3MLYH 5GGUB 2FATH 4JFFA 3S36L 1KCVL 3BPLC 3U7AA 5L8JB 3OMNB 3H2WA 3O6LH 3WEXB 3US0A 5GPRA 2KC0A 2ZG3A 4NM8L 1NDTA 3BWAA 4ALAH 4Y5XB 3A6CL 4TNWK 5HD8D 3I74A 2MOGA 1DDHA 3EO1B 3OAUH 3OX8B 1J05B 3RQ3A 1QFPA 2XT1B 3RUGF 4FKHA 1A9VA 1L0XA 5D5MA 1SFDA 4KAQH 4JKPL 5I73C 1NCBH 3ULVF 4Y2DD 5HXMA 2BNRE 3C5SB 4JQVA 3QNXA 4JBSA 3ME0A 1IC4L 2GKIA 1VENA 5GRJH 5K9JL 4DW2L 1J0IA 1U8MB 4IIQC 5DZVA 3OTTA 2OJEB 1B0GB 4OLZL 4YHYC 4UQ9A 3K71A 1XCQB 1HQ4A 1OSEA 2YXVA 5SWQB 4HHWA 3Q06A 4JHUA 4JQXA 3W9EB 1JZGA 2Q3XA 4QNPE 5HHOA 4X4YA 1X6NA 1A9EA 2BIPA 4A7QA 1MW3A 5F8QC 3VWKD 1QYGL 1LEKA 4X9HA 2A5UA 2XV2A 3TASA 4F7PB 1NCHA 3KYOA 4DT2A 3BUYA 3N06B 4YZFE 1Q9KB 3VFVB 2BO0A 4E36A 1U8QA 4PB0L 3AU1A 4PJFB 2DYPD 2P48B 2NY6D 2VT0A 3CZUB 5C09B 3L7FA 4FQLH 3EJRA 3EXLA 3U9UA 3UACA 3JV0A 3V5HB 3EH5B 3CPLB 4EUPG 2VSDA 2DH2A 4XI5D 1LDSA 4MNQD 2FK9A 3CH1B 4MNQB 5CP7B 3K2UH 5GS3A 3RGVA 4KTDL 5DRXB 3KPOA 4UTAA 4ZDHB 1SDAB 4QD2E 4JFDB 3LKSB 4AI7A 1NM4A 1RK0A 1X5MA 4NM4L 1HJCA 3HPLB 1DQLH 4H8PA 2ZICA 1TLMA 1U8CA 3HNVL 4A7GF 1OQXA 2AMGA 3OGCA 1H6EA 1SDDA 5KAQF 4UNTA 3KXFB 2YGNA 4NNXA 4QXUL 3Q8EA 4LQFH 5F7KC 1YECH 4CMHC 2DQIH 1ZE3H 2GABA 2W5PA 1OLZA 5E9AA 2B59A 2XWXA 4AZUA 4IRZL 4QRSB 4HXAL 4HH9A 3GZOA 1FVDB 4WTZG 4ZUSB 5GJTL 2VZVA 4GEIA 2VE6B 1CFTA 4WHTA 3CZGA 1I7ZA 3RVVD 3K5SA 4XCYA 1LO0H 5DS2A 4OLWH 4AYFB 2DICA 2W07A 1HQRB 4I85A 1YUHA 2WNGA 4QWWD 4V2CB 3WO4B 2XFXA 5F88A 3E9UA 1TZGL 2DRUA 2V6HA 4Y2DA 5HDRA 3MBXL 1EDQA 3EDJA 5JORB 3G5YA 4IS6B 5E9NA 5FKPB 1HWGB 5C0AD 5AALA 5PAZA 5HPMA 5I18L 5JOEA 2E6PA 4R4NC 4X6CE 3PS6A 1KYFA 2YAFA 5SX5H 3NJFA 1ITBB 3JUZA 4LDEB 5HYFA 1SLVA 1D7BA 2X1QA 4PJIB 5TQ0H 2GBAA 2NW2B 1KEGL 1IL1A 3B3IB 4F9LC 1V05A 5IBUB 4ZOEA 1ML0A 2EDJA 4Q52A 4R5XA 2YD3A 4GUCA 1WWWX 2BDNH 1K5NA 1NCGA 1P1ZA 1U3HD 2OP4H 2B9BA 1BQ5A 1RZJL 5H4YA 3RNKB 5I1HL 2NZIA 2P43B 4MVBC 2NY1D 3QW9A 2IXQA 2UVEA 4WUUB 5AZ2H 1F4XL 3CSFA 3CK0L 3FB7A 1NCUA 2EADA 4Z3IA 2F53B 5CKAA 3EJQA 4L9LB 1MLBA 4LO9A 1S7SA 3PGDB 3IFNH 2ISDA 1ZT1A 2FJHA 3H4HA 5GS0L 1B3JA 3AT0A 4HWZA 1LK3H 3OR6A 3TEXA 2CXKA 1UWEL 2ITEA 2JV6A 2P5EE 3IGAA 2EXWC 4KUCD 1T5WB 1JGIA 32C2B 4AJWA 1C5BH 1S3KL 3MOAH 3PUCA 3Q2NA 4BFGA 2WANA 2NX5B 1NCAL 4Z9KB 4KBPA 1NFDA 3N1PC 1BZ7A 2Z8VC 5H35A 1HKLL 3ZKSD 1NMCB 2GCYA 3CH8A 4U3HA 1JV2B 5T3ZH 3IF1A 4ZS7H 3CN2A 3D3VE 4AQEB 3VXUD 2ZQKA 1SXZA 4FNRA 4ELMB 3BO8A 1N5AA 3LSOA 3E6FA 5I0DA 5DR5L 3L3HB 1FC2D 2YMOA 2WIIA 3B9AA 3P9LA 4AYSA 1B4LA 3AABA 3EBGA 4U1MA 2A9BA 4XC1L 4K7FA 2BPBA 4XN5A 5AKTA 5IMLB 1IM9D 3QDGE 3QEQE 1HI6A 3TYFA 4Q7DA 4WFED 1OTTC 3G6AB 1G7JA 1LEGB 3RTQC 2NY0D 2ZPKH 2XQYA 5I1EL 2VRKA 2YRLA 3D30A 3EGSA 4IRJD 4X6DA 3RWIA 3NEEA 1NDMA 2R2BA 3S9DB 3QK0A 3G5XA 4PW9A 2YMXL 1IGYB 5E03A 2X42A 1KCUH 3ZKNC 4KKNA 1OAQL 5BRZB 1NKOA 3TIDA 1J0JA 4KRMB 5M95B 1OAKL 2DQHH 3GJFH 3GRGA 3OWRA 3W0WA 5AYTA 3ATAA 1BDYA 4WW2C 1IE5A 1H15A 1CYWA 3TX4A 1S7SB 2FJSA 1EEUA 2EVGA 5K9OB 4GAYA 2UY6A 2MTAA 1O6TA 3QISA 2RA1A 2Y3NA 3MRMB 3ECBA 4EOWH 1H6UA 2AJUL 3IJSB 3RFZC 1N7ML 3UAJC 1XGQA 4Z76B 4X6CA 3Q6GH 2AABH 2CA3A 3QUMA 1ACYL 5AENA 2FB4H 2Y6TE 4IMLB 4MJIB 4PJ7B 1GGTA 5BRQA 1N0XL 1Z7JA 1DR9A 2ZCZA 3Q3GB 1NZRA 3BIAX 4V1DD 3UMNA 2MHAA 1RFDH 2GCYB 1CDHA 3SJVE 4YDVB 1LNUA 3U46B 1C8PA 4GQ9L 2BSED 3GHPA 3L4YA 4KO9A 1K5WA 1UWYA 5C71A 2JJUA 3FO0H 1UXLA 1WBZA 5HHMB 4U1IA 4N2KA 1A6AA 1XH3A 2H4EA 1RU9L 2ZPKL 4P5KA 5D7SL 4PMEA 5I16A 4AYDC 3VD4A 3WTSA 4Y4HD 1D9KA 2NNAA 2IH9A 3DV6B 3LH2L 1GC1C 2Q7YB 3RWFB 5I1IH 4K5PA 1T0PB 5DRXA 1CFQB 4OLXH 3KGUA 2H32H 4YHIB 2BY2A 3UBXG 5E23A 5EZPA 3TTSA 5JHBA 3EGDA 3X11B 2YD6A 4PRIB 2WBJD 4PTUA 5MP6H 5IFHL 4KKQA 3CFCH 5KYXB 5T1KD 4FXGC 4EZJA 2AGJL 3ULUE 1SLUA 1MCHA 4CC1A 1RIVH 3V0GA 2OMUB 2EIBA 4NNXB 4JHWH 3H54A 2DBJA 4XZ4A 4HXAH 5B39G 4JM0A 1S3KH 3MOAL 1MEXL 2J5WA 1MFVA 5LUMA 1F1AA 1BBDH 5INDB 3ZIYA 4YDKL 2VW4A 3WLWD 3QIWD 5EPMA 4AWJC 4RFOH 1JCKA 1RIHH 3ECUA 2VQ4A 4Q8BA 3QUZB 4QKXB 1WWBX 1IEAA 2VAJA 15C8L 2DQDH 2OP4L 4AH2A 2XKUA 1ORQA 2J1YA 4Y4HB 1AE6L 4EI5A 2TRHA 4Y9CA 4KVCH 1LDPH 3SGEI 3RVWC 1HH9A 4OM1H 5IHLB 5LGHL 1J8KA 3GC3A 3SDAA 2FBOJ 1ADQL 4N2AA 4EO5A 2H8PA 4LLMA 5LAXA 3ZUCA 4H0IA 2DJSA 2EH7H 2PR9A 3V4UL 3U9PL 4GQRA 1QTSA 4BKSC 4DGWC 4PJFF 2GJ6A 5TQ2H 2X05A 3S8WA 3O2DL 3FOLA 2VDKH 4X4ZA 3DX8B 5HHPA 1NL0H 4I5BA 5LLIC 3IJYA 2IANA 1L5GA 1ZHBA 3TU6A 3D87B 2WN2A 2Z0UA 1DQQB 4PJXA 4U1HB 5I76A 3O6KL 1CFNB 1E30A 2HN7B 5GQBA 1NCAH 2IGLA 1HHJB 1KZYA 3L1EA 3U4BL 3OKNA 2UZXA 5MENB 2VL4A 1PYWA 3D9AL 4J8RB 1Q94A 3O81A 5F9JB 1ZT4A 1MREH 1OGTA 3B2DC 3T04D 2V3DA 4N1EA 1HFUA 4WFHE 3V79C 1EO5A 1QEWA 4KTGA 3LXAA 1AC0A 1Y1UA 3GSNL 4YL4A 4NQXB 4Y89A 1RI8A 4PG2A 1V55B 4TTGA 2VZ3A 1NLDL 2ZT9C 4ECNA 1KIQA 5DRWA 4H8WL 1CBVL 4MJ4A 4WNSA 2FE0A 3BGAA 3BVXA 4HX1A 3EIFA 3OMAB 4FG2A 4L0ZA 3TCTA 1JN6A 3QAZC 1GRWA 3RY4A 4RGMB 1DJZA 1R9FA 1ROCA 3IVKA 2H0PA 1S9VA 2A6JA 2WUCL 3C5ZC 1PX3A 2JELH 4Q14A 2AKRB 2QQLH 5LCVH 2IAMB 3CAFA 5L88L 2MWCA 1KJ2H 2D8KA 3FTSA 1Q0XH 1JWUB 1CFVL 4ZODA 3I50H 1K9TA 4QCIA 3V0JA 2VDLL 5I6XC 1BFVH 1L9QA 3G5ZB 5IT2H 2AV7A 1MCOL 4MJIE 3EOBB 2D0GA 3ALWA 2NSXA 5HDLA 4P99A 3B2UC 2UV3A 4HW6A 4XMPL 4FMVA 1E2WA 3BC9A 4PGZA 5AVUB 5DGQA 25C8L 4FFWC 3DKHA 4JRYB 5IJVB 1BD2E 1UWGH 3ESVF 3GSOB 3JWDC 4HLZG 5I76B 1N59B 4K73A 1GS6X 3T2OA 4LEBA 4MQ7A 3MROB 1LP9E 1E9PA 3DX6A 3FC8A 4O51B 1JGUH 3ZY7A 4JKWA 2W65A 4ZUTA 3QGVA 3KL3A 3IJHA 4EJ1C 2F2HA 4OGYH 2AXFA 5DFAA 3LH8A 1WBYB 1Y6MR 2OLDA 5TK2A 3TN0C 1E4JA 2NY3C 4F7TA 1AS7A 4WI9A 3NSDA 4GRLC 4H26A 1KJ3L 2YZ1A 1XSOA 3KLQA 1NIDA 1HU8A 4UAOB 1H8OA 1IAOA 1DEEB 2XNAB 3FAXA 1BZ9A 4OLZH 3EYFA 1CVSC 1PJWA 1FYHB 1HTYA 2AEIT 3FT0A 3HJ0A 4NDMA 1EHLH 5AB0A 1BV8A 4XR8C 3F04A 2Y2YA 2BSTB 1V10A 3D3VB 4LSTH 5E0QA 3AROA 3ZTJG 1EAOA 1KTDA 1M2VA 3GMNB 3KL5A 3HLAB 4XCEA 5IMOA 1U8MA 5SWSD 1OARH 5ICYB 3LIZL 1KB9J 3GSRB 3HAEB 1KGCD 1V3JA 5B3JE 3PE9A 5F1IB 5IEKA 2JIXA 5D1QC 1AGFB 2PTUA 3HI6L 1AO7D 3EDEA 3IJ8A 1LEIB 2QEJA 3F7YA 5EEWA 2NXYB 3RZWA 1I8KB 4DERA 2ZYIA 1RURL 4Y9EA 4R97B 4P07A 1E6OL 3HNVH 3WU1A 4FEIA 3VFVA 4ZYKA 5K1JA 4JRXB 4PUBL 4RQQB 2VM9A 2HA1A 2FHFA 4LMQE 3U0TA 1E9OA 3P4NA 1SEQL 5D1ZB 5CFAA 3TO2A 5KBNC 4ISVB 1QPXA 4NZUL 2OZNA 4CW1A 3C6LC 2QR0B 2OTUB 1SYSB 1M3IA 1XFPA 3T6ZA 3V0VB 1MLCA 1G5AA 4BWWA 5HVGB 4F7MB 4APXA 1IAII 3EYSL 5D2NC 5IQLA 3OKEA 4CN4A 3A5VA 4XBGB 3KCWA 4CSZA 3SSGA 3H55A 3NA9L 1Z9SB 1KT2A 2Z34A 1E42A 4TVUA 1M6OA 1RUPH 1G9HA 3UYRH 1II4E 5I8CB 1B9ZA 1G0XA 4O5LH 2PW1B 2A9MH 1ORQB 4KGLA 1S7QA 4OJCA 4E0RB 4F7EB 4JFYB 2SODB 1N6QL 2Q3AA 1IGML 2X1PA 4HGKC 3QWNA 1J5OL 3MUUA 5GZNA 4NI6A 2IG2H 1GHFL 4NQCB 3QB7C 2YFNA 1P5UA 1E8XA 5D70L 2GJZA 2LR4A 4N86A 2KDYA 1QHPA 3L3IB 3GSRA 3R8QA 2A83A 1NC4A 2QADC 3NMEA 3QSKB 4XX1E 4ABUA 3F64A 2AC0A 1MNUL 3SE8L 2HRPH 2NY6C 1ZLUK 1KJ2A 5IQ7H 2ZWSA 5EUOE 2ZSWA 3MRGA 4N2CA 4HU2A 3FTGA 4U0RB 2BP5M 3Q5TA 4KJWD 5CBAB 5E4AA 2BSTA 4WI8A 5E5MB 5AW5B 2YXMA 4Z7IA 5HHQA 1YEGL 2R1WB 1FQ9C 1GGCL 1JPFA 4WQOA 5JHDB 5AOLA 3BZ4B 4TSBL 5C8JB 4U1LB 1ADWA 5ISZA 3T4AB 3C6LD 4JFWA 4AYEC 3T6QC 2OFQA 3F00A 4BSWA 2OTWB 3KPSD 3KPNA 4G42B 5EV7A 2WZPA 5DRZB 1T89A 3S5YA 2IAMC 4WV1B 1E9QB 2XBDA 5HPOA 3U1SL 4NI3A 4FQQB 1NGXA 4PS8A 3OKMA 1X5IA 1E6OH 1SFHA 2R0LL 1J