3VDGA

Crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with formate and acetate
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
424
structure length
424
Chain Sequence
SMAHNRIRITGARVTPVAFADPPLLNTVGVHQPYALRAVIQLDTDAGLTGLGETYADTVHLERLQAAAHAIVGRSVFSTNVIRALISDALGGDRTGDGSGLAGMITSASVVDRVFSPFEVACLDVQGQVTGRPVSDLLGGAVRDAVPFSAYLFYKWAAHPGAEPDGWGAALDPDGIVAQARRMIDEYGFSAIKLKGGVFAPEEEMAAVEALRAAFPDHPLRLDPNAAWTPQTSVKVAAGLEGVLEYLEDPTPGLDGMAEVAAQAPMPLATNMCVVAFDQLPAAVAKNSVQVVLSDHHYWGGLQRSRLLAGICDTFGLGLSMHSNSHLGISLAAMVHLAAATPNLTYACDTHWPWRHEDVVAPGALNFCDGEVQVPATPGLGVEIDEDALAALHEQYLRCGIRDRDDTGYMRSIDPGFNASGPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enolase MSMEG_6132 FROM Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Lyase
molecule keywords Probable glucarate dehydratase
total genus 142
structure length 424
sequence length 424
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vdgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vdgA01
1XS2A 3H7VA 3BJSA 1ONEA 3OZYA 2ZC8A 3SSZA 3NO1A 3SBFA 4E8GA 3OZMA 3NXLA 4K2SA 2PS2A 3ES7A 1NU5A 1PDZA 1SJCA 1IYXA 4FI4A 3OW1A 3VDGA 3JZUA 3RGTA 4KWSA 3SN4A 2OPJA 4E5TA 1WUEA 1KKOA 3EEZA 3PK7A 3SN1A 1BKHA 3RRAA 3FJ4A 3CB3A 3QTPA 2PU0A 3DIPA 3ZVIA 2AL2A 1KD0A 4HCHA 4DYEA 3GY1A 2QJJA 1KKRA 1MNSA 3RITA 4H2HA 4DXKA 2PSNA 2PP3A 2DW6A 2PTXA 2GL5A 4ZCWA 2XH2A 3THUA 3T4WA 3IJLA 2QVHA 3TWBA 2PA6A 2OZ8A 3NFUA 4IL0A 3CXOA 3QLDA 3UCDA 4HNCA 4H83A 5EU9A 3S5SA 2XH4A 2OZ3A 3T8QA 1TZZA 2AL1A 3R25A 3FVDA 2PU1A 3TTEA 2RDXA 3QKEA 1TE6A 3TOYA 3TJ4A 4DWDA 4J1OA 5FJUA 3R11A 3DGBA 2QDDA 5J04A 4M0XA 5FJOA 1FHVA 4YWSA 2PMQA 4Z17A 5BOFA 4HCDA 4GYPC 3BSMA 3DDMA 3OTRA 1PDYA 1W6TA 4JN7A 1MDLA 2OG9A 1YEYA 3MQTA 2AKMA 3NZGA 3ZVHA 3GO2A 2HNEA 4Z1YA 2QGYA 3OP2A 3UJSA 2CHRA 3CYJA 1E9IA 3R0KA 2OVLA 4G8TA 2OQYA 3DFYA 3GD6A 2PP1A 1WUFA 3S47A 3MZNA 3ZLHA 5ENLA 2GGEA 2OQHA 1SJAA 1L8PA 3FXGA 4E4FA 3IJIA 2QJMA 3FYYA 1ECQA 4GMEA 4DN1A 3JVAA 3QN3A 3V5CA 1JPMA 4A6GA 1EC8A 2FYMA 3RCYA 3UJRA 1DTNA 4E4UA 1RVKA 3TW9A 2P0IA 4ZA0A 4IHCA 1EC9A 1R6WA 3V4BA 3CT2A 1P48A 3IK4A 5BOEA 2P8BA 3UXKA 1P43A 3DESA 4GGBA 3UGVA 3STPA 3CK5A 3I4KA 2POZA 3DG7A 4MGGA 1ELSA 2PP0A 4GIRA 3DEQA 2HZGA 3VFCA 4HPNA 1FHUA 3HPFA 3RR1A 3I6EA 1EBHA 3VC5A 4KEMA 1MDRA 3D47A 2NQLA 3N6JA 4GGHA 2OO6A 3Q4DA 3UCCA 4KT2A 2I5QA 2GSHA 1JCTA 1NELA 3UJ2A 2MUCA 3VA8A 3MUCA 2GGHA 2MNRA 3EKGA 3T6CA 4KPLA 4FP1A 2XSXA 4EWJA 4IP5A 2PGEA 3U9IA 3PFRA 3P93A 2ONEA 3PWIA 3FV9A 4JN8A 4IT1A 2OKTA 2AL2B 4DX3A 2PGWA 5IDZA 4ENLA 3MSYA 2AKZA 2PPGA 3DFHA 2OX4A 2FKPA 3FCPA 4IP4A 2PODA 3U4FA 3V3WA 2OLAA 2QJNA 4H19A 3Q45A 3RO6A 1MUCA 4MKSA 2GDQA 3DG6A 3TJIA 3H8AA 2ZADA 1KCZA 3T9PA 3UJEA 4K8GA 4F4RA 2P88A 4E6MA 4M6UA 1XPYA 3IJQA 3VCNA 3OPSA 4HNLA 1JDFA 1SJBA 4JHMA 2GGIA 3CAWA 3MY9A 2PTWA 3DG3A 4HN8A 2GGGA 3UJFA 3P3BA 6ENLA 3TWAA 4G7FA 2P8CA 2XGZA 3ES8A 3ZVHB 2XH0A 3N4FA 4GFIA 7ENLA 2HXTA 5FJTA 4HCLA 3H70A 4A35A 3R10A 3SJNA 4GYPA 3R0UA 3TQPA 3N6HA 5FJRA 4A3RA 4MMWA 3QPEA 1TKKA 1F9CA 1JPDX 3ZLFA 3H12A 2OFJA 1SJDA 2XH7A 3VCCA 4ROPA 2PTYA 3D46A 2PTZA 2GGJA 2QQ6A 4H1ZA 3VC6A 3TCSA 4DHGA 1EC7A 3UXLA 3ZLGA 1R0MA 4GISA 3SN0A 2P3ZA 4K1WA 3JW7A 3KUMA 3MKCA 4IZGA 3B97A 4IL2A 1BQGA 3PWGA 5FJPA 3R1ZA 3BOXA 3DERA 2PCEA 3ENLA 3MWCA 4HYRA 2DW7A 2O56A 4X2PA 2QDEA 3K1GA 2OZTA 3P0WA 2HXUA 3GC2A 1EBGA 4J3ZA 3SQSA 1MRAA 3I6TA 3V5FA 3N4EA 1OEPA
chains in the Genus database with same CATH superfamily
1IV8A 1F3PA 3BJSA 1POJA 3S1XA 4GK8A 1BSIA 1IXOA 1GTEA 4NNAA 2J66A 3WQCA 1JI1A 5C55A 1UR9A 2XYLA 1YNPA 4WY0A 2I5IA 1GHRA 2HEJA 2HE5A 4KRUA 3ELFA 3ARRA 3PSVA 3VDGA 1CGYA 5FF7A 7REQA 2YSWA 3JZUA 2YOCA 4Y96A 2OPJA 4ZQRA 3GUWA 3RM8A 4XAFA 4P2VA 1GRAA 4MG4A 3WUEA 4JDBA 3KTSA 4A4AA 2VGFA 4WGXA 3W02A 2YCIX 3W22A 3GRTA 3UT0A 1W3KA 3RXZA 5C0QA 3OLIA 5HUOA 4QR6A 4QDMA 1MNSA 2E9BA 2TYSA 3DUGA 3RRXA 5DCDA 3KWSA 1C8QA 3L4UA 5D8WA 2BVYA 3RG6A 1PB0A 1V6VA 2H9AB 4MFDA 2O4MA 2PTXA 1ADSA 3LLXA 4JTAA 2CFYA 5JCMA 3ICJA 3N3TA 2AMXA 4Y9AA 3UF9A 3L12A 3MMWA 1TJ0A 4PEKA 4WXZA 1F76A 4BI6A 5HQLA 4V1YA 1XLEA 4Q8WA 4JKLA 4R9XA 4D8LA 3BVJA 3MSGA 5I3IA 4O52A 3CJPA 1TMLA 2UV8G 4FX8A 2DUZA 3F5KA 3TQ0A 3PUEA 1B30A 1GRTA 2J4GA 4GACA 3S1GA 1OCQA 5LIKX 2PDMA 1YEYA 2FDSA 4JCMA 3KL5A 4J3TA 3TTQA 2WVVB 3LXAA 2PBGA 1XIBA 4O53A 3GR4A 4OVXA 1XYZA 3GD3A 3UNTA 3IEBA 3FSUA 2YXOA 3P81A 3L4YA 4H01A 5FS8A 1AODA 4ERAA 4PMYA 1KB3A 3E96A 1BF2A 1S5WA 1DPMA 3W76A 2CEQA 1US2A 1ZY9A 4Q4MA 4H9VA 1TVNA 1EOMA 2GJXA 3EDEA 2P5NA 3GKAA 1TWDA 4DBEA 3GUGA 4YTQA 4JTRA 2V3DA 4F2TA 4QEHA 1LLWA 1GEHA 2ACSA 4RV8A 5DFAA 3L5MA 4UR9A 4H9TA 4BV6A 4MJZA 4F48A 5C9RA 3T40A 3RMJA 4AWSA 3BLFA 1NPXA 1VYRA 2WJFA 4D6EA 3TW9A 4WKAA 1H0IA 1GYMA 3SAZA 2ALDA 3NSMA 3SUTA 4MJ2A 1SFTA 4UTLA 3CT2A 4LEFA 3GH4A 4QDPA 5HJXA 1IF2A 1KNWA 4ZSTA 3URAA 1OT1A 2X42A 3RFAA 4AYGA 1W1YA 4CNNA 4EMJA 4EE9A 5GVJA 4QCEA 3VOIA 3STPA 4GH1A 3EKLA 1UC4A 3VI2A 4B4FA 1AOGA 3KBWA 3O8AA 2GPTA 4GIRA 4HNUA 3FYOA 3RU6A 2ZUVA 5JU6A 1VBJA 4X63A 3O05A 1XYAA 1Z89A 3OB8A 3UZYA 4EQRA 4ZOAA 3ORWA 4KF1A 4J27A 4DIAA 1RHCA 3LXBA 4NG3A 4AY8A 1PHWA 5BYWA 4GGHA 1MQPA 3ARTA 1RQEA 1BHGA 1XGZA 3KL3A 1LTDA 4XV0A 4F0RA 3MUCA 3D0CA 1EUNA 2RFGA 2CLMA 3T6CA 4ZTXA 2ZZ0A 3ZXWA 2W54A 4JFTA 4N0RA 1S3HA 4XZNX 2VFGA 4FLRA 4RNJA 3PTKA 3PWIA 2WP5A 1YXYA 4UTJA 2WOQA 4UMCA 1KCKA 2AKZA 4HIBA 4D6GA 2WO5A 2PCQA 3CZKA 1WXZA 2BOEX 3PG9A 3LENA 4FS9A 4NJHA 3N18A 1RXOB 3LCIA 4MKSA 4EPKA 1ZALA 4H4RA 4ZODA 3H8AA 3IGHX 4EQWA 4MOZA 4OHQA 3KOWA 1G4EA 5TBOA 4C6LA 3DHFA 4LYQA 4NIRA 4HNLA 2VOTA 3NQ6A 4FNQA 4BY3A 3ZJ8A 5L6UA 4UQBA 2XVNA 2VR2A 3N2TA 4WY0F 1TV3A 2CW6A 4PMJA 3B05A 2ZVIA 1GOQA 2XH0A 1O1HA 5FJTA 2DSKA 2PC8A 1GCYA 2DSWA 4MADA 1CECA 4XAGA 3R0UA 5F4WA 4I7VA 5CJMA 4KCUA 2VENA 4HA1A 1SFJA 1FEBA 3LNPA 2V5CA 3GZ3A 5C2GA 4UFKA 3QW4B 1WZAA 1EHAA 3B4UA 3UCQA 1FWEC 3TN4A 2Z1KA 3CAVA 4G5DA 1A5BA 1UWIA 1OFRA 2NQZA 2VEGA 4FPSA 4PE8A 4ZQNA 2WCSA 1R5YA 1NOWA 4HGXA 1N62C 1VFOA 5FJPA 1VB9A 1KRCC 5DBUA 5G4WA 1QI3A 3BOXA 2XIQA 1FDZA 1PKMA 4R27A 1OFQA 1GONA 4JTQA 4GA8A 1IXNA 4DJEC 1SYTA 3HGOA 4XVEA 3AICA 1UIOA 1IT8A 2A7NA 4L4LA 3RCMA 4IUGA 3GRSA 3VYLA 1GVFA 3UR5A 1CYGA 1FA2A 1SSGA 3T44A 1XGEA 4QJ5B 3I6TA 4ZMGA 5BOEA 1PJ9A 3BAWA 2EPLX 4NX0A 3T78A 4UMBA 4PUMA 4WLCA 4MTVA 4YYCA 3V0SA 3A47A 1XH1A 1B3WA 3NIYA 4L64A 1QRQA 4DB7A 3V16A 3E2QA 1W32A 1RLDA 3NXLA 5EMYA 1MZRA 2CCRA 4PC8A 4GY1A 4TOQA 2C7FA 4G1KA 5U4NA 3EWXA 4B9YA 2VM8A 4GQGA 2WMIA 5FCZA 1O12A 5I3JA 5K2ZA 4E5TA 2GJPA 2AAMA 3U48A 4HNTA 3CTLA 1VEPA 4E2VA 3P62A 4DWSC 3SUVA 1ONWA 4KCTA 4R7JA 4AAJA 1T8QA 4O18A 1HP5A 4WUIA 1OFBA 4AISA 3SY8A 1A5LC 4HPXA 4C6QA 1M7XA 4DYEA 4RDYA 3EKZA 4I6KA 3MUAA 1JJKA 4MYAA 3M64A 1XGDA 4YWOA 2PSNA 3CV2A 2DW6A 2ZBTA 5D2VA 3W82A 4CCCA 1Q6FA 3VGBA 2I56A 3HG4A 1I75A 4BCEA 1LORA 3GK0A 4UC5A 1P0EA 1VPQA 1E72M 2WZEA 4IIHA 4BR1A 2OYMA 1ME8A 4C6FA 2E1WA 3G8EA 3NFUA 5C70A 2BOGX 1MW1A 4IGSA 5C9WA 4PZVA 1QXLA 2OZ3A 1TZZA 4YU1A 1IEWA 2HDJA 2O9OA 2QMJA 3K30A 1JGIA 2PWUA 2WANA 1U5JA 2VI0A 1XIJA 2C91A 4GKTA 3PZIA 1R46A 3GIPA 4MFEA 2EJAA 3SIZA 5BOFA 5TD4A 4BWLA 2QCFA 2B7QA 3OTRA 2J6VA 4O19A 2BGSA 3NZGA 1DNCA 3EX6A 2TPRA 2VUYA 5EY5A 3QQ1A 3MDWA 1Q8AA 2PB1A 1W9PA 4UZSA 4PUWA 5M2FX 2J7GA 3CYJA 4BEQA 1A5SA 4W8LA 3DFYA 1S38A 4GIYA 1KBBA 1VFUA 2ZUSA 4KIEA 1LWIA 1J11A 1FWJC 4GJJA 2I57A 3QGVA 2GZXA 3UPBA 4PCFA 3QV9A 3TA6A 3CM4A 1EJ7L 3PZTA 4N9BA 3CUGA 4BWLC 1UD5A 1UUMA 5G4EA 4AVFA 1YRRA 3SCRA 1JFXA 1P1MA 5AHLA 1OYBA 4A2SA 2PRLA 1CXLA 4A6GA 1F07A 4HOWA 2HRWA 3ONCA 3W1MA 4K7ZA 1E5JA 1UA7A 4FF5A 1BYBA 4O17A 3DJJA 3WF4A 3WQGA 2NQJA 2DQXA 2CLHA 1QAPA 4MKNA 3HGSA 3TW6A 3IV3A 3H21A 1W3NA 1TVPA 3ECQA 4W86A 2CZVA 1JCYA 2TSYA 3I7SA 3E0FA 4DWSB 1X1OA 4Q7NA 2ZRYA 5HQEA 5ABTA 4PTNA 4FX6M 2FDMA 1OGSA 4S3JA 3DEQA 4W7VA 3KCLA 1KM2A 4NI3A 3HPFA 3NQ2A 3I6EA 5CXPA 3JZEA 1EX1A 3T7VA 1QNRA 2W5FA 1XHGA 4U2YA 3UCCA 2BHYA 3DGZA 4LS2A 3L21A 5CSRA 4TVUA 3AOFA 4LXFA 2XGIA 3NSNA 2BTMA 3KTXA 3USBA 3QOKA 3P0XA 4KPLA 1RBOB 1ICQA 3G24A 2D2JA 3W73A 2WSKA 1YBQB 4WDUA 1J79A 4LH8A 1KO0A 2NV9A 1MMFA 3ZT7A 2AMGA 2Z25A 2OLHA 3H2MA 1ZP4A 4AHPA 2R8WA 3NYDA 3DFHA 4MY1A 3KOYA 4EWND 3RO6A 3WQPA 3RILA 2ZX9A 4H00A 1BF6A 3PBYA 4DELA 3VOJA 3MMDA 2WZTA 3HO8A 2ZWZA 5C54A 3POHA 5FF4A 4J3UA 1B4EA 3CS2A 3OPSA 4Z1CA 1C7SA 1EQCA 2VC7A 3CAWA 3MY9A 1DXIA 5K4XA 2EPKX 1XCWA 2D2OA 1TMQA 1YIXA 1RK6A 3L2LA 4MY9A 1LT8A 4EF8A 3BJTA 7ENLA 3NQFA 1EF2A 2F2KA 5JMUA 1J01A 5HXMA 1KQZA 3WNOA 1F8IA 2E67A 4AD0A 3RJYA 1QI0A 2FZNA 2KAUC 2XH7A 3B3DA 4MVAA 2GJNA 4ZOCA 1M65A 4FOKA 5A94A 1BEUA 3U3HA 1FEAA 2Y61A 3UXLA 4WF7A 2BY3A 4P7NA 2QULA 1MQRA 4GG9A 1OFEA 1UMYA 2OGYA 3N2BA 4CNSA 4EOUA 2J77A 2AQVA 4IPJA 3ITVA 1A5CA 4LY4A 2PCEA 5DXXA 1HG3A 2HWGA 4X2PA 4K8DA 3HMCA 5BXRA 1R3WA 1IEIA 1Q6OA 4LNYA 5CPOA 3AXMA 3VDBA 3M5VA 4JTLA 3A6OA 4NRSA 4F9JA 4FEZA 3VDAA 2C71A 1V6XA 1JPHA 6REQA 1DOSA 4EVZA 1ML1A 1TR1A 3CQIA 3C6CA 2A7PA 1ZFJA 5CC7A 1AVAA 4RNIA 3SBFA 1N5WC 4TMCA 4V28A 4K68A 4UTFA 4TX6A 5DEZA 2QCNA 3MUXA 1Y8BA 4S3AA 4NF7A 4CQ9A 4F79A 4A3QA 4NT0A 3CGBA 5C2CA 2HS6A 4G56A 4MWAB 3VXGA 2WKGA 1OYCA 1M41A 2ZICA 1T41A 1YDYA 1QJWA 3VUPA 3G3MA 2W61A 2FHCA 1G7VA 4B5WA 3VIPA 3MP4A 4NAFB 2F2HA 3FJLA 1Q7ZA 1R38A 1XYFA 3QHNA 1AH0A 1K3UA 3ZVIA 4Q6JA 2WPEA 2DVUA 2DJXA 2J13A 1E9LA 1V5XA 2X8GA 3OGVA 5ABEA 4JX4A 4JIPA 4L9XA 3T4WA 2FTYA 5E1QA 2X7WA 4QE1A 1H5YA 3LHTA 3SQPA 3ERPA 3RPMA 3SDOA 3WD0A 4L9YA 4DBDA 2WYSA 4ZQPA 2OLSA 4OIFA 1GVQA 2E77A 2YJQA 2DORA 3K5XA 1KC7A 2WPBA 4L65A 4JDYA 3UP8A 1LL7A 4WK9A 1L0PA 4QGCA 3GVVA 1AA1B 3VMPA 4LAMA 2QIIA 1V3HA 3N13A 3MHGA 4M0XA 4IIEA 5FJOA 3FAXA 4D9PA 3L5OA 5TNVA 3BSMA 1V93A 3EMZA 3FJ6A 3PULA 5D09A 5CQ1A 1NP2A 2OEKA 4JQ2A 3CO8A 1X1NA 5I3DA 3GHTA 4JTIA 3QYQA 5AYIA 3E2SA 1E9YB 2PWVA 4HTBA 3CZ8A 4XKYA 3S2CA 2EQ7A 1AD1A 5DMLA 5AY7A 5AFDA 3RJXA 2O0TA 2NQ9A 3RAOA 3RLUA 3UZXA 3BCDA 1LBMA 5AYZA 2IQTA 5J5DA 1ZAJA 4QAWA 1XRFA 1UKPA 2IQDA 1FIQB 1TWSA 4OOUA 4DF2A 3TIMA 5AC8A 3LHYA 1VHCA 1J6OA 2GQ8A 3S1UA 1TJRA 1XFCA 4GR1A 4GX8A 4Z2JA 5HNTA 3FYYA 4LBUA 2WVUA 1XJBA 2X0HA 3VKAA 1GT8A 1NTHA 2V3BA 4U33A 4DN1A 3V35A 4DYKA 3LHUA 4QS6A 3LSBA 3AMGA 3NQDA 4RL3A 2CITA 5D2XA 1NSJA 4M24A 4D6FA 5E5CA 1CLXA 3INPA 2PWHA 2V3EA 3PAOA 3J7HA 3GDRA 4IHCA 4U10A 1GOMA 1GERA 2G37A 3QFEA 5MKGB 2IKGA 4AD2A 1F2JA 4W9TA 2BGNE 3GD4A 5CGQA 1XLFA 5DT5A 4UQCA 5TAOA 3H22A 3EUB3 4XZWA 5A1AA 3N15A 1ZHAA 3KAOA 5FEPA 5XIAA 5CCZA 3CH0A 1I1XA 4DPPA 1ELSA 4J3SA 2HZGA 3KLJA 3AUOA 2UY5A 1JQVA 1M03A 3IAPA 1FHUA 1PIGA 3F2CA 3VGGA 2A3HA 1EZ2A 2NQLA 4QM1A 1OY0A 2VGIA 1JRBA 1U33A 3OU8A 4ZO9A 1XC6A 1UH2A 3NZPA 4XKMA 1W3JA 3GU2A 1GZ1A 1YPIA 1ENUA 4B3ZA 3GC5A 4Y9PA 5D30A 4MB1A 4C1LA 4RNFA 4GI4A 1S39A 4S3DA 3WDHA 4WVXA 3C86A 4WRHA 3TQVA 1H5VA 4DX3A 1D3CA 1ZBCA 3PSWA 1XLBA 3UXAA 4UZUA 4IP4A 2PODA 3VZXA 5C9XA 3W2KA 2X8HA 3EDJA 3W23A 1R3QA 3Q45A 3NVVB 4UTTC 4XUGA 4GC3A 2GDQA 3LGDA 1NFBA 3KBMA 3PC0A 1A50A 4X0NA 2ZADA 1E73M 1KLZA 3P5YA 4F4RA 3MMUA 3C2OA 1TSIA 3UW6A 2X2YA 5E6ZA 4K38A 5CKSA 4DO7A 2J8TA 3NURA 1XANA 4MKVA 4UNKA 3VD7A 4EIVA 1F3EA 2W92A 2O92A 4KFOA 4LBRA 4ML9A 3OBAA 1GRBA 5EB8A 4AVNA 3NEHA 1TVLA 4U5IA 3KEHA 3KOZA 3WO8A 2BB0A 5E70A 1TV8A 3FDKA 2YBTA 2BWGA 4UQ9A 3W2JA 2JKPA 4AWTA 4E38A 5HMFA 3V36A 3DFNA 1TA3B 1ZS2A 1NM9A 1W1TA 4NY2A 1ITUA 1QO2A 2VQUA 3RX3A 2VEPA 4HSHA 2PFHA 3S8HA 4ROPA 3WNMA 2ZA3A 1CXIA 3MI3A 4JY8A 5REQB 3REQB 1EYWA 1JGMA 3K4WA 1L9WA 4IPIA 4D8AA 2OB3A 3ITGA 3E5PA 1ZTVA 1N8FA 3GTHA 1GW9A 5LNRA 3KBJA 4NZCA 3VUSA 1JFHA 1FFUC 1K4HA 2EKGA 3VDHA 5C2XA 4XBKA 3W3OA 5F7UA 2BS9A 3OO2A 3RN6A 4LCQA 4A8RA 2ADAA 4H4QA 4TMBA 1A3WA 5KINA 1EBGA 1HVQA 3NRZB 4RR4A 1HP4A 1J0YA 3R2GA 4JL1A 3P67A 3S2JA 1RJPA 4N9EA 3L8KA 1UKTA 2BBFA 4B91A 4L7ZA 1W5NA 1M7JA 3AUJA 1E40A 1R86A 4NRRA 4DEFA 4CQAA 2O9RA 3WH9A 3IIVA 1UW9A 3CHFA 1TELA 1LVLA 3PS7A 2RGLA 3HIJA 3RM9A 1OCNA 2QLYA 1IYXA 1UWTA 2V30A 1IT7A 3BOLA 2I1OA 2ZZ3A 1CT5A 1P4CA 3UG5A 3LQGA 2VEFA 1BKHA 4S2CA 4FNUA 4E8CA 1I2NA 2DU2A 2F84A 1OFAA 3AYSA 2OX1A 3WH5A 3P82A 1XIGA 3PBGA 3MI6A 2TODA 3ONBA 1UR8A 3DIPA 5CGMA 3CUXA 3IGXA 2PUZA 3AHTA 3FA5A 4Z0SA 2JBMA 3TXVA 2E8ZA 1I60A 2C1IA 2BY2A 4LCSA 4WJXA 4DQWA 3WBAA 2JK2A 2XIBA 4LYRA 4NZ4A 1X97A 1EP1A 1ICPA 4U3AA 2QVNA 1W56A 2NSOA 4KQNA 2ZZBA 1J0HA 2PA6A 3NEVA 5JQ9A 3HPSA 4EXQA 4LALA 1O66A 1UZ1A 3QZAA 1EYEA 1RJRA 3FVDA 4RE4A 1XDIA 4AMCA 3TZNA 1BGAA 4XVDA 2JIWA 3WFZA 4LAZA 1HKMA 8XIAA 4AX7A 4YNGA 3BV4A 4AVOA 3I3EA 2YL9A 2R1NA 1ODUA 4Z08A 5FJUA 3DGBA 1WBHA 4N6EA 5J04A 5DMNA 2XSBA 1XBVA 1YPFA 4H8HA 2PMQA 2YVGA 1EDTA 4GUIA 4LY8A 4QP0A 3BUVA 1IR2A 1DE5A 3GO2A 3GRIA 4S3EA 2DZPA 1VQTA 1T7LA 1FWRA 4OBTA 2DZWA 3OA5A 4O15A 1A4LA 4WOQA 1E9IA 2CHNA 2ACRA 3L67A 3GD6A 2JE8A 3ZLHA 4N4QA 4QHRA 3QRHA 4ZSUA 3GHRA 1N5XA 5CLWA 4OV9A 3MBFA 5I3HA 1VKFA 5FL0A 3BAYA 3SQLA 1Q4NX 4LAOA 3A3WA 4M3PA 5J5RA 4QQ3A 2GOUA 4DJFA 3EWWA 4M80A 4P8WA 1H1YA 4XZHA 1JOAA 1SW3A 1V08A 4IGNA 1SMDA 3N2MA 2ZZ4A 5G2WA 3LGGA 4Q33A 1K8CA 3WLRA 4E4UA 6TAAA 1JVNA 1C7TA 2JKAA 1EDQA 2PAJA 5I03A 1DJIA 1GEQA 1UASA 3GDMA 4AZ5A 3QF0A 3PY2A 5DT7A 1S5TA 3AHZA 3AU2A 1G67A 4M6VA 2GVEA 5F4XA 1OB0A 1SFSA 2VNCA 5LHFA 3A4XA 3ZT6A 3G2GA 1DEDA 2E09A 1VBGA 4GGBA 1J5SA 1V6UA 1UROA 2BG5A 3QSRA 1QMLA 3OIHA 3G6MA 2BC0A 4ASTA 3O16A 1TTJA 4UFMA 3LERA 1CX9A 1UA3A 2PTDA 1L2UA 1BD0A 5LSMA 1A5NC 4KETA 4NU7A 3VC5A 1H7OA 2FVKA 4GUFA 3SW6A 4KEMA 4ZQOA 1OK4A 1W0MA 3QKZA 3UWZA 3Q4DA 3LCWA 3W6MA 2WQPA 1LG1A 2ZZCA 2HTMA 4Q8QA 1JXKA 3EX4A 2I17A 2WKLA 5D2YA 1AFSA 3TC7A 1XUUA 3NZRA 3O7UA 4RXFA 4AF0B 4UQEA 3FLUA 1IIHA 1MW3A 4AZ7A 5DELA 4IT1A 1LRQA 2VWTA 2OEJA 2PGWA 3I3DA 3CPRA 1FRBA 3GHUA 3NOYA 1LBFA 3S0CA 4RNHA 1XG4A 3ARWA 3EWCA 1VGAA 2DZUA 4I7WA 5D38A 2E6FA 1PZ0A 5I07A 4H19A 1XXXA 1YDVA 2WC4A 3W2UA 3G77A 5I78A 3AM9A 3VD5A 3T9PA 1H3GA 4XD3A 1ECEA 3R13A 1E6RA 4DUWA 3KWXA 3WNKA 2DT3A 4F9DA 5JCKA 1J12A 2Y7GA 4Q32A 1K6WA 3IJ8A 1JF5A 1XYBA 1VFMA 2EHHA 2V69A 3N4FA 3TQKA 3BCJA 1X6UA 3WBYA 2DSZA 4AC1X 4GYPA 2GDUA 3OBKA 3E2RA 2TAAA 1UHVA 1K9TA 4H2CA 1RPXA 4MMWA 5CPTA 1G9HA 2W67A 1WKYA 3NCOA 5CSYA 1AW1A 1IT0A 3VCCA 2G97A 4I8YA 3L5AA 3LNMA 5K4ZA 2VX7A 5AVNA 1O68A 2GGJA 2QQ6A 2OXNA 3VC6A 3NDOA 4J7RA 1E5NA 4FZIA 1RJQA 1UD3A 3C2RA 5BRPA 1IHIA 3BAKA 1J0ZA 3BG5A 1D2KA 3KUMA 3M1ZA 1H41A 4QTGA 4ML4A 4HPGA 4YS1A 3M0MA 1I1WA 2OU4A 3TYCA 2TRSA 3W38A 2ZZ7A 5ECVA 2JF6A 3AMDA 4IXXA 5F2GA 3F4VA 4HNVA 1DJQA 1H49A 1CZ1A 3ENLA 5M1TA 4C7DA 4N9DA 1XYMA 1XLMA 1W5OA 3L4VA 2J7BA 4CGTA 2C1GA 1VCGA 1DWIM 4IGMA 1S2VA 4Q8NA 4RW5A 5XIMA 1MVYA 2WM1A 3UBPC 2WP6A 3AYTA 4QNWA 3NSXA 3H7VA 4GCXA 2G3MA 2V3FA 3TYBA 1TPUA 1DIDA 1QATA 3SGZA 3URBA 4FA3A 4CQBA 4IFOA 4LNCA 3WNNA 2XM2A 1RD5A 1UR1A 2WLYA 5LKYA 3IK2A 2RHGA 4NJGA 1GK8A 2X1RA 4RDZA 2CC0A 5A6TC 4K1GA 3VIIA 3QLLA 1FWSA 4HB7A 3KHDA 2WOIA 3CGTA 1W54A 4DJED 1W1VA 5CBBA 3I65A 2XFYA 2GVLA 3MYPA 1SR9A 3HQPA 5HQMA 4O1EA 3G8RA 1I2QA 1LYXA 5A6AA 3CUHA 4UQAA 4JL2A 3B0PA 5BXTA 1DQUA 2JQXA 3EX2A 5DANA 4UCGA 1R9XA 3QFAA 2PZNA 3MDUA 4MHBA 1H7PA 3XINA 1IZCA 1MEHA 3WQ8A 3LTPA 3TYDA 2IS7A 3CU2A 3ABQA 4JYDA 3BGAA 4LQ1A 3MYOA 4U5KA 2R1KA 3S1WA 3IJLA 2INEA 2VEKA 4OV4A 5I0DA 3ITXA 1Q66A 2OZ8A 4O1DA 3GG8A 3S5SA 3L4ZA 3WEMA 2X1IA 2XH4A 1E6ZA 3W1XA 1P6BA 3AAMA 1RCXB 1J0IA 2NQHA 3V5OA 5HULA 5KSWA 1VDVA 4MPKA 3VKKA 3TOYA 1MUMA 3R12A 2FFIA 1PX4A 3DBPA 4XAYA 4AQLA 1ZRQA 4BURA 3S83A 3CWHA 4IG2A 1QT1A 3N3MA 2CDUA 3HW2A 2Y7DA 3GLCA 4J56A 4CCDA 3IJDA 3M0KA 2EQ9A 1UR0A 1IGWA 3SUSA 2J3NA 2J7FA 5TR3A 4QLJA 3OBEA 2PGFA 3S6TA 5F2LA 1XQKA 1JNEA 3NWRA 4M7TA 4JDRA 4CD4A 3QY6A 1OJTA 3O63A 4NP7A 1MSSA 4PMVA 3F2DA 3EXTA 2GJRA 1N63C 3P2VA 1KFJA 3VOFA 4APNA 2QUNA 2IUZA 4RDVA 2DH2A 2PRMA 3IS4A 3HB9A 3GW0A 1EC8A 4H8UA 1KR1A 3DCPA 3PTQA 5AHNA 5CJNA 4CLMA 2Z1WA 6REQB 1GWJA 2QHAA 2CLIA 3NNTA 1HT6A 5HAOA 5AC5A 1VENA 1OM0A 1K1DA 2ZUTA 1VLIA 1GQKA 1V8EA 3CC1A 1AW2A 8TIMA 3R79A 1JAEA 2CHOA 1JUKA 3S1VA 1G4SA 1W9XA 2ISFA 1LRTA 5EA9A 4DJFC 1Y5XA 1QUMA 1L6YA 4I9TA 1ONXA 2BV9A 2C6QA 1H61A 2GR1A 1G01A 3KZSA 5A8NA 2XINA 1VIZA 2X0YA 1K7EA 4DXXA 1BFNA 3CQKA 2PI6A 3B0XA 3TSMA 4C65A 5E0CA 5BRBA 3UXIA 4V33A 2OSYA 2QR6A 2TPSA 4Z2LA 1R3VA 1L6GA 2G96A 3E38A 3OA3A 3WF2A 4F0SA 5I06A 3QY8A 4Q8OA 3SURA 1RR2A 4H4TA 1K9EA 4UR7A 5F1UA 1NDVA 1W3LA 2MNRA 4QX4A 3C52A 1GKPA 3IUDA 2BY1A 3EOOA 3IIXA 4POCA 1ISVA 2Q09A 1DKWA 4TU1A 3HURA 3NAVA 5E0KA 1X2GA 1FY6A 3W7NA 4C5ZA 1WXYA 5HBFA 5DQPA 3TFCA 5ER0A 3AWOA 1ZL1A 3LTSA 3L65A 3PBUA 1F3WA 1N7KA 3AIVA 5ABFB 1C9DA 2CETA 5AYXA 1KWKA 1EIXA 3S46A 1HJWA 2WJDA 1UG6A 1FFVC 2YLLA 5I5RA 3GE7A 1JYVA 3DU0A 5EPDA 3TOPA 4U2ZA 3ABZA 2PTWA 2W4XA 4XO7A 4HN8A 4PBEA 3BQ6A 3SUUA 3AHXA 3TWAA 3UEQA 2P8CA 3USZA 1AQMA 4HD5A 1WO2A 1X38A 4GYKA 4EM4A 2D69A 4A2RA 5TQLA 3MUY1 1EJRC 2O9TA 4C6CA 3LTYA 2GQAA 1VF8A 4WD0A 3N6HA 1S46A 4H6QA 3L4TA 1SB3B 4NQ1A 2Y89A 2OR2A 1MEWA 1DXLA 5C9ZA 4JN6A 1ESWA 3SEPA 4YHGA 2Z2BA 5H8MA 5C71A 4HMNA 4MJ4A 1MWOA 1NQKA 5IHRA 1XICA 2WWDA 4WQ6A 2WXDM 3ABSA 4IOTA 1S2CA 4Y90A 4ES4A 1V0MA 3R7MA 2OTDA 3GFYA 1N8WA 5JBEA 3A22A 4IH3A 3O9NA 3W9ZA 3A4JA 5HMSA 2XIIA 3QQWA 4D71A 1VQZA 2DW7A 3OYZA 2XN2A 1W1A1 5D32A 1X98A 3WNPA 2G50A 2VFFA 2ZC1A 1E3ZA 2V0TA 3EZ4A 4RZ6A 2HXUA 3KCJA 3ZJ6A 3BPWA 2J79A 2V2DA 3VILA 4PODA 2A3LA 1IQ8A 3TNBA 4C6NA 4IWWA 4D6CA 2GUUA 1XS2A 3P80A 1JPIA 4E2DA 3A5FA 1GRGA 3C56A 3CZGA 3MCMA 3CZJA 3WBEA 1KRAC 3TZFA 3EPNA 1HN1A 3BGJA 3W1UA 1A4MA 1NARA 3ES7A 3NM3A 3NQ8A 4DY1A 4BF7A 3I3BA 4AB4A 4QE4A 5I09A 4FX7A 3BK0A 3W71A 3PZNA 2OWXA 1R30A 3OVQA 5A8PA 3NQMA 4JHOA 4PUKA 2Y62A 1CXHA 1KFEA 3E6EA 3OQ8A 1SW0A 4O1CA 1CXEA 1EB3A 3IJ9A 1V6YA 1WDSA 4ADTA 4Y8EA 3QW3A 2BCPA 4HCHA 3HZ3A 4EACA 1VCVA 3ZR6A 3NG3A 3CMJA 3GXTA 3RF9A 4KWVA 4EP8C 5EBKA 1U5HA 1NWTA 4H9MA 4EPEC 5CPNA 3QV7A 2PF0A 3THUA 3TNOA 3VE9A 5FESA 1E1EA 2HVOA 4B5SA 2OWCA 1V7YA 2WJEA 1NOUA 3CXOA 4EM3A 3RM4A 3WQEA 2RDWA 1KTNA 4CEXC 1B90A 2E3TA 2AL1A 2XFFA 3VX1A 1H09A 3WNLA 1V3MA 4ZXOA 4B15A 4L9ZA 3IRDA 1Q6DA 3S2NA 3N9RA 3ZOAA 2J9ZA 1ZMDA 5H1WA 3DFOA 1KM4A 2GVYA 3WQ4A 1B3XA 1FHVA 1EA9C 2ZZ6A 2V6AA 1C8VA 3COTA 3VIKA 2BODX 2ZX5A 3NOEA 4X22A 3ZVHA 2FHFA 1FUYA 3OYXA 1B2YA 1KXVA 3UETA 4P5UA 1ZNNA 3CMGA 3REQA 1U83A 2QGHA 1FHLA 2FPTA 3DZ1A 5M03A 1JCMP 4AD3A 3LM3A 2Y1HA 5A6BA 2YBVA 2W66A 5DRCA 2ACUA 2HVMA 3QGKC 1TTPA 3MS8A 5K9CA 1M1BA 4KEVA 1NY1A 2O55A 3FXGA 3MZ2A 3FHAA 5BROA 5I6SA 3D3AA 2HSAA 2OZ0A 2YZRA 2WBKA 3CUIA 4WR3A 4NEWA 1ZCCA 4ONVA 4JTFA 3VKJA 3JVAA 5AHMA 1W1B1 3KBVA 3UZWA 1JPMA 3BLLA 1WYIA 4GOAA 2IPWA 4HKPA 4YIWA 5EGRA 2TMDA 4ZBCA 1JG9A 2MANA 3G1XA 3RCYA 2YXXA 3UWUA 1NEYA 3SCNA 2J74A 1UZHA 1O94A 4HHHA 4JTKA 3WSUA 3KE0A 2WVTA 2X0SA 3C2YA 2Z7GA 4IJRA 3W7DA 2BNJA 3BURA 4A05A 1U1UA 3KL0A 3THQA 4AXNA 3RPDA 3F1QA 4L1GA 1MW0A 4MPQA 4DRSA 3WLKX 2VCCA 2X1UA 3ID7A 4GABA 2NX1A 4L56A 3QPZA 1D8WA 4MGGA 5BMXA 3UU0A 4NEVA 3LSCA 2GOKA 4QCFA 3GWQA 4IIGA 3MT1A 1JD9A 4XZ9A 4JIHA 2GFTA 2A1YA 3S4TA 1EBHA 5K9DA 1KM1A 3DH7A 1N60C 1J9YA 3PZMA 4LT9A 4WZHA 3MO7A 4B9ZA 2E5AA 1QI5A 2NXGA 2I5QA 1I2OA 1Q4WA 3B0VC 1W17A 2BSLA 4H41A 4PMOA 1DWHM 4PMZA 4Y9NA 4FF7A 2XSXA 2YKKA 4EWJA 3HA1A 3N6QA 3W0KA 4IISA 3P74A 3WJSA 4JN8A 3RIKA 2BXVA 2V3GA 4NAEB 4HN4A 1TUXA 1KBJA 4ENLA 3DKLA 4UFHA 1ZKQA 3E02A 4YLWA 1QASA 2OYKA 2YR1A 4FAMA 4O0KA 1MUCA 3HFYA 2ISSA 1QK2A 2JEPA 2YZ5A 3TJIA 1UC5A 1QO5A 4W85A 3UJEA 2DV0A 3MP3A 4PTWA 1R2RA 1WDDA 1GOXA 3A24A 2DGAA 3AYVA 1P7TB 4UIOA 4XIAA 4X61A 1QK0A 5HUPA 4HSOA 5BW6A 4PSRA 1UUQA 1SJBA 1SUXA 2QEZA 3AS0A 3HFTA 4O1FA 1UUOA 1DQXA 3LA4A 2PWDA 2UWFA 5DX7A 3T0CA 2P50A 2ALRA 4OFCA 3W7QA 1P6CA 2OELA 4IGHA 4IFKB 1OADA 4GFIA 4B3KA 5JBDA 4UTWC 3H70A 2W3ZA 1F4HA 1UQYA 1DJWA 2ZRUA 3NPUA 1A0DA 4JICA 3KFTA 4FOJA 1GOIA 2FJKA 1KR0A 2WCAA 2ZX8A 4XSMA 1V6TA 1XBYA 3U6WA 3M6YA 4RE3A 1H2JA 2NXIA 2XPKA 3NQAA 1P0DA 1GGOA 1V6WA 2FMOA 5LA0A 3O6CA 5AVHA 5LHEA 3EOEA 4DI9A 1DIOA 4JOMA 2C79A 1SZFA 3KOFA 4HZ6A 4DNMA 5A2BA 4GISA 4K1WA 1G5AA 2QPSA 3B06A 3MB9A 1K8YA 2EG8A 4Q4QA 2UY4A 4JYEA 3CBWA 1VR6A 3B0UX 2OQLA 4YYFA 3PZQA 1Q2RA 3CPGA 3FW6A 3F03K 4QEEA 4M56A 5G5GB 2WC7A 4DZAA 4RV3A 3PAJA 3M6DA 2O56A 3MV01 3NDYA 4UOJA 3WLOA 4W4QA 1XIEA 3TTSA 3QR0A 3GG1A 2J75A 1RSCA 4Z42C 4AZIA 3R58A 4S38A 3VMOA 4L6DA 2BVTA 3N17A 4GVIA 3WUBA 1YHTA 3O3RA 2Z2AA 3SSZA 3WYZA 4H3DA 4F2UA 1JULA 3QC3A 3LS9A 5A6JA 2Q6ZA 2PS2A 4H4XA 4OBRA 4ALDA 3T42A 4BHYA 3CHEA 1UR2A 5FS7A 3AIWA 1SJCA 4LRTA 4FI4A 1X39A 3QV8A 3S5OA 3W2NA 4LFYA 3L2MA 4OJYA 4GQQA 3U0HA 4KWSA 1IZJA 2VVSA 1MFVA 2YA0A 2ZWYA 4JQ1A 1QWGA 4AZ6A 1FVPA 3WK2A 4CNTA 4DXVA 1ZAHA 4MWAC 2FZMA 1XKYA 1G4PA 2E7FA 3RNDA 4LVDA 1TRDA 3T05A 3C4UA 1SZRA 1HJSA 3GY1A 3PNUA 1LLZA 4XG1A 2FJUB 3BAIA 2Q8XA 4S3BA 4LC8A 4S3KA 3NGJA 7TAAA 2H90A 3U8GA 4XUYA 4UUIA 4BKNA 2AQWA 2WV8A 1O7AA 3TYZA 1Q6RA 1HXJA 2GL5A 1IEVA 5MF5A 2BMBA 1CXFA 3M0HA 4BJHA 4EKJA 3VOCA 3RU8X 4HHMA 8A3HA 4B90A 4LVFA 4XZLX 3UA4A 4G7EA 5AHIA 1IIGA 1XH2A 2OYLA 2CXEA 2QAFA 4A3HA 1C93A 3CWOX 2J78A 2V5JA 5FD0A 3E2VA 2Y7FA 2E1DA 2PU1A 1QCWA 3QKEA 3VM5A 4J5NA 5LGZA 4KH2A 5G1YA 2E5DA 3TW7A 4DWDA 1H62A 4H6RA 3UPMA 4IIFA 4OWGA 4TO8A 3CNYA 4PUEA 4CD5A 1JXJA 3VE7A 1TJ1A 3WY1A 4PCPA 3E3HA 4GYJA 4V27A 3CV1A 3B9DA 1NOFA 1CPUA 4LB4A 1KXQA 2R1MA 1WE5A 1W6TA 4JXCA 3KZPA 3SRDA 1FCUA 4D1IA 4YTRA 3QJAA 2A5HA 2YBUA 3SADA 1R87A 4J35A 1DYSA 2PDBA 1VFFA 3UJSA 3W7EA 3O1NA 3FGCB 4X9YA 4HNNA 4TTUA 2PDPA 2PWGA 2I7GA 1R7AA 3PZGA 1EQPA 4Q4SA 3PM6A 4FIRA 5H2ZA 3HOJA 2OQHA 1BTMA 3L2IA 4DZ5A 1FWIC 2O7QA 2DIJA 1XV8A 2QJMA 4NZ5A 1KQYA 4AX6A 2V8ZA 2XIJA 2D3NA 3BCFA 1X8FA 1X96A 1H7XA 1LDCA 4KPRA 1Q6CA 3QZEA 3CZEA 3SCOA 3L0KA 1JZ7A 1FWFC 1OBAA 1E1CA 3W29A 1JF6A 3B8DA 1F05A 3OC4A 1K8ZA 5BWFA 4CQDA 1W3TA 1I2PA 1WKEA 1J4EA 4HOZA 4GPNA 5EMLA 4LX4A 1AMKA 1RP8A 4FNTA 3UFYA 2PDLA 4LIIA 2Z7KA 1MEIA 4KWWA 4QLLA 3GW3A 3HJZA 1LQ2A 3ALGA 2X41A 1V3IA 2P8BA 1E15A 4MLRA 4AZCB 5T9CE 1P43A 4MUZA 4P7QA 1S3TC 2DFAA 2QV4A 2RKXA 4HU8A 1GREA 4XAPA 1HKWA 2Z1SA 4L6OA 1P0BA 3D47A 3B8IA 4GFSA 4K7VA 4QJ3B 4QXIA 3EBVA 2WHJA 5G5IA 1AJZA 2NX3A 5I2UA 4HYVA 2JEQA 5LA2A 2QZRA 3IUHA 2OMAA 4I8DA 3UVIA 1HO4A 4Q8VA 4TVYA 1DJYA 2WW5A 2ONEA 1MFUA 2WOVA 2WWCA 3LXDA 4LAUA 3FCPA 2VKZG 1FBAA 3U4FA 3GVQA 1QI2A 4GJ1A 1RQHA 2YCJA 4E4PA 1P6WA 3F5LA 3T0TA 1E43A 4PBGA 3V1PA 4K8GA 4M6PA 2BDQA 1M3UA 2RABA 3Q6JA 3LU2A 2ZZ2A 2P88A 2WSYA 4J40A 4BQ2A 4R7OA 1P1XA 1O6IA 1V97A 2FTWA 3GTXA 3WX7A 1BXBA 1Y5VA 3UJFA 1ITQA 2HPIA 3BGGA 4L4OA 3GVRA 3S5YA 3GNXA 2EEXA 4FDCB 1ZUAX 3IAQA 1JIBA 4LF2A 2P53A 1NFGA 5LNUA 4A35A 2WPCA 5EFDA 2GUBA 3BL3A 4Z1BA 3KRBA 1Z8AA 3H2AA 4RPPA 3FX4A 3BXWA 1HJUA 3W27A 4R7WA 5FEWA 1RV8A 4Z1DA 1LCOA 4GVHA 1EJUC 1XD0A 1ZSXA 1HQTA 2FZ8A 2VGBA 1GQIA 4LEQA 2PTYA 4B5XA 4N6FA 3W75A 1QPRA 3FJNA 1Q6EA 1EKOA 1FCVA 4ZB5A 4GY7A 2ZA1A 3EANA 3A12A 4I9MA 2CERA 1LG2A 1ITXA 4MNJA 3IVUA 1J18A 5KEZA 1WDRA 4DVOA 3B97A 4IL2A 1BQGA 1A3XA 1YLVA 3N34A 4YVXA 1E51A 4E3TA 3DERA 3VIFA 3NYZA 5M3WA 2PDGA 4HYRA 2WB5A 4BI5A 3UY8A 4BZYA 5KTLA 4NXKA 3P6LA 3LXCA 1JUEA 4LAKA 4UWMA 3QOMA 1DHKA 1FCBA 3URQA 4M8UA 2R94A 2G5WA 4JIIX 3P14A 4OQVA 2CLEA 4YTUA 1O5RA 2NV2A 4M6QA 1T40A 4WSKA 3BW4A 3CQ0A 3W7RA 3BJFA 5FAJA 4HNOA 1R47A 3TVAA 3KCOA 4X2RA 4GZ7A 3THCA 1KW1A 2VC5A 1E0XA 3U7VA 3QZ6A 5FKYA 2A6NA 4K6AA 2Z1XA 1SO3A 1H60A 2WJZA 4P7OA 4JTTA 4NVTA 3VKCA 1EWEA 5I02A 3QV6A 3XIMA 1H11A 2YL8A 2D22A 1E4LA 1GOWA 1XLDA 3DKJA 1J5TA 3LRKA 1Q6QA 3SFWA 4UXDA 2V38A 1EO5A 3QTPA 3PTMA 1VS1A 5F2MA 2PU0A 4E3VA 2DVXA 1KD0A 4PMRA 2VGGA 1Y7VA 5LXEA 4GH3A 3QQ0A 1XYLA 3VIOA 4PBFA 1NWSA 4DM1A 1MXDA 1A0CA 2AGTA 2F7FA 1NWRA 1NHQA 2NLYA 1TZ9A 3MMTA 3G1SA 3F4NA 2I16A 2IXUA 3LLDA 4CVUA 4JEQA 2A85A 1EP2A 5KZ6A 4HZMA 5CZ0A 3W7PA 3EXSA 3TWBA 1KN0A 4RW3A 2D3LA 2HPMA 1CGVA 5HWJA 3T2QA 4LYKA 3T8QA 2V81A 5PTDA 1EDGA 2E40A 3HJEA 3LV5A 4MB3A 4LUJA 1SQ7A 4FR6A 4HA3A 4UTMA 1SSDA 2QF7A 3RLVA 3MHFA 2V9DA 3CUJA 4Q3MA 1R9YA 3L0GA 5IBXA 2XWEA 3R11A 5CG7A 1UKSA 2Y6ZA 2W0UA 2ZYFA 4B92A 3PFMA 3VM7A 3QH2A 3WQFA 1JZ4A 3W81A 1PDYA 2D73A 2RH9A 1J6PA 1X2HA 3V18A 1M6IA 2AKMA 1AQ0A 4GIAA 3AZTA 2C3CA 4MAZA 3NQ7A 4GUHA 1XW8A 2GK1B 1GOOA 2OJPA 1WBJA 2Y8UA 1N82A 2Q3OA 3W07A 4PUJA 3O0FA 4KEUA 3AU6A 3R0KA 3NGFA 3GXIA 1BZLA 3E74A 1MW2A 2EPMX 4TV6A 4QRNA 3K4AA 3MZNA 3EWBX 1E0UA 4H4YA 2CU0A 3AWNA 4F0KA 5I7GA 1UBSA 3WK1A 4H7ZA 5GPRA 4M5PA 1XLJA 4NUWA 3DXIA 5AZ1A 2GVJA 1JI2A 3CUFA 4LC6A 1UOKA 1PVNA 1KXTA 1W3IA 3ABOA 4ZO6A 1CB7B 2UBPC 1A53A 3SCPA 4GXWA 5DCBA 2IPFA 1DTNA 1XDMA 1RK5A 3ZQ9A 3A4AA 2DT2A 5F1VA 3NUKA 4EXBA 1VC4A 1HW6A 4QG6A 1YDNA 3PZVA 4H6KA 1Q2SA 5K9XA 1R6WA 1U22A 1V79A 4CN6A 4UFIA 2GQ3A 1JL8A 2ZRVA 2YCEA 1GVEA 3O0KA 4D8ZA 3CWNA 2YDQA 3EB4A 1DTUA 1K70A 1EA0A 1DWGM 4L80A 3MU7A 1V0LA 3TYAA 4ZOHB 3RR1A 2J47A 4QIUA 2A8XA 3B9AA 4H4UA 5I3GA 5C5YA 2V5LA 3T0AA 3HU7A 1VRDA 1KGUA 2QKFA 4CN1A 2GGHA 4H7CA 4R3UA 5MHBA 3TR9A 3EKGA 3YPIA 3M0YA 3H7RA 2ZQ0A 3M0VA 1BRLB 4FMVA 3H2OA 4LJ3A 4EQSA 1DWJM 5FF2A 1S2UA 4I90A 2AOSA 1J0JA 4WKFA 3LHZA 4AFYA 2OKTA 1MXGA 3BMVA 3OG2A 1OGBA 3WFAA 1O5QA 4MB4A 2FKPA 1KBLA 4REQB 4PTVA 3VOGA 2WM0A 3CH9A 1V02A 2CZ5A 4ZQMA 5IFTA 4GQBA 4WIWA 1K77A 3VNJA 1W2VA 1TV2A 2VDGA 3WMSA 1A47A 1MRQA 4U4MA 3PF3A 2W27A 2E5BA 2IMRA 3TTOA 3KOXA 1HFBA 1ZZMA 3UERA 1KFKA 2E25A 1XLIA 2ZVRA 1H1ZA 5BOOA 1TA3A 3PPCA 1FDYA 1US0A 5FMHA 3AS2A 4G7FA 5LNSA 2C1HA 3ES8A 3PPGA 3ZVHB 3K8MA 2E9LA 5REQA 1TV4A 4HCLA 1XQLA 4WHBA 4UOZA 2F8QA 2V82A 3WF3A 1UPPA 1IWPA 5FJRA 4QBXA 3PUGA 1X6LA 3BG3A 3WJZA 5D4YA 2IKJA 2J88A 1F9CA 1W31A 4JY9A 1JCJA 3BAJA 2OFJA 4RZ5A 3VNDA 1GZGA 1OG6A 4ZE4A 1XISA 3ARPA 4LV4A 2PWEA 1PKLA 1L6FA 3CL6A 3T0BA 4CKQA 4KCWA 4DHGA 4Z2GA 4RXGA 5H6HA 3FFSA 3OQEA 2E9MA 1R8LA 4G2DA 3PZOA 1BPLB 1GVIA 1SZGA 3WMCA 5IM51 3LN3A 4H9UA 4JFVA 4JTEA 1R85A 2DPEA 1SR0A 3AROA 5D9PA 3GR8A 1H6VA 1LUCB 3LPFA 1AD4A 1JDAA 3EA2A 2X09A 1KTCA 2DZVA 1Z48A 4WXYA 3U2ZA 4G9PA 4J57A 4DNHA 5KITA 1Z42A 1H0GA 1RPKA 1U30A 1OF6A 2NVKX 4HMDA 4DWSA 1XYCA 3BC9A 1UWAA 4K3ZA 5CSUA 2XFRA 5B7YA 2V5KA 4PCTA 4NNCA 1MYRA 3OODA 2Y70A 3CGEA 4H4WA 2W63A 4K2SA 3N2XA 1FP9A 4MNLA 1E55A 4J9JA 3A5VA 3N9SA 4HYWA 1G1YA 1VHNA 1LT7A 3TN5A 3A13A 1PX3A 3B8VA 4PRRA 3VGDA 4Q22A 4GI8A 5I00A 5BCAA 1EWDA 2R24A 2RUSA 5AC7A 3V75A 2QCMA 4D6HA 5CH9A 2VELA 1S2WA 4GBUA 2XDFA 4NZFA 4CU6A 1V03A 1Q1RA 1D9EA 2VCBA 4BEUA 1TMHA 3W7KA 1KFLA 1OGGA 3AXXA 3KVKA 3S2MA 4GY0A 1MUWA 4J3WA 4FX9A 1XX1A 1YDOA 2WZIA 4KCVA 2QIWA 1IZKA 3U2CA 4GKLA 3SRFA 2Q3RA 4ZCWA 2HK1A 2VC9A 3VZYA 2G4JA 1CTNA 3SCSA 1B9BA 1F7BA 3LB8A 1P7TA 3T4CA 4ZFCA 3E0IA 3D6NA 5XINA 3NDZA 3GSMA 3UG4A 3W88A 4HNCA 1F3XA 3URNA 3OLEA 1V0KA 1ITCA 2HBVA 1WP6A 3DAQA 3WQWA 3G18A 5JCNA 2VZOA 4EQXA 3LEPA 4D2JA 3PN8A 2YA2A 2FGLA 2WHLA 2C0HA 3TX9A 3FHQA 1TR9A 2BGQA 1YKWA 2A3BA 3M7WA 1IXPA 5DLCA 3W1AA 1JZ3A 3KVJA 2GDVA 3HGJA 1RY8A 1FKXA 3KDOA 2FGBA 4GYPC 3ZZ1A 1G6CA 4DI8A 1REQA 1M9HA 3T81A 3MQTA 3DOPA 3BH4A 5CC5A 4MYXA 2Z6IA 2BXZA 4XX6A 3SJ3A 4H4VA 1GPFA 3C61A 4HP5A 2PDWA 3AIEA 1CGTA 3W7GA 4GYFA 1ZU8A 2WCGA 3S2LA 2OVLA 1VZWA 5A8OA 1OABA 3L66A 3TA9A 1Y65A 3W7HA 1F6YA 3NQBA 4XWUA 3FXYA 4L4MA 4ZB0A 4FOUA 4I3GA 2ZOXA 2VRQA 1WDQA 5RUBA 1H7NA 2FPVA 4H4ZA 2RDUA 3VX0A 1DQWA 5ECUA 2QJGA 1HJXA 4JNMA 3B8WA 1NFPA 1JDCA 4U3CA 3B04A 3GDLA 4C6PA 1M7OA 3PTDA 2REQA 1QHZA 3QSTA 3DK4A 1FXPA 4Y8FA 2QXWA 3RLHA 1OG0A 4FNRA 3ZSTA 4ICNA 1KGXA 3GM8A 2DSVA 1OX5A 2IKHA 2R82A 2XSAA 1E71M 2FVMA 3H53A 1AG1O 4AXKA 1WZKA 3QMTA 4C6OA 3FA3A 3H6OA 3NPWA 3PUOA 2XVLA 1LM1A 3N04A 3OIXA 1NDAA 1TO3A 3VIGA 3IPWA 4JPGA 3IC9A 1QNVA 3A64A 3OHMB 1E9ZB 3F5JA 3SRKA 3PNZA 5A3HA 1CDGA 4AY1A 2ZFAA 2GQWA 4MNMA 2WMGA 2C14A 4FLOA 2OO6A 3KVLA 2VXNA 3OZPA 4Q8MA 4AIUA 3DH9A 1D3GA 5M17A 3AIRA 1LP6A 4JQ4A 5DO8A 4D72A 5JH1A 3LRMA 1LROA 2JF7A 1R9ZA 5JIPA 3DK9A 3U5UA 5EBUA 2E4TA 3P93A 4JR5A 1YQ2A 1E1FA 2J7DA 4QDWA 5A6MA 3MW7A 4PULA 1GRHA 1GETA 3H4GA 2PLCA 2AL2B 3LBOA 4G7EB 3MSYA 1QHPA 2OX4A 1RD6A 3G1DA 3ARXA 1UD4A 4WJ8A 1V51A 3LZ3A 3O6YX 3MJYA 1WYGA 2UZ9A 4QJ1A 1OFPA 1OCJA 3DG6A 5BXSA 5FS6A 4XAZA 2V5DA 1XIHA 2OSWA 4LRSA 3H7UA 1L6WA 4FXSA 6ALDA 4HPHA 2HQMA 2RJGA 3N12A 1XPYA 1FWAC 2Y2WA 3VCNA 3DGRA 2O7SA 3RCNA 1VJZA 2QT3A 2GGIA 3E0LA 1OQFA 1NF0A 5H8UA 2ACQA 1QOXA 3C0QA 3DG3A 5EL1A 2PE4A 2YCLB 3BZJA 5E0FA 4AEEA 2NUYA 1JDDA 1J2BA 2WNNA 1KV5A 3SCUA 2JIEA 2ZX7A 2GWGA 3CLMA 3RO8A 1ADOA 5CJ5A 5HJYA 4ACZA 1GV4A 4Q4OA 1F6PA 3AHYA 3T0DA 3KRZA 6CGTA 1FOBA 1BYAA 2CWNA 2VUNA 2I9UA 1E6SM 2XVKA 5DRIA 5JVLA 3F2BA 3TE9A 1XSJA 2G41A 5LYRA 1XUZA 2CZDA 3PVFA 2ISDA 4LU0A 4QSFA 2F9RA 2J9XA 2FQIA 1HL8A 3N1AA 4H1ZA 1N2VA 3VNYA 3PB0A 5CPLA 2Z1VA 3I68A 3C2VA 3W7LA 3PBWA 5T9BG 2WAGA 3SN0A 3N2OA 4RE0A 3POCA 2F38A 4ORMA 3WKZA 3UGRA 8RUCA 3MKCA 1XIFA 4M19A 5SWUA 1EGZA 4EMIA 2PDNA 3QHOA 3GXPA 4PB4A 3CV7A 4D6IA 3HRDC 4AIBA 1FH7A 3W6YA 1R3YA 4M51A 3MUIA 1H2IA 4FO4A 1WKFA 2PDIA 4ZEPA 1Z32X 1B54A 1F8WA 4JTGA 1JZ8A 5M5DA 5BNKA 5HPCA 4HK7A 2FPYA 1ZQ5A 3P0WA 4WGHA 1PIIA 3N29A 1AK5A 2BXYA 1MOKA 4PGLA 2B0MA 2GSJA 4XD4A 1OEPA 2OCZA 3OZYA 1PKYA 1X7IA 3SCVA 1BVZA 4LUTA 2PRHA 1AH4A 3LYEA 1DJHA 3IJ6A 2YYUA 1DL3A 1PX8A 3G1YA 4WDWA 5AZ0A 4MZYA 4EPBC 3L68A 2E28A 4I5UA 4BFAA 1EBDA 3GR7A 9RUBA 1GVSA 2A3AA 1HGWA 5FEZA 2IKIA 3KBSA 1QI4A 4ICCX 4PL1A 4KRZA 4LOCA 4NZ3A 2QCDB 3SN1A 5G4HC 3ZR4A 1CIUA 2VMFA 3BSHA 1QWKA 1BXNA 5AECA 2VFDA 3IIPA 1W1IE 3FJ4A 2X05A 3WDQA 1TYTA 3LUTA 5D9MA 1QNSA 4X60A 4H4PA 4FIQA 5D05A 2QCEA 3WF0A 3JU2A 1KKRA 1E6NA 1XF0A 3RITA 3GU1A 3ABXA 1TCMA 3D9XA 3S42A 4DBSA 1PZ2A 3QGAC 2QUMA 3AYRA 2YL5A 3WJXA 1FX6A 2WQDA 5AN7A 4NAFA 3NL2A 4EAMA 4LW7A 4CNPA 1PWLA 2PEVA 3STFA 2YGYA 2Z1BA 4N7QA 2RJHA 4UCFA 4GVFA 3O15A 2PLKA 4H83A 5HA7A 3M44A 4DUVA 2ZE3A 3FA4A 4KESA 1ZJBA 3LOTA 2ZE0A 1YXDA 4UB9A 1XLGA 3DX5A 3PG8A 2WVVA 4KEZA 4L1XA 1GTHA 2PDKA 3TJ4A 1GVRA 3IGSA 1YE6A 4S2BA 1H4PA 1OK6A 1B1YA 3FOKA 2FB3A 3KHJA 4FLSA 1UD8A 1BG9A 4HCDA 3PPFA 4RZBA 2Y63A 2ZTJA 3T8LA 3W2LA 3N4AA 1CGWA 4WJEA 1OVDA 2UY3A 3M0IA 1HUVA 5B80A 1EJVC 1Q8JA 3NL3A 3QMSA 3M9YA 3MANA 4Z1YA 4R88A 1FWDC 1RH9A 1ZCOA 3WLHA 2CHRA 4YMZA 1UP3A 5AC6A 4QE5A 1TPWA 1ZJIA 1ZMCA 2CLOA 1A5OC 3EF6A 3KP1A 4J3XA 1B3ZA 2V3AA 4KKXA 1O1ZA 2NW0A 3ZIZA 5I3KA 2YB1A 1I8JA 5A5WA 5FEXA 1DE6A 3CL7A 2DIKA 3LGEA 1LL6A 2WNZA 3UWEA 1VFTA 4L5ZA 4PEEA 3W7JA 3BQ5A 2GVGA 1W9VA 3AN1A 3CHCA 1ALDA 3DENA 3BG9A 4PRTA 1G7UA 4NZ1A 3EWDA 2Y7EA 5JCLA 4I6VA 2B7OA 4OUEA 3EPMA 1E4IA 1WX0A 3ATZA 4JFUA 2H8ZA 3WH8A 2A7RA 1E0TA 3KRUA 3WDIA 2NVAA 3UG8A 2ASHA 5CC3A 4MY8A 5U7SA 3OLDA 4DAIA 4GE8A 1POKA 3OG3A 4S3CA 3OEXA 1XBZA 2X7VA 4HU3A 3ARZA 3TSDA 3QBUA 3ZT5A 3W7IA 1RA5A 3EPOA 2NZLA 1FECA 1ME9A 1O4UA 3TCEA 3VFCA 2BY0A 4X9SA 4I9AA 1OC7A 1FP8A 1OZMA 1Q65A 1WKDA 5MKGA 2WNQA 5GQBA 2NUXA 3L5LA 5A2AA 3N6JA 1YADA 3FK4A 4PUNA 3NQVA 3TSBA 2C3DA 4IX0A 1G69A 2JFEX 3L23A 3QR1A 1UWUA 4JS3A 1XKJA 1SMAA 3UJ2A 1IR1A 4FB7A 1CLVA 5J8LA 3LQLA 1GZJA 3BE7A 1RLCL 3R0DA 4C90A 1W37A 1HO1A 1ODZA 1BVWA 3II4A 3IVSA 1XC4A 2PDQA 4H04A 5KZMA 1W5MA 2E6YA 2PDJA 4TV5A 2VEMA 2WZHA 3S5ZA 4CU7A 1JYWA 2DJLA 4ZTYA 2R1PA 3M0LA 2B81A 4C60A 2QJNA 3FY1A 3SECA 3G1FA 3T1GA 4DJFD 1ZB5A 4WCJA 1W5PA 4XTDA 1WDPA 4H9XA 4PSPA 1WQ5A 4M6UA 3UZ5A 2F61A 3EWUA 1VFHA 2YVFA 2FB2A 4OECA 4PMNA 1UJQA 1RVGA 3ZMRA 3EGJA 3LI0A 3RR4A 4A29A 1LJYA 1Q5MA 2WK2A 2NX9A 1ZDLA 1B57A 1UQZA 2GK1A 4HHPA 3UQNA 1Z69A 5JH2A 1RA0A 4K8HA 3TQPA 1N61C 2NVDA 1YW1A 1TKKA 2QMKA 2YAUA 1RBLA 3APGA 1JPDX 3ZLFA 5HR6A 2W55A 2A79A 3KDNA 2C8NA 1QNOA 3A7RA 2QYGA 3GTIA 4KWUA 3W1NA 3GQYA 1F4AA 2YA1A 1XPGA 1EO7A 5G1TA 4LANA 2X2GA 3CT7A 1RCOB 4C6KA 3S3GA 4XSLA 3ARVA 5U1OA 1UWSA 4GRSA 1H50A 2P10A 1NVMA 4IZGA 2NXHA 1TYPA 5IOBA 3W25A 4WOZA 1JQXA 4S39A 1ZENA 2OO0A 1LPFA 3MSRA 3P5ZA 2D2HA 3MWCA 2CKRA 1GHSA 3IUIA 4IQJA 2GJXB 2J7EA 3DFPA 2DZTA 5FS9A 2WMJA 3ARSA 4M7SA 1KM5A 2FZDA 3BTNA 1B3OA 2R91A 1PTGA 1NQ6A 1K6AA 1TPC1 4I9JA 2Z26A 1YTDA 3GKFA 3LHVA 4DO6A 3DFSA 4FXRA 1DVJA 2R1LA 4JFSA 4PUDA 3AALA 5KVIA 4FHAA 2PLJA 1DBTA 2W9MA 4HA0A 3WENA 2O4QA 3W6LA 3WN6A 1SZEA 3HQOA 4S3GA 4JBRA 3BW3A 2C18A 1VBHA 3BZGA 3NO1A 5HDRA 4E8GA 3MA8A 2VFIA 2Q8ZA 4AWUA 1NU5A 3SUWA 2EO7A 2ZUMA 3AISA 3A4WA 3BARA 3WEOA 3VVGA 3FIGA 3M4HA 2A4AA 1GOKA 3URHA 4C6MA 4LUSB 3VIHA 5E9XA 3GZAA 1BRLA 2G3IA 4O8AA 3BW2A 3RUBL 5A6SA 4ZZ9A 3DBNA 1OCBA 1TG7A 6XIMA 4HHLA 4HZ7A 1GUVA 5G5HB 4REQA 1RCQA 1SO6A 4JIRA 3M16A 1Z9AA 2PWFA 1UP0A 2YYTA 1TX0A 3KS5A 3VD3A 2IPJA 1LF1A 2PP3A 4O10A 5A8GA 1QW8A 2YDSA 2ATSA 1B9ZA 1YE4A 3W83A 1E56A 4GJIA 5L9FA 3LI1A 1VIWA 1PPIA 3ZM8A 5EU9A 4JX5A 4UNIA 2G3FA 4C6DA 3C0SA 2Z6JA 3UPWA 2X99A 4ERIA 2DIEA 5T26A 3S9YA 2JGQA 5D2TA 3GC4A 4LSBA 3SO7A 5DN1A 2WPGA 3QFBA 2HQAA 2Y5SA 3APTA 2EXOA 3M7SA 4P61A 1B3VA 1PIFA 4CCEA 1UWQA 1FWWA 4YWSA 4O54A 2XN1A 4B5NA 1YNYA 5CG0A 1E0WA 4JN7A 1MDLA 1U1JA 4O16A 1HTIA 1O95A 3TN3A 3E49A 4H8VA 4O11A 3NPXA 1UKOA 2QGYA 7A3HA 1P5BA 4DYJA 2WVSA 4Q4KA 2YW3A 3UNDA 3WLLA 1KM6A 3WD1A 1GJUA 3EA1A 4GX9A 4EPDC 4RJEA 3IRSA 3M5XA 2Z4GA 1TTQA 4AWEA 2GRTA 5EFFA 4UR8A 5ENLA 4IMDA 1GQLA 1TQJA 1FKWA 4Y7EA 3NO3A 2OT0A 1TJPA 3IJIA 3LCXA 3HV8A 3MI2A 1UJPA 4A22A 4PYSA 1PUDA 3DI1A 3II1A 1J2WA 5HATA 1H7WA 3UESA 3UA3A 4AC7C 2PBOA 2HMCA 2VDHA 1XIDA 1A80A 5FAGA 5HWNA 1BYCA 4NNBA 2YFOA 4K8EA 3W01A 1H63A 3NVZB 4PB5A 3GAYA 2GJLA 1TPDA 1GVYA 3B4YA 3NVYB 1JCLA 3HG2A 3AZSA 4MNKA 4W7UA 1JZ5A 1CW2A 3IK4A 2D0HA 3LHWA 4Y9MA 3WLSA 4R5EA 1JDEA 3WLPA 3Q37A 2Z28A 4N9CA 4HBKA 3MC5A 3R94A 1EX5A 5E93A 4JTUA 1GXFA 3S6OA 5DCEA 3S9ZA 3R43A 5CAKA 1YXCA 3M0JA 4E2OA 2VD8A 5CZJA 4QG8A 5G2HA 4LVGA 3W87A 3O2LA 3OVGA 3HG3A 1O5KA 1I0BA 4HOXA 3W7OA 2WMIB 1NF7A 2BVWA 2MUCA 4P8XA 2W62A 5D03A 3KM8A 4MLJA 3EMCA 3LX9A 3STCA 1EF3A 3V1HA 1OSEA 2BP1A 5IRPA 2Y5JA 3UD6A 1EH9A 4F2BA 2E5CA 3NO5A 2DEPA 3UVAA 1JAKA 3ITTA 1MZHA 4PMQA 2X1SA 2PDUA 3LRLA 2RAGA 2XFWA 3CO4A 4ATWA 1WB0A 2DDXA 2Y8VA 3LCGA 2ANUA 1S1PA 1XCFA 2VQTA 2JK6A 4AD1A 1BWVA 1K8XA 2WHMA 4H4SA 5BRQA 1K02A 4K37A 1YTKA 3WUFA 2Z0IA 3UY7A 3CV6A 3VAVA 4W5ZA 3WLMA 1LWHA 1RM6B 4JHMA 3WK3A 2V5BA 5H8PA 3PR2A 4IG2B 2EG6A 1A5AA 1TREA 3P3BA 4D6JA 1SGJA 2QUTA 4IJBA 1ZJHA 3T55A 3A7UA 1EGMA 3MPGA 5T8GA 4PA8A 3R10A 2BHUA 2QCGA 4C6IA 5C8BB 4DO4A 1BWLA 3DECA 3FKRA 4D6DA 5HNRA 3SCQA 3QPEA 2W6RA 4BS0A 4INFA 4YCPA 4DWSD 1TCDA 4W8BA 2QDGA 2D20A 4NJKA 1WDWA 1SJDA 3A23A 4JTJA 3EEGA 1C90A 1QDSA 3WG6A 3FVMA 3H2EA 3BSGA 2CZEA 4HTYA 2NVCA 1EC7A 5CGTA 3GU9A 4IMGA 1W8SA 3H24A 1AJ0A 3HMJG 3R6IA 1V59A 1GJWA 3WBXA 1OT2A 3ZJKA 1QW9A 4AEOA 2FZ9A 1WOBA 3IACA 2VJXA 2J8FA 1HL9A 2EPNA 1VP5A 1JD7A 2EPHA 4ZB2A 1RQBA 1V7AA 2ODOA 4XD6A 3QFWA 1K9FA 3TV8A 4OE7A 1QOPA 2YCKX 4J2PA 2BX7A 4TQTA 2YQUA 4Z2KA 1PAMA 3NXFA 3LPOA 1KRMA 2W3RA 3SQSA 1WOAA 3PHAA 3VCRA 4I5RA 3V5FA 2VZTA 3EWYA 3KRSA 5CPMA 5K3VA 3AHVA 3PJWA 3CUZA 4L6HA 2C16A 5C9UA 1DJGA 2EF9A 2ZXBA 4XZIA 3VNIA 1UMLA 2F6XA 3WD3A 5HANA 3ZYZA 1OD0A 4UOQA 1BWCA 1UH4A 1V02E 5DMYA 4KMQA 4UTTA 4IJCA 3TEVA 3OW1A 3AJ7A 4NZJA 3QVQA 1KV8A 3OVRA 3BDKA 2X40A 2H8XA 2XIMA 3BLIA 4R34A 1CB2A 1MO0A 4V15A 1TZ7A 3RRAA 4RUBA 4IM4A 2Y88A 4RX0A 1XINA 4PMUA 1DJXA 1JUBA 4F3HA 1WXJA 4FXJA 1Y0EA 4Q8PA 3ZWTA 3B9JB 1QNPA 4QLKA 4F40A 3LLFA 2B7NA 4TIMA 5AB3A 4JZ5A 2PDHA 4H2HA 3EDFA 2X50A 4O1BA 4IPLA 3CLWA 3CTTA 2PGRA 1UH3A 3NTYA 2XH2A 1BGGA 3W7MA 5FSEC 3KTCA 1QU4A 1SO5A 3TAKA 3QYSA 1ZLPA 3CASA 1LRNA 3TK7A 4IL0A 1F74A 2JALA 1XR2A 3BOFA 2YCLA 4DZIA 4UTIA 2CNCA 3R25A 2H3BA 3FNDA 3TH6A 2H9AA 1RUSA 2NT0A 3TUUA 4XKYB 2ZXDA 3CYVA 1M6JA 1YYAA 1OD8A 3SGGA 3HPXA 1YTEA 4MJMA 3BLEA 2HCVA 3IANA 2AQOA 3H23A 2ISVA 1X8CA 3H4KA 3DDMA 3RYSA 1JR1A 5LGXA 1TPEA 4EXAA 1C9WA 4MB5A 1VH7A 2R6OA 2HNEA 2CLFA 1W9BM 2ZRWA 3ZO9A 2NUWA 1Z44A 4ILSA 4J2MA 3ZFHA 4OTKA 5KZEA 4IX2A 3I7RA 4KW2A 3T2PA 1PYFA 4IMEA 3E9AA 3STGA 1GORA 4IF2A 4E8DA 1G0CA 4G8TA 4BQ3A 3QMRA 3LZ5A 4AHQA 1S2AA 2GGEA 2CESA 4JTHA 4L4PA 3M41A 4ADWA 1L8PA 4E4FA 4CQCA 4CNUA 2C15A 4ERGA 2A3CA 4DF0A 4C6BA 3NQCA 4ZO8A 3GNOA 2OGJA 4JHZA 1JROA 2WLZA 1RAKA 3GG7A 2C19A 3TJXA 3VGEA 3Q67A 4X0VA 2FGZA 1EJTC 4HSNA 2CLLA 2EGZA 4LWWA 3G1VA 4ATLA 2PLMA 4V2XA 1QPQA 2JGYA 2QCCA 2NWSA 1UD6A 4IUOA 4PUUA 4J28A 1FTXA 4NI8A 2CBIA 2CLKA 7TIMA 2YPIA 4R53A 3V4BA 5HOSA 2AGKA 4QSHA 4O0ZA 1HGYA 3L4WA 3TROA 1OC6A 3D5HA 5CPQA 4JQ3A 4XK2A 3MVIA 1E6QM 1LBLA 3ANVA 3UR8A 2POZA 3DG7A 1OFOA 2PP0A 3MO4A 3ETRB 2V68A 3LDVA 1XSIA 1AW5A 3UZJA 3NS1B 5H91A 4HPNA 4EF9A 2Y24A 5FA5A 1YNQA 3Q94A 4NYUA 2WSQA 3W28A 1UD2A 1MDRA 4MWAA 5JXQA 5A6LA 1EOKA 4PL2A 1JCTA 1R3SA 3IARA 6A3HA 4JIEA 3VA8A 4GXPA 1D8CA 4O13A 6TIMA 2VX5A 5EBAA 4W89A 4G6CA 2BLEA 3V0UA 3ZSSA 1EGVA 3AXKA 3L0NA 5E09A 1XBXA 3O07A 1MQQA 2I9EA 5EMJA 3O06A 4DJDC 1DIEA 1WAUA 3GTNA 2ZZ1A 1GKQA 2QF8A 4RCXA 4AD4A 4LV9A 2GR3A 1E3XA 1Q13A 2WMFA 2GYIA 3KVMA 1BSLA 4WSJA 1TWZA 3LCHA 2QJIA 1T8XA 2FH8A 1EHNA 3NZ1A 1C92A 3C5QA 3AJXA 3ISIX 4W88A 5HMDA 3NQGA 3DK8A 1HZYA 2DVTA 1DXFA 3SR6B 1AZ1A 1QNQA 5TIMA 3G22A 3SQMA 3WUGA 2INFA 2R9RA 4F66A 2GGGA 2VL4A 1DV7A 1QBBA 2XGZA 4ZQCA 1UR4A 1PZ3A 3SCTA 3W1RA 1J10A 2G95A 1UKQA 5IDIA 5BWAA 3T09A 3W53A 3GFZA 4NJJA 4ACYA 3RK8A 4A3RA 3JRKA 1NHPA 4OBSA 1TV5A 1UBPC 3G5EA 3H2FA 4YXGA 2FIQA 3D46A 3ITCA 3NVTA 2PTZA 2AAAA 2YW4A 4KS0A 2EQDA 2F6UA 4HMCA 2WBGA 4Q4PA 7CGTA 3QHMA 3U7BA 4I7UA 3GNDA 1OINA 4E2BA 4XZBA 1AH3A 2P0OA 2YDRA 3A3HA 2YIHA 3WBWA 3CAQA 4KFNA 1HJQA 3FAWA 3PJUA 2D1ZA 3SGUA 2XN0A 3HG5A 1M5WA 2QS8A 1T0OA 1K9DA 2EKCA 3VFLA 1XHCA 4FNPA 4RDWA 4GWEA 3PANA 2YB4A 3TN6A 2D2GA 1GPWA 3EWZA 5CPSA 5U25A 4KRTA 4B5TA 3FG2P 5AOUA 1NAL1 5AYYA 1RZMA 4OKDA 3M0XA 4HU4A 2XU2A 1VPYA 3BV7A 3P61A 4XTIA 4KGJA 3CGCA 3G1AA 1DIKA 4YN5A 1AUSL 3CB8A 3GDTA 1XLAA 2VZUA 2VZSA 3NZQA 4F8XA 4DLFA 4Q8TA 5HJLA 4F0HA 1T3QC 5CC6A 1JPKA 1R3RA 2X16A 3EEZA 3PK7A 2QCLA 3VKDA 4IIBA 4NJIA 2INZA 1YQZA 2PDXA 2RDTA 4H4IA 3DFTA 2NLIA 1YX1A 3CZLA 2ZXQA 3L4XA 1XD1A 4JGDA 3B9NA 1LLOA 3VO0A 3CEUA 3WLIA 2QJJA 4NHVA 2XISA 4W87A 4IMAA 3RDKA 3MSDA 3UR2A 2Y8KA 3GDKA 3KLKA 2VHLA 4Y9OA 3WQVA 5A2CA 2ESCA 4IMFA 1AL8A 3LY0A 5DY2A 4RPQA 2SFPA 3WF1A 4JYFA 3OVPA 2A3EA 2BZNA 4S1FA 3HN3A 3K2GA 1TTIA 1FCQA 2NT1A 3UYIA 3UCDA 2F5ZA 1JNDA 4AW7A 2QAPA 4WSHA 3GVWA 3N11A 3TP4A 4IFKA 5EYWA 1W9DM 4HT3A 4J1OA 3F7JA 2GH5A 1PTAA 4GD0A 3UR7A 1QTWA 4LUYA 1KA9F 4QS5A 1NWUA 4JKMA 1TPVA 2V63A 2W3SA 4WKHA 4H9ZA 3CIVA 2DUAA 4PRWA 5HWMA 3NPVA 2VP8A 3IV8A 2CZFA 3DN5A 1E4NA 3PZ9A 5FF3A 3VINA 2YLAA 1H51A 1Z41A 4N02A 4H7VA 2QNEA 2E68A 5JCIA 1ZPTA 1TIMA 3MP5A 2NSXA 3W1QA 1T96A 2WSPA 2VR4A 2VX6A 3N14A 2HS8A 2F6KA 3ANYA 1AMYA 4FXFA 5HINA 2A0NA 1B31A 4CUCA 2PP1A 3S47A 1Q6LA 1XP3A 4DNAA 5GNZA 3TTYA 1FH9A 4HU0A 4K39A 1ECQA 4GCAA 4JAWA 3GXFA 3GS6A 5CBJA 4UFJA 1XLCA 3K8LA 5CZSA 5EMUA 5C7HA 2FMNA 3KX6A 3GNPA 1NHSA 4GQ0A 2FYMA 3C3UA 2HV5A 4O4WA 3Q2DA 2XHYA 4QROA 2E6AA 1KXHA 4B2DD 4ZA0A 4BQ5A 1LQ0A 3WMBA 2WHKA 1UB3A 1WV2A 1BG4A 5GRTA 2ZRXA 3GH5A 3MCOA 3E12A 4UFLA 1YMYA 1NDYA 2VZVA 3DESA 3GIQA 3UGVA 1SVDA 3FKKA 3ARYA 3I4KA 1UPMB 2BASA 3VNKA 3SR7A 5D9OA 3PPHA 1D7FA 2YFNA 3SIMA 3CMFA 4LUSA 5BU9A 4AF0A 5LIYX 2YX0A 4LCRA 1EJXC 3RNMA 3HQ1A 1TWWA 1JEZA 4PTMA 1AJ2A 4TR9A 9XIMA 1EUAA 3GDBA 1B0IA 4MWAD 5HR7A 4M1RA 1NELA 2DY3A 8XIMA 2ZCGA 4GZJA 4M52A 2IQ0A 4IQEA 2OODA 3ATYA 4CQ8A 3H4XA 3DC8A 4FP1A 2X30A 3U9IA 4GNVA 5E9AA 1QVBA 1L6SA 3AIQA 4HK5A 3IVTA 1VD6A 3AIBA 3W84A 5IDZA 2KX9A 1TWIA 1PCWA 1S5NA 2PPGA 3LPGA 5CZKA 4W84A 4Z2IA 2OLAA 4JQ9A 2WMKA 3PUDA 5GJPA 3UWVA 1K4GA 4W5UA 1V3JA 2P3EA 2ZKMX 1E6PA 1TX2A 3OJGA 1YBQA 4ZOEA 3N19B 4PTDA 5JRBA 3H2NA 3U2EA 3IJQA 4U31A 3VZZA 4TTGA 3U2OA 1VAHA 1R3TA 1HNYA 2POTA 1IE7C 4PFMA 4KIRA 1JYNA 3CHVA 3NQEA 4WX2A 3U57A 4GLEA 1WCGA 3M5ZA 2VDIA 2W0HA 1PKNA 2HXTA 1PE1A 3ZWSA 3W00A 1K7FA 1JRCA 3F4DA 2XG9A 1LOQA 3SJNA 5FACA 3FGCA 4HA4A 5JBFA 3T08A 5DF0A 1XCXA 1AQHA 2ZX6A 4B5VA 2BOFX 1UZDA 1CWYA 3H12A 2DZBA 4K7YA 1NP0A 1ONRA 1LUCA 3GTFA 3CAKA 3TONA 1Z6KA 2GR0A 2OWWA 5C6MA 1X6NA 2EQ6A 4IXHA 4CVWA 4FALA 3LM7A 2ZA2A 2QW5A 4TXEA 2HBXA 1Y5WA 4GHRA 4KFPA 3H26A 2X8RA 3HPZA 1BTCA 1UR3M 1I0DA 4RK8A 3HGRA 2XVGA 4ZFMA 4R9OA 1PS9A 3GB6A 5KVHA 4F0LA 1ZGDA 4US6A 3VKBA 5GNYA 1QPKA 4ZGYA 2B7PA 1NDZA 1TYGA 5FSDC 5EMKA 4PCNA 2H6RA 4AZBA 4H8NA 4RLIA 3K46A 1A3HA 4C6EA 2Q02A 5G2IA 2E3ZA 3M0ZA 4JCLA 1DORA 1XLHA 3HPAA 4UQDA 1FWTA 4W7WA 2J25A 1EXBA 3W2MA 2HVNA 2Y85A 3OZMA 2CPUA 1H1NA 1CGUA 3M47A 2J7HA 4Y2WA 2FH6A 5GJNA 4US5D 1CLKA 3MV11 1CBGA 2ZDRA 4AG0A 1N8IA 3CQHA 3UWYA 1PO9A 4BI7A 2UY2A 2YDAA 3WLJA 2NQ5A 5IHSA 4AHOA 4MF4A 3NVWB 2HE8A 4B3LA 1NHRA 3CB3A 1ICSA 1FDJA 2GSEA 2YL6A 1Q7QA 2X1TA 1TPFA 4B5UA 4LYPA 3VGFA 1I6NA 1EJSC 2EG7A 2PZ0A 5CEWA 1V0NA 1W1PA 1PSCA 1QR7A 3WELA 2ICSA 3TKFA 3WD2A 1CXKA 3WFLA 1JYXA 3VPLA 1WZMA 2CLPA 1OX4A 3T07A 3BO9A 4S23A 1DHPA 2VR5A 5BU6A 1E70M 1VYPX 3W72A 3W70A 2P1FA 3VNMA 3QLDA 2W91A 4AIOA 5TF0A 4TVWA 3LV6A 3OZOA 3PWAA 5E6YA 3IWPA 3DC0A 3EX3A 2C0AA 1Q1WA 5HK4A 4C1NA 1TE6A 1X7FA 3R5EA 5LXXA 4MAVA 3NA8A 2WPFA 3LD5A 4ZR8A 1I2RA 2QDDA 2L5HA 1LL4A 5EKYA 4GQRA 2HNHA 3G1RA 4OUIA 3A9IA 1GRFA 1DXEA 3E0VA 2OG9A 5CZTA 3EXRA 2VFEA 4XBSA 1VBRA 1EZWA 4ZO7A 1VJIA 2VVNA 1IEQA 4Q8UA 1ZK7A 1ZAIA 4ADSA 2A2IA 5FJIA 3M46A 4C7FA 4DM2A 2DSUA 5KZDA 4GVGA 3FDGA 1R7OA 5CBIA 5JIWA 1PCKA 1WZLA 1OFDA 3W1LA 2XVPA 4PB3A 1WUFA 1VLWA 3MWAA 1AZ2A 2XJ7A 1WPCA 4GZIA 2DQWA 2HROA 2V2HA 3R4IA 1E4MM 2C3ZA 3WMLA 3SI9A 4LVBA 4AYSA 1US3A 5G1MA 3WLQA 2VYOA 3PB2A 4CD6A 1OIFA 3K1DA 4CN4A 2VTFA 4AD5A 2VO5A 1G4TA 3QN3A 2C13A 2HISA 4US5A 1TE1A 3ARUA 2D0FA 2WSRA 4PTXA 3BLPX 2LLEA 2QPUA 5FL1A 1XRSA 3MVTA 3A21A 4L61A 1RVKA 2B4GA 1NJJA 3VOHA 5A6BD 1XLKA 3U5YA 5A8MA 4UTHA 3MJMA 3SY1A 4LUIA 2OKOA 5A8QA 2Z27A 4XO6A 4UTKA 1A49A 1HIZA 1OIMA 4HK6A 1E1CB 3T2OA 3W24A 1C8XA 3PZUA 1GG1A 1TIWA 3AS1A 4LTSA 1JZ6A 4O0QA 3VTRA 2CXGA 2P76A 4QNEA 1L8NA 1XIMA 4OU1A 5LIWX 3DI0A 4IQDA 4XISA