3VDUA

Structure of recombination mediator protein recrk21g mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPGTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
molecule keywords Recombination protein recR
total genus 52
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vduA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vduA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vduA03
1T6T1 2AU3A 2ZBKA 4EDGA 3VDPA 4EDKA 4EE1A 4O6PB 2Q2EA 4EDTA 1D3YA 2V1CA 4E2KA 4O6OA 3VE5A 1EQNA 5GUJA 4JCVA 4EDRA 3D00A 4EDVA 3VDUA 3B39A 1DDEA 1DD9A 1VDDA
chains in the Genus database with same CATH superfamily
3ZH9B 2VRWB 2CHQA 3LCUA 4B3RM 1QUSA 3FKEA 3K9PA 4LF7M 1R2ZA 2GNOA 2KCXA 2H5XA 3E4RA 3GQ4A 1IBMM 4DBGB 4MGIE 2SGDI 3GLIB 3SYLA 1SXJC 1KYIA 3K1JA 4OU7A 2RC4A 1PJSA 3Q8GA 3W0LB 3J7BA 1CHOI 5FLXS 3E59A 3LCVB 3SGBI 1DGHA 2P6AC 1D3YA 1OFIA 4E2KA 3U61B 2L7HA 3A46A 4F2LA 1WHCA 1DV0A 3R9XB 2X49A 3J81S 2JW6A 2WSCF 3GPXA 3UOEA 1XX6A 3VK7A 4A3VB 1NO1A 1RU3A 3GQ3A 3TO7A 2OO9A 2R4EA 1SXJE 2LVAA 2O25A 2KDLA 4GRIA 4QOSA 2Z3XA 1JQJC 1XC8A 2ZTDA 5IT9S 1TDZA 5C18A 3UFFA 2FH0A 4GIPA 4X62M 1K7TA 3HU3A 4NSRA 1T6OA 4LGYA 3U5ZA 2ZANA 3B9PA 4PT5A 3KOYE 3UJNA 3MMPA 5E3RA 4OVOA 4WURA 3F92A 2ELIA 1N75A 3VFDA 2QQ8A 2GVIA 4IBIA 4MGZE 1Y8GA 4P16A 4RF0A 2XRCA 1OIPA 2Y21A 1Z6TA 4GH9A 4B3MM 1M8BA 1ZV1A 1W3SA 1IXSA 1OAOC 2V6ZM 2W0TA 1IM2A 4YHHM 3U6EA 4II7A 2L6OA 5KPZA 3H4MA 9WGAA 1Y1CA 3J27B 2V1CA 2FNFX 3TWMA 5KPRA 1HT1E 3HJ8A 1J5EM 3W0FA 3VE5A 1KSFX 1S20A 1UVFA 2UXBM 2G3QA 3RU0A 2KMRA 2UVOA 3CF2A 3UMMA 3RGPA 2C99A 2EKKA 3U6MA 4I8OA 4RKUF 1YLAA 2YQZA 4FVMA 1XXHB 4MGKE 5DFLA 5ITQA 3SAUA 4JI5M 3GLFB 5EX0A 2CWFA 4AI6A 5KQ8A 1QQWA 4KODA 1XMQM 2C9CA 2LNHC 1I94M 1IXRC 4LJ8A 3M7GA 4EE1A 3NBIA 2SGFI 3GLGB 3OL0A 2YFQA 2LB7A 1K7VA 4QNMA 2ROWA 2J7OA 1TBOA 3UGIA 3KY9A 3OTOM 1FARA 1KFVA 2DWZB 4WP4A 2C96A 1Z7KB 1PJTA 1L1TA 4LJ7A 3QYEA 3W68A 1R2YA 1XNRM 2NU2I 2F5PA 1IY5A 3FTDA 4GI3C 2XF3A 4DV2M 5CCLA 3FUTA 2BUSA 3HHWA 1V1HA 4B7HA 1EE8A 5H37D 2XSZD 3THGA 1DDEA 3SFZA 1ZMVA 1HQYE 1R4GA 4MH0E 2K6BA 2Y0MA 2DAEA 2QNJA 4B3SM 3T15A 4L15A 4LJ6A 3K2LA 2DWMA 2QQDA 2F3CI 5DNYA 3Q8XA 3HZJA 4L8RC 1N77A 1SXJB 1FAQA 1Q02A 2DZLA 3SAVA 1GLNA 1QYRA 1MJBA 3I01M 3NWLA 3R5BA 3UZUA 4FW9A 1AUAA 2EO2A 2WSFF 2DZOB 3FUWA 2LBCA 3GRYA 1LR9A 2ORVA 3MJ5A 5EP3A 3ZCBB 2VQEM 2I7NA 3UGLA 2L09A 2CV2A 4WP2A 3PNYA 4JCVA 2KRKA 2QSFX 3KSJA 2RIJA 3UEYA 2HKJA 2JP7A 1DO2A 3I4VA 5EP1A 3QAHA 5FTLA 4KO8A 4QHSA 4REZA 5BR8M 2K0BX 2LVOC 1TH3A 1HR0M 3AL0C 1NJGA 2BNKA 1P9ZA 5E3PA 4FCWA 2BWBA 5ITYA 3L2AA 5FUXA 4LZJA 1WXQA 3GLIA 4KT0F 4IBFA 3J2PB 3K9OA 1CT0I 1MJ9A 5E3QA 2RRUA 2HL7A 2APLA 2CJSC 1TTEA 2ORWA 2MROB 5FTKA 1DGGA 4AW4A 2CEAA 3SBJA 2W82A 3UK6A 2XZUA 2L7XA 4PD2A 2HAKA 2NU3I 2JA2A 2Q2EA 1E94E 2B8TA 3TWKA 2CRUA 1OQYA 4RF1A 1AIPC 1OFHA 3DZDA 3RE8A 3GRVA 4G4NA 1IY6A 4MGYE 3KXEC 4FCVA 1EFUB 2I7PA 3HX3A 1HJAI 1QAOA 4FWDA 1KMAA 3KSXA 1VEGA 1SGPI 3SATA 4LRSA 4M9ZA 5HQ8A 1NHGC 4GMQA 2KXEA 2JNHA 1W5TA 5FUVA 5J8CA 1PGYA 3FUXA 3R5CA 1NUBA 1QVRA 4P17A 3U6DA 2CV1A 1IY0A 1N78A 3AJIB 1X74A 1V92A 3FTCA 5IWAM 1HNWM 4FD2A 3KVWA 4DUZM 1PJIA 3B7NA 2OU2A 1PTQA 3SHGB 4HGUA 1OJLA 1G41A 2R4JA 4W5WA 2ZAOA 3GRRA 2JY6B 3U60B 4LJ9A 3D8BA 2RKOA 1G59A 4LJ5A 2OD1A 4DV6M 2NU4I 3I04M 2KZUA 3KP0E 5IREB 2F5QA 2UZ3A 1OIZA 2XGNA 4AQYM 4L78A 1CE3A 4IBGA 1VDLA 1U5KA 4BLCA 4AKIA 4G4OA 2DZNB 1HQCA 1IBLM 1GJSA 4M0DA 2R45A 5F3WA 1XXHA 5ITUA 4BB9A 2G5GX 2LVPC 2MR9A 1GABA 1JR3A 5FSWA 4DV4M 1AN1I 2V53A 5JHWC 1C1KA 2DXIA 5EP2A 3W67A 3TO9A 2Z7JA 1K3WA 3HHXA 1Q9BA 4JCVE 3BXWA 4XGIA 1VQ1A 4DR5M 5DYGA 4IBEA 4FCTA 2VDBB 3E46A 3LW5F 1UVGA 4G3OA 3AOGA 2JY5A 2V1CC 3ILKA 2J87A 4JYAM 1NV9A 3KDSE 5FTNA 3A45A 4DV1M 3U6CA 1V33A 2LTUA 4FWHA 3OXLA 2DNAA 3T1YM 1LR7A 4I5SA 4X66M 4JI2M 1OMTA 2R0IA 3J80S 4CHTB 3D00A 3JAMS 1Z2IA 3OXGA 5ITRA 4FKDA 2JUJA 3PVSA 4LF8M 1X4SA 3U6SA 2YUUA 3B39A 3GPPA 1SGRI 2DWNA 2XH9A 4A24A 4ZPXA 4IBDA 4HEOA 4JXJA 3GPUA 2JZMA 3GRUA 2QQEA 2BJVA 1Q3BA 4AMLA 1UUCA 4LY6A 3TL4X 2ZBKA 1Z5BA 2K9DA 4KHPM 3HJSA 2SGQI 1HDLA 2KNVA 4LFCM 4EDKA 4NRVA 1JR3E 4ANRA 4Z6YA 1M8CA 1WGLA 5EXTA 4JI7M 5FUYA 3U6PA 1OMUA 1Q3CA 1S3SA 4UXHA 2L8EA 1GO5A 2KEBA 3CF6E 3KW6A 4O6PB 1NNJA 2B3TA 2C98A 4EDTA 2DHYA 2DWLA 2Q2EB 1CSOI 2B0UC 2NU0I 1PJUA 1N36M 1HT2E 2VF8A 3SMPA 4LZZA 1LV7A 3PXGA 4D82A 4GITA 1TDHA 2QHOB 1K3XA 1ORYB 3PDNA 4LF4M 2FCJA 2DENA 3V76A 4NRWA 4AKHA 4IIWA 1OKSA 3HHZA 4ITQA 1CT4I 1PPFI 1QUTA 3U6QA 4L9MA 4IBBA 4QHTA 3SMSA 4LG2A 2XFSA 2ERCA 2R6FA 2CHGA 2N35A 1MX0A 3BOSA 2BWEA 3KOXE 3LMMA 2CUZA 5EXSA 5JI2E 4LF5M 4EIWA 4DR4M 1T6T1 3U6OA 2ZM6M 2JXDA 3GQ5A 1D0KA 1Z5AA 1XHBA 2L4FA 1IN7A 3QYBA 1YE9A 3FSXA 2JXNA 1OTRA 2XFTA 4LFBM 4GHLA 4PCZA 1SGQI 2UXCM 1TBQR 2J7NA 3EIHA 1J7KA 7CATA 2QENA 3ZQJA 2EKFA 3HWSA 4I81A 3FTFA 1DS2I 4D80A 2QPOA 1HEVA 2GKTI 2M5XA 3QWPA 5ITTA 3U60A 3AFHA 4QNRA 2D7GA 1ULNA 5EX3A 4IBKA 1IFYA 4E1RA 2MGWA 1FYBA 3AKZA 5GUJA 2YR0A 3VKGA 1MJGM 4G4QA 2Y20A 3SAWA 3SASA 5A2QS 5ITXE 1SGDI 3UEJA 3TJQA 4AKGA 2KRUA 2VF7A 1XNQM 4JV5M 3TOBA 2M5ZA 3MK6A 4LJAA 1FY7A 1KBEA 1CGJI 3C58A 1PM5A 3GLHB 2GKRI 1WR1B 2GKVA 2AU3A 3KP1E 2OZUA 2F5SA 4YY3M 2ZAMA 2L4EA 3R8FA 1SG9A 1HJPA 4AG6A 4E1PA 5EJCA 4R7GA 1A5TA 1R7RA 3HGIA 2KNAA 1GL6A 4JI1M 1Z5CA 2X4AA 5ITXA 1F4IA 1TBNA 4MGHA 1Y8FA 3KS4A 1D2NA 1TF0B 1WGNA 2O5RA 3FUVA 3CTWB 5L8RF 3AV0A 2CWBA 4X64M 3GO8A 1MT1A 3RFWA 1TBRR 2R46A 5KO3A 3IHPA 4HLQA 3T1HM 3JR5A 1QANA 1IQPA 1ZQ9A 2XZFA 4B3TM 1TGSI 4OW0A 1G4AE 4PDIA 2KA6B 3KFUG 4DR7M 3B7ZA 2D7HA 2ERWA 3FTEA 1I4WA 1IN6A 4B7FA 4AG5A 1QDRA 4Z8XA 5EXPA 4JI8M 2GQFA 4UN2B 2KNZA 2C5RA 3HU2A 1P9GA 3TQSA 3C3DA 3HU1A 1R0RI 3IECA 2M60A 1OVOA 2KW0A 2VIIA 2R62A 3PFIA 3E2IA 3B74A 2N52A 1PJQA 2HWJA 2LWXA 4NXMM 3FYDA 2QQ0A 1QAQA 4UXJA 4LFAM 1E9RA 1TGUA 4JI4M 1W4RA 4IJFA 2E5RA 2JWSA 3FRHA 1NHWC 4I4LA 4CJ6A 4PDGA 1K82A 1D0MA 1DGHB 5J8FA 4JI3M 2ODDA 1BUSA 2P5TA 1IXSB 4GEWA 3R5DA 1L2DA 1EQNA 1G8PA 3L26A 1L2CA 4DR6M 2EA0A 2LHGA 5KQDA 3DFZA 1SGEI 1T3TA 1TOTA 3UGDA 3HKPA 2I5RA 8CATA 5DAEA 3DA1A 3IG5A 2QZ4A 3FC3A 3L25A 2WZJA 2UXDM 2AHMA 1DGBA 2WCYA 3GLGE 1XB2B 3M0EA 3KOWE 2Z8YM 2LXEA 1IN8A 5DYIA 3LQQA 2UUBM 3OVOA 5IZ7D 1YUBA 4B6DA 1JR3D 3VDPA 3C9PA 1IBKM 2FS1A 2J9RA 1H6UA 2LHCA 3GOXA 2OQ4A 4DUYM 1HNZM 4LF6M 1R6BX 4JI0M 3C3EA 3GLHE 4NC6A 1UFZA 3L28A 4LF9M 2DI0A 3PNVA 4LCBA 4DR1M 4KLNA 1RFHA 2R65A 4DV5M 2KMOA 1V1IA 1WIVA 3BBZA 4CGYB 1IXZA 1H0ZA 3I4YA 3LQRA 3K8ZA 4GKJM 3L27A 4M9XA 3D8LA 4MM3B 2E5LM 4SGBI 1N32M 2D7EA 1DO0A 3QAUA 2OVOA 1NXUA 2Z4RA 3GP1A 4JI6M 2OOBA 1PJJA 5BPVA 2N1AB 1TH4A 1Z59A 2LEOA 2NU1I 2YNMD 4GC5A 3GLHA 4OX9M 1IY1A 2EJSA 2LH0A 2ZBKB 3MHVC 2CV0A 5EQTA 1XBTA 4DV7M 1MU5A 2ARPF 2DIPA 3JR4A 2N17A 3CF0A 3SARA 4DV3M 1QZEA 1VG5A 1X37A 2PQ8A 2UUAM 1NNUC 4L6V6 2OPFA 1LR8A 4HL4A 4M9SA 5LMNM 1WTJA 5HI7A 1OAIA 3NBXX 4GC9A 4S12A 4WW0A 5E6JA 2F4VM 1CGII 2N71A 2EUCA 4MB7A 1BVSA 4OVZA 4TUWA 1EIJA 2Z4SA 1WKXA 2WGCA 2OOAA 3GPYA 2MJ5B 1KBFA 3HJQA 4RNAA 3ZC7B 2K9HA 2DVWB 1XWIA 1IY2A 1ZMUA 4LRTA 3A42A 3I51A 2F5OA 4MPIA 4EDRA 4GHAA 2C9OA 2JZ1A 2R18A 3FUUA 3RGSA 2Y0QA 4EDVA 2CP8A 3FSYA 3E9SA 2RGHA 2ENZA 2DAGA 4Y28F 3TWLA 2WVJA 2CWGA 2JA1A 1YU6C 2CHVA 3KS8A 1PTRA 2A5YB 3VLFB 3H4JA 2V1UA 4NOOB 2GIVA 2QBYA 4JN6A 1HPTA 1SXJA 1W5SA 2DAKA 2XLJA 1HNXM 2VQFM 3FE3A 5JI3E 3U5ZB 1NV8A 3DOAA 1WGCA 4R3DA 3BJIA 7WGAA 3E21A 5KPTA 1TUSA 2R44A 1IN4A 2Y0TA 3SEKC 4XK8F 2X3TA 4NSOB 1VEKA 2MH8A 3B4VC 4NXNM 3TE6A 2CWHA 1IW4A 4CISA 3IG8A 2LVNC 2KHHA 4G6ZA 1UM8A 4B7GA 2UUCM 4K0KM 1K7UA 2RGOA 2KMQA 3QWLA 4B08A 1UHAA 2XSZA 3M6AA 1GVNA 4BBAA 1N13A 2L2DA 3GLIE 1N33M 2L7IA 1YTPA 4UXIA 1NY5A 2BJWA 2F5NA 1CUKA 3VDUA 3T6PA 3MEKA 2CE7A 3HH2C 2FNAA 2K47A 4Q7JA 4AZFA 2JYYA 1E32A 1ULMA 4NL4H 4IBCA 2A20A 2DAIA 3T38A 5EXXA 1NJFA 2KZSA 1XMOM 3SYKA 2DKVA 4EDGA 1GJTA 1L8QA 3B7QA 3CGWA 3EIEA 1CT2I 1WGTA 2KMPA 1P3QQ 2LVQD 4D81A 1C7YA 1R79A 1L2BA 2QQCA 2E73A 2SGEI 1N34M 1TIHA 2DAMA 3GLFA 3VKHA 3LVVA 1XXHE 1VEJA 2J5YA 5CCMA 3LVWA 1LTMA 3WHKA 3VK8A 3QTLD 4LJ4A 3GLGA 4O6OA 2XEPA 1DGFA 3AOEA 1FNNA 2WSEF 1JB0F 2X8AA 2LUYA 2QPAA 2JZ0A 1J09A 1TURA 2NQ8C 5GKNA 3FD9A 3HHYA 2HCBA 3FYCA 3UGJA 1PCEA 3OXFA 1MJAA 2HHHM 3CXLA 2UU9M 1TH2A 3TO6A 1NSFA 3A98B 3B89A 1GL7A 3KOZE 2ENNA 3TPZA 1WJ7A 1DD9A 1GKIA 1VDDA 5E26A 2FE8A 1QZMA 1ZMWA 2G8LA 2DB6A 3SC3A 1XA6A 4LGMA 1D0LA 2ZTCA 3SGQI 1Q39A 4L4UA 2QBYB 1E9SA 3FRIA 4R71A 1ZAEA 1IN5A 1V34A 5C1BA 4GKKM 1SGYI 1ULKA 3AOEC 2QP9X 4L16A 4XBOA 2JY7A 4DV0M 4DR2M 1G3IA 1NVMA 1YSYA 3WHLA 1TR8A 3U6LA 3U61A 4DNCA 1OYVI 4CIZA 1DS3I 2SGPI 4OVZB 1L1ZA 1T43A 4M0WA 1G71A 1PRBA 4G4RA 2QCUA 5FTMA 4QOZC 5LMUM 1SGNI 4IJEA 3TOAA 2DKLA 1MN3A 1QAMA 1NY6A 1R5LA 5EP4A 1FJGM 3SHFA 3GLFE 3R5AA 2X52A 4X65M 2YQPA 2FOIC 2JY8A 3J7AS 2DHRA 5FTJA 5FUWA 3K92A 3L29A 4IBJA 2FFJA 4FWGA 2CFOA 2H1RA 1QDTA 2O01F 4DR3M 4F1IA 1Y1BA 1SXJD 3HY5A 1BMOA
chains in the Genus database with same CATH topology
3ZH9B 2VRWB 2CHQA 4B3RM 3FKEA 4LF7M 1R2ZA 2KCXA 3E4RA 3GQ4A 1IBMM 4MGIE 2SGDI 3GLIB 3SYLA 1SXJC 1KYIA 3K1JA 4OU7A 3W0LB 3J7BA 1CHOI 5FLXS 3E59A 3SGBI 1DGHA 2P6AC 1D3YA 1OFIA 4E2KA 3U61B 2L7HA 3A46A 3R9XB 2X49A 3J81S 2JW6A 3GPXA 1XX6A 3VK7A 4A3VB 3GQ3A 2R4EA 1SXJE 4GRIA 4QOSA 2Z3XA 1JQJC 1XC8A 5IT9S 1TDZA 5C18A 3UFFA 4GIPA 4X62M 3MEKA 3HU3A 4NSRA 4LGYA 3U5ZA 2ZANA 3B9PA 4PT5A 3KOYE 3UJNA 4OVOA 4WURA 2ELIA 1N75A 3VFDA 2GVIA 2XRCA 4IBIA 4MGZE 4P16A 4RF0A 2Y21A 1Z6TA 4GH9A 4B3MM 1M8BA 1W3SA 2V6ZM 2W0TA 1IM2A 4YHHM 3U6EA 4II7A 2L6OA 5KPZA 3H4MA 1Y1CA 3J27B 2V1CA 2FNFX 3TWMA 5KPRA 1HT1E 3HJ8A 1J5EM 3W0FA 3VE5A 1KSFX 1UVFA 2UXBM 3RU0A 2KMRA 3CF2A 3UMMA 3RGPA 2C99A 3U6MA 4I8OA 1N13A 2YQZA 4MGKE 4FVMA 1XXHB 5ITQA 3SAUA 4JI5M 5EX0A 3GLFB 4AI6A 5KQ8A 1QQWA 4KODA 1XMQM 2C9CA 2LNHC 1I94M 1IXRC 4LJ8A 3M7GA 4EE1A 3NBIA 2SGFI 3GLGB 3OL0A 2YFQA 2ROWA 4QNMA 2J7OA 1TBOA 3UGIA 3KY9A 3OTOM 1FARA 1KFVA 2DWZB 2C96A 1Z7KB 1L1TA 4LJ7A 1R2YA 1XNRM 2NU2I 2F5PA 1IY5A 3FTDA 4GI3C 2XF3A 4DV2M 5CCLA 3FUTA 2BUSA 3HHWA 1V1HA 4B7HA 1EE8A 5H37D 2XSZD 3THGA 1DDEA 3SFZA 1HQYE 4MH0E 4B3SM 3T15A 4L15A 4LJ6A 3K2LA 2DWMA 2QQDA 2F3CI 5DNYA 3Q8XA 4L8RC 1N77A 1SXJB 1FAQA 3SAVA 1GLNA 1QYRA 3NWLA 3UZUA 4FW9A 2EO2A 3FUWA 2DZOB 3GRYA 1LR9A 2ORVA 3MJ5A 5EP3A 3ZCBB 2VQEM 2I7NA 3UGLA 2L09A 2CV2A 3PNYA 4JCVA 2KRKA 3KSJA 3UEYA 2HKJA 1DO2A 3I4VA 5EP1A 5FTLA 4KO8A 4QHSA 4REZA 5BR8M 1TH3A 1HR0M 3AL0C 1NJGA 2BNKA 4FCWA 5ITYA 3L2AA 5FUXA 4LZJA 1WXQA 3GLIA 4IBFA 3J2PB 1CT0I 2HL7A 2CJSC 2ORWA 2SGQI 2XZUA 5FTKA 1DGGA 4AW4A 2CEAA 3SBJA 2W82A 3UK6A 2L7XA 4PD2A 2NU3I 2JA2A 2Q2EA 1E94E 2B8TA 3TWKA 4G4NA 2DB6A 4RF1A 1OFHA 1IY6A 3DZDA 3RE8A 3GRVA 4MGYE 3KXEC 4FCVA 2I7PA 1HJAI 1QAOA 4FWDA 1KMAA 3KSXA 1SGPI 3SATA 4LRSA 4M9ZA 5HQ8A 1NHGC 4GMQA 2KXEA 1W5TA 5FUVA 3FUXA 1NUBA 1QVRA 3U6DA 2CV1A 1IY0A 1N78A 3AJIB 1X74A 3FTCA 5IWAM 1HNWM 4FD2A 3KVWA 4DUZM 1PJIA 1PTQA 3SHGB 4HGUA 1OJLA 1G41A 2R4JA 4W5WA 2ZAOA 3GRRA 3U60B 4LJ9A 3D8BA 2RKOA 1G59A 4LJ5A 4DV6M 2NU4I 2KZUA 3KP0E 5IREB 2F5QA 2UZ3A 1CE3A 2XGNA 4AQYM 4L78A 4IBGA 1U5KA 4BLCA 4AKIA 4G4OA 2DZNB 1HQCA 1IBLM 1LR7A 4M0DA 2R45A 5F3WA 1XXHA 5ITUA 4BB9A 2G5GX 2A20A 2V53A 1AN1I 1JR3A 5FSWA 4DV4M 5JHWC 1C1KA 2DXIA 5EP2A 2Z7JA 1K3WA 3HHXA 4XGIA 4DR5M 5DYGA 4IBEA 4FCTA 2V1CC 1UVGA 3AOGA 3ILKA 2J87A 4JYAM 3KDSE 5FTNA 3A45A 4DV1M 3U6CA 4FWHA 3OXLA 3T1YM 4I5SA 4X66M 4JI2M 1OMTA 3J80S 4CHTB 3D00A 3OXGA 3JAMS 5ITRA 4FKDA 1X4SA 3PVSA 4LF8M 3B39A 3U6SA 2YUUA 3GPPA 1SGRI 2DWNA 2XH9A 4A24A 4ZPXA 4IBDA 4JXJA 3GPUA 2QQEA 2JZMA 3GRUA 2BJVA 1Q3BA 1UUCA 4LY6A 3TL4X 2ZBKA 1Z5BA 4KHPM 3HJSA 1HDLA 4LFCM 4EDKA 4NRVA 4Z6YA 1M8CA 5EXTA 4JI7M 5FUYA 3U6PA 1OMUA 1Q3CA 1S3SA 4UXHA 2L8EA 2KEBA 3CF6E 3KW6A 4O6PB 1NNJA 2C98A 4EDTA 2DWLA 2Q2EB 1CSOI 2B0UC 2NU0I 1PJUA 1N36M 1HT2E 3SMPA 4LZZA 1LV7A 3PXGA 4D82A 4GITA 1TDHA 1K3XA 1ORYB 3PDNA 4LF4M 4NRWA 4AKHA 4IIWA 4ITQA 3HHZA 1PPFI 1CT4I 4L9MA 3U6QA 4IBBA 4QHTA 3SMSA 4LG2A 2XFSA 3KOXE 3LMMA 2CHGA 3BOSA 2ERCA 1MX0A 2OD1A 5EXSA 5JI2E 2CUZA 4LF5M 4DR4M 4JCVE 4EIWA 1T6T1 3U6OA 2ZM6M 2JXDA 3GQ5A 1Z5AA 1XHBA 1IN7A 1YE9A 2XFTA 4LFBM 4GHLA 4PCZA 1SGQI 2UXCM 1TBQR 2J7NA 3EIHA 1J7KA 7CATA 2QENA 3FTFA 2QPOA 3HWSA 4I81A 1DS2I 4D80A 2GKTI 2M5XA 3QWPA 5ITTA 3U60A 3AFHA 4QNRA 2D7GA 5EX3A 4E1RA 4IBKA 1FYBA 3AKZA 5GUJA 2YR0A 3VKGA 3SAWA 4G4QA 2Y20A 3SASA 1SGDI 5A2QS 5ITXE 3UEJA 3TJQA 4AKGA 2KRUA 1XNQM 4JV5M 2M5ZA 3MK6A 4LJAA 1KBEA 1CGJI 3C58A 1PM5A 3GLHB 2GKRI 2GKVA 2AU3A 3KP1E 2F5SA 4YY3M 2ZAMA 3R8FA 4AG6A 4E1PA 5EJCA 4R7GA 1R7RA 3HGIA 1GL6A 4JI1M 1Z5CA 2X4AA 5ITXA 1TBNA 1Y8FA 4MGHA 3KS4A 1D2NA 3FUVA 4X64M 2O5RA 3GO8A 3CTWB 1MT1A 3AV0A 1TBRR 3RFWA 2R46A 5KO3A 4HLQA 3T1HM 3JR5A 1QANA 1IQPA 1ZQ9A 2XZFA 4B3TM 1TGSI 4OW0A 1G4AE 4PDIA 2KA6B 3KFUG 4DR7M 2D7HA 2ERWA 3FTEA 1I4WA 1IN6A 4B7FA 4AG5A 4Z8XA 5EXPA 4JI8M 2C5RA 3HU2A 3TQSA 3HU1A 1R0RI 2M60A 1OVOA 2KW0A 2VIIA 2R62A 3PFIA 3E2IA 2N52A 2LWXA 4NXMM 3FYDA 2QQ0A 1QAQA 4UXJA 4LFAM 1E9RA 1TGUA 4JI4M 1W4RA 4IJFA 2E5RA 1NHWC 4I4LA 4PDGA 1K82A 1DGHB 4JI3M 2ODDA 1BUSA 2P5TA 1IXSB 1EQNA 1L2DA 1G8PA 3L26A 1L2CA 4DR6M 2EA0A 1TOTA 5KQDA 3DFZA 1SGEI 1T3TA 3UGDA 3HKPA 8CATA 5DAEA 3DA1A 3IG5A 2QZ4A 3FC3A 3L25A 2UXDM 2AHMA 1DGBA 2WCYA 3M0EA 3KOWE 2LXEA 1IN8A 5DYIA 3LQQA 2UUBM 3OVOA 5IZ7D 1YUBA 4B6DA 1JR3D 3VDPA 1IBKM 3GOXA 2J9RA 1H6UA 2OQ4A 4DUYM 1HNZM 4LF6M 1R6BX 4JI0M 4LF9M 3L28A 3PNVA 4LCBA 4DR1M 4KLNA 1RFHA 2R65A 4DV5M 2KMOA 1V1IA 4CGYB 1IXZA 1H0ZA 3I4YA 3LQRA 3K8ZA 4GKJM 3L27A 4M9XA 3D8LA 4MM3B 2E5LM 1N32M 2D7EA 1DO0A 3QAUA 2OVOA 2Z4RA 3GP1A 4JI6M 1PJJA 5BPVA 2N1AB 1TH4A 1Z59A 2LEOA 2NU1I 2YNMD 4GC5A 3GLHA 4OX9M 1IY1A 2CV0A 2LH0A 2ZBKB 3MHVC 1XBTA 5EQTA 2ARPF 4DV7M 1MU5A 2DIPA 2N17A 3JR4A 3CF0A 3SARA 4DV3M 1X37A 2UUAM 1NNUC 2OPFA 1LR8A 5HI7A 4HL4A 4M9SA 5LMNM 4GC9A 4S12A 5E6JA 4WW0A 2F4VM 1CGII 2N71A 2EUCA 4MB7A 4TUWA 4OVZA 2Z4SA 3GPYA 1KBFA 3HJQA 4RNAA 3ZC7B 2K9HA 2DVWB 1XWIA 1IY2A 4LRTA 4EDRA 3A42A 3I51A 4GHAA 2C9OA 2R18A 3FUUA 3RGSA 2Y0QA 4EDVA 3E9SA 2RGHA 2ENZA 2WVJA 3TWLA 2JA1A 1YU6C 2CHVA 3KS8A 1PTRA 2A5YB 3VLFB 2V1UA 4NOOB 2QBYA 4JN6A 1HPTA 1SXJA 1W5SA 2XLJA 1HNXM 2VQFM 5JI3E 3U5ZB 3DOAA 3BJIA 4R3DA 5KPTA 1TUSA 3SEKC 1IN4A 2Y0TA 4NSOB 3B4VC 4NXNM 3TE6A 1IW4A 4CISA 3IG8A 2UUCM 4G6ZA 1UM8A 4B7GA 4K0KM 2KMQA 4SGBI 2RGOA 3QWLA 4B08A 2XSZA 3M6AA 1GVNA 4BBAA 1N33M 2L7IA 1YTPA 4UXIA 1NY5A 2BJWA 2F5NA 3VDUA 2CE7A 3HH2C 2FNAA 2K47A 4AZFA 2JYYA 1E32A 4NL4H 4IBCA 3T38A 5EXXA 1NJFA 2KZSA 1XMOM 3SYKA 4EDGA 1L8QA 3EIEA 1CT2I 2KMPA 4D81A 1R79A 1L2BA 2QQCA 2E73A 2SGEI 1N34M 1TIHA 3GLFA 3VKHA 3LVVA 5CCMA 3LVWA 3WHKA 3VK8A 3QTLD 4LJ4A 3GLGA 4O6OA 2XEPA 1DGFA 3AOEA 1FNNA 2X8AA 2LUYA 2QPAA 1J09A 1TURA 2NQ8C 5GKNA 3FD9A 3HHYA 2HCBA 3FYCA 3UGJA 1PCEA 3OXFA 2HHHM 3CXLA 2UU9M 1TH2A 1NSFA 3A98B 3KOZE 1GL7A 2ENNA 3TPZA 1DD9A 1GKIA 1VDDA 5E26A 2FE8A 1QZMA 2G8LA 3SC3A 1XA6A 4LGMA 3SGQI 1Q39A 4L4UA 2QBYB 1E9SA 1SGYI 5C1BA 1ZAEA 1IN5A 4GKKM 3AOEC 2QP9X 4L16A 4XBOA 4DV0M 4DR2M 1G3IA 1NVMA 1YSYA 3WHLA 3U6LA 3U61A 1OYVI 2SGPI 1DS3I 4OVZB 1L1ZA 4M0WA 4G4RA 2QCUA 5FTMA 4QOZC 5LMUM 1SGNI 4IJEA 1QAMA 1NY6A 5EP4A 1FJGM 3SHFA 4X65M 2YQPA 2FOIC 3J7AS 2DHRA 5FTJA 5FUWA 3K92A 3L29A 4IBJA 4FWGA 2FFJA 2CFOA 2H1RA 2F5OA 4DR3M 1Y1BA 1SXJD 1BMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6T 1;  2AU3 A;  2ZBK A;  4EDG A;  3VDP A;  4EDK A;  4EE1 A;  4O6P B;  2Q2E A;  4EDT A;  1D3Y A;  2V1C A;  4E2K A;  4O6O A;  3VE5 A;  1EQN A;  5GUJ A;  4JCV A;  4EDR A;  3D00 A;  4EDV A;  3VDU A;  3B39 A;  1DDE A;  1DD9 A;  1VDD A; 
#chains in the Genus database with same CATH topology
 3ZH9 B;  2VRW B;  2CHQ A;  3LCU A;  4B3R M;  1QUS A;  3FKE A;  3K9P A;  4LF7 M;  1R2Z A;  2GNO A;  2KCX A;  2H5X A;  3E4R A;  3GQ4 A;  1IBM M;  4DBG B;  4MGI E;  2SGD I;  3GLI B;  3SYL A;  1SXJ C;  1KYI A;  3K1J A;  4OU7 A;  2RC4 A;  1PJS A;  3Q8G A;  3W0L B;  3J7B A;  1CHO I;  5FLX S;  3E59 A;  3LCV B;  3SGB I;  1DGH A;  2P6A C;  1D3Y A;  1OFI A;  4E2K A;  3U61 B;  2L7H A;  3A46 A;  4F2L A;  1WHC A;  1DV0 A;  3R9X B;  2X49 A;  3J81 S;  2JW6 A;  2WSC F;  3GPX A;  3UOE A;  1XX6 A;  3VK7 A;  4A3V B;  1NO1 A;  1RU3 A;  3GQ3 A;  3TO7 A;  2OO9 A;  2R4E A;  1SXJ E;  2LVA A;  2O25 A;  2KDL A;  4GRI A;  4QOS A;  2Z3X A;  1JQJ C;  1XC8 A;  2ZTD A;  5IT9 S;  1TDZ A;  5C18 A;  3UFF A;  2FH0 A;  4GIP A;  4X62 M;  1K7T A;  3HU3 A;  4NSR A;  1T6O A;  4LGY A;  3U5Z A;  2ZAN A;  3B9P A;  4PT5 A;  3KOY E;  3UJN A;  3MMP A;  5E3R A;  4OVO A;  4WUR A;  3F92 A;  2ELI A;  1N75 A;  3VFD A;  2QQ8 A;  2GVI A;  4IBI A;  4MGZ E;  1Y8G A;  4P16 A;  4RF0 A;  2XRC A;  1OIP A;  2Y21 A;  1Z6T A;  4GH9 A;  4B3M M;  1M8B A;  1ZV1 A;  1W3S A;  1IXS A;  1OAO C;  2V6Z M;  2W0T A;  1IM2 A;  4YHH M;  3U6E A;  4II7 A;  2L6O A;  5KPZ A;  3H4M A;  9WGA A;  1Y1C A;  3J27 B;  2V1C A;  2FNF X;  3TWM A;  5KPR A;  1HT1 E;  3HJ8 A;  1J5E M;  3W0F A;  3VE5 A;  1KSF X;  1S20 A;  1UVF A;  2UXB M;  2G3Q A;  3RU0 A;  2KMR A;  2UVO A;  3CF2 A;  3UMM A;  3RGP A;  2C99 A;  2EKK A;  3U6M A;  4I8O A;  4RKU F;  1YLA A;  2YQZ A;  4FVM A;  1XXH B;  4MGK E;  5DFL A;  5ITQ A;  3SAU A;  4JI5 M;  3GLF B;  5EX0 A;  2CWF A;  4AI6 A;  5KQ8 A;  1QQW A;  4KOD A;  1XMQ M;  2C9C A;  2LNH C;  1I94 M;  1IXR C;  4LJ8 A;  3M7G A;  4EE1 A;  3NBI A;  2SGF I;  3GLG B;  3OL0 A;  2YFQ A;  2LB7 A;  1K7V A;  4QNM A;  2ROW A;  2J7O A;  1TBO A;  3UGI A;  3KY9 A;  3OTO M;  1FAR A;  1KFV A;  2DWZ B;  4WP4 A;  2C96 A;  1Z7K B;  1PJT A;  1L1T A;  4LJ7 A;  3QYE A;  3W68 A;  1R2Y A;  1XNR M;  2NU2 I;  2F5P A;  1IY5 A;  3FTD A;  4GI3 C;  2XF3 A;  4DV2 M;  5CCL A;  3FUT A;  2BUS A;  3HHW A;  1V1H A;  4B7H A;  1EE8 A;  5H37 D;  2XSZ D;  3THG A;  1DDE A;  3SFZ A;  1ZMV A;  1HQY E;  1R4G A;  4MH0 E;  2K6B A;  2Y0M A;  2DAE A;  2QNJ A;  4B3S M;  3T15 A;  4L15 A;  4LJ6 A;  3K2L A;  2DWM A;  2QQD A;  2F3C I;  5DNY A;  3Q8X A;  3HZJ A;  4L8R C;  1N77 A;  1SXJ B;  1FAQ A;  1Q02 A;  2DZL A;  3SAV A;  1GLN A;  1QYR A;  1MJB A;  3I01 M;  3NWL A;  3R5B A;  3UZU A;  4FW9 A;  1AUA A;  2EO2 A;  2WSF F;  2DZO B;  3FUW A;  2LBC A;  3GRY A;  1LR9 A;  2ORV A;  3MJ5 A;  5EP3 A;  3ZCB B;  2VQE M;  2I7N A;  3UGL A;  2L09 A;  2CV2 A;  4WP2 A;  3PNY A;  4JCV A;  2KRK A;  2QSF X;  3KSJ A;  2RIJ A;  3UEY A;  2HKJ A;  2JP7 A;  1DO2 A;  3I4V A;  5EP1 A;  3QAH A;  5FTL A;  4KO8 A;  4QHS A;  4REZ A;  5BR8 M;  2K0B X;  2LVO C;  1TH3 A;  1HR0 M;  3AL0 C;  1NJG A;  2BNK A;  1P9Z A;  5E3P A;  4FCW A;  2BWB A;  5ITY A;  3L2A A;  5FUX A;  4LZJ A;  1WXQ A;  3GLI A;  4KT0 F;  4IBF A;  3J2P B;  3K9O A;  1CT0 I;  1MJ9 A;  5E3Q A;  2RRU A;  2HL7 A;  2APL A;  2CJS C;  1TTE A;  2ORW A;  2MRO B;  5FTK A;  1DGG A;  4AW4 A;  2CEA A;  3SBJ A;  2W82 A;  3UK6 A;  2XZU A;  2L7X A;  4PD2 A;  2HAK A;  2NU3 I;  2JA2 A;  2Q2E A;  1E94 E;  2B8T A;  3TWK A;  2CRU A;  1OQY A;  4RF1 A;  1AIP C;  1OFH A;  3DZD A;  3RE8 A;  3GRV A;  4G4N A;  1IY6 A;  4MGY E;  3KXE C;  4FCV A;  1EFU B;  2I7P A;  3HX3 A;  1HJA I;  1QAO A;  4FWD A;  1KMA A;  3KSX A;  1VEG A;  1SGP I;  3SAT A;  4LRS A;  4M9Z A;  5HQ8 A;  1NHG C;  4GMQ A;  2KXE A;  2JNH A;  1W5T A;  5FUV A;  5J8C A;  1PGY A;  3FUX A;  3R5C A;  1NUB A;  1QVR A;  4P17 A;  3U6D A;  2CV1 A;  1IY0 A;  1N78 A;  3AJI B;  1X74 A;  1V92 A;  3FTC A;  5IWA M;  1HNW M;  4FD2 A;  3KVW A;  4DUZ M;  1PJI A;  3B7N A;  2OU2 A;  1PTQ A;  3SHG B;  4HGU A;  1OJL A;  1G41 A;  2R4J A;  4W5W A;  2ZAO A;  3GRR A;  2JY6 B;  3U60 B;  4LJ9 A;  3D8B A;  2RKO A;  1G59 A;  4LJ5 A;  2OD1 A;  4DV6 M;  2NU4 I;  3I04 M;  2KZU A;  3KP0 E;  5IRE B;  2F5Q A;  2UZ3 A;  1OIZ A;  2XGN A;  4AQY M;  4L78 A;  1CE3 A;  4IBG A;  1VDL A;  1U5K A;  4BLC A;  4AKI A;  4G4O A;  2DZN B;  1HQC A;  1IBL M;  1GJS A;  4M0D A;  2R45 A;  5F3W A;  1XXH A;  5ITU A;  4BB9 A;  2G5G X;  2LVP C;  2MR9 A;  1GAB A;  1JR3 A;  5FSW A;  4DV4 M;  1AN1 I;  2V53 A;  5JHW C;  1C1K A;  2DXI A;  5EP2 A;  3W67 A;  3TO9 A;  2Z7J A;  1K3W A;  3HHX A;  1Q9B A;  4JCV E;  3BXW A;  4XGI A;  1VQ1 A;  4DR5 M;  5DYG A;  4IBE A;  4FCT A;  2VDB B;  3E46 A;  3LW5 F;  1UVG A;  4G3O A;  3AOG A;  2JY5 A;  2V1C C;  3ILK A;  2J87 A;  4JYA M;  1NV9 A;  3KDS E;  5FTN A;  3A45 A;  4DV1 M;  3U6C A;  1V33 A;  2LTU A;  4FWH A;  3OXL A;  2DNA A;  3T1Y M;  1LR7 A;  4I5S A;  4X66 M;  4JI2 M;  1OMT A;  2R0I A;  3J80 S;  4CHT B;  3D00 A;  3JAM S;  1Z2I A;  3OXG A;  5ITR A;  4FKD A;  2JUJ A;  3PVS A;  4LF8 M;  1X4S A;  3U6S A;  2YUU A;  3B39 A;  3GPP A;  1SGR I;  2DWN A;  2XH9 A;  4A24 A;  4ZPX A;  4IBD A;  4HEO A;  4JXJ A;  3GPU A;  2JZM A;  3GRU A;  2QQE A;  2BJV A;  1Q3B A;  4AML A;  1UUC A;  4LY6 A;  3TL4 X;  2ZBK A;  1Z5B A;  2K9D A;  4KHP M;  3HJS A;  2SGQ I;  1HDL A;  2KNV A;  4LFC M;  4EDK A;  4NRV A;  1JR3 E;  4ANR A;  4Z6Y A;  1M8C A;  1WGL A;  5EXT A;  4JI7 M;  5FUY A;  3U6P A;  1OMU A;  1Q3C A;  1S3S A;  4UXH A;  2L8E A;  1GO5 A;  2KEB A;  3CF6 E;  3KW6 A;  4O6P B;  1NNJ A;  2B3T A;  2C98 A;  4EDT A;  2DHY A;  2DWL A;  2Q2E B;  1CSO I;  2B0U C;  2NU0 I;  1PJU A;  1N36 M;  1HT2 E;  2VF8 A;  3SMP A;  4LZZ A;  1LV7 A;  3PXG A;  4D82 A;  4GIT A;  1TDH A;  2QHO B;  1K3X A;  1ORY B;  3PDN A;  4LF4 M;  2FCJ A;  2DEN A;  3V76 A;  4NRW A;  4AKH A;  4IIW A;  1OKS A;  3HHZ A;  4ITQ A;  1CT4 I;  1PPF I;  1QUT A;  3U6Q A;  4L9M A;  4IBB A;  4QHT A;  3SMS A;  4LG2 A;  2XFS A;  2ERC A;  2R6F A;  2CHG A;  2N35 A;  1MX0 A;  3BOS A;  2BWE A;  3KOX E;  3LMM A;  2CUZ A;  5EXS A;  5JI2 E;  4LF5 M;  4EIW A;  4DR4 M;  1T6T 1;  3U6O A;  2ZM6 M;  2JXD A;  3GQ5 A;  1D0K A;  1Z5A A;  1XHB A;  2L4F A;  1IN7 A;  3QYB A;  1YE9 A;  3FSX A;  2JXN A;  1OTR A;  2XFT A;  4LFB M;  4GHL A;  4PCZ A;  1SGQ I;  2UXC M;  1TBQ R;  2J7N A;  3EIH A;  1J7K A;  7CAT A;  2QEN A;  3ZQJ A;  2EKF A;  3HWS A;  4I81 A;  3FTF A;  1DS2 I;  4D80 A;  2QPO A;  1HEV A;  2GKT I;  2M5X A;  3QWP A;  5ITT A;  3U60 A;  3AFH A;  4QNR A;  2D7G A;  1ULN A;  5EX3 A;  4IBK A;  1IFY A;  4E1R A;  2MGW A;  1FYB A;  3AKZ A;  5GUJ A;  2YR0 A;  3VKG A;  1MJG M;  4G4Q A;  2Y20 A;  3SAW A;  3SAS A;  5A2Q S;  5ITX E;  1SGD I;  3UEJ A;  3TJQ A;  4AKG A;  2KRU A;  2VF7 A;  1XNQ M;  4JV5 M;  3TOB A;  2M5Z A;  3MK6 A;  4LJA A;  1FY7 A;  1KBE A;  1CGJ I;  3C58 A;  1PM5 A;  3GLH B;  2GKR I;  1WR1 B;  2GKV A;  2AU3 A;  3KP1 E;  2OZU A;  2F5S A;  4YY3 M;  2ZAM A;  2L4E A;  3R8F A;  1SG9 A;  1HJP A;  4AG6 A;  4E1P A;  5EJC A;  4R7G A;  1A5T A;  1R7R A;  3HGI A;  2KNA A;  1GL6 A;  4JI1 M;  1Z5C A;  2X4A A;  5ITX A;  1F4I A;  1TBN A;  4MGH A;  1Y8F A;  3KS4 A;  1D2N A;  1TF0 B;  1WGN A;  2O5R A;  3FUV A;  3CTW B;  5L8R F;  3AV0 A;  2CWB A;  4X64 M;  3GO8 A;  1MT1 A;  3RFW A;  1TBR R;  2R46 A;  5KO3 A;  3IHP A;  4HLQ A;  3T1H M;  3JR5 A;  1QAN A;  1IQP A;  1ZQ9 A;  2XZF A;  4B3T M;  1TGS I;  4OW0 A;  1G4A E;  4PDI A;  2KA6 B;  3KFU G;  4DR7 M;  3B7Z A;  2D7H A;  2ERW A;  3FTE A;  1I4W A;  1IN6 A;  4B7F A;  4AG5 A;  1QDR A;  4Z8X A;  5EXP A;  4JI8 M;  2GQF A;  4UN2 B;  2KNZ A;  2C5R A;  3HU2 A;  1P9G A;  3TQS A;  3C3D A;  3HU1 A;  1R0R I;  3IEC A;  2M60 A;  1OVO A;  2KW0 A;  2VII A;  2R62 A;  3PFI A;  3E2I A;  3B74 A;  2N52 A;  1PJQ A;  2HWJ A;  2LWX A;  4NXM M;  3FYD A;  2QQ0 A;  1QAQ A;  4UXJ A;  4LFA M;  1E9R A;  1TGU A;  4JI4 M;  1W4R A;  4IJF A;  2E5R A;  2JWS A;  3FRH A;  1NHW C;  4I4L A;  4CJ6 A;  4PDG A;  1K82 A;  1D0M A;  1DGH B;  5J8F A;  4JI3 M;  2ODD A;  1BUS A;  2P5T A;  1IXS B;  4GEW A;  3R5D A;  1L2D A;  1EQN A;  1G8P A;  3L26 A;  1L2C A;  4DR6 M;  2EA0 A;  2LHG A;  5KQD A;  3DFZ A;  1SGE I;  1T3T A;  1TOT A;  3UGD A;  3HKP A;  2I5R A;  8CAT A;  5DAE A;  3DA1 A;  3IG5 A;  2QZ4 A;  3FC3 A;  3L25 A;  2WZJ A;  2UXD M;  2AHM A;  1DGB A;  2WCY A;  3GLG E;  1XB2 B;  3M0E A;  3KOW E;  2Z8Y M;  2LXE A;  1IN8 A;  5DYI A;  3LQQ A;  2UUB M;  3OVO A;  5IZ7 D;  1YUB A;  4B6D A;  1JR3 D;  3VDP A;  3C9P A;  1IBK M;  2FS1 A;  2J9R A;  1H6U A;  2LHC A;  3GOX A;  2OQ4 A;  4DUY M;  1HNZ M;  4LF6 M;  1R6B X;  4JI0 M;  3C3E A;  3GLH E;  4NC6 A;  1UFZ A;  3L28 A;  4LF9 M;  2DI0 A;  3PNV A;  4LCB A;  4DR1 M;  4KLN A;  1RFH A;  2R65 A;  4DV5 M;  2KMO A;  1V1I A;  1WIV A;  3BBZ A;  4CGY B;  1IXZ A;  1H0Z A;  3I4Y A;  3LQR A;  3K8Z A;  4GKJ M;  3L27 A;  4M9X A;  3D8L A;  4MM3 B;  2E5L M;  4SGB I;  1N32 M;  2D7E A;  1DO0 A;  3QAU A;  2OVO A;  1NXU A;  2Z4R A;  3GP1 A;  4JI6 M;  2OOB A;  1PJJ A;  5BPV A;  2N1A B;  1TH4 A;  1Z59 A;  2LEO A;  2NU1 I;  2YNM D;  4GC5 A;  3GLH A;  4OX9 M;  1IY1 A;  2EJS A;  2LH0 A;  2ZBK B;  3MHV C;  2CV0 A;  5EQT A;  1XBT A;  4DV7 M;  1MU5 A;  2ARP F;  2DIP A;  3JR4 A;  2N17 A;  3CF0 A;  3SAR A;  4DV3 M;  1QZE A;  1VG5 A;  1X37 A;  2PQ8 A;  2UUA M;  1NNU C;  4L6V 6;  2OPF A;  1LR8 A;  4HL4 A;  4M9S A;  5LMN M;  1WTJ A;  5HI7 A;  1OAI A;  3NBX X;  4GC9 A;  4S12 A;  4WW0 A;  5E6J A;  2F4V M;  1CGI I;  2N71 A;  2EUC A;  4MB7 A;  1BVS A;  4OVZ A;  4TUW A;  1EIJ A;  2Z4S A;  1WKX A;  2WGC A;  2OOA A;  3GPY A;  2MJ5 B;  1KBF A;  3HJQ A;  4RNA A;  3ZC7 B;  2K9H A;  2DVW B;  1XWI A;  1IY2 A;  1ZMU A;  4LRT A;  3A42 A;  3I51 A;  2F5O A;  4MPI A;  4EDR A;  4GHA A;  2C9O A;  2JZ1 A;  2R18 A;  3FUU A;  3RGS A;  2Y0Q A;  4EDV A;  2CP8 A;  3FSY A;  3E9S A;  2RGH A;  2ENZ A;  2DAG A;  4Y28 F;  3TWL A;  2WVJ A;  2CWG A;  2JA1 A;  1YU6 C;  2CHV A;  3KS8 A;  1PTR A;  2A5Y B;  3VLF B;  3H4J A;  2V1U A;  4NOO B;  2GIV A;  2QBY A;  4JN6 A;  1HPT A;  1SXJ A;  1W5S A;  2DAK A;  2XLJ A;  1HNX M;  2VQF M;  3FE3 A;  5JI3 E;  3U5Z B;  1NV8 A;  3DOA A;  1WGC A;  4R3D A;  3BJI A;  7WGA A;  3E21 A;  5KPT A;  1TUS A;  2R44 A;  1IN4 A;  2Y0T A;  3SEK C;  4XK8 F;  2X3T A;  4NSO B;  1VEK A;  2MH8 A;  3B4V C;  4NXN M;  3TE6 A;  2CWH A;  1IW4 A;  4CIS A;  3IG8 A;  2LVN C;  2KHH A;  4G6Z A;  1UM8 A;  4B7G A;  2UUC M;  4K0K M;  1K7U A;  2RGO A;  2KMQ A;  3QWL A;  4B08 A;  1UHA A;  2XSZ A;  3M6A A;  1GVN A;  4BBA A;  1N13 A;  2L2D A;  3GLI E;  1N33 M;  2L7I A;  1YTP A;  4UXI A;  1NY5 A;  2BJW A;  2F5N A;  1CUK A;  3VDU A;  3T6P A;  3MEK A;  2CE7 A;  3HH2 C;  2FNA A;  2K47 A;  4Q7J A;  4AZF A;  2JYY A;  1E32 A;  1ULM A;  4NL4 H;  4IBC A;  2A20 A;  2DAI A;  3T38 A;  5EXX A;  1NJF A;  2KZS A;  1XMO M;  3SYK A;  2DKV A;  4EDG A;  1GJT A;  1L8Q A;  3B7Q A;  3CGW A;  3EIE A;  1CT2 I;  1WGT A;  2KMP A;  1P3Q Q;  2LVQ D;  4D81 A;  1C7Y A;  1R79 A;  1L2B A;  2QQC A;  2E73 A;  2SGE I;  1N34 M;  1TIH A;  2DAM A;  3GLF A;  3VKH A;  3LVV A;  1XXH E;  1VEJ A;  2J5Y A;  5CCM A;  3LVW A;  1LTM A;  3WHK A;  3VK8 A;  3QTL D;  4LJ4 A;  3GLG A;  4O6O A;  2XEP A;  1DGF A;  3AOE A;  1FNN A;  2WSE F;  1JB0 F;  2X8A A;  2LUY A;  2QPA A;  2JZ0 A;  1J09 A;  1TUR A;  2NQ8 C;  5GKN A;  3FD9 A;  3HHY A;  2HCB A;  3FYC A;  3UGJ A;  1PCE A;  3OXF A;  1MJA A;  2HHH M;  3CXL A;  2UU9 M;  1TH2 A;  3TO6 A;  1NSF A;  3A98 B;  3B89 A;  1GL7 A;  3KOZ E;  2ENN A;  3TPZ A;  1WJ7 A;  1DD9 A;  1GKI A;  1VDD A;  5E26 A;  2FE8 A;  1QZM A;  1ZMW A;  2G8L A;  2DB6 A;  3SC3 A;  1XA6 A;  4LGM A;  1D0L A;  2ZTC A;  3SGQ I;  1Q39 A;  4L4U A;  2QBY B;  1E9S A;  3FRI A;  4R71 A;  1ZAE A;  1IN5 A;  1V34 A;  5C1B A;  4GKK M;  1SGY I;  1ULK A;  3AOE C;  2QP9 X;  4L16 A;  4XBO A;  2JY7 A;  4DV0 M;  4DR2 M;  1G3I A;  1NVM A;  1YSY A;  3WHL A;  1TR8 A;  3U6L A;  3U61 A;  4DNC A;  1OYV I;  4CIZ A;  1DS3 I;  2SGP I;  4OVZ B;  1L1Z A;  1T43 A;  4M0W A;  1G71 A;  1PRB A;  4G4R A;  2QCU A;  5FTM A;  4QOZ C;  5LMU M;  1SGN I;  4IJE A;  3TOA A;  2DKL A;  1MN3 A;  1QAM A;  1NY6 A;  1R5L A;  5EP4 A;  1FJG M;  3SHF A;  3GLF E;  3R5A A;  2X52 A;  4X65 M;  2YQP A;  2FOI C;  2JY8 A;  3J7A S;  2DHR A;  5FTJ A;  5FUW A;  3K92 A;  3L29 A;  4IBJ A;  2FFJ A;  4FWG A;  2CFO A;  2H1R A;  1QDT A;  2O01 F;  4DR3 M;  4F1I A;  1Y1B A;  1SXJ D;  3HY5 A;  1BMO A; 
#chains in the Genus database with same CATH homology
 3ZH9 B;  2VRW B;  2CHQ A;  4B3R M;  3FKE A;  4LF7 M;  1R2Z A;  2KCX A;  3E4R A;  3GQ4 A;  1IBM M;  4MGI E;  2SGD I;  3GLI B;  3SYL A;  1SXJ C;  1KYI A;  3K1J A;  4OU7 A;  3W0L B;  3J7B A;  1CHO I;  5FLX S;  3E59 A;  3SGB I;  1DGH A;  2P6A C;  1D3Y A;  1OFI A;  4E2K A;  3U61 B;  2L7H A;  3A46 A;  3R9X B;  2X49 A;  3J81 S;  2JW6 A;  3GPX A;  1XX6 A;  3VK7 A;  4A3V B;  3GQ3 A;  2R4E A;  1SXJ E;  4GRI A;  4QOS A;  2Z3X A;  1JQJ C;  1XC8 A;  5IT9 S;  1TDZ A;  5C18 A;  3UFF A;  4GIP A;  4X62 M;  3MEK A;  3HU3 A;  4NSR A;  4LGY A;  3U5Z A;  2ZAN A;  3B9P A;  4PT5 A;  3KOY E;  3UJN A;  4OVO A;  4WUR A;  2ELI A;  1N75 A;  3VFD A;  2GVI A;  2XRC A;  4IBI A;  4MGZ E;  4P16 A;  4RF0 A;  2Y21 A;  1Z6T A;  4GH9 A;  4B3M M;  1M8B A;  1W3S A;  2V6Z M;  2W0T A;  1IM2 A;  4YHH M;  3U6E A;  4II7 A;  2L6O A;  5KPZ A;  3H4M A;  1Y1C A;  3J27 B;  2V1C A;  2FNF X;  3TWM A;  5KPR A;  1HT1 E;  3HJ8 A;  1J5E M;  3W0F A;  3VE5 A;  1KSF X;  1UVF A;  2UXB M;  3RU0 A;  2KMR A;  3CF2 A;  3UMM A;  3RGP A;  2C99 A;  3U6M A;  4I8O A;  1N13 A;  2YQZ A;  4MGK E;  4FVM A;  1XXH B;  5ITQ A;  3SAU A;  4JI5 M;  5EX0 A;  3GLF B;  4AI6 A;  5KQ8 A;  1QQW A;  4KOD A;  1XMQ M;  2C9C A;  2LNH C;  1I94 M;  1IXR C;  4LJ8 A;  3M7G A;  4EE1 A;  3NBI A;  2SGF I;  3GLG B;  3OL0 A;  2YFQ A;  2ROW A;  4QNM A;  2J7O A;  1TBO A;  3UGI A;  3KY9 A;  3OTO M;  1FAR A;  1KFV A;  2DWZ B;  2C96 A;  1Z7K B;  1L1T A;  4LJ7 A;  1R2Y A;  1XNR M;  2NU2 I;  2F5P A;  1IY5 A;  3FTD A;  4GI3 C;  2XF3 A;  4DV2 M;  5CCL A;  3FUT A;  2BUS A;  3HHW A;  1V1H A;  4B7H A;  1EE8 A;  5H37 D;  2XSZ D;  3THG A;  1DDE A;  3SFZ A;  1HQY E;  4MH0 E;  4B3S M;  3T15 A;  4L15 A;  4LJ6 A;  3K2L A;  2DWM A;  2QQD A;  2F3C I;  5DNY A;  3Q8X A;  4L8R C;  1N77 A;  1SXJ B;  1FAQ A;  3SAV A;  1GLN A;  1QYR A;  3NWL A;  3UZU A;  4FW9 A;  2EO2 A;  3FUW A;  2DZO B;  3GRY A;  1LR9 A;  2ORV A;  3MJ5 A;  5EP3 A;  3ZCB B;  2VQE M;  2I7N A;  3UGL A;  2L09 A;  2CV2 A;  3PNY A;  4JCV A;  2KRK A;  3KSJ A;  3UEY A;  2HKJ A;  1DO2 A;  3I4V A;  5EP1 A;  5FTL A;  4KO8 A;  4QHS A;  4REZ A;  5BR8 M;  1TH3 A;  1HR0 M;  3AL0 C;  1NJG A;  2BNK A;  4FCW A;  5ITY A;  3L2A A;  5FUX A;  4LZJ A;  1WXQ A;  3GLI A;  4IBF A;  3J2P B;  1CT0 I;  2HL7 A;  2CJS C;  2ORW A;  2SGQ I;  2XZU A;  5FTK A;  1DGG A;  4AW4 A;  2CEA A;  3SBJ A;  2W82 A;  3UK6 A;  2L7X A;  4PD2 A;  2NU3 I;  2JA2 A;  2Q2E A;  1E94 E;  2B8T A;  3TWK A;  4G4N A;  2DB6 A;  4RF1 A;  1OFH A;  1IY6 A;  3DZD A;  3RE8 A;  3GRV A;  4MGY E;  3KXE C;  4FCV A;  2I7P A;  1HJA I;  1QAO A;  4FWD A;  1KMA A;  3KSX A;  1SGP I;  3SAT A;  4LRS A;  4M9Z A;  5HQ8 A;  1NHG C;  4GMQ A;  2KXE A;  1W5T A;  5FUV A;  3FUX A;  1NUB A;  1QVR A;  3U6D A;  2CV1 A;  1IY0 A;  1N78 A;  3AJI B;  1X74 A;  3FTC A;  5IWA M;  1HNW M;  4FD2 A;  3KVW A;  4DUZ M;  1PJI A;  1PTQ A;  3SHG B;  4HGU A;  1OJL A;  1G41 A;  2R4J A;  4W5W A;  2ZAO A;  3GRR A;  3U60 B;  4LJ9 A;  3D8B A;  2RKO A;  1G59 A;  4LJ5 A;  4DV6 M;  2NU4 I;  2KZU A;  3KP0 E;  5IRE B;  2F5Q A;  2UZ3 A;  1CE3 A;  2XGN A;  4AQY M;  4L78 A;  4IBG A;  1U5K A;  4BLC A;  4AKI A;  4G4O A;  2DZN B;  1HQC A;  1IBL M;  1LR7 A;  4M0D A;  2R45 A;  5F3W A;  1XXH A;  5ITU A;  4BB9 A;  2G5G X;  2A20 A;  2V53 A;  1AN1 I;  1JR3 A;  5FSW A;  4DV4 M;  5JHW C;  1C1K A;  2DXI A;  5EP2 A;  2Z7J A;  1K3W A;  3HHX A;  4XGI A;  4DR5 M;  5DYG A;  4IBE A;  4FCT A;  2V1C C;  1UVG A;  3AOG A;  3ILK A;  2J87 A;  4JYA M;  3KDS E;  5FTN A;  3A45 A;  4DV1 M;  3U6C A;  4FWH A;  3OXL A;  3T1Y M;  4I5S A;  4X66 M;  4JI2 M;  1OMT A;  3J80 S;  4CHT B;  3D00 A;  3OXG A;  3JAM S;  5ITR A;  4FKD A;  1X4S A;  3PVS A;  4LF8 M;  3B39 A;  3U6S A;  2YUU A;  3GPP A;  1SGR I;  2DWN A;  2XH9 A;  4A24 A;  4ZPX A;  4IBD A;  4JXJ A;  3GPU A;  2QQE A;  2JZM A;  3GRU A;  2BJV A;  1Q3B A;  1UUC A;  4LY6 A;  3TL4 X;  2ZBK A;  1Z5B A;  4KHP M;  3HJS A;  1HDL A;  4LFC M;  4EDK A;  4NRV A;  4Z6Y A;  1M8C A;  5EXT A;  4JI7 M;  5FUY A;  3U6P A;  1OMU A;  1Q3C A;  1S3S A;  4UXH A;  2L8E A;  2KEB A;  3CF6 E;  3KW6 A;  4O6P B;  1NNJ A;  2C98 A;  4EDT A;  2DWL A;  2Q2E B;  1CSO I;  2B0U C;  2NU0 I;  1PJU A;  1N36 M;  1HT2 E;  3SMP A;  4LZZ A;  1LV7 A;  3PXG A;  4D82 A;  4GIT A;  1TDH A;  1K3X A;  1ORY B;  3PDN A;  4LF4 M;  4NRW A;  4AKH A;  4IIW A;  4ITQ A;  3HHZ A;  1PPF I;  1CT4 I;  4L9M A;  3U6Q A;  4IBB A;  4QHT A;  3SMS A;  4LG2 A;  2XFS A;  3KOX E;  3LMM A;  2CHG A;  3BOS A;  2ERC A;  1MX0 A;  2OD1 A;  5EXS A;  5JI2 E;  2CUZ A;  4LF5 M;  4DR4 M;  4JCV E;  4EIW A;  1T6T 1;  3U6O A;  2ZM6 M;  2JXD A;  3GQ5 A;  1Z5A A;  1XHB A;  1IN7 A;  1YE9 A;  2XFT A;  4LFB M;  4GHL A;  4PCZ A;  1SGQ I;  2UXC M;  1TBQ R;  2J7N A;  3EIH A;  1J7K A;  7CAT A;  2QEN A;  3FTF A;  2QPO A;  3HWS A;  4I81 A;  1DS2 I;  4D80 A;  2GKT I;  2M5X A;  3QWP A;  5ITT A;  3U60 A;  3AFH A;  4QNR A;  2D7G A;  5EX3 A;  4E1R A;  4IBK A;  1FYB A;  3AKZ A;  5GUJ A;  2YR0 A;  3VKG A;  3SAW A;  4G4Q A;  2Y20 A;  3SAS A;  1SGD I;  5A2Q S;  5ITX E;  3UEJ A;  3TJQ A;  4AKG A;  2KRU A;  1XNQ M;  4JV5 M;  2M5Z A;  3MK6 A;  4LJA A;  1KBE A;  1CGJ I;  3C58 A;  1PM5 A;  3GLH B;  2GKR I;  2GKV A;  2AU3 A;  3KP1 E;  2F5S A;  4YY3 M;  2ZAM A;  3R8F A;  4AG6 A;  4E1P A;  5EJC A;  4R7G A;  1R7R A;  3HGI A;  1GL6 A;  4JI1 M;  1Z5C A;  2X4A A;  5ITX A;  1TBN A;  1Y8F A;  4MGH A;  3KS4 A;  1D2N A;  3FUV A;  4X64 M;  2O5R A;  3GO8 A;  3CTW B;  1MT1 A;  3AV0 A;  1TBR R;  3RFW A;  2R46 A;  5KO3 A;  4HLQ A;  3T1H M;  3JR5 A;  1QAN A;  1IQP A;  1ZQ9 A;  2XZF A;  4B3T M;  1TGS I;  4OW0 A;  1G4A E;  4PDI A;  2KA6 B;  3KFU G;  4DR7 M;  2D7H A;  2ERW A;  3FTE A;  1I4W A;  1IN6 A;  4B7F A;  4AG5 A;  4Z8X A;  5EXP A;  4JI8 M;  2C5R A;  3HU2 A;  3TQS A;  3HU1 A;  1R0R I;  2M60 A;  1OVO A;  2KW0 A;  2VII A;  2R62 A;  3PFI A;  3E2I A;  2N52 A;  2LWX A;  4NXM M;  3FYD A;  2QQ0 A;  1QAQ A;  4UXJ A;  4LFA M;  1E9R A;  1TGU A;  4JI4 M;  1W4R A;  4IJF A;  2E5R A;  1NHW C;  4I4L A;  4PDG A;  1K82 A;  1DGH B;  4JI3 M;  2ODD A;  1BUS A;  2P5T A;  1IXS B;  1EQN A;  1L2D A;  1G8P A;  3L26 A;  1L2C A;  4DR6 M;  2EA0 A;  1TOT A;  5KQD A;  3DFZ A;  1SGE I;  1T3T A;  3UGD A;  3HKP A;  8CAT A;  5DAE A;  3DA1 A;  3IG5 A;  2QZ4 A;  3FC3 A;  3L25 A;  2UXD M;  2AHM A;  1DGB A;  2WCY A;  3M0E A;  3KOW E;  2LXE A;  1IN8 A;  5DYI A;  3LQQ A;  2UUB M;  3OVO A;  5IZ7 D;  1YUB A;  4B6D A;  1JR3 D;  3VDP A;  1IBK M;  3GOX A;  2J9R A;  1H6U A;  2OQ4 A;  4DUY M;  1HNZ M;  4LF6 M;  1R6B X;  4JI0 M;  4LF9 M;  3L28 A;  3PNV A;  4LCB A;  4DR1 M;  4KLN A;  1RFH A;  2R65 A;  4DV5 M;  2KMO A;  1V1I A;  4CGY B;  1IXZ A;  1H0Z A;  3I4Y A;  3LQR A;  3K8Z A;  4GKJ M;  3L27 A;  4M9X A;  3D8L A;  4MM3 B;  2E5L M;  1N32 M;  2D7E A;  1DO0 A;  3QAU A;  2OVO A;  2Z4R A;  3GP1 A;  4JI6 M;  1PJJ A;  5BPV A;  2N1A B;  1TH4 A;  1Z59 A;  2LEO A;  2NU1 I;  2YNM D;  4GC5 A;  3GLH A;  4OX9 M;  1IY1 A;  2CV0 A;  2LH0 A;  2ZBK B;  3MHV C;  1XBT A;  5EQT A;  2ARP F;  4DV7 M;  1MU5 A;  2DIP A;  2N17 A;  3JR4 A;  3CF0 A;  3SAR A;  4DV3 M;  1X37 A;  2UUA M;  1NNU C;  2OPF A;  1LR8 A;  5HI7 A;  4HL4 A;  4M9S A;  5LMN M;  4GC9 A;  4S12 A;  5E6J A;  4WW0 A;  2F4V M;  1CGI I;  2N71 A;  2EUC A;  4MB7 A;  4TUW A;  4OVZ A;  2Z4S A;  3GPY A;  1KBF A;  3HJQ A;  4RNA A;  3ZC7 B;  2K9H A;  2DVW B;  1XWI A;  1IY2 A;  4LRT A;  4EDR A;  3A42 A;  3I51 A;  4GHA A;  2C9O A;  2R18 A;  3FUU A;  3RGS A;  2Y0Q A;  4EDV A;  3E9S A;  2RGH A;  2ENZ A;  2WVJ A;  3TWL A;  2JA1 A;  1YU6 C;  2CHV A;  3KS8 A;  1PTR A;  2A5Y B;  3VLF B;  2V1U A;  4NOO B;  2QBY A;  4JN6 A;  1HPT A;  1SXJ A;  1W5S A;  2XLJ A;  1HNX M;  2VQF M;  5JI3 E;  3U5Z B;  3DOA A;  3BJI A;  4R3D A;  5KPT A;  1TUS A;  3SEK C;  1IN4 A;  2Y0T A;  4NSO B;  3B4V C;  4NXN M;  3TE6 A;  1IW4 A;  4CIS A;  3IG8 A;  2UUC M;  4G6Z A;  1UM8 A;  4B7G A;  4K0K M;  2KMQ A;  4SGB I;  2RGO A;  3QWL A;  4B08 A;  2XSZ A;  3M6A A;  1GVN A;  4BBA A;  1N33 M;  2L7I A;  1YTP A;  4UXI A;  1NY5 A;  2BJW A;  2F5N A;  3VDU A;  2CE7 A;  3HH2 C;  2FNA A;  2K47 A;  4AZF A;  2JYY A;  1E32 A;  4NL4 H;  4IBC A;  3T38 A;  5EXX A;  1NJF A;  2KZS A;  1XMO M;  3SYK A;  4EDG A;  1L8Q A;  3EIE A;  1CT2 I;  2KMP A;  4D81 A;  1R79 A;  1L2B A;  2QQC A;  2E73 A;  2SGE I;  1N34 M;  1TIH A;  3GLF A;  3VKH A;  3LVV A;  5CCM A;  3LVW A;  3WHK A;  3VK8 A;  3QTL D;  4LJ4 A;  3GLG A;  4O6O A;  2XEP A;  1DGF A;  3AOE A;  1FNN A;  2X8A A;  2LUY A;  2QPA A;  1J09 A;  1TUR A;  2NQ8 C;  5GKN A;  3FD9 A;  3HHY A;  2HCB A;  3FYC A;  3UGJ A;  1PCE A;  3OXF A;  2HHH M;  3CXL A;  2UU9 M;  1TH2 A;  1NSF A;  3A98 B;  3KOZ E;  1GL7 A;  2ENN A;  3TPZ A;  1DD9 A;  1GKI A;  1VDD A;  5E26 A;  2FE8 A;  1QZM A;  2G8L A;  3SC3 A;  1XA6 A;  4LGM A;  3SGQ I;  1Q39 A;  4L4U A;  2QBY B;  1E9S A;  1SGY I;  5C1B A;  1ZAE A;  1IN5 A;  4GKK M;  3AOE C;  2QP9 X;  4L16 A;  4XBO A;  4DV0 M;  4DR2 M;  1G3I A;  1NVM A;  1YSY A;  3WHL A;  3U6L A;  3U61 A;  1OYV I;  2SGP I;  1DS3 I;  4OVZ B;  1L1Z A;  4M0W A;  4G4R A;  2QCU A;  5FTM A;  4QOZ C;  5LMU M;  1SGN I;  4IJE A;  1QAM A;  1NY6 A;  5EP4 A;  1FJG M;  3SHF A;  4X65 M;  2YQP A;  2FOI C;  3J7A S;  2DHR A;  5FTJ A;  5FUW A;  3K92 A;  3L29 A;  4IBJ A;  4FWG A;  2FFJ A;  2CFO A;  2H1R A;  2F5O A;  4DR3 M;  1Y1B A;  1SXJ D;  1BMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...