3VDGA

Crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with formate and acetate
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
424
structure length
424
Chain Sequence
SMAHNRIRITGARVTPVAFADPPLLNTVGVHQPYALRAVIQLDTDAGLTGLGETYADTVHLERLQAAAHAIVGRSVFSTNVIRALISDALGGDRTGDGSGLAGMITSASVVDRVFSPFEVACLDVQGQVTGRPVSDLLGGAVRDAVPFSAYLFYKWAAHPGAEPDGWGAALDPDGIVAQARRMIDEYGFSAIKLKGGVFAPEEEMAAVEALRAAFPDHPLRLDPNAAWTPQTSVKVAAGLEGVLEYLEDPTPGLDGMAEVAAQAPMPLATNMCVVAFDQLPAAVAKNSVQVVLSDHHYWGGLQRSRLLAGICDTFGLGLSMHSNSHLGISLAAMVHLAAATPNLTYACDTHWPWRHEDVVAPGALNFCDGEVQVPATPGLGVEIDEDALAALHEQYLRCGIRDRDDTGYMRSIDPGFNASGPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glucarate dehydratase
publication title Crystal structure of enolase MSMEG_6132 FROM Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Lyase
total genus 142
structure length 424
sequence length 424
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vdgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vdgA01
2GDQA 3D47A 4F4RA 3CYJA 3T6CA 1ONEA 3RGTA 1BQGA 5FJPA 3JW7A 1PDZA 3GY1A 4K2SA 2QJNA 3SN1A 2PCEA 1FHVA 3PWIA 1TE6A 4ROPA 4JN8A 2P3ZA 3V5FA 3FCPA 3MZNA 4G8TA 3NXLA 2ONEA 2XGZA 4Z1YA 1EC9A 3BJSA 3OZMA 1ECQA 3UXLA 4MKSA 2HZGA 3ES7A 3DFYA 3GO2A 4JN7A 1KCZA 3DERA 3IJQA 4KWSA 1YEYA 2PGWA 3STPA 1E9IA 4KT2A 4GYPC 3ZLFA 3T9PA 3UJSA 2P8BA 1EC7A 4HNCA 2XH7A 3H8AA 2PU0A 1XS2A 3P93A 3OPSA 2MNRA 2OO6A 2XH4A 3RCYA 2PS2A 3RITA 2GL5A 3TCSA 1W6TA 2OZ8A 3CAWA 4GGBA 5ENLA 4DXKA 4JHMA 3TJIA 3P3BA 3UJ2A 2PP3A 1NU5A 3SN4A 2OQYA 3VC6A 2QDDA 4IL0A 5FJTA 3BOXA 4HN8A 3TW9A 3QTPA 3TJ4A 3DFHA 3H12A 2AKMA 2QJMA 4GGHA 4FI4A 2POZA 3UXKA 3CXOA 2I5QA 1KKRA 7ENLA 4GISA 3THUA 3R1ZA 3CB3A 3ENLA 4KEMA 1R0MA 1EBHA 3GD6A 3UGVA 3QLDA 3N6JA 4K1WA 3FXGA 3BSMA 3TWAA 5BOFA 4E8GA 2PP1A 2DW6A 1ELSA 4H83A 2XH2A 3ZVHA 3Q45A 3IJLA 3RO6A 2NQLA 4X2PA 4H19A 3PK7A 4DWDA 1L8PA 1XPYA 1BKHA 3R0UA 6ENLA 3NO1A 3TTEA 2OX4A 3R11A 3ES8A 3R0KA 2MUCA 1MDLA 1MUCA 2HXUA 4Z17A 3MKCA 1JPMA 2GGGA 2DW7A 4DYEA 3UJRA 2HXTA 1EC8A 4E5TA 2OKTA 5FJOA 4MMWA 3TOYA 3EKGA 2GGHA 1R6WA 2PGEA 3V3WA 2PA6A 3MQTA 3QKEA 2GGIA 3T8QA 3V5CA 2P88A 3UCDA 3FV9A 3IK4A 3DGBA 3JZUA 4MGGA 4DHGA 3R10A 3VCNA 3ZVHB 3I6TA 4KPLA 2OG9A 5EU9A 4ZCWA 1MDRA 4EWJA 3TQPA 3VFCA 1IYXA 1RVKA 3P0WA 4E6MA 4FP1A 1EBGA 3DG6A 4A3RA 3DIPA 1OEPA 3MUCA 1JPDX 4J3ZA 3CK5A 3R25A 4M6UA 3H70A 5BOEA 2XH0A 2GGJA 3HPFA 3S47A 3H7VA 4IZGA 3JVAA 3EEZA 2PU1A 2CHRA 3SSZA 4GIRA 2P8CA 3U4FA 3UCCA 3ZLHA 1P48A 3NFUA 3OTRA 3OP2A 3UJFA 2PP0A 3QPEA 3ZVIA 4GFIA 4HPNA 2QJJA 4H2HA 4IT1A 3I6EA 4HNLA 2O56A 4YWSA 1JCTA 2PPGA 2QVHA 2RDXA 3U9IA 1SJAA 4DN1A 4ZA0A 4M0XA 3VA8A 3DG3A 3VC5A 4GMEA 3GC2A 4IHCA 2OZ3A 2OVLA 2FYMA 3N4EA 3OW1A 3VDGA 1PDYA 3UJEA 3S5SA 2OZTA 3T4WA 3V4BA 1MNSA 4HCDA 1FHUA 4IL2A 4HYRA 5IDZA 3IJIA 1DTNA 2GGEA 2AKZA 1NELA 1TZZA 3MSYA 3N4FA 1P43A 2QQ6A 4G7FA 2GSHA 2OPJA 3RR1A 4DX3A 4A35A 2XSXA 2PMQA 2PTZA 2QDEA 3Q4DA 3SQSA 3I4KA 3OZYA 2QGYA 3RRAA 1KKOA 2OFJA 3ZLGA 1SJCA 2AL2A 4E4UA 4H1ZA 5FJRA 2P0IA 4A6GA 3K1GA 1TKKA 1MRAA 3DESA 3SN0A 5J04A 3FVDA 2ZADA 4IP4A 3N6HA 1SJDA 3NZGA 2OQHA 3PFRA 1KD0A 3VCCA 3DDMA 4J1OA 1SJBA 3SJNA 3B97A 3FYYA 2PSNA 4HCHA 2HNEA 3FJ4A 1F9CA 2PTXA 5FJUA 3SBFA 4E4FA 2FKPA 2AL1A 3MY9A 4IP5A 1WUEA 2PTWA 1WUFA 3KUMA 2AL2B 3TWBA 1JDFA 2PTYA 3PWGA 3DEQA 3MWCA 2OLAA 4ENLA 4HCLA 3DG7A 2PODA 3QN3A 4GYPA 4K8GA 3CT2A 3D46A 2ZC8A
chains in the Genus database with same CATH superfamily
4E3VA 1E70M 4MYXA 2A3AA 3W38A 3C3NA 1CW2A 3LPPA 1XICA 5D30A 3SQLA 1NIUA 3PN8A 4J2MA 4O52A 2ADAA 2A0NA 1DWFM 2OX1A 3WLQA 2BVWA 6XIMA 3CV2A 2A7PA 4DZAA 1VBJA 3OU8A 3GM8A 1V97A 4AIUA 1XYBA 3W70A 1EIXA 4Z1YA 4W8LA 1RQBA 1S2TA 2QCFA 4ATDA 1EB3A 4GQGA 1A5KC 3L2MA 3GAYA 1GTHA 2W27A 2D0FA 4O1FA 2VD9A 2PGWA 1QWKA 4Y2WA 3RIKA 4GA8A 4FSAA 4L5ZA 1MVYA 3RM9A 4PL2A 3UBPC 2Q8ZA 3ZLFA 4R7WA 4CQAA 5D2XA 8XIAA 2YKKA 4K6AA 5FKYA 3UWEA 1EXBA 4PE8A 5G4EA 3WD1A 5D33A 2F2HA 3RITA 1D3HA 1GHRA 2A6LA 3PSVA 4HA4A 4NX0A 1NY1A 3HIJA 3PTQA 3OQEA 4FEZA 2YDAA 4ZO7A 5D04C 2E1DA 3RXZA 3LYEA 2FHBA 2DZXA 1GYMA 1TPUA 1PV8A 3NZ1A 3F2CA 2J8GA 1GRTA 1O5KA 1VCFA 1VPXA 2Z7KA 1AQHA 1MXSA 3DXIA 1XYFA 2X41A 3A64A 3H12A 4IGMA 1JCYA 3WEZA 1EGMA 3KL3A 5CSYA 3IAPA 4Q6JA 5LGXA 3VNKA 3LHVA 5CAHA 5E70A 4AISA 3SCOA 1BTMA 2V2DA 5CAKA 2BLEA 4QDWA 3SIZA 4UTTC 2QJGA 4PMRA 3CUIA 1RPKA 4RZ5A 1X1NA 1YXCA 1QI4A 1BVWA 5M03A 1H7RA 3W02A 3WK3A 2CKRA 4PTNA 2F6UA 1TV7A 1Q63A 4WKAA 3B9EA 4NYUA 2IKIA 3B4YA 3S9ZA 1WZMA 1CI1A 1VR6A 2RJHA 2NV1A 2NT1A 4RDZA 2Z1XA 3MDWA 3IPWA 1FDYA 3I65A 1H5VA 2YW3A 3SCWA 3QBUA 4GPNA 5BXSA 1DP0A 2HXTA 2PDUA 4HP5A 2YLLA 1FH8A 3ABZA 2VEIA 2W4XA 4C5ZA 4INFA 4NJJA 4ZL1A 5CPOA 2YA2A 1VJZA 1UWRA 4I7VA 3ZMRA 4GG9A 4B9YA 4DZHA 4FXFA 4HU4A 1F74A 5HMSA 1PBGA 4IICA 2VENA 5TIMA 3QEZA 1NDAA 1KRMA 3R4IA 3KEHA 5F1UA 3T0DA 2OG9A 1A0CA 4NU7A 3OEXA 4WSJA 2YVGA 3PWAA 8A3HA 3C61A 3SY1A 2E6YA 3STFA 1UKQA 3ZQ9A 3UR2A 3HQPA 3RPDA 1Q1WA 3KLKA 5DQPA 2XINA 3CQ0A 2WZHA 5DBUA 3DECA 1GEHA 1T5AA 1QFEA 2J7FA 2B4GA 1FWWA 4W85A 4EMWA 2OSWA 1NWUA 4QQUA 2V8ZA 3FVMA 4WGXA 3IRDA 1AODA 3ARVA 3LV6A 1HG3A 4NKCA 3OVRA 2DVUA 1QNRA 4AWSA 3WBEA 3K1DA 2CNCA 1BKSA 4C6BA 4DO4A 3LB8A 1CPUA 3WLKX 2GQ8A 3M7SA 3RRXA 1TWIA 3IRSA 5HPOA 1RHCA 1EDGA 2HMCA 2PZ0A 1W1YA 1GOIA 1WP6A 4XAZA 3N9RA 5IBXA 1M9HA 5T9BG 3RCMA 3GIPA 3NL2A 4V28A 4X0NA 1Q6QA 2BV9A 2VI0A 4FB7A 5CPSA 1XDJA 4W93A 1CWYA 3UJEA 3LMZA 2Y63A 4KW2A 3M64A 2OZTA 2W91A 4X9SA 3WDIA 4GJIA 1MNSA 1W3HA 1PAMA 4H6QA 4GBUA 1DORA 2WM0A 3LCIA 4UZUA 4GI6A 2WYSA 2PDJA 4WQ6A 1UMLA 3EX3A 3VOIA 4NRSA 3CPUA 1GPFA 3RLHA 3KBVA 4J2PA 4QDPA 3EB4A 3TW6A 1SYTA 3BUVA 1ZB5A 3MTWA 2FMOA 3SI9A 5BXTA 1KXHA 3R8GA 2QAFA 4H1ZA 4H50A 3WYZA 1JG9A 1EQCA 2G3IA 4X2RA 3GX9A 4CLMA 3K1GA 1TKKA 4O1BA 3DESA 4M1BA 3ITYA 7A3HA 4LCRA 4PR4A 4F79A 1KGWA 5JXQA 3N2OA 4B5UA 2J7EA 3QMTA 1GV4A 2P50A 2D23A 1HJVA 1C91A 2QCLA 3TMLA 4B92A 3QYSA 1GUVA 5A95A 1FEBA 1E0UA 5D2YA 3LCGA 1UD5A 1DJIA 2VTFA 3DC0A 2VGIA 2NQHA 3N1AA 1AG1O 2DIKA 1ZBKA 1ISZA 2PTYA 3WLRA 3S1XA 1A0DA 2EPKX 2FZBA 4C6MA 5I6SA 4GNJA 1CGYA 4LFYA 1RK6A 1H2JA 3PUGA 4NNBA 1LL6A 5JCKA 4K8GA 1OFDA 3BOLA 2FFCA 5BNKA 4QXIA 1Q5MA 3KLLA 3GHRA 4XISA 2OTDA 4F8XA 2DIJA 1FKWA 2JKEA 3NRZB 3VNDA 4YTQA 1VCVA 3W23A 2JEPA 4YVVA 1LRTA 1PDZA 1SPQA 3H55A 3MA8A 2PLJA 1Z32X 2CU0A 4TVUA 4K37A 3RX4A 3TXZA 1JPHA 2OZ0A 4GWEA 3FCPA 3E96A 2WM1A 3M0KA 5AVNA 4ZQNA 1TUFA 3EB3A 3PAJA 2WW5A 4I5XA 4LALA 4N9CA 1LG1A 1KCZA 4WF7A 2DUAA 2HROA 3PZ9A 4RZ4A 1TELA 4H9YA 3OQ8A 2DORA 3D9XA 2W62A 2Z1VA 4UTKA 1VBHA 4HBKA 4KERA 5F2IA 3P93A 3OPSA 4AB4A 4W88A 5FEZA 4OOZA 1JCJA 5CZKA 3WLMA 4PCSA 2X2YA 3GZ3A 4ES4A 2E8ZA 1XLEA 5ENLA 4LS2A 1QPNA 3W01A 1J0YA 1CXKA 3VDCA 1VD6A 3AMCA 5AC6A 1K03A 3EX2A 1G9HA 2P0OA 1JPKA 1C8VA 1W91A 4LXFA 5C7VA 1LBLA 3FHAA 4XKYB 1V03A 4Q8WA 4HN8A 1LBFA 2E68A 4M19A 3IUDA 3IAQA 5HMEA 1KBKA 2JBMA 1A3WA 2PDGA 4ZOHB 1OFQA 3KTCA 2AAMA 2Z1SA 4U5IA 2BOFX 1R3WA 1K8YA 2I5QA 4Z0SA 5HANA 2CZ5A 4U3AA 1QO2A 4FIRA 4LCSA 3N29A 1R0MA 3BURA 4JAWA 4XAFA 3CWOX 5K9DA 3CMFA 4JXCA 2WKJA 4H9TA 4HA1A 2PC4A 1YPFA 4X3ZA 2AMXA 2R94A 1PHWA 4CUCA 1HJWA 5CJNA 4Y96A 4DWDA 2V6OA 3L66A 3KP0A 1FWTA 1GETA 3G24A 1P7TB 2I16A 1W17A 2WMIB 1GCYA 1JPMA 1NARA 2WB5A 3LCHA 2J3NA 1TRDA 1SZFA 1R6WA 1PE1A 1EWEA 3W72A 1R86A 3T0TA 2B81A 4M52A 3GH7A 4NIRA 4LC8A 2UY5A 1EJWC 4PMNA 1Q8JA 3ITCA 2VFHA 2QW5A 3W7DA 3DUGA 2Q01A 5JBFA 3KAOA 3R10A 1UZHA 3PNUA 3I6TA 1LROA 1UMYA 4PFMA 3ZR6A 1E5NA 1NM9A 2BVDA 1TE1A 4CQ9A 1F3TA 3F03K 5C70A 1IYXA 1RVKA 1NOWA 1VLWA 2DH3A 3A13A 4IIBA 5H8UA 3L4ZA 4V15A 1AQ0A 3HTWA 4EXBA 1ZP3A 2OB3A 3S42A 3HMCA 1ZJIA 1EUAA 4OHQA 4B90A 4CN1A 1QOQA 1XQLA 1W9DM 4EM3A 3O2LA 1S5TA 3QVQA 2J9ZA 1G4SA 4XZBA 3DFPA 4DNAA 3BLPX 2EPHA 4L1WA 4JBRA 4QR6A 1EX5A 4GIRA 2ZUVA 2QIIA 3U4FA 4LUJA 4N4QA 1EXPA 3SJ3A 4IISA 1N60C 3AJ7A 4WVXA 3W2NA 2R8WA 1QOPA 1JEHA 5E93A 3V0SA 3VKCA 3KOZA 4DUXA 2D73A 1JNEA 2O56A 4LB3A 5F2MA 4RW5A 3WUGA 4ERIA 1I45A 3LG3A 1OX6A 2VZOA 3AC0A 4ZTXA 4M0XA 1CENA 3BCDA 3VC5A 2CIPA 4IMGA 3ZSTA 4HJWA 2ODOA 2CBVA 3N4EA 3PG8A 2VFIA 4PEKA 4XZWA 1PZ1A 5AN7A 4FLOA 4HCDA 5LIWX 4NF7A 5C71A 2X8GA 2ISFA 2GGEA 4FLQA 1CT5A 2WPCA 1YKWA 2G5WA 4MPKA 4DI9A 3N14A 1KV8A 4ICNA 3QKZA 4QAIA 2CEQA 4H6RA 5DRIA 1I2OA 3BW4A 4WCJA 5F7UA 3GVRA 1FA2A 2PTZA 3Q4DA 3SUWA 4GO8A 4ADSA 3MI6A 2JGYA 1L2UA 5L9FA 1LYXA 1SJCA 4Q3MA 1ZMDA 4O53A 2NT0A 3P6LA 3SN0A 2V3BA 3FAXA 3XINA 3STCA 1BWKA 2X1UA 2ZUWA 4BI5A 5HWNA 2O9OA 1MSSA 1AL8A 2OLHA 5G5HB 5LNVA 4OE7A 1QATA 3W73A 4AD0A 3VTRA 2DQWA 4PMXA 1CYGA 1LOSA 7PTDA 2FPVA 2P5NA 3LHWA 3KBNA 2HNEA 3V35A 1VC4A 4AIEA 1F9CA 2EPLX 4QSFA 3NSMA 3L0KA 4JIQA 1SFTA 5KVHA 5BMWA 3MSGA 4B3LA 3RG6A 3UXAA 3MT1A 1V6XA 1A5NC 3MVTA 4Z2HA 3SSJA 3MU7A 3MWCA 3NL6A 2Q3OA 1Q8AA 1RZMA 4F40A 4XIAA 3BAKA 1DXLA 4CU8A 3FEMA 4ZFMA 3CHVA 3M43A 3RFAA 4GXPA 1QI5A 1U1JA 4AVFA 2LLEA 3CYJA 3PTKA 1GZ1A 1HKJA 1EP1A 3RGTA 2PDLA 4MVAA 4IQJA 1WXYA 4N9EA 3VVGA 4NG3A 1U83A 3AYVA 1TJ1A 3AIWA 1T0OA 3GG1A 4AUBA 5HINA 4QEHA 3LGDA 4A3YA 4GRTA 5K9CA 2V3AA 3TROA 4HOZA 2J79A 4XB3A 3B04A 4KQNA 4XAYA 4WY0F 7TAAA 3PZNA 3DFYA 1J0JA 2WOQA 1L6WA 4AC7C 3NAVA 3U5UA 1BHGA 3THCA 3G6LA 3KL5A 2Y0FA 3L7RA 1UR4A 2FB2A 3HPXA 3UG3A 1LZOA 2GFTA 2OU4A 4NQ1A 2I9UA 4TVDA 1QW8A 1R2RA 1BSIA 1W9BM 4E8DA 1RJQA 2XGIA 3M0IA 1XANA 3CB8A 4PTWA 1Z6KA 5DMLA 2WC4A 4PMYA 4DXKA 3UYCA 4JYDA 1FWCC 3TTOA 1XLGA 1VBGA 2PAJA 2YOCA 1I2QA 5EFFA 3R07C 2ALRA 1US0A 3GNOA 3ANVA 3TW7A 4AQLA 1LPFA 3ATZA 3PBGA 1UR9A 1FXPA 2C18A 3CAKA 1SVDA 3TC7A 2WP5A 3WQOA 5MKGA 2WHMA 4GXWA 3PANA 1IIGA 1R2TA 4AVOA 4ADUA 2POZA 4L9YA 1V0NA 2ZZ1A 4M29A 4U3CA 1OFAA 2QCHA 5JH2A 2W66A 1LT8A 2YL8A 2PB1A 4OKDA 1TPWA 2VZUA 1PZ2A 1F05A 2QV4A 3GZAA 3UGVA 4QX4A 4EPBC 3BMWA 4ZOAA 4LV9A 3NQGA 5BOFA 1WOBA 4IP7A 5E09A 1JD7A 1W1TA 4MIMA 3UR5A 3QY6A 4LEQA 5EBKA 3ZT5A 1BYCA 2GK1A 3UVIA 1NOUA 2ZFAA 2YBVA 3UNDA 3GNRA 5U4NA 6ENLA 3GD4A 3EOUA 4DBEA 1GQLA 5FOOA 4BQ4A 3FX4A 2ZRZA 4AHPA 1CXHA 3CIVA 4Z17A 4GH3A 3WF3A 1MWOA 4NYYA 1ZXIC 1QDSA 1EC8A 5TD4A 5CJ5A 3UY8A 3M9YA 1EFZA 2XVKA 5A1AA 3AZSA 1E0WA 4XZHA 2W5FA 4F2TA 3SM0A 2WMHA 1JCLA 3GFXA 4GX9A 3G1YA 3CAQA 3M6YA 3HF3A 4GRSA 4B5NA 4NJGA 1KRBC 3W7HA 4YCOA 1TA3A 1K1DA 4LSBA 4H4YA 3NQAA 5K2ZA 2WQDA 3H22A 3TQKA 1QI0A 1B30A 4WUIA 1WAUA 1EBGA 4JTHA 3SO7A 4AZCB 1R9XA 1X96A 3UQNA 3MSDA 3EWZA 2W61A 3K4AA 1KWKA 1O1HA 2ESCA 2HRWA 2OJPA 2NQZA 1Z42A 2PU1A 1FWEC 3GU2A 4H9XA 2C71A 3GRIA 4MDPA 3S5NA 3VM5A 3O6YX 5DF0A 1OG0A 3BMVA 4GIAA 4TUFA 6TAAA 4GUIA 3QHNA 2RUSA 3PHAA 2CITA 1RY0A 2OXNA 1RA0A 4HPNA 1SR0A 5BWAA 6REQA 3C2YA 4LF2A 4W89A 3COTA 1IZJA 3MV11 5MHBA 2R82A 4KWOA 2Z29A 5LA2A 4MB5A 3M0ZA 4Y8FA 2NXGA 2VDHA 4AZGA 2D2JA 2V5CA 4PODA 1SJAA 1RSCA 1PX8A 3WBXA 3DHUA 4CNSA 4REQA 3PBUA 3TFXA 2OZ3A 2GYIA 1K8ZA 5EYWA 3VDGA 4Q4PA 3NPUA 3W85A 3EKLA 3PZTA 2PDBA 2NVAA 3EWCA 1FWHC 4AEOA 4HVXA 1QBBA 3II1A 3BAJA 3H7UA 4RNJA 1WKYA 1NELA 1KO0A 3UWYA 4IFRA 1OYCA 4MLRA 5D05A 4DJDC 1WDSA 3D3AA 3R0DA 2XVLA 1H1NA 3CIXA 2W0UA 1QVBA 3CNYA 5REQA 4UCFA 1XCWA 4JHZA 3CWNA 4C1NA 3VIMA 3I4KA 2EGZA 3ZWTA 1IF2A 3KBMA 1J5SA 1RVGA 3OGRA 1R7AA 2Z2AA 3DYOA 3IUHA 1R3VA 3G1AA 3R8RA 2D22A 1W54A 4GYJA 2VMFA 1W3JA 1D7FA 3GTFA 3R89A 1KLZA 1LLWA 1WDRA 3QR1A 3ARTA 4IP4A 4HN4A 1A4MA 4G5DA 1ZENA 1Y8BA 1XGDA 4KFNA 4PMZA 1R3SA 4J1OA 2V3DA 4I3GA 3O16A 1JYXA 3SJNA 2NVKX 2HK1A 4EPEC 1GSNA 3H2AA 3W7MA 3A23A 3FJ4A 1UPPA 1CX9A 4GZIA 4UOQA 1FRBA 4UOZA 4M24A 4E4FA 2DQXA 9RUBA 1QNVA 2X05A 3W76A 3N34A 2XIJA 3QFEA 5LNRA 4UTFA 4Q7NA 4JX4A 1MEIA 4IX2A 2AL2B 3AO0A 1PKYA 4BS0A 4YVXA 3CGTA 1UD6A 3E38A 2E25A 5EA9A 2ZZBA 5FSEC 5HBFA 3CT7A 1QPQA 1JQXA 2KX9A 3FY1A 1Q2RA 4C91A 3TQVA 3RCNA 4FDCB 1JJKA 4FXJA 3WLIA 3CM4A 3GTXA 1J96A 5EGRA 5AB3A 2MANA 3T44A 4HSHA 4ZQOA 3T6CA 4MJ4A 3T0BA 1ME7A 1E9ZB 4AZ7A 4NNAA 4IGSA 2RH9A 5AOUA 1EJXC 4E2VA 5JBEA 4JY8A 3O07A 1BYBA 1SZNA 2FLIA 4S3BA 1UWQA 2Y7EA 1DEDA 4LS0A 4JEJA 2NUWA 4FNRA 1F61A 1HGYA 3NL3A 4E2DA 1Q6EA 1XLFA 1EC9A 3HGJA 1WKEA 1ECQA 1OBAA 2H8ZA 2ZZ5A 1IEVA 4R7JA 2YIHA 4PEEA 3WBYA 1T8XA 1NH6A 1GVFA 2VURA 2GJXA 2VC6A 4RR4A 1KFBA 1QPOA 4GYFA 4TIMA 2FGZA 4HHLA 2F61A 1XPGA 5FF4A 3KRSA 2C13A 2XVPA 3C8NA 5HNRA 4L61A 2QUNA 3LXCA 4LNCA 3K2GA 4AHQA 3QPZA 2QZRA 5D9PA 4U10A 4Z08A 2ZXAA 3USZA 2BGQA 2RABA 5CQ1A 1Q6LA 4ZXLA 1V0KA 1J01A 1A49A 5HULA 2EAWA 4V1XA 4MDOA 2BZNA 3IIOA 3MP5A 4JKLA 4LUSA 4LYKA 4ML9A 1XLLA 4FLRA 1NHPA 1ZY9A 4GGHA 3W7OA 4NAFA 4DNHA 2CWXA 4HK6A 1EKOA 3FG2P 4O8RA 4TU1A 1J5TA 2WK2A 4HD5A 1XL9A 3XISA 3M0VA 1LORA 3WFAA 3MVIA 4X9YA 4JN6A 4H9MA 4YIWA 2ATSA 1XH1A 2XG9A 4D8ZA 1F3PA 1FWGC 1D7YA 2OOGA 3QLDA 5GJNA 3O0HA 4IFOA 3BSMA 1JZ2A 5JCIA 3LXDA 3NL5A 1OFPA 2EPNA 1RLDA 1H0GA 2PDNA 3P61A 3HB9A 4H4VA 1V93A 1FDJA 2YAUA 3HPAA 1VYRA 1FKXA 2PGFA 4H8UA 2RDUA 2ZA2A 4XTIA 4BF5A 3AHZA 3R94A 3OODA 3BW3A 2X8RA 2Z1KA 1D8WA 1M04A 1E4MM 5EB8A 3AMKA 3VNYA 4HMCA 1XW8A 2OKTA 4GI4A 2TSYA 3V3WA 1SW0A 2PA6A 4LEFA 3W1NA 2VR5A 1ZALA 3VX0A 1WXZA 2GVYA 3CYVA 3RJYA 3OA5A 3ZVHB 3UGRA 3AYSA 3WNOA 3L8KA 3SUVA 1WKFA 1MDRA 4ZENA 3MO4A 3THQA 1EJRC 4W84A 4ZGYA 3WQGA 1DXIA 3NNTA 2VEMA 3A24A 4F3HA 1VS1A 2JQXA 3GHTA 1QNPA 2EEXA 1BYDA 1FFVC 4EF8A 3DIPA 2VC9A 3NOYA 8RUCA 1ONRA 2ZX8A 5A8GA 1OY0A 4PTXA 5A69A 1TUXA 4JTCA 4HZ8A 5FL0A 3NTYA 3EOLA 1Z41A 4RE2A 5F4WA 4JL2A 4IZGA 3VGGA 4O57A 3IV3A 3FLUA 3NJ3A 2VT0A 4P7QA 4CEXC 1OABA 4LYQA 5DY3A 1I8JA 4J3UA 4QFUA 2BXZA 1GYNA 1OCBA 4FOKA 2DH2A 1HJSA 4F0SA 5HQMA 3SZ8A 1OGSA 2Z0IA 5FIPA 4H2HA 4QE1A 5LXEA 4IXXA 4ORIA 4AWUA 4H4XA 1QRQA 2YX0A 5HR6A 3L0GA 3DFSA 4WR3A 4K7VA 3WJXA 2FZMA 3GXDA 1TCDA 1ZS2A 4GCXA 1PKLA 2CKSA 2PRMA 2Z27A 4ADTA 3ZJ8A 3W4RA 3WMBA 2VX5A 4JFVA 5HJLA 3KCJA 2F6XA 4IHCA 3OW1A 2JEQA 4DUVA 1W31A 3O0KA 4DJFC 2I5GA 5CBJA 2FZ8A 4O10A 4P8VA 3N2XA 1FHDA 1A0EA 2HVMA 2XSBA 4H4ZA 1EHAA 1K9DA 2BASA 4Y6GA 4P2VA 1RPXA 3QC3A 2O7QA 2HV5A 4X61A 1H51A 4UB9A 3ME3A 1RP9A 3VGEA 5FA5A 3H2NA 4FHAA 3MJYA 2CZDA 4LJ3A 4S3EA 4UMAA 3IGUA 1W9XA 1OQFA 4O1CA 5AZ0A 1XGEA 5BU6A 2FB3A 3LI1A 4NEWA 4GUFA 2J7GA 3A4AA 3HQ1A 1WDDA 3W7CA 1Q7MA 5D9NA 5C5YA 2ZZ3A 3CASA 1P0EA 4JQ4A 2E6AA 3QQ0A 2VRQA 1AD1A 4ICMA 3LNMA 4XAPA 2UY2A 1OC6A 3VZYA 2QT3A 5DX7A 1HP5A 3NOEA 4H00A 1WDWA 1XIGA 2YCJA 4UTWC 3B97A 4WKFA 4LVFA 4PULA 1DJWA 2WXDM 4X63A 3FJNA 2E09A 4UTUA 4PMJA 2VC5A 3AMZA 1K9EA 4M51A 1M3UA 3SUSA 4F0KA 3VZXA 2BHUA 1R8LA 3WBAA 2DUXA 1V3IA 2PDWA 4RDVA 1K7EA 2X09A 3T08A 2J9XA 3PWGA 4GUGA 1XD1A 2JE8A 3ZS4A 4AEFA 2PBOA 3APGA 4JICA 2PDQA 3KS6A 1RP8A 3DG7A 2PODA 4A8LA 2VX4A 1XBZA 4O4WA 2J8FA 1DIOA 4QQ3A 2VNCA 4GJJA 4IGNA 4WDUA 1KR1A 1ZX9A 3FK4A 1TJ0A 3VU2A 1LP6A 3BAWA 4N7QA 1KQYA 1OB0A 3JW7A 3KOXA 3GYEA 3VABA 1TTJA 1UW9A 1POKA 4JKKA 5A6JA 3E1F1 1O4UA 3SCTA 4M5PA 1M03A 2NLIA 3RJXA 5D2WA 1V0MA 2QAEA 2JKAA 2VVNA 1BPLB 2INEA 1GESA 5LNSA 5AHNA 4UFJA 3KFTA 2HZGA 2PD9A 5A3HA 3SY8A 1STZA 2A21A 3GB6A 1DJZA 4KWSA 5KZDA 2HS6A 3B0XA 2J13A 5B7ZA 2ABAA 2G3JA 3LHTA 2DP3A 4W7UA 5A8PA 1H4PA 4REQB 4H3DA 1JQVA 4HNCA 1XIBA 1N63C 1TREA 3AUJA 1MMFA 3T1GA 1QJWA 4LBUA 2MNRA 4Y9PA 3LZ5A 4LW7A 3VGHA 5AC7A 4ALDA 3DHPA 4MAVA 3ZIZA 5IFPA 1K8CA 1R2SA 1W6TA 2OZ8A 3ZT7A 3T2PA 4KGLA 4LAZA 3A9BA 1FWJC 1N5WC 4ACZA 3R12A 3AZTA 4DYJA 3WBWA 2YYUA 1P6WA 4DJDD 1YQZA 4GR1A 4J9JA 3SR6B 5REQB 1M7OA 4C1KA 1H6VA 3QHMA 4WJ8A 4I7UA 3II4A 4G9PA 5EBUA 4MY8A 3WQFA 2YDRA 1E0TA 4ZBCA 2XYLA 4LOCA 1ODUA 2QHAA 5XIAA 1HO4A 4OFCA 1SW7A 1WAWA 4XIMA 1SGJA 3I7SA 1K4HA 3ENLA 3ARYA 3NQ7A 3BPWA 1W5QA 4XO7A 1DJNA 3LM7A 3U57A 4PBFA 3L5LA 3P8IA 1GZGA 3TAOA 3O0FA 1OF8A 3OZOA 3S2JA 3NCOA 1DWJM 3A12A 2QUVA 3PZMA 4H04A 2XVGA 4YTUA 3L4WA 2Y24A 3Q65A 2C0AA 3VOHA 5CLWA 3MKCA 2DSKA 4H6EA 4OECA 4IIDA 1IXQA 4NI8A 4ZO8A 1WBJA 2NSOA 4KBXA 4C6DA 4NJIA 2PGEA 2ZUNA 1C93A 3GXMA 3ATYA 2ZOXA 2C16A 4EAYA 3T8QA 2ZRYA 3L68A 3R6IA 5KZ6A 3NZPA 4XUYA 9XIMA 2QPSA 3E0WA 5AYZA 4P5UA 2XSAA 2VDGA 1ZAJA 1YTDA 3B9NA 2X1TA 1OK6A 3AROA 4DO6A 1PKMA 1U2YA 3AWOA 2BHYA 1LWIA 4S1FA 4KCVA 3CH9A 3LRKA 5CSUA 1ZBWA 4H2CA 4YYFA 3DG6A 5I24A 1PB0A 2YCIX 3LBMA 4J40A 3TP4A 3VMOA 3HJZA 3CK5A 3R25A 1W3LA 3VNLA 5HQEA 1JXJA 2GVLA 4CNUA 3HPFA 3DBPA 2GJXB 2QMJA 2CPUA 2P8CA 3T42A 4YHEA 1U5JA 2J4GA 4OTKA 4H9UA 2POTA 3NQMA 3FYPA 3WK0A 4HPGA 1CZ1A 2QR6A 1EJ7L 4Q8MA 5EY5A 5AHLA 3EDEA 1KTBA 4GI9A 4JGDA 4TR9A 4D1JA 1BWCA 3V75A 3ARRA 3VO0A 4HNLA 3MCOA 1Y5WA 3ZR4A 3T40A 5CC7A 3NQ2A 4JD4A 5JRBA 3S5ZA 2QLYA 3B40A 2X0SA 3C56A 4KIRA 3GTNA 5I3FA 2ZZ2A 2VWTA 4N2YA 3TC3A 2TYSA 3AMGA 3AHYA 4NAFB 5CZSA 1OCQA 7XIMA 1XG3A 4KFOA 1FHUA 3R43A 3IJIA 1J10A 5K9XA 2ZICA 1R3QA 5AHFA 1WKDA 4JX6A 3VKBA 3HM7A 4AMAA 4DIAA 4DX3A 4AD5A 1JZ8A 3MHGA 3KTXA 1KBBA 1KFWA 4JIRA 3SQSA 4JDBA 3Q2DA 1JULA 4DF2A 1ADOA 1AW1A 2CHOA 3B0YA 3PPFA 2V67A 3T05A 5DELA 2OEJA 3VDHA 2E0PA 5JIWA 1YNPA 1MQQA 2Y61A 5I3JA 1NDZA 3A7UA 4L80A 3NDYA 1KWGA 4LUTA 2HWGA 5GJPA 4DLMA 5EKYA 6A3HA 4AYSA 4B4HA 4HK7A 5I07A 3KXQA 4KRZA 2DGAA 3TFCA 1KD0A 3VCCA 5LA1A 3KLJA 2WO5A 4ZOBA 1O5XA 4LRSA 1UHVA 1UBPC 4R34A 4TX8A 1B9ZA 1O12A 3E12A 1LLOA 3Q94A 4FXSA 3TNBA 3BG9A 1TVPA 3NYZA 1XWYA 1LCOA 1TIMA 1SMAA 1VIZA 5I3HA 3WJYA 3WJSA 2R24A 1ZRQA 5HMFA 4U28A 3TWBA 3UEQA 4CD8A 5ER0A 4JTLA 1Q65A 4PUKA 5LHFA 1GREA 2W3SA 4C60A 3QN3A 3N2CA 2VL4A 4HB7A 3W1MA 2INFA 4U33A 3LOTA 3ARSA 2YLAA 1XHGA 2G41A 1V3MA 1TYGA 1I0DA 2GDVA 3ANUA 3M16A 2ZX5A 2V30A 1ONEA 3CLMA 1FH9A 2V5JA 3M0MA 3OLDA 1FWDC 1SUXA 1IWBA 1Q6OA 4M1RA 2VCBA 5LKYA 3ITGA 4NXKA 3NEHA 3PBWA 5EFDA 5AZ1A 3M0JA 3W6MA 3T78A 4ROPA 2FQIA 1H7WA 4JN8A 1ISWA 4R9OA 1ISXA 1G1YA 4A8IA 1TFVA 2NQ5A 1UOZA 1PIFA 4O15A 3NQFA 1DL3A 1YE4A 4S3FA 4UTHA 4AFYA 4TVYA 4H4IA 3ES7A 3DERA 5FS9A 4UFKA 3W7QA 3EF6A 1PTGA 2V63A 3W29A 4MY9A 1DKWA 3C0JA 4TX6A 3TSMA 5A2CA 1A5OC 3FW6A 4JTSA 1HX0A 3LHYA 2V68A 3L0NA 3N18A 3GDMA 5I77A 1HKVA 3NVYB 4H7CA 1US2A 1ZBVA 2HSAA 3WNNA 3KOFA 2XH4A 4LPCA 4DO5A 5DXXA 2CERA 4DJFD 5M5DA 4JQ2A 2F38A 4Q6XA 1E6RA 4E2OA 5C9XA 5D2TA 3GLCA 4ATWA 4UQDA 3ANYA 4DF1A 3OIXA 2WHJA 1TYTA 3MP3A 3W1AA 4UFLA 2ACUA 4O12A 3CUFA 3S83A 4L4OA 2YDQA 4Z1DA 1Z7AA 1XX1A 2PDCA 1A5BA 3K8LA 2WHKA 1CXIA 2FGLA 4N9BA 3C2EA 4GXMA 4XTDA 3QTPA 9XIAA 4HNNA 2X7WA 3EWDA 1FWRA 4RNIA 3F4WA 3BAIA 3MHFA 3V0UA 1V6TA 3TH6A 4EWND 1KGXA 3CUGA 3CXOA 3TAKA 4CQBA 1MO9A 4B5TA 3ARXA 2WLYA 4EP8C 3GU1A 1CLXA 4AZBA 3SCQA 4MADA 3U7VA 3QV6A 4KEMA 3BQ6A 3F4CA 4ZODA 3WG6A 3P5ZA 5FEWA 2Y85A 4QG6A 3FXGA 3GG8A 2YQUA 3KCOA 3TWAA 4A21A 4TOQA 2OELA 1ADDA 2Y89A 4QIUA 1WZAA 1JCNA 3FA3A 3IJLA 4D8AA 2D2HA 4OOUA 4AY8A 5FESA 2HS8A 2FIQA 2AAQA 3EOEA 3G1XA 4J5NA 4P7RA 1WCGA 2IMRA 3EDFA 1KRCC 3O06A 3QHOA 5J5RA 4MLJA 3EA3A 2HXUA 3LM3A 1QHOA 5JIPA 1JRCA 3AIBA 5ABTA 3TOYA 4KGJA 1QAPA 1ZLPA 1LJYA 3SRDA 4UTWA 3DJJA 1T96A 3MQTA 3GXIA 4IFKA 2Z26A 3BG3A 3LRMA 2CC0A 3RU6A 3WMLA 3AS3A 3R58A 1UQYA 3BC9A 3OGVA 3SCNA 1HL2A 4MNMA 3LD5A 3BWWA 3FJ6A 2IKGA 3NPWA 4Z1CA 1VAHA 1JRPA 3WUBA 3NVVB 4MZ1A 1ITUA 4ZOCA 3WLHA 2KZHA 2ISWA 3A22A 4IXHA 1ODZA 1U22A 2ISSA 1AK5A 3OBKA 4E6MA 3UW6A 4GQRA 1W2VA 4D2JA 3S5OA 4BQ5A 4YTTA 3AIVA 1GOXA 2DVTA 1KFCA 2R9RA 1TIWA 5CPNA 3AYTA 4YMZA 3S47A 2J66A 1N61C 3VIKA 2ZWYA 4CN4A 1UR2A 4XD6A 2J75A 1DJGA 4H8NA 4L65A 4W8BA 5U25A 1JD9A 2DJLA 3LERA 3NVZB 1OFEA 3USBA 3NXFA 3L12A 4Q4QA 1QK0A 2XFFA 1D9EA 3UJFA 3QPEA 2Q8XA 4GACA 4LVAA 7TIMA 4CU7A 4NAEA 2ZC1A 2Y6ZA 2WBKA 3EX6A 3ARZA 3AJXA 1IEQA 4OU1A 4Z2JA 4PBEA 3AICA 5D02A 2WPGA 3LQLA 1ZBCA 4MWAD 2Y7GA 1OFRA 5L6UA 3I3BA 4BR1A 4GVIA 3URBA 2GSEA 3B06A 2XIQA 4GQQA 3C86A 4O16A 2DSVA 4H8VA 1K4GA 2PWEA 4ZE4A 4MM1A 1TWDA 4H6KA 1EBDA 1K4QA 5BU9A 1X8FA 3V16A 2E28A 5EMYA 2YXGA 4JTDA 3GIQA 4MWAA 4LANA 3MW7A 4JKMA 4MJZA 3S5YA 1GOWA 1C8QA 1NHQA 1QNOA 1LWHA 3B8DA 1SZEA 1F3XA 1H63A 4J3XA 3RR1A 2PWUA 4TTGA 3B4UA 5U1OA 1JI1A 4GQ0A 2DVXA 4FAMA 1UWTA 2XFYA 3CUXA 4QJ5B 4UFIA 1O7AA 2DZTA 2XHYA 3I4EA 4E4UA 1M5WA 3D6NA 4WDWA 4AIOA 3C8FA 1JUBA 1XLCA 4CN6A 1K7XA 3LHUA 1QHZA 3BGJA 3S2MA 4PN2A 3O7UA 1BF2A 2J47A 5AKQA 4AF0A 2A79A 2L5HA 3AIEA 4CD4A 4WXYA 2RGLA 1ZL1A 2H90A 2J6XA 1ONWA 3VNJA 2CLLA 1KXTA 4H7VA 3NSNA 4QJ4B 4WY0A 2FKPA 4PCNA 1VFSA 3LGEA 2Z28A 3HGOA 3OHMB 3VAVA 2A5HA 2CETA 4WJXA 3PPHA 4UXDA 2C3CA 3DEQA 3VGFA 5A6BD 1EUNA 1UR0A 2AQVA 5D8ZA 3C2VA 1T99A 1NHRA 4KRUA 4YHGA 2V82A 2OWXA 3EA2A 2ZC8A 1CB2A 2J9YA 3AHXA 3QGAC 3UXIA 2TMDA 2EKCA 2WBGA 4AD4A 1XP3A 4NL1A 1XRTA 3AS0A 1M65A 1LVLA 1Z89A 4V27A 1CGTA 3BJTA 3OHIA 1DQWA 2HTMA 3SQMA 1CXLA 1BVNP 4XSMA 3EDDA 3POCA 1D8CA 1S2AA 1M6IA 5TR3A 4FMVA 1G0CA 5A2AA 1GOQA 2WOVA 4MKSA 1IE7C 1S2WA 3GO2A 2PDKA 1IGSA 4ERAA 3NVDA 4PB5A 2OODA 4IG2A 1B54A 3O6CA 3F4DA 1UJPA 4HZ7A 1N5XA 4LCQA 4GD0A 4PYSA 2D2GA 3EOOA 3M44A 3TMQA 2FZDA 2HDJA 1J4EA 2DSZA 1F7BA 3P8JA 1L6GA 2EO7A 2H6RA 1HVQA 1NF0A 3T0CA 5LA0A 2GL5A 3VXGA 1XDLA 3WK1A 4AHOA 5M3WA 4JCMA 3H24A 4Q4KA 5FF3A 1FOBA 5A6AA 1B3ZA 2PLKA 3RPTA 2CLHA 4Z0JA 1FECA 3RNDA 2ASHA 3WNLA 8CGTA 1VJSA 2YXOA 4MAZA 4BEQA 1I4NA 2WSQA 2D3LA 3N9SA 5E0FA 4UQEA 3GUWA 2ZXBA 4AG0A 2WPBA 1J93A 2EJ1A 3TZFA 3W1UA 3GUGA 3TNOA 2O4MA 1XH2A 4EE9A 1R7OA 1W1ZA 1JNDA 4AC1X 1QASA 1A5UA 3WX7A 4BF9A 2DDXA 5A6TC 3S9YA 1FCUA 1EGVA 4ZQPA 2REQA 2WVVA 2IPJA 2BC1A 4M7SA 1YRRA 3CB3A 3G0SA 1VIWA 2R1NA 4IMFA 3RNMA 1WA3A 4N42A 2GVJA 3UP8A 3FNDA 5HJYA 1QNQA 4K1WA 1S7MA 3WQ5A 2PP1A 2GUBA 1FVPA 4H4QA 1T8QA 3Q6JA 3UZ5A 3LLXA 1WDQA 1U1HA 1TVLA 3EPNA 3WD0A 1DJQA 3EANA 1LTDA 3OBEA 4RPPA 2VFFA 3NO1A 3SDOA 1EO5A 4CCDA 3R0KA 2MUCA 2WZEA 1MDLA 5IXEA 1M6JA 5A8NA 1W37A 1GNXA 5K7JA 4CNTA 4JFWA 4E5TA 5FJJA 3W1PA 4HU8A 3C0LA 3EUB3 3OO2A 1F6YA 1AJ0A 3LNPA 5FAJA 3SRHA 3EDJA 2J77A 4GI8A 3DGBA 4YPJA 1XBYA 4JNYA 3TA6A 5LYRA 5AVHA 1AH0A 4ML4A 4YLWA 1ICSA 4DJEA 1JZ3A 1XBVA 2OGYA 2V5BA 3CTLA 3I7QA 4IPPA 3IIPA 4XZLX 3DKJA 1E55A 3TVAA 4IWWA 1X98A 2O92A 3MMWA 5C8BB 3VOGA 1XFBA 2FZNA 1HJXA 3VX1A 2P3EA 3QZEA 4UR8A 3BL3A 1JPDX 4QG8A 4BKNA 1PSCA 1MXGA 2A7NA 3L67A 5BOOA 1FBAA 1ZP4A 3GS6A 1XLMA 2AMGA 2VGBA 3MCMA 3CL7A 3QGVA 4DRSA 2JALA 2XH0A 2GGJA 3AALA 1JFHA 3JU2A 4TMCA 1GRBA 1RBOB 4FOJA 1K77A 1BQCA 2A3BA 1HKMA 1ZY8A 4KCUA 1GW9A 1EF3A 3UCCA 1TJPA 1T3QC 1KW1A 1UASA 4C6LA 3RMEA 2OQLA 4JTFA 2E3TA 3LMYA 4JTIA 2Y7DA 2OWWA 1MOKA 5I2UA 3WD4A 4XAGA 1ZJHA 4MB3A 1E1CA 2BFGA 2A3HA 3QW3A 3SCUA 4JFSA 1O1ZA 3L2LA 4KS0A 1JCTA 3PNZA 3WL1A 2Y2WA 1BG4A 1E0VA 1IT8A 4C5YA 2V9DA 4EX4A 3EKZA 1H7NA 2QCCA 2E3ZA 2ISDA 1WOAA 4CU6A 3W71A 3T8LA 3MV01 2GVGA 1UH2A 2FYMA 4CCEA 4WKHA 1PWLA 3IVUA 2WNWA 1S2CA 1JCXA 1V6UA 4JIHA 3MSYA 2G4JA 4GUJA 2EJAA 3AYRA 4FXRA 4OJYA 1I60A 3KW3A 3L4VA 4OZOA 3BLOA 3INPA 1Y7VA 4JCLA 3MBFA 3LADA 1UKPA 2EBNA 1XLAA 2Z1BA 4DBUA 3OVGA 1YQ2A 3ZLGA 1RBAA 3E0IA 3U8GA 2GOKA 1QK2A 1NHSA 4G56A 4K68A 5A8OA 4V2XA 2X50A 1TPB1 1PIGA 5AFDA 3WJZA 5KINA 1CGWA 4NNCA 4ONVA 4FR6A 4LQ1A 2F84A 4FF5A 2WP6A 5B7YA 1OADA 3VKJA 2V3GA 1EPVA 3DHDA 1ZZMA 3URHA 3KZSA 4PMVA 1B57A 4FNPA 2PDYA 1OVDA 5LSMA 4NI3A 3OOQA 4KETA 4KCWA 4AY1A 3KCLA 1E40A 2C8NA 4GY1A 2VGFA 3R8HA 1AOGA 4K3ZA 1KBLA 2VZVA 3O05A 2O9PA 3P2VA 1L6SA 1HO1A 1GKQA 5DT7A 3RLGA 4J56A 5DRCA 1BXBA 1ZDLA 1J6PA 4ORMA 1JDFA 3LLFA 1TQJA 2JIWA 4ENLA 3CZGA 1YTKA 3MUY1 4JTKA 3WKZA 1F3EA 1B9BA 3WLPA 3LCXA 2DIEA 1HW6A 1SO3A 1GVEA 2GDQA 5D09A 2HE8A 5DANA 3U48A 1FWIC 3GH4A 3OYXA 1EJSC 2VHLA 3NM3A 2V3EA 4B2DA 3FKKA 4G1NA 3NPVA 3PZUA 3HGRA 3SN1A 3U2EA 3H2OA 1IXNA 1PS9A 3BVJA 4XD4A 4MKNA 4BFAA 3W25A 5FEPA 2JK6A 4NAEB 1FUYA 1R5YA 3V5FA 3QMRA 3WQVA 3NXLA 3W1XA 1T7LA 3QTGA 3GFZA 1E6NA 1KCLA 3GBDA 3C2FA 1A5CA 3I7RA 2TPSA 5J8LA 1AMKA 1EOKA 2YB4A 4Q4SA 2X8CA 3ICJA 1OGGA 3TSBA 3RLVA 1X6LA 4O13A 2Y62A 4IX0A 1Z48A 1AUSL 3VE9A 3MB9A 2PU0A 2PEVA 3I68A 2EF9A 3KE0A 4MWAB 3JR2A 2QJHA 3NDZA 3EYPA 2IQTA 3ECQA 2H9AB 3DGHA 2DY3A 4UC5A 3C6CA 2OWCA 1SO6A 1VFHA 1KM6A 3VD4A 2Y8UA 4ILSA 2GJPA 2XN2A 3A5VA 2PP3A 1GQIA 4IUGA 3SN4A 1Z9AA 1ZPTA 1ICQA 5H6HA 4ZTYA 3VCRA 3UWVA 1S5NA 2ZBTA 4UQAA 4B3ZA 3E9AA 5AC5A 3BGGA 3BOXA 1RAKA 5FCZA 4HPHA 1S1RA 3QPYA 2OYKA 2IPGA 1MW2A 3EX4A 3LK6A 4Z2GA 4AMCA 1PTAA 5IM51 2EKGA 2PD5A 1LQAA 1V51A 1JEZA 1H1YA 5LZLA 4DBSA 3WJWA 5GNXA 1A47A 3WQCA 1JDEA 1Z69A 4AF0B 3BICA 3GD6A 4PUUA 4L6DA 3GTIA 4GOAA 4KKXA 1IXPA 1PZ3A 2PTDA 4M56A 1ECEA 4DPPA 5A5WA 4U2YA 3HG5A 4WY0B 2R14A 1MQRA 2GWGA 1BKHA 4D6DA 4HNTA 1AVAA 3GFYA 5JVLA 3CUHA 3S1VA 4I6VA 2BGNE 1B4KA 3PF3A 4DYEA 2C6QA 4GLEA 1ICPA 3OYZA 1O94A 1MO0A 1NDYA 1I2PA 1VDVA 3GYCA 2QCEA 4D6IA 2GGIA 1UKSA 5CGTA 1E71M 4UUIA 4GX8A 1AFSA 3IJ7A 3MHUA 5CJMA 1UROA 3YPIA 3VCNA 5FL1A 4PTVA 1B0IA 2ZIDA 4PCPA 5EMJA 1BYAA 2AAAA 3QW4B 4EWJA 3KVJA 2I5IA 2J7BA 4AZ5A 4JIEA 2GR0A 3E2SA 3L5MA 1NFPA 4YWIA 4Y90A 4KF1A 4A8RA 3TU9A 1LL4A 2H8XA 1DXFA 5DMMA 1QOXA 4J3ZA 3V36A 1J2WA 3EPMA 2XISA 3BG5A 2V81A 3OLGA 1KFEA 2XM1A 5AYBA 1KFJA 1JZ7A 4Y8EA 1GQNA 3MC5A 4CQDA 3S4TA 3S6DA 3JVAA 3GVVA 3CGCA 3LN3A 4AZ6A 4MWAE 4PSPA 2GQWA 6PTDA 4LTSA 3GC4A 4PCFA 2WLZA 2R6OA 5DLCA 1TR1A 4TMBA 4HA3A 3D5HA 3OP2A 2PP0A 5AHIA 3DCPA 1V6WA 3THDA 1SW3A 3G1VA 3GKFA 2FPYA 5CH9A 4RV8A 1JZ6A 1PYMA 4ADWA 2ZQ0A 3NURA 1JZ4A 2WZMA 4DUOA 3VI2A 1C3FA 2VZSA 3IGHX 3GDKA 3VOJA 4KFPA 1O66A 3T2QA 1UIPA 1TTPA 2FPTA 1RK5A 4LX4A 3T4WA 1Q1RA 3FEQA 3G6MA 3QOKA 1RALA 2REQB 2WVVB 4IL2A 1RXOB 3SGUA 2CHNA 1GKPA 1VGAA 3A7AA 2D24A 3AIUA 5ECUA 1GVOA 2NX3A 1TV2A 1YHTA 3P67A 4JL1A 3UZJA 2ZZ0A 4LGXA 3STGA 2F8QA 4RJEA 2I17A 1E3XA 2VFDA 3VDBA 5C9WA 2OFJA 4UTIA 2PUZA 1W3TA 1Z3NA 2OLSA 1AA1B 4QLJA 3Q67A 2WSPA 3KOYA 3GDTA 2BY3A 1V59A 1OCJA 4EANA 3VNIA 5D2VA 2PRLA 3MO7A 2Y70A 4BJHA 4R7OA 1C90A 2QS8A 3PFRA 3WUEA 3E02A 3UR8A 3FKRA 5LNUA 2F5ZA 1JFXA 3D0CA 2J24A 3GG7A 1Q4WA 4RLIA 4DZIA 5FSDC 1XV8A 4HA0A 3PB0A 3GXNA 4PFHA 4IP5A 1WUFA 3IACA 1I2NA 3KWXA 1KV5A 4AY7A 3V5OA 2ABBA 3IIXA 9CGTA 2QCDA 3B3DA 4P8UA 1Y5VA 1VH7A 4RV3A 2AGKA 1MFUA 4GYPA 1P6CA 2E5DA 4UTLA 4GVHA 3P84A 5EBAA 4MY1A 4LRTA 1XIDA 3W86A 3W84A 3WD2A 4L9ZA 4FX9A 3SB0A 1P0KA 5FJPA 2G97A 4HT3A 2BY0A 2C79A 2Y5JA 2G3MA 1EH9A 2DT1A 1XYAA 2XZ7A 4S2BA 5H8MA 1XLKA 3QV9A 5AC8A 2P3ZA 2V6AA 3AQUA 4A2RA 4RKAA 1E1CB 3EMQA 3E5PA 3IS4A 2XWDA 1N55A 1QT1A 1R9ZA 1P6BA 1Z44A 1ZQ5A 2VCCA 3M46A 3VGBA 3DYPA 2ZXQA 4F0LA 3KZPA 1BAGA 2HBVA 1FX6A 3WFLA 3RM4A 2YL5A 1CBGA 1Q66A 3T2OA 2R91A 2HE5A 3CEPA 4W8AA 2P8BA 3G0XA 3DJGX 4NJKA 4LYRA 1CGUA 3W7KA 4H7ZA 1OD8A 3KHJA 2WWCA 1PTDA 2OKOA 2CZFA 2Y5SA 1CDGA 4Q8OA 1UG6A 1ML1A 3VUPA 3EWWA 1HFBA 3TR9A 4O28A 4E3TA 4Q4MA 2JK2A 3VD5A 3V1HA 4LAKA 4NX5A 3SECA 1CGVA 1NU5A 2EQ9A 4KEZA 1OM0A 4S38A 2BSLA 4URIA 3MPGA 3B05A 1H2IA 3H53A 1ZJAA 2NX1A 4FI4A 5TQLA 4QGCA 3B9OA 4P7LA 2A2IA 1TR9A 1HNYA 2D2OA 1PVNA 2WV8A 4AWEA 1GRFA 2BMBA 1V3KA 1W8SA 3WQ4A 2CLOA 3PB2A 2VZTA 3S6TA 1YDOA 2C19A 2GLKA 1SO5A 1KGUA 3NQ8A 5BWFA 3C52A 1XD0A 2D0HA 2IPFA 1UCWA 2YA0A 3A47A 3GNNA 4W7VA 4Y9MA 2VP8A 3PK7A 4MUPA 4BF7A 3L9CA 3R0UA 2EQ8A 2F2KA 2BY2A 4NVTA 4D71A 1WQ5A 2R1MA 4XBJA 3WF0A 4DM2A 1GKRA 3SW6A 5D03A 5IRPA 3G8RA 3W7EA 3QKEA 4H4UA 4I9TA 1XLIA 3EWUA 1UQZA 4D8LA 2Q71A 1SMDA 3ORWA 1SB3B 5T26A 1N8FA 3FV9A 2NPXA 1X7FA 3ZR5A 1GJWA 3H2FA 4F9DA 5XIMA 5FJIA 1X97A 2GQAA 4ZCWA 3QM3A 1FFQA 3IVTA 3WF1A 2NQ9A 2OCZA 4I7WA 3TJLA 3W6YA 3A21A 1T41A 1L9WA 3H2CA 3GTHA 3LB0A 4DAFA 1ZCCA 3HURA 1TSIA 4NRRA 4O0QA 3W7NA 4E38A 1HF6A 1C7TA 4O0KA 2ICSA 3CUJA 3RAOA 4EAMA 3LCFA 3WLSA 3BLLA 3FN9A 3H70A 1JRBA 3IGXA 4RDYA 5LIXX 4BY3A 4JDRA 1CXEA 3OG3A 1G7VA 4DWSC 1R85A 5I3KA 1UWIA 4NP7A 3FSTA 2VFEA 4F2BA 2YCEA 1JUKA 2W92A 5JCMA 3CHEA 1TV3A 3FFSA 3C2OA 3U7BA 4IIEA 5E9AA 4F0HA 2ZX9A 1EJUC 1EDTA 4IT1A 1REQA 2QKFA 5AYYA 1FH7A 1ME9A 3BLDA 3PTMA 3CL8A 1U30A 1WX0A 1XCFA 2ACQA 3MDUA 3HGSA 2CLPA 4DN1A 1RV8A 4YL2A 1YNQA 3B0VC 3B8SA 4UQ9A 2Q09A 3PBMA 5CBIA 3UG8A 1ZGDA 3OIHA 3CHFA 5I79A 4B5WA 1IR1A 3AZRA 4CNOA 5A94A 2DFAA 1WO2A 3FOKA 3GVQA 3WN6A 4TV6A 1BSLA 3PS7A 3NGFA 1TCMA 1RD6A 3CQHA 4CD6A 4DAIA 3H2MA 5C6MA 1P43A 3DKLA 3H54A 1DWHM 5G1YA 4FX6M 2OPJA 2DSUA 4LYPA 1NSJA 1UR3M 3PZIA 4ZMGA 4F2UA 3KRUA 1YIXA 4GY0A 1QTWA 1FQ0A 3WDRA 1R3RA 5IHRA 3BLKA 1HJUA 3W2MA 3BV4A 4NT0A 2A7RA 4B5XA 4JTUA 5F2LA 2ZRXA 1RQEA 2QCMA 2WCAA 1QWGA 4QCFA 2TPRA 1AH4A 4BA0A 4MFDA 2RDTA 2J88A 1F8WA 2QF7A 2E7FA 2VGGA 3UZYA 1AH3A 1E6XM 1S1PA 3L21A 1LM1A 3B9DA 3KL0A 4WSKA 3N2TA 4ZO6A 1R46A 3FVDA 1BGAA 2TRSA 4HPXA 3G22A 3N6HA 3SADA 4S3KA 2GRTA 1TQXA 2E40A 2YL9A 2VVSA 3NVTA 5CG0A 3ONCA 5HATA 3VIOA 3G0UA 5A8QA 2DV0A 3PJXA 2NW0A 4UOJA 2BWGA 3MY9A 1EHNA 3N12A 2BXVA 4LU0A 3F5KA 4JTEA 5DBTA 3UPWA 3ID7A 3KUMA 2X7VA 4ZR8A 5FS7A 4ZSUA 4YN5A 1UZ4A 2CBUA 2XM2A 5CEWA 3B8IA 4CD7A 1IIHA 3FSUA 5GNYA 5HXMA 3CV6A 3PZQA 1IZKA 7ODCA 3AI0A 2EG7A 1B5TA 2C3ZA 1BWVA 3N9KA 1JROA 4S3CA 4Z42C 1NVMA 3H7RA 3MSRA 3NO5A 3W88A 4S39A 2BNJA 3NA8A 2WHLA 4MJ2A 3REQA 5D32A 3O1NA 2Y7FA 1V79A 2WKGA 4UWMA 1PX3A 3QZAA 4G2DA 1EWDA 1YDNA 1W5MA 4H4WA 2G8ZA 3E2VA 1EP3A 2PCEA 4PA8A 2G96A 2D1ZA 4BQ3A 3RILA 1IR2A 3K5XA 1J0KA 4I9JA 3C3UA 4QLLA 5I78A 1S2VA 4NY2A 3A3WA 5CPTA 4OGZA 4AW7A 1X2GA 2ATMA 1MEWA 4XKYA 2WC7A 1YBQA 4D6JA 1KQZA 1FP8A 1SSDA 3N15A 4W5UA 2DZUA 1GG1A 3WQ8A 2XWEA 4K7YA 1SQ7A 1YDVA 1S38A 1T6MA 4OUIA 1FWSA 1VRXA 1U5HA 4GIEA 3PAOA 4ZVJA 1QCWA 3H8AA 4NHVA 4GIYA 4IIGA 1KA9F 1AJ2A 1XCXA 1V02A 4C7FA 1XG4A 2GR2A 1LUCA 1O5QA 3HZ3A 1I9CB 1DBTA 1YX1A 2GJLA 3SRKA 3UFYA 4J3VA 3F4VA 4XZMX 4JHMA 4WSHA 1KTNA 4ICCX 1E5JA 1MW3A 4ZFCA 1ZAHA 4FX7A 5H8PA 2QDDA 3S1WA 3CGBA 4UBPC 5DT5A 4MJMA 3W2KA 2YCLA 1K7FA 3IC9A 1DVJA 4B16A 2OGJA 1XKJA 3EXRA 3SFWA 1DQUA 4OIFA 2Y5EA 1KM4A 5LGZA 2QJMA 5JCLA 4TTUA 3BE7A 4TV5A 3G8EA 3TYAA 5MF5A 3EEGA 3ALGA 1KKRA 5GPRA 1XKYA 1MI3A 3M4HA 4GISA 3BTNA 3TE9A 2PC8A 1KCKA 2UV8G 1XJBA 3SCRA 3LQGA 1P0NA 1KTCA 4RE0A 3KVKA 1O60A 2WJFA 3BARA 2BS9A 1NDWA 5G1MA 2GJNA 1UH3A 3WUFA 1ME8A 3WSUA 3L65A 4FNUA 5J5DA 1ELSA 4H83A 4H19A 3CV7A 2X2GA 2FJKA 1MRQA 2F6KA 2GJRA 1L8PA 1VHNA 2YCKX 4DF0A 3S0CA 3TYCA 2DSWA 2NUXA 3R11A 1OIFA 1EP2A 1W32A 1MUCA 3WDQA 4A05A 3M5VA 4X0VA 2QCDB 3HG4A 3CTTA 3B9AA 1B4EA 2UY3A 1GEUA 2IKJA 2GGHA 1GVQA 2OSXA 2XU2A 3HW2A 3NGJA 1ZUAX 3I10A 3BW2A 1KXVA 4O11A 1K6AA 5M2FX 3GKAA 4UFHA 1N8WA 1FFUC 4WK9A 3VNZA 4K8HA 1FWAC 4K38A 1Q13A 3W1QA 3S8HA 4GQBA 1HL9A 1WZKA 1XXXA 1GOMA 5EU9A 2GR3A 3I3DA 1HP4A 4MKVA 4N9DA 2HCVA 4XD5A 3GBEA 1BXCA 3SCVA 4N4PA 1OT1A 4UQBA 2OT1A 1MYRA 1BRLA 2ON3A 1K9FA 4L6OA 2A85A 3WLJA 1D3CA 4POCA 2WMFA 4LA1A 1D7KA 6CGTA 2C3DA 1GHSA 1OJTA 4O1EA 3GSMA 1JDCA 1OHLA 4ZQCA 4EMJA 5BCAA 4LWWA 5CCZA 1MW0A 3T4CA 2BX7A 4QLKA 4FOUA 2O4QA 3N04A 2NWRA 3I6EA 1JUEA 2X30A 1PPIA 4XZNX 3TLQA 4GNKB 1CGXA 2A3CA 1H7PA 5CLTA 3KBWA 3NM1A 4IPJA 4R53A 4L9XA 2QVHA 5EMKA 2A4AA 2C1HA 3CGDA 2C1IA 3CS2A 1FWFC 3WELA 3CZEA 4QE4A 5A6MA 1H41A 3MCNA 1W8GA 3GC2A 3VD7A 4BZYA 4HMNA 4YCPA 1PDYA 3WCZA 1JZ5A 1VLIA 4GZ7A 3RN6A 1XIJA 3UZZA 3QC0A 1WDPA 3KVLA 4KIEA 3DENA 3F5LA 4XG1A 2QQ6A 2NQJA 2QXWA 3VUSA 3RM8A 1EL3A 2BC0A 1NQ6A 3M6DA 4QM1A 1YYAA 1RH9A 3JS3A 1M68A 4K8DA 2XSXA 3N2BA 3GNDA 1YW1A 4PUDA 3GXPA 3OZYA 4NZFA 4APNA 4Q22A 3SAZA 2VQTA 4IJRA 4Z1BA 2QCGA 4JYFA 3CZJA 2V2CA 4U2ZA 2QAPA 3LLDA 3W7GA 1US3A 3ZXWA 2NV2A 3AXKA 3SQPA 1ISVA 1CLKA 3DGZA 3RUBL 3S6OA 2INZA 4QTGA 3W82A 1OG6A 1JR1A 2NVCA 5KTLA 1K02A 2A3LA 3PPGA 1EO7A 1DIDA 1PO9A 3UERA 1TPH1 2IXUA 1CEOA 5FACA 4MB1A 1TWSA 3DDMA 1SZRA 3UG4A 2EQ6A 1GYLA 1IV8A 5GVJA 3PZVA 2VFGA 1E51A 3LY0A 3NG3A 4KEVA 3LI0A 3ZFHA 4QSHA 2AQWA 1G67A 3SFKA 3XIMA 3DC8A 3NIYA 3CV1A 5G5IA 1FO4A 4HU3A 3HQNA 3WF2A 2DZWA 3URNA 2H3BA 3AHVA 3ETRB 2B7QA 2O55A 3P5YA 2OLAA 1UUMA 4O8AA 1WE5A 3TR2A 3QZ6A 3BMXA 1DTUA 3G2GA 3W6LA 2WQPA 3K4DA 3D46A 1UKTA 3UXDA 1XC4A 4GNVA 4P7OA 3TYBA 3VPLA 2CDUA 2FTWA 4C6CA 2IPWA 1VFMA 3APYA 1I0BA 5F4SA 3LTSA 3UWWA 4BCEA 4DWSD 3GY1A 4PUEA 2VR4A 2QJNA 1A4LA 1WZLA 3P7YA 1E6ZA 4O1DA 3AM9A 3PWIA 3QFWA 4J3SA 2VJXA 1OX4A 3AN1A 3HG2A 2P1FA 1XM3A 1GJPA 1REQB 1VF8A 2C15A 1XIMA 2B7OA 4DM1A 1B3YA 4GJ1A 2PI6A 4J57A 1PL9A 4ZO9A 4B5SA 1GOKA 2GSJA 4MPQA 3TKFA 2HQMA 2C1GA 2PGRA 4DWSA 3L5OA 1E0XA 1E9IA 1LF1A 1A5LC 2VR2A 3QSTA 3N3TA 4PCTA 7REQA 4PGLA 1VFLA 4KWWA 4AXKA 4M82A 1UC5A 4W87A 3BAYA 4B4FA 4N6FA 5I0DA 2FVKA 3EX1A 4CVUA 3WFZA 1U5VA 3CAVA 3BDKA 2OO6A 2JF6A 4PUMA 1UUOA 3GXTA 4AD1A 1ZSXA 3H4KA 1J9YA 4UZSA 1E1FA 1GVSA 2WOWA 4FS9A 1LOLA 1UR1A 2XIBA 3OG2A 4EMIA 3TJIA 1TJRA 3L2IA 3UJ2A 1HQTA 2FTPA 4J28A 1XIHA 4XX6A 3NEVA 4JNZA 4A22A 3EBVA 5I23A 4QNWA 3VIPA 4K36A 2WOIA 2ZDSA 1XFCA 4NSBA 1H49A 4OBRA 2FFIA 3F4NA 2YJQA 4K7ZA 2FZ9A 4XK2A 5HWJA 1W56A 3WH7A 2YXXA 3F2BA 1E3ZA 1B3OA 3I3EA 4QE5A 4RNHA 2WZTA 4DUWA 4DBDA 3GHSA 3M1ZA 1ZK7A 3K8KA 3QQ1A 2GR1A 4HNVA 3UU0A 5DY2A 1I1XA 3ELFA 1ITXA 1XLHA 2HQAA 1F6KA 5D8WA 3F5JA 4LBRA 1POJA 1UA7A 2ZUTA 4O54A 2UZ9A 2V69A 3M0XA 2PRHA 1KXQA 3SY5A 5A8MA 4HGXA 5MKGB 2Q6ZA 3A5FA 4E4PA 3KTSA 3E2RA 3W1TA 1FIQB 1MW1A 1B1YA 3DK4A 1OC5A 1I2RA 4AZCA 3CBWA 4OVXA 5FJOA 2VDIA 2YFOA 5HUPA 1H0IA 2PDIA 3JRKA 4I6KA 1H3GA 3CJPA 4W9TA 1VYPX 3UWUA 3DGRA 3REQB 3E6EA 2A8XA 2EXOA 1N2VA 1ZFJA 3CU2A 1PCKA 1FWNA 3LZ3A 4IIHA 5DXYA 2GK1B 3GHUA 1DIKA 1UJQA 2WJDA 3ONBA 5H1WA 4X22A 5DCEA 2V2HA 1E6SM 1VEMA 3P0WA 3AAMA 5I06A 3W26A 4WXZA 4PB3A 4GVGA 3GDRA 2QGHA 3W75A 1OEPA 4BURA 3K46A 4XVEA 1IT0A 2QVNA 1W0MA 3KWSA 2EQ7A 1YBQB 2GUUA 1XF0A 3HBLA 3UWQA 4GINA 5G2WA 1UPMB 3H7VA 4NEVA 3TYUA 1FCQA 1JGIA 4B3KA 5B80A 2G3NA 1E56A 1MNZA 5GJMA 1Q3NA 2NSXA 3UZWA 3TYEA 1Q7ZA 3NFUA 3PUEA 1TA3B 3H4GA 1LUCB 1KC7A 1FDZA 4A4AA 2PDXA 3FA5A 1EF2A 3CC1A 2QJJA 2W79A 3PY2A 1RCXB 4NUWA 2HPMA 4J4KA 2VRJA 3IJ8A 4YWSA 3A4JA 5LNWA 4LC6A 5H91A 2VWSA 5ABFA 4HQVA 1LQ2A 3HV9A 4QITA 1TPDA 3WH8A 5E9XA 2YCLB 3TTSA 2QDHA 4AX7A 5BRQA 2BVYA 4S3DA 4JIPA 3QR0A 2RJGA 5CBBA 4LVGA 4UCGA 2ZUSA 5LIKX 2R1KA 3C0QA 1DJYA 2E5BA 2XPKA 3DBNA 2AKZA 4L7ZA 1CTNA 2A6NA 6REQB 1TYPA 5KETA 4XSLA 2QYGA 1M7JA 2BP1A 3BOFA 3PJTA 2YVJA 3ABQA 4EQSA 4H01A 3W53A 2BHZA 3ZZ1A 2QDEA 3NUKA 2J62A 1A5MC 2HBXA 2ZA3A 1KBJA 2CXGA 3RLUA 3B9JB 3L4TA 4LH8A 2AL2A 4O1AA 4US5D 3S9IA 5FJRA 2DT3A 3E74A 3WDHA 5HR7A 4KESA 3LPFA 5AYIA 5HA7A 2V5LA 1GJUA 2NXHA 4YS1A 5T8GA 5ABGA 2AQOA 3LPGA 3CO4A 4GCAA 4NZ5A 2C7FA 1SJDA 3E0VA 8TIMA 4JEQA 4MWAC 2OEKA 1P4CA 4YYCA 3GW0A 2RKXA 4HCHA 1BTCA 1DHPA 3WIJA 3KP1A 1S46A 1TZ7A 3GNPA 4US5A 2PLMA 1TPC1 5FAGA 4C1NB 1XUZA 4Y7EA 4F48A 4LS1A 2CLMA 3BJFA 4TO8A 4HU0A 4D6EA 3CL6A 5HWMA 4P7NA 3QGKC 2IKHA 4ZSTA 4A2SA 5E0CA 4M7TA 1XSIA 4CNPA 1BRLB 2X1IA 3CHCA 1R9YA 4JQ1A 4M6PA 2OT0A 1RM6B 4IIFA 2OMAA 3AFBA 2ZTJA 2SFPA 2XGBA 3UPBA 4UNIA 5DFAA 1RY8A 3TJXA 1V02E 3MI3A 1P1XA 4J27A 4FNSA 3DYMA 1TE6A 2X42A 5E5CA 1YXYA 3ARQA 1Q45A 3ISIX 2ACSA 1RCQA 1NWTA 4G8TA 3VIHA 3UXLA 3UD6A 5A2BA 3A9IA 4PZVA 2EPOA 2V5DA 3AISA 4TVWA 1BVZA 1ESWA 3BH4A 3O3RA 4AU0A 1UWSA 4LF1A 4W7WA 5HNUA 1O68A 3DFNA 4M6QA 3T0AA 2PBGA 2WANA 4UTTA 3BCJA 2PS2A 1NQKA 3U4AA 4IPLA 4BK9A 4NILA 1AD4A 4LUYA 3KX6A 2I1OA 2VM8A 1HVXA 2RGMA 3OA3A 5D4YA 1JAKA 3CMJA 1XINA 3G3DA 4GUHA 3NS1B 1S5VA 3AIRA 4I9AA 4DELA 4PMUA 3GR8A 5AC4A 2ISVA 2W3RA 4CQ8A 4AXNA 4C90A 1LRQA 2AKMA 1IWPA 3VD3A 1S3HA 2WVSA 1MQPA 3QJAA 3ALFA 7ENLA 3DK9A 1V3HA 4Q8TA 3E3HA 3R1ZA 1RBLA 3AU6A 2CLEA 3BLIA 4HSNA 3MJMA 3UA4A 1YMYA 4NJHA 1V7YA 4HNOA 1UP0A 3GDLA 4FIQA 1DWIM 3VE7A 4E8GA 2PDFA 5FEXA 3ZVHA 3KOWA 3C0SA 1YPXA 1S2UA 2FVMA 4IPIA 4HTYA 3TIMA 4LUSB 1NDVA 5G4HC 4RX0A 4KRTA 1TVNA 2QF8A 1TZ9A 1J0IA 2ZRUA 3MKKA 3N25A 4JTRA 2B0MA 4RL3A 3S46A 2DZPA 1E1EA 5FF2A 1QO5A 3TA9A 1H7XA 3EKGA 1SFLA 3TV8A 4LIIA 1I6NA 4AZHA 3VMPA 3VM7A 1Q6FA 1VFUA 4DI8A 1KM2A 3V5CA 3WQDA 1IEIA 2VELA 1NWSA 4HYVA 4ERGA 3JZUA 2ZZCA 1JYWA 1RA5A 3KDNA 5JQ9A 4XBSA 1Q2SA 5BRBA 2ZVRA 5DMYA 1D2KA 2X1SA 4F0RA 3EB2A 4EM4A 5H2ZA 2D20A 4CCCA 1OX4B 4MZ8A 1BLIA 5IOBA 1PYFA 2A1YA 3NVWB 3O6AA 5AYXA 4RZ6A 1GVYA 4JYEA 1VFOA 5C2GA 2WPEA 4U4MA 5I03A 3M0LA 2I57A 1K70A 4DY1A 1B31A 5BOEA 4PSRA 1EPXA 1DXEA 4DWSB 3CO8A 4MTVA 4BHYA 1PUDA 3OZPA 1IQ8A 3N19B 4A3HA 3EEZA 3LHZA 5JU6A 4DBWA 7REQB 6XIAA 2ZKMX 4FK9A 1KFKA 3PP7A 2E6DA 3ABRA 1QBAA 2O9RA 5HUOA 4BEUA 3WLLA 2ZZ4A 1C29A 4G6CA 5PTDA 3UA3A 3BSGA 3W87A 2GWNA 4DJEC 5G2IA 1TPFA 1TPVA 3IEBA 1S3TC 4OV9A 1WYIA 1ZCOA 4FR1A 3BXWA 3GE7A 1VHCA 1UIOA 1EQPA 5GRTA 3R7MA 3MUXA 1JF6A 3VA8A 3DG3A 2E9LA 3NYDA 1RUSA 5I3IA 3W37A 4HYWA 3U2CA 5M17A 4H8HA 2O7SA 4PUJA 3N17A 5GQBA 4Q4OA 4CKQA 3TDFA 5KVIA 3T07A 5IDZA 5LHEA 2BG5A 3UWZA 3W9ZA 2WZIA 4CNNA 1M41A 1TWWA 3UYIA 2XIOA 2PZNA 5A6KA 3N4FA 1GGOA 2WSRA 4WX2A 2GSHA 4A29A 4FLSA 1YLVA 4KMQA 5D9OA 3AUOA 1GEQA 4PUWA 4IH3A 1DOSA 3HO8A 3L4UA 1MUWA 1XIEA 4NZCA 3U3HA 3K13A 1KKOA 4L1GA 1CIUA 3E0FA 4US6A 4O4VA 3TTQA 3W07A 4DNMA 2Z4GA 3PSWA 3H4WA 1EDQA 3VMNA 2NZLA 3DH7A 1MRAA 5J04A 1GZJA 1IZCA 1TV5A 3W7LA 1ADSA 2Z2BA 5I7GA 1GWJA 2CYGA 5CPQA 4D9PA 1QI3A 3G1RA 1PIIA 3A3HA 2CWNA 3EDKA 3IK2A 5DO8A 5KEZA 2RAGA 4PC8A 2DZVA 3C5QA 1SJBA 4WZHA 5GNZA 1C9WA 3GAKA 4MZYA 1KM3A 5I5RA 1FEAA 1QW7A 2CCRA 1QW9A 4H4PA 4J3TA 2DEPA 4WOQA 3BV7A 3QH2A 2OEMA 5ABHA 2E77A 3W00A 2ACRA 1UR8A 1ZU8A 2GQ3A 3TN5A 3TQ0A 3WDJA 3A4WA 3T55A 1AL7A 3HA1A 4O18A 1X6NA 3TX9A 2HPIA 3IUIA 3L4XA 4JIIX 4IPNB 3CEUA 3UESA 1M7XA 4EIVA 2W67A 3RU8X 3P62A 3GQYA 3U5YA 2YBUA 4JDYA 4PUNA 2GPTA 3DK8A 1TV4A 1FWBC 3ZOAA 1S39A 3JUGA 1BQGA 1X8CA 2J7DA 4Q8QA 2OYLA 4DQWA 2AGTA 3P81A 1IGWA 1GK8A 4AVNA 3G1DA 2CFFA 1FCBA 3GVWA 3M0YA 3QFAA 1KNWA 3QY7A 4XD3A 3MANA 1C7SA 4AYGA 4W5ZA 1FHVA 1XRSA 4D6GA 4PRTA 1QXLA 5CZTA 3HV8A 3MZNA 2XGZA 3PBYA 2EHHA 4IJBA 1P5BA 4GABA 1ALDA 3UVAA 5ABFB 4YVPA 4XWUA 1W1IE 3E2QA 2WNZA 3O6DA 4C6JA 2QEZA 1XYLA 2BOGX 2Z2UA 4AAJA 2VEPA 3WNKA 2UWFA 4D72A 4LAOA 1XSJA 1D3GA 4TQTA 2YDSA 3WLTA 4Z2IA 4UR9A 5BRPA 1V4YA 1AQMA 2GOUA 3VD9A 4BI7A 3FDKA 1OFOA 2V5KA 3TCSA 4TX9A 1F76A 4GKLA 1OYBA 1Q6RA 4JTAA 2DZAA 1J0HA 1M7PA 4MFEA 2OQYA 3C2RA 1GQJA 3WD3A 1OINA 2IXVA 2ZE0A 3FDGA 1HKIA 3KBSA 3W7IA 4IL0A 4MNLA 2FDSA 2I7GA 1GVIA 5E6ZA 3NDOA 2FTYA 3DFHA 2W55A 3VDAA 2WBAA 4IMDA 1KBIA 2WKLA 1VFTA 3TEVA 3CMGA 2CLFA 2ZX6A 6ALDA 1XISA 1ZAIA 1XYCA 3F7JA 2O9TA 3VGDA 4C7GA 5BXPA 2R1PA 2YBTA 3ZM8A 4ECLA 4HZMA 3NQDA 3RX3A 3MUZ1 3MP4A 4A3QA 1L6YA 4ACZB 1H5YA 4LAUA 4I5UA 1EA9C 3TYZA 3G1HA 2V0TA 1N62C 2VC7A 1JL8A 1UP2A 3IVSA 1BZLA 1QNSA 1QPRA 2Z1WA 3FAWA 1TMQA 1J2BA 2E4TA 3PR2A 5JH1A 4HIBA 2OX4A 1NFGA 3WO8A 1F2JA 3UT0A 1V77A 1G4PA 1F3WA 2X0HA 1H60A 1VYSX 5BXRA 4MMWA 4ASTA 1TPEA 2BBFA 2J74A 4BV6A 1JAEA 3QSRA 2P53A 2IQDA 4XV0A 1HKWA 1X39A 3IJDA 3UCDA 1Q6CA 3IIZA 3T09A 4W86A 2VYOA 4PRRA 2ZXDA 3RF9A 4MGGA 4IM4A 4LBSA 5DCDA 2HK0A 4D6CA 3PBVA 3IGSA 2VKZG 4NZ4A 1EZ2A 3A4XA 4UTJA 3N4AA 3GWQA 4S2CA 5C2XA 1LQ0A 1CECA 2VRKA 3EWBX 4DZ5A 3U6WA 1OJXA 1DWGM 1I75A 1XI3A 1XLJA 3ZJKA 3M5XA 1J11A 1G5AA 3DAQA 3KM8A 3A7RA 2WCSA 4M6UA 4EPDC 3EZ4A 3TZNA 3IJ6A 1XRFA 3G5EA 3LXAA 3A3XA 4OBSA 3RPMA 4FZIA 1FFRA 4S23A 4ZEPA 2Z7GA 4NZ3A 1B90A 2FMNA 4GC4A 4IF2A 2BVTA 3ZLHA 3K30A 1LG2A 4Q8NA 2E6FA 4ZXOA 1PWMA 4JPGA 3EA1A 4GFIA 3B8UA 3PM6A 1TX0A 3AS2A 4GH1A 1J8VA 3D3FA 3VOFA 4HNUA 3B0UX 3CH0A 2DU2A 2Q3RA 4YJ5A 3FHQA 3W2UA 3O63A 2W3ZA 4RPQA 2JGQA 3B8TA 1PKNA 2DT0A 1TB3A 2R9ZA 1EA0A 3MKVA 2JKPA 3OJGA 2WSYA 3UNTA 5U7SA 3WEMA 2NUYA 1FY6A 4HTBA 5G1TA 2Y8KA 1G6CA 3DFOA 3BO9A 4HYRA 1RJRA 3L23A 3W7PA 3FIGA 3H21A 4I8DA 1KB3A 3M5ZA 1TZZA 1V6VA 1X1OA 3PFMA 1JCMP 4O19A 3PUOA 1I1WA 2BCPA 1YNYA 3MYPA 2DPEA 1C8XA 2QUUA 3R79A 3WQ6A 2PFHA 2GH5A 1W9PA 3F2DA 4IUOA 5G5GB 3RR4A 3VK5A 4JOMA 1NOFA 3W83A 1N82A 2CXEA 4QHRA 5HAOA 1OYAA 2BY1A 4RXFA 1TMLA 4CQCA 2QUTA 3P80A 2A3EA 4LV4A 4MUZA 4G7EA 2X99A 2ZA1A 2CFYA 4JTGA 3SR7A 3QLLA 1E9LA 5C9ZA 4C6NA 1B3WA 1KFLA 3VKDA 1CB7B 3JZEA 5I3DA 2JF7A 2OR2A 2OSYA 4RCXA 5K4XA 3LX9A 4LT9A 2IS7A 3NZGA 5G2HA 2G37A 5JMUA 4QCEA 1LT7A 1E73M 1C8YA 1DIEA 3A6OA 1N8IA 3HPSA 2XFWA 3FYYA 3I6RA 2C91A 1H11A 2UBPC 5G4WA 2PURA 2GQ9A 3SBFA 3WZ0E 1GORA 2AL1A 2CBIA 3TK7A 1ONFA 1EEXA 3TLLA 4H4SA 2PTWA 5M1TA 3LTPA 2YL6A 2WMKA 5D37A 5K3VA 4E0CA 3NWRA 3NZRA 3VFLA 1XLDA 4BQ2A 3S2LA 1X7IA 4LY8A 4ROQA 4LUTB 3FGCA 3N11A 4MHBA 3CT2A 1ZTVA 1VEPA 4PRWA 2ZVIA 3CQKA 3IV8A 3CWHA 3POHA 3P14A 1DE5A 5CC3A 3QV7A 2OO0A 3AU2A 3MWAA 1YXDA 1GW1A 4F4RA 3WNPA 2PWVA 3HMJG 1J18A 1F07A 1WPCA 4ZB5A 1V5XA 1VEOA 4XBKA 3PULA 4MB4A 1RQHA 1QMLA 2XUCA 2P10A 4K2SA 1VZWA 1VPQA 5CZ0A 5BROA 3GG0A 5T9CE 1L2QA 3NQCA 3B03A 3HQOA 4C6FA 2VQUA 1NFBA 1SR9A 2WMGA 2YB1A 3E49A 2VX7A 3AMDA 2KAUC 3OZMA 1UKOA 4DJED 4ZB2A 1HIZA 1Q7QA 1VFFA 1GVRA 3G18A 3U2OA 1JYNA 4N0RA 4KT2A 4GYPC 4RW3A 2AOSA 3THAA 3T9PA 3UJSA 3LA4A 1EC7A 5HPCA 4ZB0A 3O15A 3G1SA 2XH7A 3SUTA 1DV7A 1GG0A 4C6EA 1VCGA 4Z2KA 2J6VA 1G4EA 1Y65A 3PVFA 3RCYA 3ZWSA 5KSWA 2BOEX 3J7HA 3GC5A 4NXSA 5A6LA 1FHLA 1L8NA 5EL1A 1VQTA 3URAA 3WL0A 4R85A 2PWGA 4HMDA 4GO9A 3VC6A 5F4XA 1XR2A 3DI0A 3OLEA 2NWSA 1AZ1A 1F4HA 2J78A 1W5PA 3HJEA 4H4RA 1X2HA 1HTIA 4FX8A 2VEGA 1XBXA 3R5EA 1OX5A 1G4TA 3MI2A 1F8IA 5AHEA 3DN5A 3V1PA 3UR7A 2ZTKA 3BCFA 3BZJA 3WQWA 3UZXA 3THUA 3SEPA 4UTMA 4QJ1A 2VOMA 1XYZA 2I14A 2CLKA 1VRDA 3VZZA 2G50A 1DNCA 3GRSA 4UIOA 4OUEA 1V0LA 3TTYA 5C55A 4ACYA 2VOTA 3N6JA 3EAOA 3MBDA 1ISYA 4LAMA 3EMZA 1WBHA 2E5AA 4Y9NA 2ZDRA 5F2GA 1NEYA 3Q45A 4S3JA 2JFEX 1KR0A 1OSEA 1XLBA 3MYOA 4EQRA 3W2JA 1JF5A 1M1BA 5FF7A 2R1LA 3M41A 1LLZA 1BXNA 2E9MA 4B91A 4BI6A 1JXKA 3PUDA 3HN3A 3S3GA 3BAXA 5HMDA 3UJRA 1FXQA 4XKMA 1HL8A 3TN4A 4FPSA 3ZT6A 1JYVA 4UNKA 4MNKA 1MZRA 2WMJA 4DVOA 4GFSA 3ERPA 2YPIA 2YZ5A 3AXXA 4I8YA 5TF0A 4JS3A 1EZWA 4C6IA 3AHTA 3IIVA 4Y9OA 3IK4A 2XN0A 1C92A 2J7HA 4EKJA 2D0GA 1SSGA 1VB9A 3EPOA 3W81A 3EXSA 3O8AA 2WC3A 2OYMA 4KPLA 2ZUMA 3GIYA 2CESA 4IQLA 1UWUA 4AZIA 2DZBA 4DB7A 3HG3A 3VFCA 1EYWA 4DLFA 1B3XA 3F1QA 4V1YA 1QI2A 4PL1A 1W5NA 2CBJA 2WVUA 1CNVA 2VUNA 4GKTA 4MYAA 2HJPA 3CZLA 2PLCA 5JCNA 3MUCA 3ARPA 3NQEA 1P0BA 1YE6A 4J3WA 3S2CA 3WH6A 3APTA 3SCSA 1GXFA 4IFKB 1XDMA 5CC5A 2E67A 4H9VA 1U33A 3WENA 1OFBA 1W3IA 3KRBA 3RMJA 4QAWA 3WMSA 3FJLA 3CZKA 4U31A 3OTRA 4HJFA 3ZYZA 2BTMA 3LU2A 4DJDA