3VDUA

Structure of recombination mediator protein recrk21g mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPGTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 52
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vduA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vduA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vduA03
3VDUA 4EE1A 5GUJA 1VDDA 4O6PB 3B39A 4JCVA 1DD9A 4EDVA 1EQNA 4O6OA 1D3YA 1DDEA 4EDGA 4E2KA 4EDKA 1T6T1 3VDPA 3VE5A 4EDTA 4EDRA 2ZBKA 2V1CA 2AU3A 3D00A 2Q2EA
chains in the Genus database with same CATH superfamily
3HU3A 2J9RA 3UEYA 1GKIA 2CRUA 3V76A 3FE3A 2OPFA 1EE8A 4NXMM 3SBJA 4LGMA 3M6AA 3KSJA 1SGYI 3T15A 2L7XA 2GVIA 3BBZA 4JI2M 4CHTB 3U6LA 2MH8A 1Q3CA 2SGPI 5ITTA 4KHPM 3TWLA 2LVQD 2D7EA 1NY6A 2EJSA 1IBKM 3TO6A 1IY1A 3L26A 2CFOA 2LHGA 5BR8M 1N13A 2N71A 5DYIA 2UXBM 5DFLA 2ZAMA 4LJ5A 2ODDA 3UGLA 2V53A 3WHLA 1XA6A 2NU3I 4AMLA 2O01F 3GPYA 5ITXA 2HL7A 2UUBM 1L2BA 1R7RA 3HHZA 3SHGB 1V33A 3SASA 4L78A 1QUSA 4WP4A 2QHOB 2KZUA 2JY7A 4NL4H 2LWXA 3HU1A 3GLGB 1V1HA 4IBKA 2JZMA 4I81A 2BUSA 3GPPA 1CE3A 1MJBA 1R6BX 4AI6A 3RFWA 2FCJA 1P9GA 4AQYM 2L7IA 2C5RA 4KLNA 1XXHB 3OVOA 2R45A 5IT9S 4R7GA 3OXFA 1OVOA 2KNAA 3OXLA 2YR0A 3E21A 4IIWA 1PPFI 2ERWA 1P9ZA 2DAKA 4Q7JA 2CV2A 1OYVI 1ULNA 4IBBA 2OD1A 3UOEA 4EDRA 4RKUF 1J5EM 3I04M 2F5PA 1MX0A 2QBYA 2ORVA 3GLHB 5FTLA 3LQRA 2HHHM 1L1ZA 1NHWC 2QSFX 1UVGA 3ILKA 4IJEA 3UGIA 2FS1A 2X4AA 1AUAA 1MU5A 2KW0A 3I4YA 2DENA 2VQEM 1JR3D 1WGNA 4B3RM 1QDRA 4UN2B 4DR4M 2B3TA 3TPZA 3UK6A 4DR3M 2QCUA 2UZ3A 1QAQA 2CHGA 2L4EA 3R5AA 4EDKA 2KA6B 3U6QA 1V34A 4LJ7A 2AU3A 4GC9A 1SXJD 4LF4M 4UXHA 5E26A 1XBTA 2UU9M 2Y21A 3AKZA 1D2NA 3DOAA 4GRIA 3HWSA 3A98B 3J27B 4OVOA 3UMMA 1FARA 2LB7A 5ITUA 2GKVA 2LVNC 3QWLA 4EDTA 4NC6A 3QYEA 2W0TA 5FUXA 1LR8A 3TQSA 2H1RA 4CJ6A 4IBIA 3GLIA 5FTMA 8CATA 3GO8A 1DO2A 4G4RA 2A20A 2JA1A 1G41A 5EQTA 1IW4A 1E9SA 4R71A 1GJTA 1N36M 3CF6E 2UXDM 5LMUM 3U6MA 1HT2E 3GLGE 3GRUA 3DFZA 4D82A 5C1BA 3M0EA 1QDTA 2SGFI 3FKEA 2XFSA 2LVPC 2DAMA 4IBEA 4E1RA 1XXHE 1V92A 2JY8A 2QPAA 1OMTA 2KZSA 3U6SA 2KXEA 2KEBA 1LR9A 3J2PB 2DAIA 3GRYA 3SEKC 3I4VA 2K9HA 4NRVA 3NBIA 1NV9A 1MN3A 3PNYA 1SGQI 1FJGM 4B3MM 3KOYE 3E9SA 1OFIA 4HEOA 1WJ7A 2X8AA 1BVSA 1TGUA 4BBAA 2KHHA 1DO0A 4BB9A 1G8PA 3OL0A 4E2KA 2DWLA 3L27A 2L09A 2DZNB 3GLHE 3T1YM 1K3WA 3RGPA 1XNRM 2QP9X 4LG2A 1QAOA 2UVOA 2DWNA 5FTKA 3FRHA 3TOAA 2SGQI 2E73A 4MM3B 2JW6A 1PJJA 1N77A 3MHVC 7WGAA 3KP1E 4L15A 3R5DA 2G5GX 1X74A 2F5SA 1K7VA 2EKFA 4MGKE 1BUSA 4DR5M 3GPUA 3GRRA 1C7YA 1TH3A 2W82A 2A5YB 3E2IA 2APLA 3VDUA 1HNZM 1W4RA 2Q2EB 1N33M 4BLCA 2VRWB 1PJTA 2PQ8A 1XNQM 3Q8GA 1K3XA 1OIPA 5KQDA 1YTPA 4QNMA 2ZBKA 5CCMA 5H37D 4DV6M 2SGEI 4FWDA 3HJSA 5E3PA 2NU1I 2YUUA 1XB2B 1R4GA 3KXEC 3FTFA 3K9OA 5HI7A 1G71A 1NXUA 4OVZB 4JV5M 1CGJI 5EX3A 2JY6B 4DV7M 4UXJA 2XZUA 4QOZC 1UFZA 5FUYA 2I7NA 3UGJA 1OTRA 3WHKA 1T3TA 1DD9A 3CXLA 1IN4A 4PCZA 3D8BA 3KDSE 4X64M 1NHGC 1CHOI 1GO5A 4Z6YA 2BWBA 4FWGA 2C99A 2M5ZA 1I4WA 2OZUA 4LF6M 3ZQJA 1TH4A 3U60A 4AKHA 4EIWA 1T43A 1GVNA 1NJFA 1FAQA 4S12A 2K0BX 2YQPA 2AHMA 4E1PA 4GKJM 3U6DA 2GIVA 3GLFB 4O6PB 4X65M 3TE6A 4ANRA 4MGIE 1HJAI 3OXGA 5E3RA 1IY6A 2EUCA 2R6FA 1SXJB 3FSYA 4GMQA 4YY3M 2JXDA 2R4JA 4ITQA 3HJ8A 1SGPI 4NOOB 4EE1A 4FCWA 1IN6A 2L7HA 2LH0A 4M9XA 1XC8A 2X49A 3U6PA 4B6DA 2FNAA 3B89A 1L2DA 2L2DA 3RE8A 2B0UC 1NO1A 3L29A 4MGZE 2ZAOA 2V1CC 2FH0A 2V6ZM 2KMRA 1D0LA 2Z4SA 2XSZA 4M9ZA 5JI2E 4IBJA 2ARPF 4G4NA 2D7HA 2WZJA 2R44A 2R62A 2M60A 1DGHA 3F92A 5DYGA 4F1IA 3BJIA 4EDGA 4I8OA 2LUYA 1XMOM 1KBFA 2LVOC 3T6PA 3SC3A 1TGSI 5DNYA 1Z5CA 4LF5M 4JI7M 3TOBA 3KSXA 1GJSA 2J7OA 2KCXA 1OAIA 2OQ4A 2JNHA 2VF8A 1PCEA 1Z6TA 5CCLA 4DR1M 3MK6A 2J87A 3U61A 4DV2M 4IJFA 4QOSA 2FNFX 1YSYA 2OVOA 1YU6C 3ZC7B 4IBFA 2J7NA 4P17A 1GL6A 2GQFA 3GOXA 1Y1BA 4CIZA 2BJVA 1DV0A 3E46A 4QHSA 4LCBA 3B7NA 4NXNM 3VFDA 2I5RA 4JCVE 2JP7A 1CT4I 4Z8XA 3SMPA 1DS3I 3LMMA 4GHAA 3UEJA 3I01M 1VEJA 5J8CA 3C9PA 1QUTA 2LHCA 2J5YA 4SGBI 1HEVA 1PM5A 4LFBM 2ZANA 4RF1A 2JYYA 3IG8A 4D81A 1LV7A 3KFUG 3FD9A 3EIEA 3TO9A 2ELIA 2LVAA 2Y0TA 2CE7A 3CGWA 5EP2A 3AL0C 3SAUA 4EDVA 4O6OA 3ZCBB 4FD2A 2KMPA 1LTMA 1HNXM 3J7AS 1NV8A 2Y0MA 3HHXA 4DV3M 1JR3E 1HDLA 3C58A 3IG5A 1GL7A 2JXNA 2HCBA 1ULKA 3R5CA 4B7FA 3SHFA 5BPVA 4IBCA 5JI3E 2XRCA 5IWAM 1X4SA 2NU0I 3JR4A 4KO8A 2DIPA 1IXSA 4DUYM 2V1CA 3GLFE 1UUCA 3GQ3A 5KPZA 3B7ZA 1Q02A 2N17A 5E3QA 2HWJA 3GQ5A 1VDDA 1WR1B 3AV0A 1SXJE 1SXJC 2WSCF 3UJNA 2XZFA 1U5KA 3FUWA 5EXPA 3QAHA 4DV4M 2CWHA 4LJ6A 2Z4RA 1SG9A 1OIZA 1MJAA 2CUZA 4LY6A 1J7KA 4Y28F 1RU3A 2FOIC 3FYCA 2FFJA 2XF3A 3QAUA 2F3CI 4GHLA 1TDHA 2VQFM 5EP4A 1OKSA 2G8LA 3U5ZA 4DR6M 2ORWA 4XGIA 2MROB 2Z3XA 3IHPA 1NNJA 1XHBA 3VDPA 3VKGA 1G4AE 3GPXA 1TUSA 1AN1I 3KY9A 5FUVA 3AOEC 1TBOA 1OFHA 1K7UA 4PDGA 2C9OA 2F5QA 1IQPA 2R18A 1PGYA 5GUJA 5KPTA 3UZUA 3KW6A 3Q8XA 1D0KA 1YLAA 2OOAA 2XGNA 3FSXA 3LVWA 2MR9A 1R0RI 2R65A 4R3DA 3HGIA 5FUWA 1QQWA 1DGGA 1TBQR 1IBMM 5LMNM 3W68A 3VLFB 2P5TA 1L1TA 4G4QA 1PJSA 2EKKA 1TBRR 2YQZA 5FLXS 2JZ0A 3SYKA 1WHCA 3SGBI 1OAOC 5EXTA 4HL4A 4AKIA 3M7GA 3LVVA 1NJGA 3A45A 4DNCA 2KNVA 1E32A 2BNKA 3HKPA 3AJIB 4LRTA 2UUCM 1JQJC 1MT1A 3I51A 1ULMA 2CJSC 2XFTA 3L25A 3VE5A 3IECA 2DAGA 1NNUC 5GKNA 3R9XB 2QBYB 1W3SA 4MB7A 4GKKM 2MGWA 3C3DA 2R0IA 2Z8YM 1X37A 3FUUA 1MJGM 1KMAA 5ITYA 2DKLA 4QHTA 1IBLM 1XWIA 7CATA 3PVSA 1PTQA 3KOWE 1TF0B 4M0WA 4REZA 2D7GA 2GNOA 2K6BA 3HX3A 3QTLD 3C3EA 4TUWA 2MJ5B 1BMOA 2VDBB 4LJAA 1H0ZA 4LJ9A 1LR7A 2CV1A 5EP3A 4AW4A 2O25A 4UXIA 2I7PA 4GI3C 1E9RA 2QZ4A 2OO9A 1WTJA 3AOEA 4RF0A 3SARA 1Q3BA 4FCVA 3NBXX 3W0FA 1YE9A 1Y8FA 2CWBA 5J8FA 1D0MA 3THGA 1Q9BA 2VIIA 2CWFA 2NU2I 1IN8A 3GLGA 2JWSA 3TWMA 1VDLA 1VEGA 4B3SM 1QAMA 4L6V6 3HHYA 1IY0A 1Q39A 1K82A 1MJ9A 3SGQI 2KNZA 2ENNA 4HGUA 4PDIA 2GKTI 3GQ4A 3E59A 3K1JA 2DVWB 3GLIB 1XXHA 2H5XA 2XSZD 2QENA 5ITXE 1D3YA 1TR8A 2DB6A 1M8BA 1Z2IA 1KBEA 4FKDA 4G4OA 4CISA 1KYIA 4LF7M 4FWHA 3D8LA 1OJLA 2N52A 3HY5A 5FTJA 1OMUA 1ZMVA 4JI3M 2R46A 2X52A 1XMQM 4NSRA 3L28A 3LCVB 3GLHA 4X66M 2HKJA 2QQ8A 2SGDI 4B3TM 2DNAA 1DGBA 1T6OA 1QYRA 4P16A 2EO2A 3FC3A 2UUAM 1Z7KB 1G59A 2QPOA 4GC5A 3U6OA 5EXSA 1FY7A 3DA1A 3SMSA 1GLNA 3VKHA 1IN7A 3SAVA 3QWPA 3T38A 3MEKA 1PJIA 3PNVA 3K92A 2LEOA 3GRVA 1GABA 3CF0A 2RRUA 3FUTA 1R5LA 4B08A 1Z5BA 2CEAA 4DR7M 5L8RF 2ZM6M 1CT0I 2Y0QA 3R5BA 3FTEA 2QNJA 4DV5M 4A3VB 1H6UA 2ZTCA 2JUJA 2KRKA 2F5NA 1ZQ9A 3LW5F 3J7BA 4OX9M 3B74A 3LCUA 4X62M 4LRSA 1I94M 3B9PA 3PFIA 4M9SA 1QZMA 4LFCM 2JZ1A 1IXRC 1Y1CA 1NUBA 2DI0A 1RFHA 2ZBKB 2E5LM 1K7TA 2XEPA 2KDLA 1F4IA 2DXIA 2BWEA 4OU7A 3KVWA 3HH2C 1WGCA 2YNMD 4MPIA 1W5TA 2R4EA 4GITA 1QZEA 4JYAM 4LZJA 2M5XA 4GH9A 2C9CA 3PXGA 3FYDA 3QYBA 1IY2A 1SGRI 3A46A 2HAKA 3KOZE 3GLIE 4LF9M 4GEWA 1SGNI 3FUVA 2OU2A 3GP1A 2NQ8C 4HLQA 4KT0F 1S20A 1WXQA 1IXZA 2DKVA 1EFUB 2WSFF 2P6AC 5FTNA 2QQCA 3SYLA 3FTCA 1N34M 2LXEA 2RGHA 3FUXA 3W0LB 2XH9A 1DDEA 4K0KM 1R79A 3U60B 1NVMA 5E6JA 2N35A 1TBNA 3PDNA 2ERCA 2LTUA 1CT2I 1IM2A 2LNHC 3AOGA 3J80S 2L4FA 2DHRA 2K47A 1IN5A 1UVFA 2QQ0A 3CF2A 1CGII 1W5SA 2CP8A 2VF7A 3H4JA 3EIHA 4JI1M 1PJUA 2CWGA 4L8RC 1HJPA 1UHAA 3J81S 1CSOI 2WVJA 3H4MA 1R2YA 4JI0M 3SFZA 1PRBA 1A5TA 2Q2EA 3K8ZA 4MGYE 2LBCA 2V1UA 2L8EA 1DGHB 2C96A 4PT5A 2EA0A 5EXXA 1J09A 3HZJA 4FVMA 2O5RA 4WP2A 4MH0E 3NWLA 4JXJA 4JN6A 1ZMUA 2F4VM 2ENZA 1E94E 4W5WA 4OW0A 4I4LA 1TIHA 4JCVA 1HNWM 5HQ8A 2YFQA 4IBGA 4OVZA 2C98A 1HQCA 5KPRA 2B8TA 4LZZA 4QNRA 3TL4X 4ZPXA 3AFHA 3D00A 1Z59A 3U61B 1R2ZA 4GIPA 3HHWA 1TURA 2Z7JA 1YUBA 2GKRI 4L9MA 3ZH9B 4F2LA 1SGEI 3A42A 2DHYA 5EP1A 4LGYA 3TWKA 4XBOA 1EIJA 3JR5A 1JR3A 3U6CA 3RU0A 3B39A 1TDZA 2L6OA 3MJ5A 3MMPA 1HR0M 2N1AB 1JB0F 3CTWB 1V1IA 1ZAEA 2RIJA 3T1HM 4LFAM 3VK8A 3FRIA 4LJ8A 4DUZM 1SGDI 2DWMA 4FW9A 4XK8F 3R8FA 3GLFA 4A24A 2XLJA 3E4RA 2OOBA 5ITRA 2WCYA 5F3WA 4AKGA 2DZLA 2DWZB 3K9PA 2RC4A 2CHVA 1NY5A 1SXJA 4G3OA 1TTEA 3FTDA 4L16A 3DZDA 1NSFA 3K2LA 3KS4A 1KFVA 2CV0A 4KODA 5ITQA 4B7GA 4DR2M 2ROWA 1QANA 1TOTA 3B7QA 1PJQA 4RNAA 5EX0A 2WSEF 4YHHM 1IXSB 1KSFX 1DS2I 2UXCM 1HQYE 1WIVA 2NU4I 5A2QS 3TJQA 5IZ7D 4PD2A 2X3TA 4JI5M 2JY5A 3HJQA 3B4VC 5C18A 4II7A 1Y8GA 3L2AA 4JI8M 1HPTA 1M8CA 4JI6M 1L8QA 4D80A 1N78A 3BOSA 3OTOM 1N32M 3KP0E 4LJ4A 3UFFA 5KQ8A 2G3QA 2RKOA 2K9DA 3UGDA 1TH2A 1UM8A 9WGAA 4B7HA 4AZFA 2DAEA 1WGTA 1L2CA 3SAWA 2FE8A 2ZTDA 1VEKA 2KMQA 1C1KA 1ZV1A 3U5ZB 1FYBA 4WW0A 3VK7A 2Y20A 3LQQA 2KRUA 4NRWA 2KMOA 1WGLA 5IREB 1FNNA 5FSWA 5KO3A 1ZMWA 1DGFA 5DAEA 1VG5A 3SATA 4MGHA 1IFYA 4IBDA 4DV1M 1PTRA 2E5RA 3KS8A 2BJWA 2WGCA 3HU2A 1WKXA 1HT1E 2JA2A 4WURA 4DBGB 2RGOA 2QQDA 3U6EA 1XX6A 1OQYA 4DV0M 1S3SA 4AG6A 4I5SA 4G6ZA 1CUKA 1QVRA 4FCTA 3RGSA 4L4UA 2F5OA 3BXWA 4AG5A 2QQEA 1VQ1A 1Z5AA 1T6T1 4CGYB 4M0DA 1N75A 4JI4M 3KOXE 3W67A 1IY5A 1EQNA 4LF8M 1AIPC 5EJCA 4NSOB 5JHWC 1G3IA 3JAMS 1ORYB 1P3QQ 3TO7A 2CHQA 2DZOB
chains in the Genus database with same CATH topology
3VDUA 5GUJA 5KPTA 1HNZM 1W4RA 3HU3A 3UZUA 2Q2EB 2J9RA 3SYLA 3UEYA 3FTCA 1N34M 2LXEA 3KW6A 3Q8XA 2RGHA 1GKIA 3FUXA 3W0LB 1N33M 4BLCA 2VRWB 2XGNA 2XH9A 1XNQM 3QWPA 1DDEA 3LVWA 4K0KM 1R79A 1K3XA 5KQDA 3U60B 1YTPA 1R0RI 1NVMA 2R65A 4R3DA 4QNMA 2OPFA 2ZBKA 5E6JA 3HGIA 5FUWA 5CCMA 5H37D 1QQWA 1TBNA 1DGGA 1TBQR 1EE8A 4DV6M 4NXMM 3PDNA 1IBMM 5LMNM 3SBJA 4LGMA 3M6AA 2ERCA 3KSJA 2SGEI 4FWDA 3VLFB 2P5TA 1L1TA 1CT2I 4G4QA 3HJSA 1SGYI 3T15A 2L7XA 1IM2A 2GVIA 2LNHC 3AOGA 1TBRR 2NU1I 2YQZA 4JI2M 5FLXS 2YUUA 4CHTB 3U6LA 3J80S 3KXEC 3FTFA 1Q3CA 2DHRA 2SGPI 5HI7A 3SYKA 3SGBI 5ITTA 4OVZB 4KHPM 2K47A 5EXTA 4HL4A 1IN5A 3TWLA 1UVFA 4JV5M 2QQ0A 1CGJI 2D7EA 3CF2A 5EX3A 4DV7M 1NY6A 4AKIA 1CGII 4UXJA 1W5SA 3M7GA 3LVVA 2XZUA 1IBKM 3EIHA 4JI1M 1NJGA 1PJUA 4QOZC 3A45A 4L8RC 1IY1A 3L26A 5FUYA 2I7NA 1E32A 2BNKA 2CFOA 3HKPA 3UGJA 5BR8M 1N13A 2N71A 5DYIA 2UXBM 3AJIB 3WHKA 2ZAMA 4LJ5A 1T3TA 3J81S 4LRTA 2ODDA 3CXLA 2UUCM 1DD9A 1IN4A 1JQJC 4PCZA 3D8BA 3KDSE 1CSOI 3UGLA 4X64M 1MT1A 2WVJA 3I51A 3H4MA 2V53A 3WHLA 1XA6A 2NU3I 1R2YA 1NHGC 2CJSC 3GPYA 1CHOI 2XFTA 3L25A 5ITXA 3VE5A 4JI0M 2HL7A 3SFZA 4Z6YA 2UUBM 1NNUC 1L2BA 1R7RA 5GKNA 3SHGB 3HHZA 3R9XB 4FWGA 2QBYB 2Q2EA 3K8ZA 3SASA 1W3SA 4L78A 4MB7A 2C99A 2M5ZA 4MGYE 4GKKM 2KZUA 1I4WA 4LF6M 2V1UA 4NL4H 2L8EA 1DGHB 2C96A 2LWXA 1X37A 3FUUA 4PT5A 2EA0A 3HU1A 1TH4A 3U60A 4AKHA 3GLGB 1V1HA 5EXXA 1KMAA 1J09A 5ITYA 4EIWA 4FVMA 4IBKA 4QHTA 2JZMA 2O5RA 4I81A 1IBLM 1XWIA 7CATA 4MH0E 1GVNA 3NWLA 1NJFA 4JXJA 4JN6A 3PVSA 1FAQA 2BUSA 3GPPA 2F4VM 2ENZA 1E94E 4S12A 3KOWE 4M0WA 1PTQA 1R6BX 1CE3A 4W5WA 2YQPA 4OW0A 4REZA 2D7GA 2AHMA 4I4LA 4AI6A 4E1PA 4GKJM 1TIHA 3U6DA 3GLFB 4O6PB 3RFWA 4X65M 4JCVA 4AQYM 2L7IA 1HNWM 3TE6A 5HQ8A 2YFQA 2C5RA 4MGIE 3QTLD 1HJAI 4KLNA 3FC3A 1XXHB 3OXGA 4IBGA 4TUWA 4OVZA 1BMOA 2R45A 3OVOA 1IY6A 2C98A 1HQCA 5KPRA 5IT9S 4LJAA 4R7GA 2EUCA 3OXFA 1SXJB 4GMQA 4YY3M 1H0ZA 4LJ9A 2B8TA 2R4JA 2JXDA 4LZZA 4ITQA 3HJ8A 1LR7A 4QNRA 1OVOA 3TL4X 4ZPXA 1SGPI 3AFHA 3D00A 4NOOB 2CV1A 2YR0A 5EP3A 3OXLA 4EE1A 4FCWA 1IN6A 1Z59A 4AW4A 3U61B 1R2ZA 4GIPA 2L7HA 4UXIA 2LH0A 3HHWA 2I7PA 4M9XA 1XC8A 4IIWA 2X49A 3U6PA 1PPFI 2ERWA 4GI3C 2FNAA 2Z7JA 1TURA 4B6DA 1YUBA 2GKRI 4L9MA 1E9RA 2QZ4A 1L2DA 3RE8A 3ZH9B 2CV2A 1OYVI 1SGEI 2B0UC 3L29A 3A42A 4MGZE 3AOEA 4RF0A 5EP1A 2ZAOA 4IBBA 2OD1A 4EDRA 3SARA 1Q3BA 4FCVA 4LGYA 1J5EM 2F5PA 2V1CC 2V6ZM 2KMRA 3TWKA 1MX0A 2QBYA 3W0FA 2Z4SA 4XBOA 1YE9A 1Y8FA 2ORVA 2XSZA 3GLHB 1JR3A 4M9ZA 5JI2E 4IBJA 3JR5A 2ARPF 4G4NA 2D7HA 3U6CA 3RU0A 5FTLA 3B39A 1TDZA 2L6OA 3LQRA 3MJ5A 3THGA 2R62A 2HHHM 2M60A 1DGHA 1L1ZA 1HR0M 2N1AB 2VIIA 5DYGA 1NHWC 2NU2I 1IN8A 3GLGA 3CTWB 3BJIA 4EDGA 4I8OA 1UVGA 2LUYA 1V1IA 1XMOM 1KBFA 1ZAEA 3TWMA 3T1HM 4LFAM 3VK8A 3ILKA 4IJEA 3UGIA 4B3SM 4LJ8A 1QAMA 2X4AA 3HHYA 4DUZM 1SGDI 1IY0A 1Q39A 1K82A 2DWMA 4FW9A 3SGQI 3R8FA 3GLFA 2ENNA 4HGUA 1MU5A 2KW0A 3I4YA 3SC3A 4PDIA 2XLJA 4A24A 1TGSI 2GKTI 3E4RA 3GQ4A 3E59A 5ITRA 3K1JA 2DVWB 3GLIB 1XXHA 5DNYA 1Z5CA 2XSZD 2VQEM 4LF5M 1JR3D 2WCYA 2QENA 5F3WA 4AKGA 5ITXE 1D3YA 4JI7M 2DWZB 4B3RM 2CHVA 3KSXA 1NY5A 2DB6A 1SXJA 2J7OA 2KCXA 1M8BA 1KBEA 2OQ4A 4FKDA 4G4OA 4CISA 1PCEA 1KYIA 1Z6TA 3FTDA 4L16A 4LF7M 4DR4M 3TPZA 3DZDA 5CCLA 4FWHA 3MK6A 4DR1M 2J87A 3KS4A 3K2LA 1NSFA 3U61A 3D8LA 1KFVA 2CV0A 1OJLA 4DV2M 4IJFA 4QOSA 2FNFX 4KODA 3UK6A 2N52A 1YSYA 2OVOA 1YU6C 4DR3M 5ITQA 4B7GA 3ZC7B 4IBFA 2J7NA 4DR2M 2QCUA 1GL6A 5FTJA 1OMUA 2UZ3A 3GOXA 1QAQA 1Y1BA 2ROWA 2BJVA 1QANA 1TOTA 2CHGA 4JI3M 2R46A 4RNAA 4QHSA 5EX0A 4EDKA 2KA6B 3U6QA 1XMQM 4YHHM 1IXSB 4LCBA 4LJ7A 4NSRA 1KSFX 4NXNM 3VFDA 2AU3A 1DS2I 2UXCM 1HQYE 3L28A 4GC9A 1CT4I 4JCVE 1SXJD 3GLHA 4LF4M 5E26A 2HKJA 4X66M 4Z8XA 2Y21A 3SMPA 2UU9M 3AKZA 1XBTA 2SGDI 4UXHA 2NU4I 1D2NA 4B3TM 1DS3I 3LMMA 4GHAA 5A2QS 3DOAA 3UEJA 1DGBA 3TJQA 1QYRA 5IZ7D 4GRIA 4P16A 2EO2A 3HWSA 4PD2A 3A98B 4SGBI 3J27B 1PM5A 4JI5M 2ZANA 4LFBM 3UMMA 4OVOA 3HJQA 4RF1A 1FARA 2JYYA 3B4VC 3IG8A 5ITUA 2UUAM 1Z7KB 2GKVA 1G59A 5C18A 4D81A 2QPOA 4GC5A 4II7A 3QWLA 1LV7A 3L2AA 3U6OA 3KFUG 4EDTA 4JI8M 1HPTA 3FD9A 5EXSA 3EIEA 1M8CA 4JI6M 2W0TA 5FUXA 3DA1A 3SMSA 1L8QA 1GLNA 4D80A 3TQSA 3VKHA 1N78A 3BOSA 1LR8A 3OTOM 2ELIA 1IN7A 2H1RA 1N32M 3KP0E 4LJ4A 4IBIA 3UFFA 3GLIA 3SAVA 2Y0TA 2CE7A 5EP2A 3T38A 5FTMA 1PJIA 3SAUA 5KQ8A 3AL0C 3MEKA 4EDVA 8CATA 4O6OA 3PNVA 3ZCBB 3K92A 2RKOA 4FD2A 2LEOA 1TH2A 1UM8A 3GO8A 3UGDA 3GRVA 2KMPA 1HNXM 4B7HA 3J7AS 1DO2A 4AZFA 3HHXA 4G4RA 3CF0A 2A20A 3FUTA 4DV3M 2JA1A 1G41A 5EQTA 1L2CA 1IW4A 3SAWA 2FE8A 1HDLA 3C58A 3IG5A 1GL7A 1E9SA 4B08A 2HCBA 4B7FA 1Z5BA 1N36M 2KMQA 3CF6E 2CEAA 1C1KA 2UXDM 3SHFA 5LMUM 3U6MA 1HT2E 3U5ZB 3GRUA 3DFZA 5BPVA 1FYBA 4D82A 5C1BA 3M0EA 2ZM6M 4DR7M 4WW0A 4IBCA 2Y20A 3LQQA 5JI3E 3VK7A 5IWAM 2XRCA 1CT0I 2SGFI 3FKEA 1X4SA 2Y0QA 3JR4A 2NU0I 4KO8A 2DIPA 2XFSA 2KRUA 4NRWA 2KMOA 4DUYM 2V1CA 3FTEA 4DV5M 1UUCA 4A3VB 3GQ3A 4IBEA 5KPZA 1H6UA 5IREB 1FNNA 5FSWA 4E1RA 5KO3A 2N17A 2QPAA 2KRKA 2KZSA 2F5NA 1OMTA 1DGFA 2KXEA 3GQ5A 3U6SA 1VDDA 5DAEA 2KEBA 3AV0A 1LR9A 1SXJE 3J2PB 1ZQ9A 3GRYA 3J7BA 3SATA 4OX9M 4MGHA 1SXJC 4IBDA 4X62M 3I4VA 2K9HA 3SEKC 4DV1M 4NRVA 3NBIA 3UJNA 1PTRA 4LRSA 3PNYA 2XZFA 1SGQI 1U5KA 2E5RA 3FUWA 1FJGM 2BJWA 5EXPA 1I94M 3KS8A 4DV4M 3HU2A 4B3MM 1HT1E 3KOYE 3E9SA 3B9PA 1OFIA 3PFIA 4LJ6A 1QZMA 2JA2A 2Z4RA 4M9SA 4LFCM 2X8AA 4WURA 2RGOA 2CUZA 1TGUA 4BBAA 1DO0A 4BB9A 2QQDA 3U6EA 1G8PA 4LY6A 1IXRC 1J7KA 1XX6A 1Y1CA 2FOIC 4DV0M 3OL0A 1S3SA 4E2KA 4AG6A 2DWLA 3L27A 2L09A 3FYCA 2FFJA 2XF3A 2DZNB 3QAUA 4G6ZA 4I5SA 3T1YM 1QVRA 1K3WA 1NUBA 4FCTA 1RFHA 2F3CI 3RGSA 2ZBKB 4L4UA 2E5LM 2F5OA 4GHLA 3RGPA 1TDHA 1XNRM 2QP9X 2XEPA 5EP4A 2VQFM 4LG2A 2DXIA 4OU7A 2G8LA 3KVWA 1QAOA 3U5ZA 4AG5A 3HH2C 2YNMD 2QQEA 4DR6M 1W5TA 2R4EA 2ORWA 4GITA 4XGIA 2DWNA 5FTKA 4JYAM 1Z5AA 4LZJA 2Z3XA 2M5XA 4GH9A 2C9CA 1NNJA 3PXGA 1XHBA 3FYDA 1T6T1 2SGQI 1IY2A 2E73A 3VDPA 3VKGA 1SGRI 1G4AE 3A46A 4MM3B 4CGYB 3KOZE 4M0DA 2JW6A 1PJJA 1N77A 3GPXA 3MHVC 1N75A 1TUSA 4LF9M 3KP1E 4L15A 4JI4M 1AN1I 3KOXE 2G5GX 1SGNI 1X74A 2F5SA 3FUVA 3KY9A 3GP1A 4MGKE 1BUSA 1IY5A 1EQNA 4LF8M 2NQ8C 4HLQA 5EJCA 4DR5M 4NSOB 5FUVA 3GPUA 3AOEC 3GRRA 5JHWC 1G3IA 1TBOA 1OFHA 3JAMS 1ORYB 1WXQA 1IXZA 4PDGA 2C9OA 2F5QA 1TH3A 1IQPA 2CHQA 5FTNA 2R18A 2W82A 2A5YB 2P6AC 2QQCA 3E2IA 2DZOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDU A;  4EE1 A;  5GUJ A;  1VDD A;  4O6P B;  3B39 A;  4JCV A;  1DD9 A;  4EDV A;  1EQN A;  4O6O A;  1D3Y A;  1DDE A;  4EDG A;  4E2K A;  4EDK A;  1T6T 1;  3VDP A;  3VE5 A;  4EDT A;  4EDR A;  2ZBK A;  2V1C A;  2AU3 A;  3D00 A;  2Q2E A; 
#chains in the Genus database with same CATH topology
 3HU3 A;  2J9R A;  3UEY A;  1GKI A;  2CRU A;  3V76 A;  3FE3 A;  2OPF A;  1EE8 A;  4NXM M;  3SBJ A;  4LGM A;  3M6A A;  3KSJ A;  1SGY I;  3T15 A;  2L7X A;  2GVI A;  3BBZ A;  4JI2 M;  4CHT B;  3U6L A;  2MH8 A;  1Q3C A;  2SGP I;  5ITT A;  4KHP M;  3TWL A;  2LVQ D;  2D7E A;  1NY6 A;  2EJS A;  1IBK M;  3TO6 A;  1IY1 A;  3L26 A;  2CFO A;  2LHG A;  5BR8 M;  1N13 A;  2N71 A;  5DYI A;  2UXB M;  5DFL A;  2ZAM A;  4LJ5 A;  2ODD A;  3UGL A;  2V53 A;  3WHL A;  1XA6 A;  2NU3 I;  4AML A;  2O01 F;  3GPY A;  5ITX A;  2HL7 A;  2UUB M;  1L2B A;  1R7R A;  3HHZ A;  3SHG B;  1V33 A;  3SAS A;  4L78 A;  1QUS A;  4WP4 A;  2QHO B;  2KZU A;  2JY7 A;  4NL4 H;  2LWX A;  3HU1 A;  3GLG B;  1V1H A;  4IBK A;  2JZM A;  4I81 A;  2BUS A;  3GPP A;  1CE3 A;  1MJB A;  1R6B X;  4AI6 A;  3RFW A;  2FCJ A;  1P9G A;  4AQY M;  2L7I A;  2C5R A;  4KLN A;  1XXH B;  3OVO A;  2R45 A;  5IT9 S;  4R7G A;  3OXF A;  1OVO A;  2KNA A;  3OXL A;  2YR0 A;  3E21 A;  4IIW A;  1PPF I;  2ERW A;  1P9Z A;  2DAK A;  4Q7J A;  2CV2 A;  1OYV I;  1ULN A;  4IBB A;  2OD1 A;  3UOE A;  4EDR A;  4RKU F;  1J5E M;  3I04 M;  2F5P A;  1MX0 A;  2QBY A;  2ORV A;  3GLH B;  5FTL A;  3LQR A;  2HHH M;  1L1Z A;  1NHW C;  2QSF X;  1UVG A;  3ILK A;  4IJE A;  3UGI A;  2FS1 A;  2X4A A;  1AUA A;  1MU5 A;  2KW0 A;  3I4Y A;  2DEN A;  2VQE M;  1JR3 D;  1WGN A;  4B3R M;  1QDR A;  4UN2 B;  4DR4 M;  2B3T A;  3TPZ A;  3UK6 A;  4DR3 M;  2QCU A;  2UZ3 A;  1QAQ A;  2CHG A;  2L4E A;  3R5A A;  4EDK A;  2KA6 B;  3U6Q A;  1V34 A;  4LJ7 A;  2AU3 A;  4GC9 A;  1SXJ D;  4LF4 M;  4UXH A;  5E26 A;  1XBT A;  2UU9 M;  2Y21 A;  3AKZ A;  1D2N A;  3DOA A;  4GRI A;  3HWS A;  3A98 B;  3J27 B;  4OVO A;  3UMM A;  1FAR A;  2LB7 A;  5ITU A;  2GKV A;  2LVN C;  3QWL A;  4EDT A;  4NC6 A;  3QYE A;  2W0T A;  5FUX A;  1LR8 A;  3TQS A;  2H1R A;  4CJ6 A;  4IBI A;  3GLI A;  5FTM A;  8CAT A;  3GO8 A;  1DO2 A;  4G4R A;  2A20 A;  2JA1 A;  1G41 A;  5EQT A;  1IW4 A;  1E9S A;  4R71 A;  1GJT A;  1N36 M;  3CF6 E;  2UXD M;  5LMU M;  3U6M A;  1HT2 E;  3GLG E;  3GRU A;  3DFZ A;  4D82 A;  5C1B A;  3M0E A;  1QDT A;  2SGF I;  3FKE A;  2XFS A;  2LVP C;  2DAM A;  4IBE A;  4E1R A;  1XXH E;  1V92 A;  2JY8 A;  2QPA A;  1OMT A;  2KZS A;  3U6S A;  2KXE A;  2KEB A;  1LR9 A;  3J2P B;  2DAI A;  3GRY A;  3SEK C;  3I4V A;  2K9H A;  4NRV A;  3NBI A;  1NV9 A;  1MN3 A;  3PNY A;  1SGQ I;  1FJG M;  4B3M M;  3KOY E;  3E9S A;  1OFI A;  4HEO A;  1WJ7 A;  2X8A A;  1BVS A;  1TGU A;  4BBA A;  2KHH A;  1DO0 A;  4BB9 A;  1G8P A;  3OL0 A;  4E2K A;  2DWL A;  3L27 A;  2L09 A;  2DZN B;  3GLH E;  3T1Y M;  1K3W A;  3RGP A;  1XNR M;  2QP9 X;  4LG2 A;  1QAO A;  2UVO A;  2DWN A;  5FTK A;  3FRH A;  3TOA A;  2SGQ I;  2E73 A;  4MM3 B;  2JW6 A;  1PJJ A;  1N77 A;  3MHV C;  7WGA A;  3KP1 E;  4L15 A;  3R5D A;  2G5G X;  1X74 A;  2F5S A;  1K7V A;  2EKF A;  4MGK E;  1BUS A;  4DR5 M;  3GPU A;  3GRR A;  1C7Y A;  1TH3 A;  2W82 A;  2A5Y B;  3E2I A;  2APL A;  3VDU A;  1HNZ M;  1W4R A;  2Q2E B;  1N33 M;  4BLC A;  2VRW B;  1PJT A;  2PQ8 A;  1XNQ M;  3Q8G A;  1K3X A;  1OIP A;  5KQD A;  1YTP A;  4QNM A;  2ZBK A;  5CCM A;  5H37 D;  4DV6 M;  2SGE I;  4FWD A;  3HJS A;  5E3P A;  2NU1 I;  2YUU A;  1XB2 B;  1R4G A;  3KXE C;  3FTF A;  3K9O A;  5HI7 A;  1G71 A;  1NXU A;  4OVZ B;  4JV5 M;  1CGJ I;  5EX3 A;  2JY6 B;  4DV7 M;  4UXJ A;  2XZU A;  4QOZ C;  1UFZ A;  5FUY A;  2I7N A;  3UGJ A;  1OTR A;  3WHK A;  1T3T A;  1DD9 A;  3CXL A;  1IN4 A;  4PCZ A;  3D8B A;  3KDS E;  4X64 M;  1NHG C;  1CHO I;  1GO5 A;  4Z6Y A;  2BWB A;  4FWG A;  2C99 A;  2M5Z A;  1I4W A;  2OZU A;  4LF6 M;  3ZQJ A;  1TH4 A;  3U60 A;  4AKH A;  4EIW A;  1T43 A;  1GVN A;  1NJF A;  1FAQ A;  4S12 A;  2K0B X;  2YQP A;  2AHM A;  4E1P A;  4GKJ M;  3U6D A;  2GIV A;  3GLF B;  4O6P B;  4X65 M;  3TE6 A;  4ANR A;  4MGI E;  1HJA I;  3OXG A;  5E3R A;  1IY6 A;  2EUC A;  2R6F A;  1SXJ B;  3FSY A;  4GMQ A;  4YY3 M;  2JXD A;  2R4J A;  4ITQ A;  3HJ8 A;  1SGP I;  4NOO B;  4EE1 A;  4FCW A;  1IN6 A;  2L7H A;  2LH0 A;  4M9X A;  1XC8 A;  2X49 A;  3U6P A;  4B6D A;  2FNA A;  3B89 A;  1L2D A;  2L2D A;  3RE8 A;  2B0U C;  1NO1 A;  3L29 A;  4MGZ E;  2ZAO A;  2V1C C;  2FH0 A;  2V6Z M;  2KMR A;  1D0L A;  2Z4S A;  2XSZ A;  4M9Z A;  5JI2 E;  4IBJ A;  2ARP F;  4G4N A;  2D7H A;  2WZJ A;  2R44 A;  2R62 A;  2M60 A;  1DGH A;  3F92 A;  5DYG A;  4F1I A;  3BJI A;  4EDG A;  4I8O A;  2LUY A;  1XMO M;  1KBF A;  2LVO C;  3T6P A;  3SC3 A;  1TGS I;  5DNY A;  1Z5C A;  4LF5 M;  4JI7 M;  3TOB A;  3KSX A;  1GJS A;  2J7O A;  2KCX A;  1OAI A;  2OQ4 A;  2JNH A;  2VF8 A;  1PCE A;  1Z6T A;  5CCL A;  4DR1 M;  3MK6 A;  2J87 A;  3U61 A;  4DV2 M;  4IJF A;  4QOS A;  2FNF X;  1YSY A;  2OVO A;  1YU6 C;  3ZC7 B;  4IBF A;  2J7N A;  4P17 A;  1GL6 A;  2GQF A;  3GOX A;  1Y1B A;  4CIZ A;  2BJV A;  1DV0 A;  3E46 A;  4QHS A;  4LCB A;  3B7N A;  4NXN M;  3VFD A;  2I5R A;  4JCV E;  2JP7 A;  1CT4 I;  4Z8X A;  3SMP A;  1DS3 I;  3LMM A;  4GHA A;  3UEJ A;  3I01 M;  1VEJ A;  5J8C A;  3C9P A;  1QUT A;  2LHC A;  2J5Y A;  4SGB I;  1HEV A;  1PM5 A;  4LFB M;  2ZAN A;  4RF1 A;  2JYY A;  3IG8 A;  4D81 A;  1LV7 A;  3KFU G;  3FD9 A;  3EIE A;  3TO9 A;  2ELI A;  2LVA A;  2Y0T A;  2CE7 A;  3CGW A;  5EP2 A;  3AL0 C;  3SAU A;  4EDV A;  4O6O A;  3ZCB B;  4FD2 A;  2KMP A;  1LTM A;  1HNX M;  3J7A S;  1NV8 A;  2Y0M A;  3HHX A;  4DV3 M;  1JR3 E;  1HDL A;  3C58 A;  3IG5 A;  1GL7 A;  2JXN A;  2HCB A;  1ULK A;  3R5C A;  4B7F A;  3SHF A;  5BPV A;  4IBC A;  5JI3 E;  2XRC A;  5IWA M;  1X4S A;  2NU0 I;  3JR4 A;  4KO8 A;  2DIP A;  1IXS A;  4DUY M;  2V1C A;  3GLF E;  1UUC A;  3GQ3 A;  5KPZ A;  3B7Z A;  1Q02 A;  2N17 A;  5E3Q A;  2HWJ A;  3GQ5 A;  1VDD A;  1WR1 B;  3AV0 A;  1SXJ E;  1SXJ C;  2WSC F;  3UJN A;  2XZF A;  1U5K A;  3FUW A;  5EXP A;  3QAH A;  4DV4 M;  2CWH A;  4LJ6 A;  2Z4R A;  1SG9 A;  1OIZ A;  1MJA A;  2CUZ A;  4LY6 A;  1J7K A;  4Y28 F;  1RU3 A;  2FOI C;  3FYC A;  2FFJ A;  2XF3 A;  3QAU A;  2F3C I;  4GHL A;  1TDH A;  2VQF M;  5EP4 A;  1OKS A;  2G8L A;  3U5Z A;  4DR6 M;  2ORW A;  4XGI A;  2MRO B;  2Z3X A;  3IHP A;  1NNJ A;  1XHB A;  3VDP A;  3VKG A;  1G4A E;  3GPX A;  1TUS A;  1AN1 I;  3KY9 A;  5FUV A;  3AOE C;  1TBO A;  1OFH A;  1K7U A;  4PDG A;  2C9O A;  2F5Q A;  1IQP A;  2R18 A;  1PGY A;  5GUJ A;  5KPT A;  3UZU A;  3KW6 A;  3Q8X A;  1D0K A;  1YLA A;  2OOA A;  2XGN A;  3FSX A;  3LVW A;  2MR9 A;  1R0R I;  2R65 A;  4R3D A;  3HGI A;  5FUW A;  1QQW A;  1DGG A;  1TBQ R;  1IBM M;  5LMN M;  3W68 A;  3VLF B;  2P5T A;  1L1T A;  4G4Q A;  1PJS A;  2EKK A;  1TBR R;  2YQZ A;  5FLX S;  2JZ0 A;  3SYK A;  1WHC A;  3SGB I;  1OAO C;  5EXT A;  4HL4 A;  4AKI A;  3M7G A;  3LVV A;  1NJG A;  3A45 A;  4DNC A;  2KNV A;  1E32 A;  2BNK A;  3HKP A;  3AJI B;  4LRT A;  2UUC M;  1JQJ C;  1MT1 A;  3I51 A;  1ULM A;  2CJS C;  2XFT A;  3L25 A;  3VE5 A;  3IEC A;  2DAG A;  1NNU C;  5GKN A;  3R9X B;  2QBY B;  1W3S A;  4MB7 A;  4GKK M;  2MGW A;  3C3D A;  2R0I A;  2Z8Y M;  1X37 A;  3FUU A;  1MJG M;  1KMA A;  5ITY A;  2DKL A;  4QHT A;  1IBL M;  1XWI A;  7CAT A;  3PVS A;  1PTQ A;  3KOW E;  1TF0 B;  4M0W A;  4REZ A;  2D7G A;  2GNO A;  2K6B A;  3HX3 A;  3QTL D;  3C3E A;  4TUW A;  2MJ5 B;  1BMO A;  2VDB B;  4LJA A;  1H0Z A;  4LJ9 A;  1LR7 A;  2CV1 A;  5EP3 A;  4AW4 A;  2O25 A;  4UXI A;  2I7P A;  4GI3 C;  1E9R A;  2QZ4 A;  2OO9 A;  1WTJ A;  3AOE A;  4RF0 A;  3SAR A;  1Q3B A;  4FCV A;  3NBX X;  3W0F A;  1YE9 A;  1Y8F A;  2CWB A;  5J8F A;  1D0M A;  3THG A;  1Q9B A;  2VII A;  2CWF A;  2NU2 I;  1IN8 A;  3GLG A;  2JWS A;  3TWM A;  1VDL A;  1VEG A;  4B3S M;  1QAM A;  4L6V 6;  3HHY A;  1IY0 A;  1Q39 A;  1K82 A;  1MJ9 A;  3SGQ I;  2KNZ A;  2ENN A;  4HGU A;  4PDI A;  2GKT I;  3GQ4 A;  3E59 A;  3K1J A;  2DVW B;  3GLI B;  1XXH A;  2H5X A;  2XSZ D;  2QEN A;  5ITX E;  1D3Y A;  1TR8 A;  2DB6 A;  1M8B A;  1Z2I A;  1KBE A;  4FKD A;  4G4O A;  4CIS A;  1KYI A;  4LF7 M;  4FWH A;  3D8L A;  1OJL A;  2N52 A;  3HY5 A;  5FTJ A;  1OMU A;  1ZMV A;  4JI3 M;  2R46 A;  2X52 A;  1XMQ M;  4NSR A;  3L28 A;  3LCV B;  3GLH A;  4X66 M;  2HKJ A;  2QQ8 A;  2SGD I;  4B3T M;  2DNA A;  1DGB A;  1T6O A;  1QYR A;  4P16 A;  2EO2 A;  3FC3 A;  2UUA M;  1Z7K B;  1G59 A;  2QPO A;  4GC5 A;  3U6O A;  5EXS A;  1FY7 A;  3DA1 A;  3SMS A;  1GLN A;  3VKH A;  1IN7 A;  3SAV A;  3QWP A;  3T38 A;  3MEK A;  1PJI A;  3PNV A;  3K92 A;  2LEO A;  3GRV A;  1GAB A;  3CF0 A;  2RRU A;  3FUT A;  1R5L A;  4B08 A;  1Z5B A;  2CEA A;  4DR7 M;  5L8R F;  2ZM6 M;  1CT0 I;  2Y0Q A;  3R5B A;  3FTE A;  2QNJ A;  4DV5 M;  4A3V B;  1H6U A;  2ZTC A;  2JUJ A;  2KRK A;  2F5N A;  1ZQ9 A;  3LW5 F;  3J7B A;  4OX9 M;  3B74 A;  3LCU A;  4X62 M;  4LRS A;  1I94 M;  3B9P A;  3PFI A;  4M9S A;  1QZM A;  4LFC M;  2JZ1 A;  1IXR C;  1Y1C A;  1NUB A;  2DI0 A;  1RFH A;  2ZBK B;  2E5L M;  1K7T A;  2XEP A;  2KDL A;  1F4I A;  2DXI A;  2BWE A;  4OU7 A;  3KVW A;  3HH2 C;  1WGC A;  2YNM D;  4MPI A;  1W5T A;  2R4E A;  4GIT A;  1QZE A;  4JYA M;  4LZJ A;  2M5X A;  4GH9 A;  2C9C A;  3PXG A;  3FYD A;  3QYB A;  1IY2 A;  1SGR I;  3A46 A;  2HAK A;  3KOZ E;  3GLI E;  4LF9 M;  4GEW A;  1SGN I;  3FUV A;  2OU2 A;  3GP1 A;  2NQ8 C;  4HLQ A;  4KT0 F;  1S20 A;  1WXQ A;  1IXZ A;  2DKV A;  1EFU B;  2WSF F;  2P6A C;  5FTN A;  2QQC A;  3SYL A;  3FTC A;  1N34 M;  2LXE A;  2RGH A;  3FUX A;  3W0L B;  2XH9 A;  1DDE A;  4K0K M;  1R79 A;  3U60 B;  1NVM A;  5E6J A;  2N35 A;  1TBN A;  3PDN A;  2ERC A;  2LTU A;  1CT2 I;  1IM2 A;  2LNH C;  3AOG A;  3J80 S;  2L4F A;  2DHR A;  2K47 A;  1IN5 A;  1UVF A;  2QQ0 A;  3CF2 A;  1CGI I;  1W5S A;  2CP8 A;  2VF7 A;  3H4J A;  3EIH A;  4JI1 M;  1PJU A;  2CWG A;  4L8R C;  1HJP A;  1UHA A;  3J81 S;  1CSO I;  2WVJ A;  3H4M A;  1R2Y A;  4JI0 M;  3SFZ A;  1PRB A;  1A5T A;  2Q2E A;  3K8Z A;  4MGY E;  2LBC A;  2V1U A;  2L8E A;  1DGH B;  2C96 A;  4PT5 A;  2EA0 A;  5EXX A;  1J09 A;  3HZJ A;  4FVM A;  2O5R A;  4WP2 A;  4MH0 E;  3NWL A;  4JXJ A;  4JN6 A;  1ZMU A;  2F4V M;  2ENZ A;  1E94 E;  4W5W A;  4OW0 A;  4I4L A;  1TIH A;  4JCV A;  1HNW M;  5HQ8 A;  2YFQ A;  4IBG A;  4OVZ A;  2C98 A;  1HQC A;  5KPR A;  2B8T A;  4LZZ A;  4QNR A;  3TL4 X;  4ZPX A;  3AFH A;  3D00 A;  1Z59 A;  3U61 B;  1R2Z A;  4GIP A;  3HHW A;  1TUR A;  2Z7J A;  1YUB A;  2GKR I;  4L9M A;  3ZH9 B;  4F2L A;  1SGE I;  3A42 A;  2DHY A;  5EP1 A;  4LGY A;  3TWK A;  4XBO A;  1EIJ A;  3JR5 A;  1JR3 A;  3U6C A;  3RU0 A;  3B39 A;  1TDZ A;  2L6O A;  3MJ5 A;  3MMP A;  1HR0 M;  2N1A B;  1JB0 F;  3CTW B;  1V1I A;  1ZAE A;  2RIJ A;  3T1H M;  4LFA M;  3VK8 A;  3FRI A;  4LJ8 A;  4DUZ M;  1SGD I;  2DWM A;  4FW9 A;  4XK8 F;  3R8F A;  3GLF A;  4A24 A;  2XLJ A;  3E4R A;  2OOB A;  5ITR A;  2WCY A;  5F3W A;  4AKG A;  2DZL A;  2DWZ B;  3K9P A;  2RC4 A;  2CHV A;  1NY5 A;  1SXJ A;  4G3O A;  1TTE A;  3FTD A;  4L16 A;  3DZD A;  1NSF A;  3K2L A;  3KS4 A;  1KFV A;  2CV0 A;  4KOD A;  5ITQ A;  4B7G A;  4DR2 M;  2ROW A;  1QAN A;  1TOT A;  3B7Q A;  1PJQ A;  4RNA A;  5EX0 A;  2WSE F;  4YHH M;  1IXS B;  1KSF X;  1DS2 I;  2UXC M;  1HQY E;  1WIV A;  2NU4 I;  5A2Q S;  3TJQ A;  5IZ7 D;  4PD2 A;  2X3T A;  4JI5 M;  2JY5 A;  3HJQ A;  3B4V C;  5C18 A;  4II7 A;  1Y8G A;  3L2A A;  4JI8 M;  1HPT A;  1M8C A;  4JI6 M;  1L8Q A;  4D80 A;  1N78 A;  3BOS A;  3OTO M;  1N32 M;  3KP0 E;  4LJ4 A;  3UFF A;  5KQ8 A;  2G3Q A;  2RKO A;  2K9D A;  3UGD A;  1TH2 A;  1UM8 A;  9WGA A;  4B7H A;  4AZF A;  2DAE A;  1WGT A;  1L2C A;  3SAW A;  2FE8 A;  2ZTD A;  1VEK A;  2KMQ A;  1C1K A;  1ZV1 A;  3U5Z B;  1FYB A;  4WW0 A;  3VK7 A;  2Y20 A;  3LQQ A;  2KRU A;  4NRW A;  2KMO A;  1WGL A;  5IRE B;  1FNN A;  5FSW A;  5KO3 A;  1ZMW A;  1DGF A;  5DAE A;  1VG5 A;  3SAT A;  4MGH A;  1IFY A;  4IBD A;  4DV1 M;  1PTR A;  2E5R A;  3KS8 A;  2BJW A;  2WGC A;  3HU2 A;  1WKX A;  1HT1 E;  2JA2 A;  4WUR A;  4DBG B;  2RGO A;  2QQD A;  3U6E A;  1XX6 A;  1OQY A;  4DV0 M;  1S3S A;  4AG6 A;  4I5S A;  4G6Z A;  1CUK A;  1QVR A;  4FCT A;  3RGS A;  4L4U A;  2F5O A;  3BXW A;  4AG5 A;  2QQE A;  1VQ1 A;  1Z5A A;  1T6T 1;  4CGY B;  4M0D A;  1N75 A;  4JI4 M;  3KOX E;  3W67 A;  1IY5 A;  1EQN A;  4LF8 M;  1AIP C;  5EJC A;  4NSO B;  5JHW C;  1G3I A;  3JAM S;  1ORY B;  1P3Q Q;  3TO7 A;  2CHQ A;  2DZO B; 
#chains in the Genus database with same CATH homology
 3VDU A;  5GUJ A;  5KPT A;  1HNZ M;  1W4R A;  3HU3 A;  3UZU A;  2Q2E B;  2J9R A;  3SYL A;  3UEY A;  3FTC A;  1N34 M;  2LXE A;  3KW6 A;  3Q8X A;  2RGH A;  1GKI A;  3FUX A;  3W0L B;  1N33 M;  4BLC A;  2VRW B;  2XGN A;  2XH9 A;  1XNQ M;  3QWP A;  1DDE A;  3LVW A;  4K0K M;  1R79 A;  1K3X A;  5KQD A;  3U60 B;  1YTP A;  1R0R I;  1NVM A;  2R65 A;  4R3D A;  4QNM A;  2OPF A;  2ZBK A;  5E6J A;  3HGI A;  5FUW A;  5CCM A;  5H37 D;  1QQW A;  1TBN A;  1DGG A;  1TBQ R;  1EE8 A;  4DV6 M;  4NXM M;  3PDN A;  1IBM M;  5LMN M;  3SBJ A;  4LGM A;  3M6A A;  2ERC A;  3KSJ A;  2SGE I;  4FWD A;  3VLF B;  2P5T A;  1L1T A;  1CT2 I;  4G4Q A;  3HJS A;  1SGY I;  3T15 A;  2L7X A;  1IM2 A;  2GVI A;  2LNH C;  3AOG A;  1TBR R;  2NU1 I;  2YQZ A;  4JI2 M;  5FLX S;  2YUU A;  4CHT B;  3U6L A;  3J80 S;  3KXE C;  3FTF A;  1Q3C A;  2DHR A;  2SGP I;  5HI7 A;  3SYK A;  3SGB I;  5ITT A;  4OVZ B;  4KHP M;  2K47 A;  5EXT A;  4HL4 A;  1IN5 A;  3TWL A;  1UVF A;  4JV5 M;  2QQ0 A;  1CGJ I;  2D7E A;  3CF2 A;  5EX3 A;  4DV7 M;  1NY6 A;  4AKI A;  1CGI I;  4UXJ A;  1W5S A;  3M7G A;  3LVV A;  2XZU A;  1IBK M;  3EIH A;  4JI1 M;  1NJG A;  1PJU A;  4QOZ C;  3A45 A;  4L8R C;  1IY1 A;  3L26 A;  5FUY A;  2I7N A;  1E32 A;  2BNK A;  2CFO A;  3HKP A;  3UGJ A;  5BR8 M;  1N13 A;  2N71 A;  5DYI A;  2UXB M;  3AJI B;  3WHK A;  2ZAM A;  4LJ5 A;  1T3T A;  3J81 S;  4LRT A;  2ODD A;  3CXL A;  2UUC M;  1DD9 A;  1IN4 A;  1JQJ C;  4PCZ A;  3D8B A;  3KDS E;  1CSO I;  3UGL A;  4X64 M;  1MT1 A;  2WVJ A;  3I51 A;  3H4M A;  2V53 A;  3WHL A;  1XA6 A;  2NU3 I;  1R2Y A;  1NHG C;  2CJS C;  3GPY A;  1CHO I;  2XFT A;  3L25 A;  5ITX A;  3VE5 A;  4JI0 M;  2HL7 A;  3SFZ A;  4Z6Y A;  2UUB M;  1NNU C;  1L2B A;  1R7R A;  5GKN A;  3SHG B;  3HHZ A;  3R9X B;  4FWG A;  2QBY B;  2Q2E A;  3K8Z A;  3SAS A;  1W3S A;  4L78 A;  4MB7 A;  2C99 A;  2M5Z A;  4MGY E;  4GKK M;  2KZU A;  1I4W A;  4LF6 M;  2V1U A;  4NL4 H;  2L8E A;  1DGH B;  2C96 A;  2LWX A;  1X37 A;  3FUU A;  4PT5 A;  2EA0 A;  3HU1 A;  1TH4 A;  3U60 A;  4AKH A;  3GLG B;  1V1H A;  5EXX A;  1KMA A;  1J09 A;  5ITY A;  4EIW A;  4FVM A;  4IBK A;  4QHT A;  2JZM A;  2O5R A;  4I81 A;  1IBL M;  1XWI A;  7CAT A;  4MH0 E;  1GVN A;  3NWL A;  1NJF A;  4JXJ A;  4JN6 A;  3PVS A;  1FAQ A;  2BUS A;  3GPP A;  2F4V M;  2ENZ A;  1E94 E;  4S12 A;  3KOW E;  4M0W A;  1PTQ A;  1R6B X;  1CE3 A;  4W5W A;  2YQP A;  4OW0 A;  4REZ A;  2D7G A;  2AHM A;  4I4L A;  4AI6 A;  4E1P A;  4GKJ M;  1TIH A;  3U6D A;  3GLF B;  4O6P B;  3RFW A;  4X65 M;  4JCV A;  4AQY M;  2L7I A;  1HNW M;  3TE6 A;  5HQ8 A;  2YFQ A;  2C5R A;  4MGI E;  3QTL D;  1HJA I;  4KLN A;  3FC3 A;  1XXH B;  3OXG A;  4IBG A;  4TUW A;  4OVZ A;  1BMO A;  2R45 A;  3OVO A;  1IY6 A;  2C98 A;  1HQC A;  5KPR A;  5IT9 S;  4LJA A;  4R7G A;  2EUC A;  3OXF A;  1SXJ B;  4GMQ A;  4YY3 M;  1H0Z A;  4LJ9 A;  2B8T A;  2R4J A;  2JXD A;  4LZZ A;  4ITQ A;  3HJ8 A;  1LR7 A;  4QNR A;  1OVO A;  3TL4 X;  4ZPX A;  1SGP I;  3AFH A;  3D00 A;  4NOO B;  2CV1 A;  2YR0 A;  5EP3 A;  3OXL A;  4EE1 A;  4FCW A;  1IN6 A;  1Z59 A;  4AW4 A;  3U61 B;  1R2Z A;  4GIP A;  2L7H A;  4UXI A;  2LH0 A;  3HHW A;  2I7P A;  4M9X A;  1XC8 A;  4IIW A;  2X49 A;  3U6P A;  1PPF I;  2ERW A;  4GI3 C;  2FNA A;  2Z7J A;  1TUR A;  4B6D A;  1YUB A;  2GKR I;  4L9M A;  1E9R A;  2QZ4 A;  1L2D A;  3RE8 A;  3ZH9 B;  2CV2 A;  1OYV I;  1SGE I;  2B0U C;  3L29 A;  3A42 A;  4MGZ E;  3AOE A;  4RF0 A;  5EP1 A;  2ZAO A;  4IBB A;  2OD1 A;  4EDR A;  3SAR A;  1Q3B A;  4FCV A;  4LGY A;  1J5E M;  2F5P A;  2V1C C;  2V6Z M;  2KMR A;  3TWK A;  1MX0 A;  2QBY A;  3W0F A;  2Z4S A;  4XBO A;  1YE9 A;  1Y8F A;  2ORV A;  2XSZ A;  3GLH B;  1JR3 A;  4M9Z A;  5JI2 E;  4IBJ A;  3JR5 A;  2ARP F;  4G4N A;  2D7H A;  3U6C A;  3RU0 A;  5FTL A;  3B39 A;  1TDZ A;  2L6O A;  3LQR A;  3MJ5 A;  3THG A;  2R62 A;  2HHH M;  2M60 A;  1DGH A;  1L1Z A;  1HR0 M;  2N1A B;  2VII A;  5DYG A;  1NHW C;  2NU2 I;  1IN8 A;  3GLG A;  3CTW B;  3BJI A;  4EDG A;  4I8O A;  1UVG A;  2LUY A;  1V1I A;  1XMO M;  1KBF A;  1ZAE A;  3TWM A;  3T1H M;  4LFA M;  3VK8 A;  3ILK A;  4IJE A;  3UGI A;  4B3S M;  4LJ8 A;  1QAM A;  2X4A A;  3HHY A;  4DUZ M;  1SGD I;  1IY0 A;  1Q39 A;  1K82 A;  2DWM A;  4FW9 A;  3SGQ I;  3R8F A;  3GLF A;  2ENN A;  4HGU A;  1MU5 A;  2KW0 A;  3I4Y A;  3SC3 A;  4PDI A;  2XLJ A;  4A24 A;  1TGS I;  2GKT I;  3E4R A;  3GQ4 A;  3E59 A;  5ITR A;  3K1J A;  2DVW B;  3GLI B;  1XXH A;  5DNY A;  1Z5C A;  2XSZ D;  2VQE M;  4LF5 M;  1JR3 D;  2WCY A;  2QEN A;  5F3W A;  4AKG A;  5ITX E;  1D3Y A;  4JI7 M;  2DWZ B;  4B3R M;  2CHV A;  3KSX A;  1NY5 A;  2DB6 A;  1SXJ A;  2J7O A;  2KCX A;  1M8B A;  1KBE A;  2OQ4 A;  4FKD A;  4G4O A;  4CIS A;  1PCE A;  1KYI A;  1Z6T A;  3FTD A;  4L16 A;  4LF7 M;  4DR4 M;  3TPZ A;  3DZD A;  5CCL A;  4FWH A;  3MK6 A;  4DR1 M;  2J87 A;  3KS4 A;  3K2L A;  1NSF A;  3U61 A;  3D8L A;  1KFV A;  2CV0 A;  1OJL A;  4DV2 M;  4IJF A;  4QOS A;  2FNF X;  4KOD A;  3UK6 A;  2N52 A;  1YSY A;  2OVO A;  1YU6 C;  4DR3 M;  5ITQ A;  4B7G A;  3ZC7 B;  4IBF A;  2J7N A;  4DR2 M;  2QCU A;  1GL6 A;  5FTJ A;  1OMU A;  2UZ3 A;  3GOX A;  1QAQ A;  1Y1B A;  2ROW A;  2BJV A;  1QAN A;  1TOT A;  2CHG A;  4JI3 M;  2R46 A;  4RNA A;  4QHS A;  5EX0 A;  4EDK A;  2KA6 B;  3U6Q A;  1XMQ M;  4YHH M;  1IXS B;  4LCB A;  4LJ7 A;  4NSR A;  1KSF X;  4NXN M;  3VFD A;  2AU3 A;  1DS2 I;  2UXC M;  1HQY E;  3L28 A;  4GC9 A;  1CT4 I;  4JCV E;  1SXJ D;  3GLH A;  4LF4 M;  5E26 A;  2HKJ A;  4X66 M;  4Z8X A;  2Y21 A;  3SMP A;  2UU9 M;  3AKZ A;  1XBT A;  2SGD I;  4UXH A;  2NU4 I;  1D2N A;  4B3T M;  1DS3 I;  3LMM A;  4GHA A;  5A2Q S;  3DOA A;  3UEJ A;  1DGB A;  3TJQ A;  1QYR A;  5IZ7 D;  4GRI A;  4P16 A;  2EO2 A;  3HWS A;  4PD2 A;  3A98 B;  4SGB I;  3J27 B;  1PM5 A;  4JI5 M;  2ZAN A;  4LFB M;  3UMM A;  4OVO A;  3HJQ A;  4RF1 A;  1FAR A;  2JYY A;  3B4V C;  3IG8 A;  5ITU A;  2UUA M;  1Z7K B;  2GKV A;  1G59 A;  5C18 A;  4D81 A;  2QPO A;  4GC5 A;  4II7 A;  3QWL A;  1LV7 A;  3L2A A;  3U6O A;  3KFU G;  4EDT A;  4JI8 M;  1HPT A;  3FD9 A;  5EXS A;  3EIE A;  1M8C A;  4JI6 M;  2W0T A;  5FUX A;  3DA1 A;  3SMS A;  1L8Q A;  1GLN A;  4D80 A;  3TQS A;  3VKH A;  1N78 A;  3BOS A;  1LR8 A;  3OTO M;  2ELI A;  1IN7 A;  2H1R A;  1N32 M;  3KP0 E;  4LJ4 A;  4IBI A;  3UFF A;  3GLI A;  3SAV A;  2Y0T A;  2CE7 A;  5EP2 A;  3T38 A;  5FTM A;  1PJI A;  3SAU A;  5KQ8 A;  3AL0 C;  3MEK A;  4EDV A;  8CAT A;  4O6O A;  3PNV A;  3ZCB B;  3K92 A;  2RKO A;  4FD2 A;  2LEO A;  1TH2 A;  1UM8 A;  3GO8 A;  3UGD A;  3GRV A;  2KMP A;  1HNX M;  4B7H A;  3J7A S;  1DO2 A;  4AZF A;  3HHX A;  4G4R A;  3CF0 A;  2A20 A;  3FUT A;  4DV3 M;  2JA1 A;  1G41 A;  5EQT A;  1L2C A;  1IW4 A;  3SAW A;  2FE8 A;  1HDL A;  3C58 A;  3IG5 A;  1GL7 A;  1E9S A;  4B08 A;  2HCB A;  4B7F A;  1Z5B A;  1N36 M;  2KMQ A;  3CF6 E;  2CEA A;  1C1K A;  2UXD M;  3SHF A;  5LMU M;  3U6M A;  1HT2 E;  3U5Z B;  3GRU A;  3DFZ A;  5BPV A;  1FYB A;  4D82 A;  5C1B A;  3M0E A;  2ZM6 M;  4DR7 M;  4WW0 A;  4IBC A;  2Y20 A;  3LQQ A;  5JI3 E;  3VK7 A;  5IWA M;  2XRC A;  1CT0 I;  2SGF I;  3FKE A;  1X4S A;  2Y0Q A;  3JR4 A;  2NU0 I;  4KO8 A;  2DIP A;  2XFS A;  2KRU A;  4NRW A;  2KMO A;  4DUY M;  2V1C A;  3FTE A;  4DV5 M;  1UUC A;  4A3V B;  3GQ3 A;  4IBE A;  5KPZ A;  1H6U A;  5IRE B;  1FNN A;  5FSW A;  4E1R A;  5KO3 A;  2N17 A;  2QPA A;  2KRK A;  2KZS A;  2F5N A;  1OMT A;  1DGF A;  2KXE A;  3GQ5 A;  3U6S A;  1VDD A;  5DAE A;  2KEB A;  3AV0 A;  1LR9 A;  1SXJ E;  3J2P B;  1ZQ9 A;  3GRY A;  3J7B A;  3SAT A;  4OX9 M;  4MGH A;  1SXJ C;  4IBD A;  4X62 M;  3I4V A;  2K9H A;  3SEK C;  4DV1 M;  4NRV A;  3NBI A;  3UJN A;  1PTR A;  4LRS A;  3PNY A;  2XZF A;  1SGQ I;  1U5K A;  2E5R A;  3FUW A;  1FJG M;  2BJW A;  5EXP A;  1I94 M;  3KS8 A;  4DV4 M;  3HU2 A;  4B3M M;  1HT1 E;  3KOY E;  3E9S A;  3B9P A;  1OFI A;  3PFI A;  4LJ6 A;  1QZM A;  2JA2 A;  2Z4R A;  4M9S A;  4LFC M;  2X8A A;  4WUR A;  2RGO A;  2CUZ A;  1TGU A;  4BBA A;  1DO0 A;  4BB9 A;  2QQD A;  3U6E A;  1G8P A;  4LY6 A;  1IXR C;  1J7K A;  1XX6 A;  1Y1C A;  2FOI C;  4DV0 M;  3OL0 A;  1S3S A;  4E2K A;  4AG6 A;  2DWL A;  3L27 A;  2L09 A;  3FYC A;  2FFJ A;  2XF3 A;  2DZN B;  3QAU A;  4G6Z A;  4I5S A;  3T1Y M;  1QVR A;  1K3W A;  1NUB A;  4FCT A;  1RFH A;  2F3C I;  3RGS A;  2ZBK B;  4L4U A;  2E5L M;  2F5O A;  4GHL A;  3RGP A;  1TDH A;  1XNR M;  2QP9 X;  2XEP A;  5EP4 A;  2VQF M;  4LG2 A;  2DXI A;  4OU7 A;  2G8L A;  3KVW A;  1QAO A;  3U5Z A;  4AG5 A;  3HH2 C;  2YNM D;  2QQE A;  4DR6 M;  1W5T A;  2R4E A;  2ORW A;  4GIT A;  4XGI A;  2DWN A;  5FTK A;  4JYA M;  1Z5A A;  4LZJ A;  2Z3X A;  2M5X A;  4GH9 A;  2C9C A;  1NNJ A;  3PXG A;  1XHB A;  3FYD A;  1T6T 1;  2SGQ I;  1IY2 A;  2E73 A;  3VDP A;  3VKG A;  1SGR I;  1G4A E;  3A46 A;  4MM3 B;  4CGY B;  3KOZ E;  4M0D A;  2JW6 A;  1PJJ A;  1N77 A;  3GPX A;  3MHV C;  1N75 A;  1TUS A;  4LF9 M;  3KP1 E;  4L15 A;  4JI4 M;  1AN1 I;  3KOX E;  2G5G X;  1SGN I;  1X74 A;  2F5S A;  3FUV A;  3KY9 A;  3GP1 A;  4MGK E;  1BUS A;  1IY5 A;  1EQN A;  4LF8 M;  2NQ8 C;  4HLQ A;  5EJC A;  4DR5 M;  4NSO B;  5FUV A;  3GPU A;  3AOE C;  3GRR A;  5JHW C;  1G3I A;  1TBO A;  1OFH A;  3JAM S;  1ORY B;  1WXQ A;  1IXZ A;  4PDG A;  2C9O A;  2F5Q A;  1TH3 A;  1IQP A;  2CHQ A;  5FTN A;  2R18 A;  2W82 A;  2A5Y B;  2P6A C;  2QQC A;  3E2I A;  2DZO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...