3VDUA

Structure of recombination mediator protein recrk21g mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
197
Chain Sequence
b'YYSTSVAKLIEELSKLPGIGPGTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 52
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vduA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vduA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vduA03
4O6PB 2AU3A 1D3YA 3VDPA 3B39A 5GUJA 1EQNA 3D00A 4O6OA 4EDTA 4EDRA 4EE1A 1T6T1 3VE5A 1VDDA 4EDGA 2Q2EA 4JCVA 1DDEA 2V1CA 2ZBKA 3VDUA 4E2KA 4EDVA 1DD9A 4EDKA
chains in the Genus database with same CATH superfamily
2OPFA 1ZV1A 1QYRA 5FTLA 2RKOA 2ERCA 1EQNA 3KOZE 4A3VB 1DO0A 5C1BA 2DI0A 1XXHE 1DS3I 1TGSI 2M5ZA 3Q8XA 1JR3A 4G4NA 1NVMA 3KDSE 2FE8A 4FW9A 3LCVB 4R7GA 3W0LB 2LVPC 2KMOA 2X8AA 3VLFB 2C9OA 3FD9A 5ITQA 4PDGA 4LJ4A 2XZFA 3UJNA 4OVOA 2SGFI 2PQ8A 2SGPI 4HEOA 2LVQD 1Z7KB 2R65A 4QHTA 2WSCF 4Z6YA 2VDBB 1TURA 3RFWA 1WHCA 1NJGA 1IXZA 3GRRA 5KO3A 2F5SA 2WSFF 1N36M 4P17A 2ROWA 3VK8A 5IZ7D 5GKNA 3LQRA 1Z5CA 1QUTA 2BUSA 3DOAA 1H0ZA 1DS2I 3J7AS 2W82A 1EE8A 4JI6M 4AG6A 3SGBI 3C3DA 2XSZD 3F92A 1Y8FA 5ITYA 2JYYA 5JI2E 2R4EA 4NXNM 4XBOA 1TDHA 2UUAM 2I7NA 3E2IA 2VIIA 1R7RA 3QTLD 3J7BA 3UGIA 2E73A 1GABA 3QAUA 4AZFA 2R62A 4X66M 3U6CA 4EDKA 1R0RI 3R9XB 4GEWA 4GKJM 3GP1A 3UOEA 1CHOI 2NU1I 3E46A 4X64M 5FUYA 1XWIA 2DWMA 2X3TA 1XMQM 1OMTA 2ORVA 1E9SA 4O6PB 2L8EA 1OVOA 3K92A 1NUBA 1NO1A 2DAKA 3FC3A 3MJ5A 1ZQ9A 5EQTA 1XBTA 1W3SA 2OOBA 3WHLA 1XHBA 3HZJA 5J8FA 1WTJA 2K47A 1OIPA 2CHQA 2FNAA 4GKKM 2E5LM 2VQFM 1V34A 1NJFA 2WGCA 1R6BX 1M8CA 1WJ7A 4LG2A 2APLA 1LR9A 5FLXS 4DR1M 2V1CA 1OQYA 3R5CA 4RKUF 1GO5A 5IWAM 3CF6E 3EIHA 2LH0A 3UMMA 3CTWB 4MH0E 3JR4A 4FCTA 3ZC7B 3KW6A 1RU3A 2UZ3A 1WKXA 1WXQA 4GHAA 3U6MA 4FWGA 3GO8A 1IXSA 2GVIA 1UVFA 3A98B 1SXJB 2DIPA 1AN1I 4DV0M 2UXDM 2RRUA 4LJ8A 2ARPF 2LEOA 5BPVA 5A2QS 3UFFA 3JAMS 3FYDA 3KVWA 1FNNA 3U61A 3M6AA 1TBNA 1DGHA 2RIJA 1L8QA 1K82A 2ENNA 1SXJC 1TTEA 2EO2A 4MGHA 4E2KA 1DD9A 1S3SA 3VFDA 3I01M 1OAOC 4FWHA 3TOBA 4G4RA 1QVRA 2KZSA 3UGDA 5C18A 3L28A 3SGQI 4L4UA 3JR5A 1PJIA 1TH4A 4BB9A 3I04M 1QZMA 2VRWB 3SASA 2YNMD 2LHGA 4JI0M 4PT5A 1Q02A 4A24A 5EXSA 5FTNA 1AUAA 2D7HA 2L4EA 2X52A 4DNCA 2ZANA 2MJ5B 1XXHB 2XFSA 2ZAOA 4GIPA 2J7NA 8CATA 2FCJA 2OU2A 3IECA 4JXJA 5BR8M 5JI3E 2MGWA 1R4GA 3HWSA 2O25A 1UUCA 2QPAA 4QNRA 4M9XA 4WW0A 3T6PA 1EFUB 5KQDA 4IBIA 2Z3XA 2DWLA 2W0TA 3A45A 3FE3A 4SGBI 3AOGA 1SXJD 3I51A 2LVAA 1J5EM 4E1PA 3T1YM 1HNXM 1UM8A 1T6OA 2R0IA 3HJSA 3HHYA 3L2AA 1Q3BA 3TL4X 1ZMWA 2DKLA 5HI7A 5CCMA 3BJIA 3U6EA 2JZMA 4FD2A 4RF1A 3QWPA 1V33A 2KNAA 2XF3A 4IIWA 3TE6A 2Y0TA 2C5RA 1KFVA 3HU3A 4LJ5A 4CISA 2XSZA 1W5SA 2LHCA 4DV1M 1IY0A 2V6ZM 4JCVA 2KRUA 3KY9A 2C9CA 3M0EA 3AOEA 1D0KA 1IFYA 4D80A 4DV6M 1YU6C 4LZJA 1TBOA 2N71A 4KO8A 2DB6A 3K2LA 3GQ4A 4XK8F 4JI3M 3D8LA 3VKHA 2FNFX 3E4RA 3FSYA 2OQ4A 1MT1A 1A5TA 4KODA 2CJSC 3HU1A 2B3TA 5DYIA 1NY6A 4LFAM 2CWFA 2M5XA 4B7FA 1WIVA 1FY7A 4DR6M 1P9ZA 5DNYA 3PDNA 1F4IA 1D3YA 2EJSA 4II7A 1J09A 4LGMA 5EP2A 1CT4I 2ODDA 3RGSA 2KNVA 2R45A 1Z59A 3VDUA 1TBQR 3GLIB 4Y28F 3ZCBB 2E5RA 2GQFA 2HL7A 4GHLA 2J87A 4O6OA 2MROB 4NSRA 4B3SM 1L2DA 2HHHM 1NHGC 2O01F 4GMQA 2DZLA 3R8FA 1JQJC 2WCYA 2HCBA 3HH2C 4JI4M 3OVOA 1T3TA 2M60A 2JUJA 5CCLA 2QQ8A 3IG8A 4G3OA 4Z8XA 3W67A 4UXHA 4LF8M 4DUYM 1X74A 3KOXE 3GLFB 3QAHA 1DO2A 4ZPXA 4OW0A 1Z2IA 2EKKA 4IBCA 3GPPA 1MX0A 2G3QA 3C58A 2K0BX 7CATA 2JA1A 4DV7M 4DR5M 2XGNA 4GITA 1GL6A 3OXFA 4IBJA 3KOYE 5EXXA 4RF0A 4RNAA 4E1RA 3GPUA 2ZM6M 1N13A 2DZOB 4M0DA 1ZMUA 2X4AA 4NRWA 1IY1A 1VEGA 3EIEA 2QBYA 9WGAA 1N75A 1P9GA 2QSFX 2ORWA 5GUJA 4IBFA 2D7EA 1PM5A 1P3QQ 1V92A 5IREB 3J2PB 2FH0A 4PDIA 2LVOC 1XNQM 4LY6A 3E21A 3PNYA 2RC4A 5L8RF 1JB0F 4LJAA 2R44A 1T43A 2UXBM 3LCUA 1LTMA 2CE7A 1VDLA 1HT2E 2CV0A 3KXEC 2DVWB 4L78A 3BOSA 2JZ1A 1XNRM 2J9RA 1FARA 2UU9M 1QANA 3ZH9B 4ITQA 4KT0F 4OVZB 3NWLA 1BMOA 3H4MA 2HKJA 1PGYA 1MJ9A 3I4YA 4FVMA 1GL7A 1PPFI 4LJ9A 5EP1A 3J81S 2ENZA 3SYKA 1TF0B 2QHOB 4WURA 4B7HA 1D0LA 1XA6A 4CGYB 4B3TM 2CHVA 2XFTA 2F5QA 3D8BA 3UK6A 3GPXA 4P16A 2JWSA 4PCZA 4GH9A 3BBZA 1L2CA 2DWNA 2CV2A 3CF2A 1RFHA 1AIPC 2KRKA 4HL4A 1CSOI 4F2LA 4W5WA 2L7HA 1NY5A 2SGDI 2I7PA 2LVNC 3FUUA 4QHSA 4IBKA 3D00A 4G6ZA 2MH8A 3U5ZA 2KNZA 4G4QA 4B3MM 4D82A 4DR4M 5LMUM 2P6AC 1OKSA 4LCBA 4LFBM 2JY7A 1UFZA 1K7UA 2R18A 5F3WA 2CWGA 5EP3A 5KPRA 2EUCA 3OXLA 4JI1M 1FAQA 2C98A 3Q8GA 2NU0I 1NHWC 2GIVA 1SGEI 1IY6A 2QZ4A 3C3EA 3KOWE 1DGFA 3PFIA 1HEVA 1PJQA 2C99A 4JCVE 1HQCA 2L7IA 3V76A 4G4OA 5DAEA 2R6FA 4CHTB 1X4SA 2RGOA 3U6QA 3U6PA 2DAGA 4S12A 1OTRA 3FTCA 2H1RA 1CT0I 2D7GA 3T1HM 4B3RM 3FUWA 4AQYM 1OFHA 1JR3D 2N52A 2FS1A 1Y1BA 1G3IA 3U6OA 3PNVA 3AJIB 4DBGB 2VF7A 3VE5A 3AV0A 2GKRI 2N17A 7WGAA 2QNJA 4M0WA 1MU5A 2KCXA 2UVOA 3SARA 2HWJA 4NSOB 1SGYI 2CEAA 1Z6TA 3SHGB 4EE1A 4MB7A 4AKHA 2JNHA 3U60B 1G59A 2LUYA 4I5SA 4LF4M 1BVSA 2CP8A 2XH9A 4EIWA 2QPOA 1R5LA 1N34M 1IBLM 1QAOA 3I4VA 4L16A 3J27B 1VDDA 4JI2M 1QDRA 1V1IA 3GQ5A 3FSXA 1MN3A 1XMOM 4FKDA 3FRIA 3ILKA 3CXLA 5FTJA 3MEKA 5ITUA 2QQ0A 1MJAA 3VK7A 1SGPI 1IXSB 1Y8GA 1HT1E 1PJTA 5FTKA 2Q2EA 1IN5A 4TUWA 2V1CC 4QNMA 1N32M 1IN8A 3T15A 4UXIA 2DNAA 3GLGA 3TWLA 2UUBM 1ULKA 1KSFX 3IG5A 2A20A 2XEPA 3TOAA 1IN7A 2KHHA 2ZBKA 3U61B 1ULNA 3RGPA 1DGHB 2LB7A 2Y21A 3RU0A 3K1JA 4PD2A 1EIJA 3GLHA 3TPZA 2K6BA 5KPTA 3R5DA 2MR9A 2Y20A 1MJGM 1CUKA 2OO9A 3A46A 5J8CA 4FCWA 3FUTA 1E94E 1SGQI 1ZAEA 2JY6B 5E6JA 1LR8A 2X49A 2DKVA 1HJAI 4NC6A 3RE8A 3R5BA 4LF6M 1IY5A 2BWBA 3GRYA 3B7QA 3OTOM 2GKVA 3GRVA 3ZQJA 4LF7M 4NOOB 3TWKA 2GNOA 2KEBA 3SMSA 3HHZA 4IBBA 2AU3A 4B6DA 1TDZA 1N77A 2QQEA 3KS4A 1W4RA 2UXCM 2R46A 1D0MA 1PTQA 3L27A 4AI6A 3MMPA 1HDLA 3VKGA 5EX3A 5E3RA 3J80S 1UHAA 2JZ0A 1Z5AA 4QOZC 3LVWA 4HGUA 3GLFA 1WGCA 2K9DA 1R2ZA 1GKIA 2Y0QA 1ULMA 1YE9A 2KZUA 5EX0A 3L25A 5EXPA 3PXGA 2LTUA 1Z5BA 2B8TA 4EDGA 1QUSA 4JI5M 1IQPA 1YUBA 4GC5A 2KW0A 4KLNA 3R5AA 1NNJA 2F3CI 4Q7JA 4IBDA 2L2DA 1NV8A 1W5TA 4DV5M 1CE3A 2ZTDA 3MK6A 5E3PA 1YLAA 3B4VC 4NRVA 3SBJA 1WGLA 1SGNI 2ZTCA 5E26A 3IHPA 1KMAA 3LW5F 3GOXA 1NV9A 3SATA 2DAMA 1IM2A 3TJQA 2Z4SA 2FOIC 1QDTA 2CHGA 2SGQI 1WGNA 2QQDA 2NQ8C 1G71A 3UZUA 1H6UA 2K9HA 4FCVA 2CWHA 3TO7A 1DV0A 1IN4A 4LGYA 3SAVA 2Z4RA 3VDPA 1WR1B 4OVZA 1NXUA 4BBAA 2B0UC 2YR0A 2A5YB 2OZUA 3HHWA 4GRIA 3QYBA 3FTEA 1LR7A 5FTMA 1VEJA 3KS8A 2AHMA 1X37A 3AOEC 1OFIA 1HNWM 4LRTA 4EDRA 4YY3M 4L15A 2N1AB 3OXGA 2GKTI 3LVVA 3B89A 2NU3I 1K7VA 2DHYA 1OMUA 3HKPA 3KSXA 2F4VM 2Y0MA 1QAMA 2KDLA 5EXTA 2N35A 1S20A 1ZMVA 1HNZM 3SEKC 1QAQA 2V1UA 4OU7A 4BLCA 1N78A 4EDVA 2F5NA 2QP9X 2LBCA 1E9RA 1C1KA 2DXIA 1IBKM 2LXEA 2WSEF 1TH3A 3LQQA 4QOSA 5E3QA 1Q3CA 4KHPM 1G8PA 2O5RA 4DR7M 3E9SA 3GQ3A 2BJWA 1Q39A 2BNKA 3W0FA 1G4AE 2YFQA 3L29A 2CV1A 3WHKA 1GJTA 3B9PA 3HJQA 5FUVA 1IN6A 2Z8YM 3L26A 3TO9A 3K9OA 1SXJA 2OOAA 1GJSA 5JHWC 4MGYE 2DWZB 4UN2B 2L09A 5ITXE 1K3WA 3B7NA 4CJ6A 3CF0A 3GLGE 2J5YA 3SHFA 4LRSA 2QQCA 1YTPA 2DHRA 1XX6A 1YSYA 2QCUA 1HQYE 1C7YA 1FYBA 3DFZA 1IW4A 1VEKA 3FRHA 2QBYB 4LZZA 1HPTA 2DAEA 4MGZE 4I8OA 3OL0A 3GLHE 3U60A 4MPIA 3PVSA 4GC9A 1R2YA 2HAKA 4AG5A 3A42A 1SGRI 3FKEA 2RGHA 2L7XA 3GLIE 2NU2I 3HJ8A 2XZUA 1VG5A 2G5GX 4JN6A 1PJJA 4DV3M 3U6LA 3GRUA 1D2NA 3TQSA 1OAIA 1XXHA 4IJEA 5EJCA 2R4JA 4MGIE 2LWXA 2KXEA 3LMMA 4F1IA 1TH2A 2P5TA 4X62M 4NL4H 1CGII 3DZDA 2F5OA 2DZNB 1TOTA 5H37D 3HHXA 1MJBA 4AMLA 1PCEA 4WP2A 3FTFA 4JYAM 3GLFE 2QENA 2YQPA 1OYVI 4LJ6A 4YHHM 1V1HA 5ITRA 4X65M 4JV5M 1TGUA 1ORYB 4M9SA 2C96A 1PJSA 4MGKE 3H4JA 3B74A 1PJUA 1TR8A 4DV2M 3AFHA 4I81A 3FUVA 2CRUA 1UVGA 2XRCA 1J7KA 4L8RC 4GI3C 3U5ZB 2WZJA 4JI7M 4JI8M 1WGTA 1QZEA 3HGIA 1T6T1 4D81A 1I4WA 3HX3A 4DR3M 1DDEA 1K7TA 2VF8A 2KMQA 1OJLA 1TUSA 2L6OA 4AKGA 1G41A 1XC8A 3KP1E 1Q9BA 1FJGM 1SGDI 2KA6B 2ZAMA 2YQZA 2ELIA 3CGWA 4I4LA 3KSJA 3SMPA 4IJFA 3U6DA 3DA1A 4R3DA 2BJVA 4OX9M 2SGEI 4K0KM 2JXNA 1IBMM 5ITXA 3KFUG 1HJPA 4R71A 4LJ7A 2OD1A 1N33M 1KYIA 3E59A 4AKIA 5HQ8A 3W68A 3THGA 1OIZA 2OVOA 2YUUA 3NBIA 4NXMM 2KMRA 4B7GA 1JR3E 5KPZA 2L4FA 1I94M 2DAIA 1L1TA 1L1ZA 4L9MA 4FWDA 5DFLA 4IBEA 3UGJA 1LV7A 1DGBA 4LF9M 4HLQA 5FUXA 1CGJI 2G8LA 3UEJA 4REZA 1GLNA 4UXJA 3MHVC 2H5XA 3C9PA 2EA0A 1KBEA 2JW6A 2CFOA 3K8ZA 3K9PA 3T38A 3GLIA 2KMPA 4L6V6 1CT2I 3UGLA 4M9ZA 1R79A 3SAWA 3FYCA 5IT9S 1SG9A 3QWLA 2CWBA 4LFCM 2JY5A 4AW4A 5DYGA 3B39A 1XB2B 3QYEA 2JA2A 4IBGA 1GVNA 3HU2A 4B08A 3HY5A 4XGIA 3SC3A 4DUZM 3B7ZA 1TIHA 4CIZA 4EDTA 2Q2EB 1BUSA 3AKZA 2JP7A 1VQ1A 1PTRA 3FUXA 1NSFA 3GLGB 1TBRR 1E32A 1K3XA 4WP4A 2WVJA 1QQWA 1M8BA 3UEYA 1NNUC 1DGGA 1SXJE 4LF5M 2JY8A 5LMNM 2J7OA 1HR0M 2ZBKB 1Y1CA 5FUWA 2I5RA 5KQ8A 4ANRA 3AL0C 2VQEM 3M7GA 2DENA 5ITTA 4DV4M 3FTDA 3U6SA 3SFZA 2CUZA 3GLHB 2JXDA 2LNHC 4MM3B 4DR2M 3SYLA 2UUCM 3GPYA 2EKFA 1PRBA 5EP4A 3BXWA 1IY2A 1KBFA 3SAUA 2NU4I 2XLJA 3KP0E 1IXRC 2F5PA 2V53A 3TWMA 3NBXX 1L2BA 1U5KA 2BWEA 2Z7JA 5FSWA 2FFJA 3TO6A 2ERWA
chains in the Genus database with same CATH topology
3TE6A 2OPFA 4MGYE 1QYRA 2DWZB 2Y0TA 5FTLA 2C5RA 1KFVA 2RKOA 4NSOB 2ERCA 3SARA 1SGYI 1EQNA 3KOZE 2L09A 4A3VB 2CEAA 3HU3A 1DO0A 1Z6TA 5C1BA 3SHGB 4LJ5A 4CISA 5ITXE 4MB7A 1K3WA 4AKHA 2XSZA 4EE1A 1W5SA 1DS3I 1TGSI 3CF0A 3U60B 2M5ZA 3Q8XA 4DV1M 1IY0A 1JR3A 4LRSA 3SHFA 1G59A 4G4NA 2V6ZM 1YTPA 2LUYA 2QQCA 2DHRA 4JCVA 1XX6A 1NVMA 4I5SA 4EDVA 1YSYA 2KRUA 3KDSE 3KY9A 4LF4M 2QCUA 2FE8A 4FW9A 2C9CA 2XH9A 3M0EA 4EIWA 2QPOA 4R7GA 3AOEA 1N34M 3W0LB 1IBLM 1HQYE 4D80A 4DV6M 1QAOA 2KMOA 1FYBA 2X8AA 1YU6C 3DFZA 4LZJA 3VLFB 1TBOA 2C9OA 3FD9A 3I4VA 5ITQA 4L16A 2N71A 1IW4A 3J27B 4PDGA 4LJ4A 4KO8A 2XZFA 2DB6A 3UJNA 1VDDA 2QBYB 4JI2M 4LZZA 1HPTA 1V1IA 4OVOA 3K2LA 3GQ4A 2SGFI 4JI3M 3D8LA 4MGZE 3GQ5A 4I8OA 3VKHA 2SGPI 3OL0A 2FNFX 1XMOM 4FKDA 3E4RA 3U60A 2OQ4A 3ILKA 3CXLA 1IY6A 1Z7KB 5FTJA 1MT1A 3MEKA 2R65A 5ITUA 3PVSA 4QHTA 4KODA 4GC9A 1R2YA 2QQ0A 2CJSC 4AG5A 3HU1A 3VK7A 3A42A 5DYIA 1SGPI 3FKEA 1SGRI 2RGHA 1NY6A 4LFAM 4Z6YA 1IXSB 2L7XA 2M5XA 1HT1E 4B7FA 1TURA 3RFWA 4DR6M 5FTKA 2NU2I 3HJ8A 2Q2EA 2XZUA 4JN6A 2G5GX 1IN5A 4TUWA 1PJJA 1NJGA 4DV3M 2V1CC 1IXZA 3GRRA 5KO3A 2F5SA 4QNMA 5DNYA 3U6LA 1N32M 3GRUA 1N36M 1IN8A 2ROWA 3PDNA 1D2NA 3TQSA 3T15A 3VK8A 1D3YA 1XXHA 4IJEA 5IZ7D 4UXIA 5EJCA 2R4JA 4MGIE 3GLGA 2LWXA 4II7A 1J09A 2KXEA 5GKNA 4LGMA 3TWLA 2UUBM 3LQRA 5EP2A 1Z5CA 1CT4I 1KSFX 2ODDA 3IG5A 3LMMA 2A20A 2BUSA 2XEPA 3DOAA 1TH2A 1H0ZA 3RGSA 3J7AS 1DS2I 2P5TA 4X62M 4NL4H 2R45A 1CGII 3DZDA 1IN7A 2F5OA 2W82A 1Z59A 2DZNB 1EE8A 4JI6M 2ZBKA 4AG6A 3VDUA 1TBQR 1TOTA 3U61B 3GLIB 5H37D 3RGPA 3ZCBB 2XSZD 1Y8FA 2E5RA 3SGBI 1DGHB 5ITYA 2JYYA 3HHXA 2HL7A 2Y21A 4GHLA 5JI2E 2J87A 3RU0A 2R4EA 1PCEA 4O6OA 3K1JA 4PD2A 3FTFA 4JYAM 4NSRA 4NXNM 3GLHA 4XBOA 1TDHA 3TPZA 5KPTA 2UUAM 2I7NA 4B3SM 3E2IA 2QENA 2VIIA 1R7RA 1L2DA 2YQPA 2Y20A 3QTLD 2HHHM 3J7BA 1OYVI 3UGIA 2E73A 1NHGC 4GMQA 3QAUA 4AZFA 3A46A 3R8FA 1JQJC 4FCWA 3FUTA 2WCYA 2R62A 1E94E 2HCBA 4X66M 3U6CA 4JI4M 1SGQI 3HH2C 4LJ6A 4YHHM 3OVOA 1ZAEA 1V1HA 5E6JA 4EDKA 5ITRA 4X65M 4JV5M 1R0RI 1TGUA 1T3TA 2X49A 3R9XB 2M60A 1LR8A 4GKJM 1HJAI 1ORYB 3RE8A 4M9SA 3GP1A 2C96A 5CCLA 4LF6M 3IG8A 1IY5A 4UXHA 4MGKE 4Z8XA 4LF8M 5JHWC 4DUYM 3GRYA 1CHOI 3OTOM 1PJUA 2NU1I 1X74A 2GKVA 3GRVA 3KOXE 3GLFB 3AFHA 4DV2M 1DO2A 4I81A 4ZPXA 4OW0A 4X64M 4LF7M 4NOOB 3FUVA 3TWKA 5FUYA 1XWIA 1UVGA 2XRCA 1J7KA 2KEBA 2DWMA 3SMSA 4L8RC 4GI3C 1XMQM 3HHZA 4IBCA 3GPPA 1OMTA 1E9SA 4IBBA 3U5ZB 2ORVA 4O6PB 2AU3A 2L8EA 1MX0A 4JI7M 4JI8M 1OVOA 3K92A 1NUBA 4B6DA 1TDZA 1N77A 3C58A 2QQEA 3FC3A 3KS4A 1W4RA 3HGIA 2UXCM 2R46A 7CATA 2JA1A 4DV7M 1T6T1 4D81A 3MJ5A 1PTQA 3L27A 4DR5M 2XGNA 4AI6A 1HDLA 4GITA 1GL6A 3VKGA 5EX3A 3J80S 1I4WA 3OXFA 4IBJA 1ZQ9A 4DR3M 5EQTA 1DDEA 1Z5AA 3KOYE 1OJLA 1W3SA 1XBTA 2KMQA 4QOZC 1TUSA 2L6OA 3LVWA 4AKGA 1G41A 5EXXA 1XHBA 3WHLA 1XC8A 3KP1E 3GLFA 4HGUA 4RF0A 1R2ZA 1GKIA 2K47A 2Y0QA 1FJGM 2CHQA 4RNAA 1YE9A 1SGDI 2FNAA 4E1RA 4GKKM 3GPUA 2KZUA 2E5LM 2ZM6M 2VQFM 1N13A 5EX0A 2KA6B 3L25A 1NJFA 2ZAMA 2DZOB 2YQZA 5EXPA 1R6BX 3PXGA 1M8CA 4M0DA 2ELIA 4I4LA 4LG2A 3KSJA 3SMPA 1Z5BA 2B8TA 2X4AA 4NRWA 4EDGA 4JI5M 4IJFA 1LR9A 3U6DA 5FLXS 4DR1M 1IQPA 1YUBA 1IY1A 2V1CA 4GC5A 2KW0A 3DA1A 3EIEA 4R3DA 2BJVA 4OX9M 4KLNA 2SGEI 2QBYA 4K0KM 1IBMM 1N75A 1NNJA 2F3CI 5ITXA 2ORWA 5IWAM 5GUJA 3CF6E 3EIHA 2LH0A 3KFUG 4IBFA 2D7EA 3UMMA 3CTWB 1PM5A 4IBDA 4LJ7A 4MH0E 2OD1A 3JR4A 4FCTA 1N33M 1W5TA 1KYIA 5IREB 3E59A 4DV5M 1CE3A 3ZC7B 4AKIA 3KW6A 3J2PB 5HQ8A 2UZ3A 4PDIA 1WXQA 1XNQM 4GHAA 3MK6A 3THGA 3U6MA 4LY6A 2OVOA 2YUUA 4FWGA 3NBIA 4NXMM 2KMRA 4B7GA 3PNYA 3GO8A 2GVIA 4LJAA 5KPZA 1UVFA 3A98B 3B4VC 4NRVA 3SBJA 2UXBM 1I94M 1L1TA 2CE7A 1L1ZA 1HT2E 4L9MA 1SXJB 4FWDA 2CV0A 1SGNI 2DIPA 3KXEC 2DVWB 4DV0M 1AN1I 4IBEA 2UXDM 4L78A 1LV7A 5E26A 4LJ8A 1DGBA 3UGJA 3BOSA 4LF9M 1KMAA 4HLQA 2ARPF 3GOXA 5FUXA 3SATA 1XNRM 1CGJI 1IM2A 2LEOA 2J9RA 2G8LA 3UEJA 1FARA 5BPVA 3TJQA 2UU9M 1QANA 2Z4SA 3ZH9B 4ITQA 4REZA 4OVZB 3NWLA 1BMOA 1GLNA 2FOIC 5A2QS 4UXJA 3H4MA 3MHVC 2EA0A 3UFFA 1KBEA 2CHGA 2CFOA 2HKJA 3FYDA 3KVWA 3I4YA 3K8ZA 3T38A 3JAMS 2JW6A 4FVMA 1FNNA 1GL7A 2SGQI 3U61A 3GLIA 2KMPA 3M6AA 1PPFI 2QQDA 3UGLA 4LJ9A 1CT2I 1TBNA 5EP1A 1DGHA 3J81S 2ENZA 4M9ZA 1R79A 3SYKA 2NQ8C 3SAWA 1L8QA 2V1UA 3UZUA 1H6UA 1K82A 2ENNA 1SXJC 4WURA 2K9HA 3FYCA 4FCVA 4B7HA 5IT9S 3QWLA 2EO2A 4MGHA 1XA6A 4CGYB 4B3TM 1IN4A 4LGYA 2CHVA 3SAVA 1DD9A 4LFCM 4E2KA 2Z4RA 4AW4A 5DYGA 1S3SA 3VFDA 2XFTA 3VDPA 3D8BA 2F5QA 3B39A 4FWHA 3UK6A 3GPXA 4P16A 4G4RA 4PCZA 4GH9A 1QVRA 1L2CA 2KZSA 4OVZA 4BBAA 2DWNA 2B0UC 2YR0A 3UGDA 2JA2A 5C18A 2A5YB 3L28A 4IBGA 3SGQI 2CV2A 4L4UA 3JR5A 3HHWA 1PJIA 1TH4A 3CF2A 1RFHA 4BB9A 4GRIA 3HU2A 1GVNA 2KRKA 4HL4A 3FTEA 1CSOI 4B08A 1LR7A 1QZMA 4W5WA 2L7HA 4XGIA 5FTMA 2VRWB 3SASA 3SC3A 3KS8A 2YNMD 1NY5A 2AHMA 2SGDI 1X37A 4JI0M 2I7PA 3AOEC 4PT5A 1OFIA 3FUUA 4DUZM 4A24A 4QHSA 1HNWM 4IBKA 4IIWA 1TIHA 3D00A 4G6ZA 5EXSA 5FTNA 4EDTA 2D7HA 2Q2EB 4LRTA 1BUSA 4EDRA 3AKZA 3U5ZA 4YY3M 2ZANA 4L15A 4G4QA 1PTRA 2N1AB 3OXGA 4B3MM 4D82A 4DR4M 1XXHB 3FUXA 2XFSA 5LMUM 2ZAOA 1NSFA 2P6AC 3GLGB 1TBRR 1E32A 1K3XA 2GKTI 4GIPA 4LCBA 2J7NA 4LFBM 3LVVA 2NU3I 2WVJA 1QQWA 1M8BA 8CATA 3UEYA 1OMUA 3HKPA 1NNUC 1DGGA 2R18A 5F3WA 3KSXA 1SXJE 5EP3A 5KPRA 2F4VM 4LF5M 2EUCA 5LMNM 1QAMA 4JI1M 3OXLA 2J7OA 4JXJA 5BR8M 5JI3E 3HWSA 1HR0M 5EXTA 1FAQA 2ZBKB 2C98A 1Y1CA 5FUWA 1UUCA 1HNZM 2QPAA 4QNRA 4M9XA 4WW0A 5KQ8A 2NU0I 1NHWC 3SEKC 3AL0C 2VQEM 5KQDA 3M7GA 1QAQA 5ITTA 1SGEI 4IBIA 2QZ4A 3FTDA 3KOWE 4BLCA 4OU7A 2Z3XA 4DV4M 3SFZA 3U6SA 2DWLA 2F5NA 1DGFA 2CUZA 2QP9X 2W0TA 3GLHB 3PFIA 2JXDA 3A45A 1E9RA 1C1KA 2DXIA 2C99A 2LNHC 1IBKM 2LXEA 4JCVE 4SGBI 3AOGA 4MM3B 1HQCA 4DR2M 1SXJD 2L7IA 3I51A 3SYLA 2UUCM 1TH3A 3LQQA 4QOSA 1Q3CA 4G4OA 4KHPM 5DAEA 3GPYA 1J5EM 1G8PA 4E1PA 4CHTB 5EP4A 2RGOA 3U6QA 2O5RA 3T1YM 3U6PA 1HNXM 4DR7M 3E9SA 1X4SA 4S12A 1N78A 1IY2A 3GQ3A 3FTCA 2H1RA 1CT0I 2D7GA 1UM8A 2BJWA 1Q39A 2BNKA 3T1HM 4B3RM 1KBFA 3FUWA 3W0FA 4AQYM 3SAUA 1OFHA 1JR3D 3HJSA 3HHYA 1G4AE 2YFQA 3L29A 3L2AA 2CV1A 3WHKA 2N52A 1Q3BA 2NU4I 1Y1BA 1G3IA 3TL4X 3U6OA 2XLJA 3PNVA 3AJIB 5HI7A 5CCMA 3B9PA 3KP0E 1IXRC 2F5PA 3HJQA 5FUVA 3VE5A 3BJIA 3AV0A 2V53A 1IN6A 3TWMA 3U6EA 3L26A 2GKRI 2JZMA 1L2BA 1U5KA 1SXJA 2N17A 4FD2A 4M0WA 4RF1A 2Z7JA 1MU5A 5FSWA 2KCXA 3QWPA 2FFJA 2XF3A 2ERWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6P B;  2AU3 A;  1D3Y A;  3VDP A;  3B39 A;  5GUJ A;  1EQN A;  3D00 A;  4O6O A;  4EDT A;  4EDR A;  4EE1 A;  1T6T 1;  3VE5 A;  1VDD A;  4EDG A;  2Q2E A;  4JCV A;  1DDE A;  2V1C A;  2ZBK A;  3VDU A;  4E2K A;  4EDV A;  1DD9 A;  4EDK A; 
#chains in the Genus database with same CATH topology
 2OPF A;  1ZV1 A;  1QYR A;  5FTL A;  2RKO A;  2ERC A;  1EQN A;  3KOZ E;  4A3V B;  1DO0 A;  5C1B A;  2DI0 A;  1XXH E;  1DS3 I;  1TGS I;  2M5Z A;  3Q8X A;  1JR3 A;  4G4N A;  1NVM A;  3KDS E;  2FE8 A;  4FW9 A;  3LCV B;  4R7G A;  3W0L B;  2LVP C;  2KMO A;  2X8A A;  3VLF B;  2C9O A;  3FD9 A;  5ITQ A;  4PDG A;  4LJ4 A;  2XZF A;  3UJN A;  4OVO A;  2SGF I;  2PQ8 A;  2SGP I;  4HEO A;  2LVQ D;  1Z7K B;  2R65 A;  4QHT A;  2WSC F;  4Z6Y A;  2VDB B;  1TUR A;  3RFW A;  1WHC A;  1NJG A;  1IXZ A;  3GRR A;  5KO3 A;  2F5S A;  2WSF F;  1N36 M;  4P17 A;  2ROW A;  3VK8 A;  5IZ7 D;  5GKN A;  3LQR A;  1Z5C A;  1QUT A;  2BUS A;  3DOA A;  1H0Z A;  1DS2 I;  3J7A S;  2W82 A;  1EE8 A;  4JI6 M;  4AG6 A;  3SGB I;  3C3D A;  2XSZ D;  3F92 A;  1Y8F A;  5ITY A;  2JYY A;  5JI2 E;  2R4E A;  4NXN M;  4XBO A;  1TDH A;  2UUA M;  2I7N A;  3E2I A;  2VII A;  1R7R A;  3QTL D;  3J7B A;  3UGI A;  2E73 A;  1GAB A;  3QAU A;  4AZF A;  2R62 A;  4X66 M;  3U6C A;  4EDK A;  1R0R I;  3R9X B;  4GEW A;  4GKJ M;  3GP1 A;  3UOE A;  1CHO I;  2NU1 I;  3E46 A;  4X64 M;  5FUY A;  1XWI A;  2DWM A;  2X3T A;  1XMQ M;  1OMT A;  2ORV A;  1E9S A;  4O6P B;  2L8E A;  1OVO A;  3K92 A;  1NUB A;  1NO1 A;  2DAK A;  3FC3 A;  3MJ5 A;  1ZQ9 A;  5EQT A;  1XBT A;  1W3S A;  2OOB A;  3WHL A;  1XHB A;  3HZJ A;  5J8F A;  1WTJ A;  2K47 A;  1OIP A;  2CHQ A;  2FNA A;  4GKK M;  2E5L M;  2VQF M;  1V34 A;  1NJF A;  2WGC A;  1R6B X;  1M8C A;  1WJ7 A;  4LG2 A;  2APL A;  1LR9 A;  5FLX S;  4DR1 M;  2V1C A;  1OQY A;  3R5C A;  4RKU F;  1GO5 A;  5IWA M;  3CF6 E;  3EIH A;  2LH0 A;  3UMM A;  3CTW B;  4MH0 E;  3JR4 A;  4FCT A;  3ZC7 B;  3KW6 A;  1RU3 A;  2UZ3 A;  1WKX A;  1WXQ A;  4GHA A;  3U6M A;  4FWG A;  3GO8 A;  1IXS A;  2GVI A;  1UVF A;  3A98 B;  1SXJ B;  2DIP A;  1AN1 I;  4DV0 M;  2UXD M;  2RRU A;  4LJ8 A;  2ARP F;  2LEO A;  5BPV A;  5A2Q S;  3UFF A;  3JAM S;  3FYD A;  3KVW A;  1FNN A;  3U61 A;  3M6A A;  1TBN A;  1DGH A;  2RIJ A;  1L8Q A;  1K82 A;  2ENN A;  1SXJ C;  1TTE A;  2EO2 A;  4MGH A;  4E2K A;  1DD9 A;  1S3S A;  3VFD A;  3I01 M;  1OAO C;  4FWH A;  3TOB A;  4G4R A;  1QVR A;  2KZS A;  3UGD A;  5C18 A;  3L28 A;  3SGQ I;  4L4U A;  3JR5 A;  1PJI A;  1TH4 A;  4BB9 A;  3I04 M;  1QZM A;  2VRW B;  3SAS A;  2YNM D;  2LHG A;  4JI0 M;  4PT5 A;  1Q02 A;  4A24 A;  5EXS A;  5FTN A;  1AUA A;  2D7H A;  2L4E A;  2X52 A;  4DNC A;  2ZAN A;  2MJ5 B;  1XXH B;  2XFS A;  2ZAO A;  4GIP A;  2J7N A;  8CAT A;  2FCJ A;  2OU2 A;  3IEC A;  4JXJ A;  5BR8 M;  5JI3 E;  2MGW A;  1R4G A;  3HWS A;  2O25 A;  1UUC A;  2QPA A;  4QNR A;  4M9X A;  4WW0 A;  3T6P A;  1EFU B;  5KQD A;  4IBI A;  2Z3X A;  2DWL A;  2W0T A;  3A45 A;  3FE3 A;  4SGB I;  3AOG A;  1SXJ D;  3I51 A;  2LVA A;  1J5E M;  4E1P A;  3T1Y M;  1HNX M;  1UM8 A;  1T6O A;  2R0I A;  3HJS A;  3HHY A;  3L2A A;  1Q3B A;  3TL4 X;  1ZMW A;  2DKL A;  5HI7 A;  5CCM A;  3BJI A;  3U6E A;  2JZM A;  4FD2 A;  4RF1 A;  3QWP A;  1V33 A;  2KNA A;  2XF3 A;  4IIW A;  3TE6 A;  2Y0T A;  2C5R A;  1KFV A;  3HU3 A;  4LJ5 A;  4CIS A;  2XSZ A;  1W5S A;  2LHC A;  4DV1 M;  1IY0 A;  2V6Z M;  4JCV A;  2KRU A;  3KY9 A;  2C9C A;  3M0E A;  3AOE A;  1D0K A;  1IFY A;  4D80 A;  4DV6 M;  1YU6 C;  4LZJ A;  1TBO A;  2N71 A;  4KO8 A;  2DB6 A;  3K2L A;  3GQ4 A;  4XK8 F;  4JI3 M;  3D8L A;  3VKH A;  2FNF X;  3E4R A;  3FSY A;  2OQ4 A;  1MT1 A;  1A5T A;  4KOD A;  2CJS C;  3HU1 A;  2B3T A;  5DYI A;  1NY6 A;  4LFA M;  2CWF A;  2M5X A;  4B7F A;  1WIV A;  1FY7 A;  4DR6 M;  1P9Z A;  5DNY A;  3PDN A;  1F4I A;  1D3Y A;  2EJS A;  4II7 A;  1J09 A;  4LGM A;  5EP2 A;  1CT4 I;  2ODD A;  3RGS A;  2KNV A;  2R45 A;  1Z59 A;  3VDU A;  1TBQ R;  3GLI B;  4Y28 F;  3ZCB B;  2E5R A;  2GQF A;  2HL7 A;  4GHL A;  2J87 A;  4O6O A;  2MRO B;  4NSR A;  4B3S M;  1L2D A;  2HHH M;  1NHG C;  2O01 F;  4GMQ A;  2DZL A;  3R8F A;  1JQJ C;  2WCY A;  2HCB A;  3HH2 C;  4JI4 M;  3OVO A;  1T3T A;  2M60 A;  2JUJ A;  5CCL A;  2QQ8 A;  3IG8 A;  4G3O A;  4Z8X A;  3W67 A;  4UXH A;  4LF8 M;  4DUY M;  1X74 A;  3KOX E;  3GLF B;  3QAH A;  1DO2 A;  4ZPX A;  4OW0 A;  1Z2I A;  2EKK A;  4IBC A;  3GPP A;  1MX0 A;  2G3Q A;  3C58 A;  2K0B X;  7CAT A;  2JA1 A;  4DV7 M;  4DR5 M;  2XGN A;  4GIT A;  1GL6 A;  3OXF A;  4IBJ A;  3KOY E;  5EXX A;  4RF0 A;  4RNA A;  4E1R A;  3GPU A;  2ZM6 M;  1N13 A;  2DZO B;  4M0D A;  1ZMU A;  2X4A A;  4NRW A;  1IY1 A;  1VEG A;  3EIE A;  2QBY A;  9WGA A;  1N75 A;  1P9G A;  2QSF X;  2ORW A;  5GUJ A;  4IBF A;  2D7E A;  1PM5 A;  1P3Q Q;  1V92 A;  5IRE B;  3J2P B;  2FH0 A;  4PDI A;  2LVO C;  1XNQ M;  4LY6 A;  3E21 A;  3PNY A;  2RC4 A;  5L8R F;  1JB0 F;  4LJA A;  2R44 A;  1T43 A;  2UXB M;  3LCU A;  1LTM A;  2CE7 A;  1VDL A;  1HT2 E;  2CV0 A;  3KXE C;  2DVW B;  4L78 A;  3BOS A;  2JZ1 A;  1XNR M;  2J9R A;  1FAR A;  2UU9 M;  1QAN A;  3ZH9 B;  4ITQ A;  4KT0 F;  4OVZ B;  3NWL A;  1BMO A;  3H4M A;  2HKJ A;  1PGY A;  1MJ9 A;  3I4Y A;  4FVM A;  1GL7 A;  1PPF I;  4LJ9 A;  5EP1 A;  3J81 S;  2ENZ A;  3SYK A;  1TF0 B;  2QHO B;  4WUR A;  4B7H A;  1D0L A;  1XA6 A;  4CGY B;  4B3T M;  2CHV A;  2XFT A;  2F5Q A;  3D8B A;  3UK6 A;  3GPX A;  4P16 A;  2JWS A;  4PCZ A;  4GH9 A;  3BBZ A;  1L2C A;  2DWN A;  2CV2 A;  3CF2 A;  1RFH A;  1AIP C;  2KRK A;  4HL4 A;  1CSO I;  4F2L A;  4W5W A;  2L7H A;  1NY5 A;  2SGD I;  2I7P A;  2LVN C;  3FUU A;  4QHS A;  4IBK A;  3D00 A;  4G6Z A;  2MH8 A;  3U5Z A;  2KNZ A;  4G4Q A;  4B3M M;  4D82 A;  4DR4 M;  5LMU M;  2P6A C;  1OKS A;  4LCB A;  4LFB M;  2JY7 A;  1UFZ A;  1K7U A;  2R18 A;  5F3W A;  2CWG A;  5EP3 A;  5KPR A;  2EUC A;  3OXL A;  4JI1 M;  1FAQ A;  2C98 A;  3Q8G A;  2NU0 I;  1NHW C;  2GIV A;  1SGE I;  1IY6 A;  2QZ4 A;  3C3E A;  3KOW E;  1DGF A;  3PFI A;  1HEV A;  1PJQ A;  2C99 A;  4JCV E;  1HQC A;  2L7I A;  3V76 A;  4G4O A;  5DAE A;  2R6F A;  4CHT B;  1X4S A;  2RGO A;  3U6Q A;  3U6P A;  2DAG A;  4S12 A;  1OTR A;  3FTC A;  2H1R A;  1CT0 I;  2D7G A;  3T1H M;  4B3R M;  3FUW A;  4AQY M;  1OFH A;  1JR3 D;  2N52 A;  2FS1 A;  1Y1B A;  1G3I A;  3U6O A;  3PNV A;  3AJI B;  4DBG B;  2VF7 A;  3VE5 A;  3AV0 A;  2GKR I;  2N17 A;  7WGA A;  2QNJ A;  4M0W A;  1MU5 A;  2KCX A;  2UVO A;  3SAR A;  2HWJ A;  4NSO B;  1SGY I;  2CEA A;  1Z6T A;  3SHG B;  4EE1 A;  4MB7 A;  4AKH A;  2JNH A;  3U60 B;  1G59 A;  2LUY A;  4I5S A;  4LF4 M;  1BVS A;  2CP8 A;  2XH9 A;  4EIW A;  2QPO A;  1R5L A;  1N34 M;  1IBL M;  1QAO A;  3I4V A;  4L16 A;  3J27 B;  1VDD A;  4JI2 M;  1QDR A;  1V1I A;  3GQ5 A;  3FSX A;  1MN3 A;  1XMO M;  4FKD A;  3FRI A;  3ILK A;  3CXL A;  5FTJ A;  3MEK A;  5ITU A;  2QQ0 A;  1MJA A;  3VK7 A;  1SGP I;  1IXS B;  1Y8G A;  1HT1 E;  1PJT A;  5FTK A;  2Q2E A;  1IN5 A;  4TUW A;  2V1C C;  4QNM A;  1N32 M;  1IN8 A;  3T15 A;  4UXI A;  2DNA A;  3GLG A;  3TWL A;  2UUB M;  1ULK A;  1KSF X;  3IG5 A;  2A20 A;  2XEP A;  3TOA A;  1IN7 A;  2KHH A;  2ZBK A;  3U61 B;  1ULN A;  3RGP A;  1DGH B;  2LB7 A;  2Y21 A;  3RU0 A;  3K1J A;  4PD2 A;  1EIJ A;  3GLH A;  3TPZ A;  2K6B A;  5KPT A;  3R5D A;  2MR9 A;  2Y20 A;  1MJG M;  1CUK A;  2OO9 A;  3A46 A;  5J8C A;  4FCW A;  3FUT A;  1E94 E;  1SGQ I;  1ZAE A;  2JY6 B;  5E6J A;  1LR8 A;  2X49 A;  2DKV A;  1HJA I;  4NC6 A;  3RE8 A;  3R5B A;  4LF6 M;  1IY5 A;  2BWB A;  3GRY A;  3B7Q A;  3OTO M;  2GKV A;  3GRV A;  3ZQJ A;  4LF7 M;  4NOO B;  3TWK A;  2GNO A;  2KEB A;  3SMS A;  3HHZ A;  4IBB A;  2AU3 A;  4B6D A;  1TDZ A;  1N77 A;  2QQE A;  3KS4 A;  1W4R A;  2UXC M;  2R46 A;  1D0M A;  1PTQ A;  3L27 A;  4AI6 A;  3MMP A;  1HDL A;  3VKG A;  5EX3 A;  5E3R A;  3J80 S;  1UHA A;  2JZ0 A;  1Z5A A;  4QOZ C;  3LVW A;  4HGU A;  3GLF A;  1WGC A;  2K9D A;  1R2Z A;  1GKI A;  2Y0Q A;  1ULM A;  1YE9 A;  2KZU A;  5EX0 A;  3L25 A;  5EXP A;  3PXG A;  2LTU A;  1Z5B A;  2B8T A;  4EDG A;  1QUS A;  4JI5 M;  1IQP A;  1YUB A;  4GC5 A;  2KW0 A;  4KLN A;  3R5A A;  1NNJ A;  2F3C I;  4Q7J A;  4IBD A;  2L2D A;  1NV8 A;  1W5T A;  4DV5 M;  1CE3 A;  2ZTD A;  3MK6 A;  5E3P A;  1YLA A;  3B4V C;  4NRV A;  3SBJ A;  1WGL A;  1SGN I;  2ZTC A;  5E26 A;  3IHP A;  1KMA A;  3LW5 F;  3GOX A;  1NV9 A;  3SAT A;  2DAM A;  1IM2 A;  3TJQ A;  2Z4S A;  2FOI C;  1QDT A;  2CHG A;  2SGQ I;  1WGN A;  2QQD A;  2NQ8 C;  1G71 A;  3UZU A;  1H6U A;  2K9H A;  4FCV A;  2CWH A;  3TO7 A;  1DV0 A;  1IN4 A;  4LGY A;  3SAV A;  2Z4R A;  3VDP A;  1WR1 B;  4OVZ A;  1NXU A;  4BBA A;  2B0U C;  2YR0 A;  2A5Y B;  2OZU A;  3HHW A;  4GRI A;  3QYB A;  3FTE A;  1LR7 A;  5FTM A;  1VEJ A;  3KS8 A;  2AHM A;  1X37 A;  3AOE C;  1OFI A;  1HNW M;  4LRT A;  4EDR A;  4YY3 M;  4L15 A;  2N1A B;  3OXG A;  2GKT I;  3LVV A;  3B89 A;  2NU3 I;  1K7V A;  2DHY A;  1OMU A;  3HKP A;  3KSX A;  2F4V M;  2Y0M A;  1QAM A;  2KDL A;  5EXT A;  2N35 A;  1S20 A;  1ZMV A;  1HNZ M;  3SEK C;  1QAQ A;  2V1U A;  4OU7 A;  4BLC A;  1N78 A;  4EDV A;  2F5N A;  2QP9 X;  2LBC A;  1E9R A;  1C1K A;  2DXI A;  1IBK M;  2LXE A;  2WSE F;  1TH3 A;  3LQQ A;  4QOS A;  5E3Q A;  1Q3C A;  4KHP M;  1G8P A;  2O5R A;  4DR7 M;  3E9S A;  3GQ3 A;  2BJW A;  1Q39 A;  2BNK A;  3W0F A;  1G4A E;  2YFQ A;  3L29 A;  2CV1 A;  3WHK A;  1GJT A;  3B9P A;  3HJQ A;  5FUV A;  1IN6 A;  2Z8Y M;  3L26 A;  3TO9 A;  3K9O A;  1SXJ A;  2OOA A;  1GJS A;  5JHW C;  4MGY E;  2DWZ B;  4UN2 B;  2L09 A;  5ITX E;  1K3W A;  3B7N A;  4CJ6 A;  3CF0 A;  3GLG E;  2J5Y A;  3SHF A;  4LRS A;  2QQC A;  1YTP A;  2DHR A;  1XX6 A;  1YSY A;  2QCU A;  1HQY E;  1C7Y A;  1FYB A;  3DFZ A;  1IW4 A;  1VEK A;  3FRH A;  2QBY B;  4LZZ A;  1HPT A;  2DAE A;  4MGZ E;  4I8O A;  3OL0 A;  3GLH E;  3U60 A;  4MPI A;  3PVS A;  4GC9 A;  1R2Y A;  2HAK A;  4AG5 A;  3A42 A;  1SGR I;  3FKE A;  2RGH A;  2L7X A;  3GLI E;  2NU2 I;  3HJ8 A;  2XZU A;  1VG5 A;  2G5G X;  4JN6 A;  1PJJ A;  4DV3 M;  3U6L A;  3GRU A;  1D2N A;  3TQS A;  1OAI A;  1XXH A;  4IJE A;  5EJC A;  2R4J A;  4MGI E;  2LWX A;  2KXE A;  3LMM A;  4F1I A;  1TH2 A;  2P5T A;  4X62 M;  4NL4 H;  1CGI I;  3DZD A;  2F5O A;  2DZN B;  1TOT A;  5H37 D;  3HHX A;  1MJB A;  4AML A;  1PCE A;  4WP2 A;  3FTF A;  4JYA M;  3GLF E;  2QEN A;  2YQP A;  1OYV I;  4LJ6 A;  4YHH M;  1V1H A;  5ITR A;  4X65 M;  4JV5 M;  1TGU A;  1ORY B;  4M9S A;  2C96 A;  1PJS A;  4MGK E;  3H4J A;  3B74 A;  1PJU A;  1TR8 A;  4DV2 M;  3AFH A;  4I81 A;  3FUV A;  2CRU A;  1UVG A;  2XRC A;  1J7K A;  4L8R C;  4GI3 C;  3U5Z B;  2WZJ A;  4JI7 M;  4JI8 M;  1WGT A;  1QZE A;  3HGI A;  1T6T 1;  4D81 A;  1I4W A;  3HX3 A;  4DR3 M;  1DDE A;  1K7T A;  2VF8 A;  2KMQ A;  1OJL A;  1TUS A;  2L6O A;  4AKG A;  1G41 A;  1XC8 A;  3KP1 E;  1Q9B A;  1FJG M;  1SGD I;  2KA6 B;  2ZAM A;  2YQZ A;  2ELI A;  3CGW A;  4I4L A;  3KSJ A;  3SMP A;  4IJF A;  3U6D A;  3DA1 A;  4R3D A;  2BJV A;  4OX9 M;  2SGE I;  4K0K M;  2JXN A;  1IBM M;  5ITX A;  3KFU G;  1HJP A;  4R71 A;  4LJ7 A;  2OD1 A;  1N33 M;  1KYI A;  3E59 A;  4AKI A;  5HQ8 A;  3W68 A;  3THG A;  1OIZ A;  2OVO A;  2YUU A;  3NBI A;  4NXM M;  2KMR A;  4B7G A;  1JR3 E;  5KPZ A;  2L4F A;  1I94 M;  2DAI A;  1L1T A;  1L1Z A;  4L9M A;  4FWD A;  5DFL A;  4IBE A;  3UGJ A;  1LV7 A;  1DGB A;  4LF9 M;  4HLQ A;  5FUX A;  1CGJ I;  2G8L A;  3UEJ A;  4REZ A;  1GLN A;  4UXJ A;  3MHV C;  2H5X A;  3C9P A;  2EA0 A;  1KBE A;  2JW6 A;  2CFO A;  3K8Z A;  3K9P A;  3T38 A;  3GLI A;  2KMP A;  4L6V 6;  1CT2 I;  3UGL A;  4M9Z A;  1R79 A;  3SAW A;  3FYC A;  5IT9 S;  1SG9 A;  3QWL A;  2CWB A;  4LFC M;  2JY5 A;  4AW4 A;  5DYG A;  3B39 A;  1XB2 B;  3QYE A;  2JA2 A;  4IBG A;  1GVN A;  3HU2 A;  4B08 A;  3HY5 A;  4XGI A;  3SC3 A;  4DUZ M;  3B7Z A;  1TIH A;  4CIZ A;  4EDT A;  2Q2E B;  1BUS A;  3AKZ A;  2JP7 A;  1VQ1 A;  1PTR A;  3FUX A;  1NSF A;  3GLG B;  1TBR R;  1E32 A;  1K3X A;  4WP4 A;  2WVJ A;  1QQW A;  1M8B A;  3UEY A;  1NNU C;  1DGG A;  1SXJ E;  4LF5 M;  2JY8 A;  5LMN M;  2J7O A;  1HR0 M;  2ZBK B;  1Y1C A;  5FUW A;  2I5R A;  5KQ8 A;  4ANR A;  3AL0 C;  2VQE M;  3M7G A;  2DEN A;  5ITT A;  4DV4 M;  3FTD A;  3U6S A;  3SFZ A;  2CUZ A;  3GLH B;  2JXD A;  2LNH C;  4MM3 B;  4DR2 M;  3SYL A;  2UUC M;  3GPY A;  2EKF A;  1PRB A;  5EP4 A;  3BXW A;  1IY2 A;  1KBF A;  3SAU A;  2NU4 I;  2XLJ A;  3KP0 E;  1IXR C;  2F5P A;  2V53 A;  3TWM A;  3NBX X;  1L2B A;  1U5K A;  2BWE A;  2Z7J A;  5FSW A;  2FFJ A;  3TO6 A;  2ERW A; 
#chains in the Genus database with same CATH homology
 3TE6 A;  2OPF A;  4MGY E;  1QYR A;  2DWZ B;  2Y0T A;  5FTL A;  2C5R A;  1KFV A;  2RKO A;  4NSO B;  2ERC A;  3SAR A;  1SGY I;  1EQN A;  3KOZ E;  2L09 A;  4A3V B;  2CEA A;  3HU3 A;  1DO0 A;  1Z6T A;  5C1B A;  3SHG B;  4LJ5 A;  4CIS A;  5ITX E;  4MB7 A;  1K3W A;  4AKH A;  2XSZ A;  4EE1 A;  1W5S A;  1DS3 I;  1TGS I;  3CF0 A;  3U60 B;  2M5Z A;  3Q8X A;  4DV1 M;  1IY0 A;  1JR3 A;  4LRS A;  3SHF A;  1G59 A;  4G4N A;  2V6Z M;  1YTP A;  2LUY A;  2QQC A;  2DHR A;  4JCV A;  1XX6 A;  1NVM A;  4I5S A;  4EDV A;  1YSY A;  2KRU A;  3KDS E;  3KY9 A;  4LF4 M;  2QCU A;  2FE8 A;  4FW9 A;  2C9C A;  2XH9 A;  3M0E A;  4EIW A;  2QPO A;  4R7G A;  3AOE A;  1N34 M;  3W0L B;  1IBL M;  1HQY E;  4D80 A;  4DV6 M;  1QAO A;  2KMO A;  1FYB A;  2X8A A;  1YU6 C;  3DFZ A;  4LZJ A;  3VLF B;  1TBO A;  2C9O A;  3FD9 A;  3I4V A;  5ITQ A;  4L16 A;  2N71 A;  1IW4 A;  3J27 B;  4PDG A;  4LJ4 A;  4KO8 A;  2XZF A;  2DB6 A;  3UJN A;  1VDD A;  2QBY B;  4JI2 M;  4LZZ A;  1HPT A;  1V1I A;  4OVO A;  3K2L A;  3GQ4 A;  2SGF I;  4JI3 M;  3D8L A;  4MGZ E;  3GQ5 A;  4I8O A;  3VKH A;  2SGP I;  3OL0 A;  2FNF X;  1XMO M;  4FKD A;  3E4R A;  3U60 A;  2OQ4 A;  3ILK A;  3CXL A;  1IY6 A;  1Z7K B;  5FTJ A;  1MT1 A;  3MEK A;  2R65 A;  5ITU A;  3PVS A;  4QHT A;  4KOD A;  4GC9 A;  1R2Y A;  2QQ0 A;  2CJS C;  4AG5 A;  3HU1 A;  3VK7 A;  3A42 A;  5DYI A;  1SGP I;  3FKE A;  1SGR I;  2RGH A;  1NY6 A;  4LFA M;  4Z6Y A;  1IXS B;  2L7X A;  2M5X A;  1HT1 E;  4B7F A;  1TUR A;  3RFW A;  4DR6 M;  5FTK A;  2NU2 I;  3HJ8 A;  2Q2E A;  2XZU A;  4JN6 A;  2G5G X;  1IN5 A;  4TUW A;  1PJJ A;  1NJG A;  4DV3 M;  2V1C C;  1IXZ A;  3GRR A;  5KO3 A;  2F5S A;  4QNM A;  5DNY A;  3U6L A;  1N32 M;  3GRU A;  1N36 M;  1IN8 A;  2ROW A;  3PDN A;  1D2N A;  3TQS A;  3T15 A;  3VK8 A;  1D3Y A;  1XXH A;  4IJE A;  5IZ7 D;  4UXI A;  5EJC A;  2R4J A;  4MGI E;  3GLG A;  2LWX A;  4II7 A;  1J09 A;  2KXE A;  5GKN A;  4LGM A;  3TWL A;  2UUB M;  3LQR A;  5EP2 A;  1Z5C A;  1CT4 I;  1KSF X;  2ODD A;  3IG5 A;  3LMM A;  2A20 A;  2BUS A;  2XEP A;  3DOA A;  1TH2 A;  1H0Z A;  3RGS A;  3J7A S;  1DS2 I;  2P5T A;  4X62 M;  4NL4 H;  2R45 A;  1CGI I;  3DZD A;  1IN7 A;  2F5O A;  2W82 A;  1Z59 A;  2DZN B;  1EE8 A;  4JI6 M;  2ZBK A;  4AG6 A;  3VDU A;  1TBQ R;  1TOT A;  3U61 B;  3GLI B;  5H37 D;  3RGP A;  3ZCB B;  2XSZ D;  1Y8F A;  2E5R A;  3SGB I;  1DGH B;  5ITY A;  2JYY A;  3HHX A;  2HL7 A;  2Y21 A;  4GHL A;  5JI2 E;  2J87 A;  3RU0 A;  2R4E A;  1PCE A;  4O6O A;  3K1J A;  4PD2 A;  3FTF A;  4JYA M;  4NSR A;  4NXN M;  3GLH A;  4XBO A;  1TDH A;  3TPZ A;  5KPT A;  2UUA M;  2I7N A;  4B3S M;  3E2I A;  2QEN A;  2VII A;  1R7R A;  1L2D A;  2YQP A;  2Y20 A;  3QTL D;  2HHH M;  3J7B A;  1OYV I;  3UGI A;  2E73 A;  1NHG C;  4GMQ A;  3QAU A;  4AZF A;  3A46 A;  3R8F A;  1JQJ C;  4FCW A;  3FUT A;  2WCY A;  2R62 A;  1E94 E;  2HCB A;  4X66 M;  3U6C A;  4JI4 M;  1SGQ I;  3HH2 C;  4LJ6 A;  4YHH M;  3OVO A;  1ZAE A;  1V1H A;  5E6J A;  4EDK A;  5ITR A;  4X65 M;  4JV5 M;  1R0R I;  1TGU A;  1T3T A;  2X49 A;  3R9X B;  2M60 A;  1LR8 A;  4GKJ M;  1HJA I;  1ORY B;  3RE8 A;  4M9S A;  3GP1 A;  2C96 A;  5CCL A;  4LF6 M;  3IG8 A;  1IY5 A;  4UXH A;  4MGK E;  4Z8X A;  4LF8 M;  5JHW C;  4DUY M;  3GRY A;  1CHO I;  3OTO M;  1PJU A;  2NU1 I;  1X74 A;  2GKV A;  3GRV A;  3KOX E;  3GLF B;  3AFH A;  4DV2 M;  1DO2 A;  4I81 A;  4ZPX A;  4OW0 A;  4X64 M;  4LF7 M;  4NOO B;  3FUV A;  3TWK A;  5FUY A;  1XWI A;  1UVG A;  2XRC A;  1J7K A;  2KEB A;  2DWM A;  3SMS A;  4L8R C;  4GI3 C;  1XMQ M;  3HHZ A;  4IBC A;  3GPP A;  1OMT A;  1E9S A;  4IBB A;  3U5Z B;  2ORV A;  4O6P B;  2AU3 A;  2L8E A;  1MX0 A;  4JI7 M;  4JI8 M;  1OVO A;  3K92 A;  1NUB A;  4B6D A;  1TDZ A;  1N77 A;  3C58 A;  2QQE A;  3FC3 A;  3KS4 A;  1W4R A;  3HGI A;  2UXC M;  2R46 A;  7CAT A;  2JA1 A;  4DV7 M;  1T6T 1;  4D81 A;  3MJ5 A;  1PTQ A;  3L27 A;  4DR5 M;  2XGN A;  4AI6 A;  1HDL A;  4GIT A;  1GL6 A;  3VKG A;  5EX3 A;  3J80 S;  1I4W A;  3OXF A;  4IBJ A;  1ZQ9 A;  4DR3 M;  5EQT A;  1DDE A;  1Z5A A;  3KOY E;  1OJL A;  1W3S A;  1XBT A;  2KMQ A;  4QOZ C;  1TUS A;  2L6O A;  3LVW A;  4AKG A;  1G41 A;  5EXX A;  1XHB A;  3WHL A;  1XC8 A;  3KP1 E;  3GLF A;  4HGU A;  4RF0 A;  1R2Z A;  1GKI A;  2K47 A;  2Y0Q A;  1FJG M;  2CHQ A;  4RNA A;  1YE9 A;  1SGD I;  2FNA A;  4E1R A;  4GKK M;  3GPU A;  2KZU A;  2E5L M;  2ZM6 M;  2VQF M;  1N13 A;  5EX0 A;  2KA6 B;  3L25 A;  1NJF A;  2ZAM A;  2DZO B;  2YQZ A;  5EXP A;  1R6B X;  3PXG A;  1M8C A;  4M0D A;  2ELI A;  4I4L A;  4LG2 A;  3KSJ A;  3SMP A;  1Z5B A;  2B8T A;  2X4A A;  4NRW A;  4EDG A;  4JI5 M;  4IJF A;  1LR9 A;  3U6D A;  5FLX S;  4DR1 M;  1IQP A;  1YUB A;  1IY1 A;  2V1C A;  4GC5 A;  2KW0 A;  3DA1 A;  3EIE A;  4R3D A;  2BJV A;  4OX9 M;  4KLN A;  2SGE I;  2QBY A;  4K0K M;  1IBM M;  1N75 A;  1NNJ A;  2F3C I;  5ITX A;  2ORW A;  5IWA M;  5GUJ A;  3CF6 E;  3EIH A;  2LH0 A;  3KFU G;  4IBF A;  2D7E A;  3UMM A;  3CTW B;  1PM5 A;  4IBD A;  4LJ7 A;  4MH0 E;  2OD1 A;  3JR4 A;  4FCT A;  1N33 M;  1W5T A;  1KYI A;  5IRE B;  3E59 A;  4DV5 M;  1CE3 A;  3ZC7 B;  4AKI A;  3KW6 A;  3J2P B;  5HQ8 A;  2UZ3 A;  4PDI A;  1WXQ A;  1XNQ M;  4GHA A;  3MK6 A;  3THG A;  3U6M A;  4LY6 A;  2OVO A;  2YUU A;  4FWG A;  3NBI A;  4NXM M;  2KMR A;  4B7G A;  3PNY A;  3GO8 A;  2GVI A;  4LJA A;  5KPZ A;  1UVF A;  3A98 B;  3B4V C;  4NRV A;  3SBJ A;  2UXB M;  1I94 M;  1L1T A;  2CE7 A;  1L1Z A;  1HT2 E;  4L9M A;  1SXJ B;  4FWD A;  2CV0 A;  1SGN I;  2DIP A;  3KXE C;  2DVW B;  4DV0 M;  1AN1 I;  4IBE A;  2UXD M;  4L78 A;  1LV7 A;  5E26 A;  4LJ8 A;  1DGB A;  3UGJ A;  3BOS A;  4LF9 M;  1KMA A;  4HLQ A;  2ARP F;  3GOX A;  5FUX A;  3SAT A;  1XNR M;  1CGJ I;  1IM2 A;  2LEO A;  2J9R A;  2G8L A;  3UEJ A;  1FAR A;  5BPV A;  3TJQ A;  2UU9 M;  1QAN A;  2Z4S A;  3ZH9 B;  4ITQ A;  4REZ A;  4OVZ B;  3NWL A;  1BMO A;  1GLN A;  2FOI C;  5A2Q S;  4UXJ A;  3H4M A;  3MHV C;  2EA0 A;  3UFF A;  1KBE A;  2CHG A;  2CFO A;  2HKJ A;  3FYD A;  3KVW A;  3I4Y A;  3K8Z A;  3T38 A;  3JAM S;  2JW6 A;  4FVM A;  1FNN A;  1GL7 A;  2SGQ I;  3U61 A;  3GLI A;  2KMP A;  3M6A A;  1PPF I;  2QQD A;  3UGL A;  4LJ9 A;  1CT2 I;  1TBN A;  5EP1 A;  1DGH A;  3J81 S;  2ENZ A;  4M9Z A;  1R79 A;  3SYK A;  2NQ8 C;  3SAW A;  1L8Q A;  2V1U A;  3UZU A;  1H6U A;  1K82 A;  2ENN A;  1SXJ C;  4WUR A;  2K9H A;  3FYC A;  4FCV A;  4B7H A;  5IT9 S;  3QWL A;  2EO2 A;  4MGH A;  1XA6 A;  4CGY B;  4B3T M;  1IN4 A;  4LGY A;  2CHV A;  3SAV A;  1DD9 A;  4LFC M;  4E2K A;  2Z4R A;  4AW4 A;  5DYG A;  1S3S A;  3VFD A;  2XFT A;  3VDP A;  3D8B A;  2F5Q A;  3B39 A;  4FWH A;  3UK6 A;  3GPX A;  4P16 A;  4G4R A;  4PCZ A;  4GH9 A;  1QVR A;  1L2C A;  2KZS A;  4OVZ A;  4BBA A;  2DWN A;  2B0U C;  2YR0 A;  3UGD A;  2JA2 A;  5C18 A;  2A5Y B;  3L28 A;  4IBG A;  3SGQ I;  2CV2 A;  4L4U A;  3JR5 A;  3HHW A;  1PJI A;  1TH4 A;  3CF2 A;  1RFH A;  4BB9 A;  4GRI A;  3HU2 A;  1GVN A;  2KRK A;  4HL4 A;  3FTE A;  1CSO I;  4B08 A;  1LR7 A;  1QZM A;  4W5W A;  2L7H A;  4XGI A;  5FTM A;  2VRW B;  3SAS A;  3SC3 A;  3KS8 A;  2YNM D;  1NY5 A;  2AHM A;  2SGD I;  1X37 A;  4JI0 M;  2I7P A;  3AOE C;  4PT5 A;  1OFI A;  3FUU A;  4DUZ M;  4A24 A;  4QHS A;  1HNW M;  4IBK A;  4IIW A;  1TIH A;  3D00 A;  4G6Z A;  5EXS A;  5FTN A;  4EDT A;  2D7H A;  2Q2E B;  4LRT A;  1BUS A;  4EDR A;  3AKZ A;  3U5Z A;  4YY3 M;  2ZAN A;  4L15 A;  4G4Q A;  1PTR A;  2N1A B;  3OXG A;  4B3M M;  4D82 A;  4DR4 M;  1XXH B;  3FUX A;  2XFS A;  5LMU M;  2ZAO A;  1NSF A;  2P6A C;  3GLG B;  1TBR R;  1E32 A;  1K3X A;  2GKT I;  4GIP A;  4LCB A;  2J7N A;  4LFB M;  3LVV A;  2NU3 I;  2WVJ A;  1QQW A;  1M8B A;  8CAT A;  3UEY A;  1OMU A;  3HKP A;  1NNU C;  1DGG A;  2R18 A;  5F3W A;  3KSX A;  1SXJ E;  5EP3 A;  5KPR A;  2F4V M;  4LF5 M;  2EUC A;  5LMN M;  1QAM A;  4JI1 M;  3OXL A;  2J7O A;  4JXJ A;  5BR8 M;  5JI3 E;  3HWS A;  1HR0 M;  5EXT A;  1FAQ A;  2ZBK B;  2C98 A;  1Y1C A;  5FUW A;  1UUC A;  1HNZ M;  2QPA A;  4QNR A;  4M9X A;  4WW0 A;  5KQ8 A;  2NU0 I;  1NHW C;  3SEK C;  3AL0 C;  2VQE M;  5KQD A;  3M7G A;  1QAQ A;  5ITT A;  1SGE I;  4IBI A;  2QZ4 A;  3FTD A;  3KOW E;  4BLC A;  4OU7 A;  2Z3X A;  4DV4 M;  3SFZ A;  3U6S A;  2DWL A;  2F5N A;  1DGF A;  2CUZ A;  2QP9 X;  2W0T A;  3GLH B;  3PFI A;  2JXD A;  3A45 A;  1E9R A;  1C1K A;  2DXI A;  2C99 A;  2LNH C;  1IBK M;  2LXE A;  4JCV E;  4SGB I;  3AOG A;  4MM3 B;  1HQC A;  4DR2 M;  1SXJ D;  2L7I A;  3I51 A;  3SYL A;  2UUC M;  1TH3 A;  3LQQ A;  4QOS A;  1Q3C A;  4G4O A;  4KHP M;  5DAE A;  3GPY A;  1J5E M;  1G8P A;  4E1P A;  4CHT B;  5EP4 A;  2RGO A;  3U6Q A;  2O5R A;  3T1Y M;  3U6P A;  1HNX M;  4DR7 M;  3E9S A;  1X4S A;  4S12 A;  1N78 A;  1IY2 A;  3GQ3 A;  3FTC A;  2H1R A;  1CT0 I;  2D7G A;  1UM8 A;  2BJW A;  1Q39 A;  2BNK A;  3T1H M;  4B3R M;  1KBF A;  3FUW A;  3W0F A;  4AQY M;  3SAU A;  1OFH A;  1JR3 D;  3HJS A;  3HHY A;  1G4A E;  2YFQ A;  3L29 A;  3L2A A;  2CV1 A;  3WHK A;  2N52 A;  1Q3B A;  2NU4 I;  1Y1B A;  1G3I A;  3TL4 X;  3U6O A;  2XLJ A;  3PNV A;  3AJI B;  5HI7 A;  5CCM A;  3B9P A;  3KP0 E;  1IXR C;  2F5P A;  3HJQ A;  5FUV A;  3VE5 A;  3BJI A;  3AV0 A;  2V53 A;  1IN6 A;  3TWM A;  3U6E A;  3L26 A;  2GKR I;  2JZM A;  1L2B A;  1U5K A;  1SXJ A;  2N17 A;  4FD2 A;  4M0W A;  4RF1 A;  2Z7J A;  1MU5 A;  5FSW A;  2KCX A;  3QWP A;  2FFJ A;  2XF3 A;  2ERW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...