3VDLA

Crystal structure of circumsporozoite protein atsr domain, p43212 form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
YVEFEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unexpected fold in the circumsporozoite protein target of malaria vaccines.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell invasion
molecule keywords Circumsporozoite (CS) protein
total genus 15
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00090 TSP_1 Thrombospondin type 1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.100.10 Mainly Beta Single Sheet TSP-1 type 1 repeat Thrombospondin type-1 (TSP1) repeat 3vdlA00
1LSLA 4HQLA 1SZLA 3R6BA 3VDLA 1VEXA 4HQOA 3VDJA 3VDKA 4HQNA 4A5WB 3T5OA
chains in the Genus database with same CATH superfamily
1LSLA 4HQLA 1SZLA 3R6BA 3VDLA 1VEXA 4HQOA 3VDJA 3VDKA 4HQNA 4A5WB 3T5OA
chains in the Genus database with same CATH topology
1LSLA 4HQLA 1SZLA 3R6BA 3VDLA 1VEXA 4HQOA 3VDJA 3VDKA 4HQNA 4A5WB 3T5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSL A;  4HQL A;  1SZL A;  3R6B A;  3VDL A;  1VEX A;  4HQO A;  3VDJ A;  3VDK A;  4HQN A;  4A5W B;  3T5O A; 
#chains in the Genus database with same CATH topology
 1LSL A;  4HQL A;  1SZL A;  3R6B A;  3VDL A;  1VEX A;  4HQO A;  3VDJ A;  3VDK A;  4HQN A;  4A5W B;  3T5O A; 
#chains in the Genus database with same CATH homology
 1LSL A;  4HQL A;  1SZL A;  3R6B A;  3VDL A;  1VEX A;  4HQO A;  3VDJ A;  3VDK A;  4HQN A;  4A5W B;  3T5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...