3VDUA

Structure of recombination mediator protein recrk21g mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
197
Chain Sequence
b'YYSTSVAKLIEELSKLPGIGPGTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 52
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vduA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vduA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vduA03
3B39A 2AU3A 4EDVA 4O6PB 4E2KA 1D3YA 4EDRA 1DD9A 2V1CA 3VDPA 4EDKA 1VDDA 3D00A 1EQNA 2Q2EA 4EDGA 5GUJA 3VE5A 4EE1A 4EDTA 2ZBKA 1T6T1 3VDUA 4O6OA 4JCVA 1DDEA
chains in the Genus database with same CATH superfamily
1HT1E 5EP2A 4GIPA 4LG2A 3LMMA 3TL4X 3KSJA 4LJ8A 4IBJA 1DV0A 3UGIA 1VQ1A 2X49A 4A24A 1D0KA 4EDGA 1AUAA 3OXFA 4A3VB 4W5WA 2XSZD 1GVNA 3I51A 1MJGM 2JXNA 3QAHA 1NHGC 4LGMA 1TBQR 1NY6A 3L25A 2CE7A 2GKRI 4MGZE 3U6CA 4AKGA 2O5RA 5BPVA 3GQ3A 1EFUB 3ZC7B 2UUBM 1DS3I 2JA2A 1HNXM 1XA6A 1UVGA 4LF7M 3KXEC 2F5SA 1HT2E 1NHWC 4I81A 2JXDA 2Y21A 2LH0A 1XNQM 5LMNM 2XZUA 4LJ5A 4LZZA 2VF8A 1HPTA 2J87A 3KSXA 1FAQA 9WGAA 1H6UA 4X62M 3FD9A 3AV0A 4IBGA 2N17A 2OVOA 2JY6B 1CT0I 4L8RC 5FTJA 2MH8A 2ZM6M 2AU3A 1IY1A 2B8TA 1X74A 3GLFA 4RKUF 3SMSA 3GP1A 1YTPA 2KCXA 5FUVA 1HJPA 1DD9A 2Z3XA 1HEVA 2XF3A 4KHPM 2E5RA 1JB0F 1OIZA 2O01F 2DI0A 3LCVB 3J7AS 4QHTA 3SAWA 2CV2A 3FTDA 4O6PB 3PNVA 4DR5M 4EDRA 5ITQA 2ZTCA 3TO6A 2J5YA 3FSXA 2KZUA 2DNAA 4GHAA 1Q3BA 4NXMM 4DV3M 2UVOA 2BWEA 4QHSA 3DZDA 1N77A 2R44A 4FD2A 1L1ZA 3FTCA 2OD1A 3FUUA 1XBTA 3I4VA 1Y1CA 1Q02A 2N52A 4G6ZA 5LMUM 4JI2M 2LB7A 3E46A 1AIPC 3HU1A 3GQ4A 1QZMA 4IBBA 1EE8A 1NY5A 1PM5A 3KS8A 1XX6A 1HNWM 3CXLA 2JP7A 3KS4A 3CF0A 3C9PA 4JYAM 5CCLA 2CHGA 1IN8A 4DNCA 3R5BA 4CHTB 1MN3A 1TURA 4X65M 1R7RA 3AOEA 4OX9M 3HH2C 3C3EA 1S20A 1XNRM 3VE5A 2QNJA 3SYLA 4DUYM 1Y8GA 1GL6A 5E3PA 4B3TM 2Y0MA 4CGYB 4F1IA 1XMOM 3VDPA 3PDNA 5KQ8A 2V1CC 1R4GA 1OMTA 4DR6M 1OMUA 2L4EA 3J27B 1P9ZA 2E73A 2YQPA 2LVAA 1JR3D 4CIZA 4HL4A 3EIHA 1E32A 1MJAA 2QENA 2C9OA 2BNKA 1T3TA 1R2YA 1SGPI 1IQPA 4I4LA 2ELIA 1T6T1 2C99A 1CUKA 2J9RA 2CP8A 3KFUG 1LV7A 3SMPA 3GLGA 2LNHC 2M5XA 2UUAM 1VDDA 4Q7JA 3BOSA 3TOAA 7CATA 4OVZA 4HLQA 3QWLA 1PJQA 4AG6A 4OVZB 2R45A 4DV5M 3OXLA 4JCVA 5ITTA 2PQ8A 1QANA 4B7GA 5KQDA 2DZOB 4KODA 2D7GA 1R6BX 5KPRA 5A2QS 4JXJA 4Z6YA 3ZH9B 3J80S 2ZBKA 3UZUA 4PT5A 1I94M 1TBRR 2ZBKB 2XGNA 3KP0E 1NJFA 4G4QA 2M5ZA 5KPTA 5FLXS 4QNRA 4NC6A 1R2ZA 2CHVA 3UEYA 4LJ4A 1WR1B 2QP9X 3HKPA 2L2DA 4E1RA 4DR3M 1Z7KB 3MHVC 4DV7M 2LHGA 2DIPA 3CF6E 3U6EA 1L8QA 4L9MA 4R71A 4MGKE 1MX0A 1XXHA 4FCVA 1ULKA 3SGQI 3W0FA 2RGOA 4MPIA 5EXPA 3T6PA 4FWHA 3KOXE 2OPFA 2R62A 3GLHE 2WSCF 3T38A 4EDTA 3VKHA 3TE6A 2JZ1A 2ZAOA 1DDEA 2B0UC 1DGFA 3CTWB 3QAUA 1VG5A 1W4RA 4X64M 2XZFA 4LFCM 2FE8A 3LW5F 5JI2E 2Q2EA 4NSRA 1QAOA 3FSYA 1QZEA 4L6V6 2JWSA 3A45A 2GVIA 3GLIE 1PJSA 5ITYA 4R3DA 4GMQA 1VEKA 3SATA 2X52A 1FJGM 4LF5M 2C98A 1KBEA 3EIEA 3HJ8A 4QOSA 1NV9A 4BB9A 3HHYA 2LVPC 4LJ9A 2L7HA 3FRIA 2R46A 1GL7A 2O25A 3E4RA 3GRVA 1G59A 1D0LA 1IBLM 3TJQA 2RRUA 3K8ZA 3GPXA 1JQJC 4KT0F 2QQEA 2QPOA 3W0LB 3GLIB 5C1BA 4QOZC 2DZNB 3PNYA 4RNAA 3LCUA 2DAEA 3B89A 2DXIA 2L09A 2OO9A 4FCTA 1CE3A 1V92A 3B39A 4M9XA 3R5DA 5FUYA 4RF0A 4B08A 4FCWA 3SASA 4WURA 4JI1M 3GPPA 4LCBA 4DBGB 1IY0A 1OFHA 3D00A 4JV5M 1N34M 5DNYA 4ITQA 4IJFA 1YE9A 5EXXA 1FYBA 4AKIA 2RC4A 1TTEA 5FTNA 3UK6A 1SGDI 1WHCA 2C9CA 3U61B 5IZ7D 1OAOC 3J2PB 2DZLA 3KY9A 4L15A 1JR3E 1PRBA 3QTLD 1D3YA 5EP4A 1Q9BA 3UGLA 3U6DA 3IECA 3DA1A 3AL0C 2HWJA 2UU9M 1PCEA 2X8AA 4II7A 2JYYA 5EXTA 1CGII 4KO8A 1N13A 1NV8A 3U60A 1YU6C 2V53A 2HAKA 1BVSA 3UGJA 3OL0A 2YFQA 2BJWA 3M7GA 3TWKA 4E2KA 2LVOC 2ENZA 1TH3A 4B3SM 3R8FA 4R7GA 2ZAMA 1A5TA 3FKEA 3KOWE 2I5RA 1TH2A 1MT1A 3GRRA 1OTRA 2K9HA 2RKOA 4DV4M 4AG5A 4Y28F 4LZJA 1ZQ9A 1PGYA 1IY5A 4MB7A 1WKXA 4L4UA 4HEOA 3I01M 3NBIA 4FW9A 2JY8A 1BMOA 2WSEF 5FTMA 3K9OA 2F5NA 2XLJA 1KFVA 1TBNA 1G3IA 3GQ5A 1J7KA 1IW4A 1J5EM 3RGPA 2MGWA 4M0WA 4JI3M 2K6BA 5HQ8A 1OJLA 3W67A 3JAMS 1TGUA 4WP4A 2WVJA 4GHLA 1CHOI 2FOIC 2L7IA 4LJ7A 1M8CA 2L8EA 1NSFA 2L4FA 1QAMA 3KW6A 1L2BA 2DKVA 3HU2A 4IJEA 4L78A 4IBKA 2SGDI 1QYRA 4D82A 1UM8A 1W3SA 1N36M 1XC8A 4GITA 4JI5M 3T1HM 1MU5A 4KLNA 1NUBA 2QHOB 3Q8XA 3E9SA 3B74A 2FFJA 2H1RA 4LFBM 1CT4I 2SGEI 3U6OA 2R4JA 1HQCA 3QWPA 1TF0B 3SBJA 3HHXA 2CWGA 1F4IA 1ZMUA 1SXJD 2EKFA 4RF1A 4DR7M 4FWDA 1OAIA 3C3DA 1UFZA 1NXUA 2LVQD 1Z5CA 3MEKA 1NO1A 1V1IA 1TDHA 1K3WA 2N71A 4G4OA 4I5SA 1DO2A 2CWHA 3A42A 2RIJA 3RGSA 1K3XA 2ORWA 2LWXA 1IXRC 5F3WA 1I4WA 1Q3CA 2LVNC 4GC9A 3ZCBB 2CWFA 3MMPA 1Z6TA 2CRUA 3U6QA 4Z8XA 3VLFB 5KO3A 1E9SA 2SGQI 3GPYA 4DV6M 2BUSA 4HGUA 2XFTA 2P5TA 1HJAI 1GABA 4EDVA 2CV1A 1GO5A 2LBCA 1SGRI 2FNFX 3AOEC 2V1CA 2DVWB 4TUWA 3LQRA 2R4EA 2H5XA 3HZJA 3KVWA 1RFHA 3L2AA 2DAIA 2HHHM 2RGHA 2YUUA 3AOGA 4REZA 1HDLA 2QBYB 1QDTA 4GRIA 1ZMWA 4OW0A 5DFLA 2GKTI 1PJJA 1OQYA 3PFIA 2OOBA 2MJ5B 3FUXA 2FS1A 3NWLA 4BLCA 4AZFA 1FNNA 4PCZA 1R5LA 1WGCA 4AMLA 1AN1I 1P3QQ 2N35A 3JR5A 2G5GX 2DWNA 2JY7A 2F5QA 4SGBI 1TR8A 4I8OA 1PJIA 4JI0M 5FTLA 1N32M 2EO2A 3OVOA 3WHKA 3THGA 4PDGA 2KXEA 3T15A 3HJSA 5J8FA 1H0ZA 3R5CA 3B7ZA 2MROB 1LTMA 5JI3E 2Y20A 2CWBA 4NRWA 4AI6A 2NU4I 1WGLA 3BBZA 3UOEA 4FWGA 2V1UA 2OOAA 1M8BA 4DV1M 1OIPA 5ITXE 1WGNA 2CHQA 3FYDA 2XSZA 2D7EA 4MH0E 3KP1E 1Z5BA 5ITRA 2NQ8C 1QAQA 1G4AE 4PD2A 4CJ6A 4MGIE 3LQQA 5FTKA 3ILKA 2QQ0A 2UXBM 5E26A 2D7HA 1TGSI 3QYEA 1CSOI 1LR9A 3GRYA 4LF6M 3U6SA 1CGJI 5HI7A 3K2LA 3KDSE 2SGPI 1GJTA 1C1KA 3LVWA 2ORVA 3BJIA 2KEBA 3D8BA 2GNOA 3MJ5A 4GC5A 4B7FA 1TDZA 2CV0A 2Z4RA 4ZPXA 3L29A 2KMPA 3SFZA 3HGIA 3PXGA 1L1TA 4YY3M 5IREB 2R6FA 1SXJE 3H4JA 3GLHA 1DO0A 2NU2I 1VEGA 3GLHB 2LHCA 1Q39A 2KNAA 2GIVA 3GPUA 1KYIA 3VKGA 5L8RF 1D0MA 1X37A 2G3QA 2F4VM 3SEKC 2VDBB 2DWLA 1WGTA 2VRWB 3SARA 3SAVA 1YSYA 4OU7A 2QQCA 2QQ8A 3GLIA 5EJCA 2DWZB 3VK7A 1SXJC 3GOXA 3ZQJA 4UXHA 1ZAEA 2Z7JA 3TO7A 5IWAM 2ENNA 1QUSA 1OYVI 3OTOM 5E3RA 4JI8M 1CT2I 3T1YM 3L26A 1NNUC 5H37D 2FNAA 4XGIA 3SHGB 3GO8A 1J09A 4FVMA 4DUZM 2F5PA 2CFOA 3F92A 2CJSC 1G71A 3U61A 4DR4M 4UXIA 1IBKM 2X3TA 1TIHA 1LR8A 1T43A 1MJBA 3TWMA 4JI6M 1ZV1A 4AKHA 3UGDA 4LF4M 2AHMA 2MR9A 2KRUA 1IXSA 1C7YA 4QNMA 3R9XB 3FRHA 1IXSB 2Y0TA 4LGYA 2DAMA 1Y1BA 2KRKA 1JR3A 3TO9A 1RU3A 3IG8A 3AFHA 2W82A 2GKVA 4IBFA 2R18A 3A46A 3UJNA 1ZMVA 2DAGA 1K7UA 3FTFA 4G4NA 3HHWA 3FTEA 2XEPA 5JHWC 2Z4SA 2F3CI 4M0DA 1DGHB 4EE1A 2QPAA 4D81A 2KZSA 1KSFX 4DV2M 2VF7A 3AKZA 2QCUA 8CATA 2JZ0A 4B3MM 3B7QA 1QQWA 4MM3B 2J7NA 1G41A 2C96A 1OKSA 5ITUA 5GKNA 2HL7A 2UUCM 2QZ4A 1GKIA 1IN7A 2M60A 3FUVA 1IY6A 1XHBA 2YQZA 1N78A 2GQFA 2FH0A 3GLFE 1MJ9A 2APLA 4IBIA 2QQDA 2JY5A 2R0IA 2Z8YM 4B6DA 2K9DA 3LVVA 3MK6A 2EJSA 4G4RA 2KHHA 3RFWA 3DFZA 1G8PA 1T6OA 3FUTA 1D2NA 3GLFB 1HQYE 1SGYI 3K1JA 5GUJA 1FARA 4BBAA 2ODDA 1U5KA 7WGAA 3DOAA 3C58A 1PPFI 2OZUA 4LJAA 1YLAA 1UUCA 2ZANA 5EXSA 3SGBI 3HJQA 2JZMA 2LTUA 4PDIA 4GH9A 2UXCM 2G8LA 2K0BX 2VQEM 2ZTDA 4IBDA 3RE8A 4GKKM 1IXZA 2YNMD 4IBCA 3B9PA 2SGFI 2WSFF 3SAUA 1GLNA 3QYBA 5EX0A 1WTJA 1YUBA 2WGCA 3FUWA 4FKDA 2P6AC 2ROWA 4B7HA 2XH9A 2I7NA 4LF8M 1EQNA 2FCJA 1Y8FA 3H4MA 1Z59A 3B7NA 2DENA 2KMQA 3FE3A 2L6OA 3KOYE 4G3OA 3I04M 2E5LM 2L7XA 5EP1A 1K7TA 1ULNA 4OVOA 3L27A 4MGHA 2BJVA 2VIIA 3K9PA 2JW6A 3TWLA 2XFSA 4X66M 2DWMA 1IN4A 3SYKA 4M9ZA 2QBYA 4IIWA 5DYIA 4LF9M 1XB2B 1PTQA 1TBOA 2V6ZM 1PJUA 3TPZA 5EX3A 5BR8M 2KNZA 2WCYA 3IHPA 1EIJA 2CUZA 4NRVA 3M6AA 2OU2A 3U6PA 3I4YA 4JN6A 4F2LA 3GLGE 3FC3A 1V1HA 2R65A 2UZ3A 3A98B 1K7VA 5C18A 2XRCA 4JCVE 4MGYE 4K0KM 2LEOA 3PVSA 2UXDM 2EUCA 4NXNM 2X4AA 3B4VC 2DKLA 2JNHA 3HWSA 3GLGB 1IBMM 1OVOA 2ARPF 1QDRA 3AJIB 2HCBA 2KNVA 4M9SA 3SC3A 2OQ4A 3RU0A 2LXEA 4XK8F 1FY7A 5FUWA 1KMAA 3Q8GA 3M0EA 1NNJA 1Z5AA 4LFAM 4WW0A 1IN6A 1XMQM 1WIVA 3NBXX 1NVMA 1W5TA 2KMOA 4YHHM 4L16A 2YR0A 4O6OA 1QVRA 1SGNI 4UXJA 2A5YB 5CCMA 3TQSA 2QSFX 2NU0I 1IN5A 1N75A 3HX3A 3CF2A 4NL4H 1VDLA 3E21A 3UMMA 3U5ZA 1S3SA 2B3TA 5ITXA 4EDKA 1XXHE 4DV0M 3U5ZB 2KW0A 2WZJA 3IG5A 3VDUA 1PTRA 1KBFA 4AQYM 1HR0M 1SG9A 3JR4A 5FUXA 1SGEI 5IT9S 1XXHB 2DAKA 5DYGA 1V33A 4UN2B 2LUYA 1QUTA 1IM2A 3V76A 3L28A 4XBOA 2Y0QA 4GKJM 2KA6B 4EIWA 2F5OA 4CISA 3E2IA 2DHRA 1E94E 4JI4M 4GI3C 3OXGA 4DR1M 5E6JA 1IFYA 4P16A 1SGQI 3J7BA 2C5RA 1VEJA 1P9GA 3K92A 2Q2EB 1R79A 2DHYA 2A20A 4WP2A 1R0RI 4AW4A 4LJ6A 3R5AA 1SXJA 3HU3A 1L2DA 1NJGA 1SXJB 1GJSA 2KDLA 2KMRA 5EP3A 3TOBA 4NOOB 4D80A 1BUSA 1HNZM 1UVFA 1PJTA 4GEWA 4S12A 1Z2IA 1XWIA 1X4SA 3KOZE 3UFFA 4IBEA 1ULMA 3D8LA 3HY5A 1WJ7A 5E3QA 3SHFA 1E9RA 2HKJA 1DGGA 5KPZA 4NSOB 2NU3I 1TOTA 2VQFM 1ORYB 3HHZA 1L2CA 2N1AB 1V34A 4B3RM 4LRSA 3BXWA 1W5SA 3WHLA 1OFIA 1LR7A 2DB6A 4ANRA 1UHAA 2W0TA 2BWBA 1IY2A 3U6LA 1WXQA 5EQTA 4JI7M 3U6MA 2J7OA 2JUJA 3CGWA 5DAEA 3VFDA 3VK8A 1DS2I 3GRUA 1N33M 4DR2M 4LY6A 4P17A 4E1PA 2ERWA 4LRTA 3FYCA 1TUSA 2NU1I 2ERCA 2K47A 3U60B 1DGBA 2I7PA 3J81S 2EKKA 1DGHA 2EA0A 5J8CA 3UEJA 1K82A 1TH4A 5FSWA 3W68A 2JA1A 2CEAA 3E59A
chains in the Genus database with same CATH topology
1HT1E 5FTLA 2JZMA 3SATA 2EO2A 1N32M 5EP2A 4GIPA 4LF5M 3LMMA 2C98A 3TL4X 4PDIA 3EIEA 4GH9A 3HJ8A 4QOSA 3WHKA 3KSJA 1KBEA 3OVOA 2UXCM 4BB9A 2ORWA 3THGA 4LJ8A 3HHYA 4IBJA 4PDGA 4LJ9A 3UGIA 2L7HA 2G8LA 2R46A 2KXEA 1GL7A 3T15A 3HJSA 3E4RA 2VQEM 1H0ZA 3GRVA 2X49A 4IBDA 4A24A 1G59A 4EDGA 1IBLM 3OXFA 3RE8A 4A3VB 3TJQA 4W5WA 2XSZD 1GVNA 3K8ZA 5JI3E 1JQJC 2Y20A 3GPXA 4GKKM 3I51A 1IXZA 2YNMD 4IBCA 3B9PA 2QQEA 2SGFI 4NRWA 4AI6A 2NU4I 3W0LB 2QPOA 1NHGC 4LGMA 5C1BA 3GLIB 1NY6A 3SAUA 4QOZC 1TBQR 3L25A 4FWGA 2V1UA 2CE7A 1M8BA 4MGZE 2DZNB 1GLNA 3U6CA 4AKGA 2O5RA 3PNYA 4RNAA 4DV1M 5ITXE 2CHQA 3FYDA 5EX0A 5BPVA 3GQ3A 2XSZA 1YUBA 2D7EA 3FUWA 4FKDA 2P6AC 2ROWA 4B7HA 2XH9A 2I7NA 3ZC7B 2UUBM 4LF8M 1DS3I 1EQNA 2JA2A 1HNXM 4MH0E 3KP1E 1XA6A 2DXIA 3H4MA 1Z5BA 5ITRA 1Z59A 1Y8FA 1UVGA 2NQ8C 2L09A 4LF7M 3KXEC 2KMQA 4FCTA 1QAQA 2F5SA 1HT2E 1CE3A 1NHWC 3B39A 1G4AE 4M9XA 2L6OA 4I81A 2JXDA 3KOYE 5FUYA 4RF0A 4B08A 4FCWA 4PD2A 2E5LM 2Y21A 3SASA 2LH0A 2L7XA 1XNQM 5EP1A 4WURA 4MGIE 5LMNM 4OVOA 3L27A 3LQQA 2XZUA 5FTKA 3GPPA 4JI1M 4LJ5A 4LZZA 4MGHA 4LCBA 3ILKA 3KSXA 1HPTA 2J87A 1FAQA 2BJVA 2VIIA 2JW6A 1IY0A 2QQ0A 3TWLA 1OFHA 2XFSA 1H6UA 4X66M 5E26A 2UXBM 2D7HA 3D00A 1TGSI 4JV5M 1N34M 2DWMA 1IN4A 3SYKA 5DNYA 1CSOI 4ITQA 4IJFA 4X62M 1YE9A 4M9ZA 5EXXA 1FYBA 1LR9A 3FD9A 3GRYA 4AKIA 3AV0A 5FTNA 4IBGA 3UK6A 3T1HM 4LF6M 3U6SA 1CGJI 5HI7A 2N17A 1SGDI 3K2LA 2OVOA 2C9CA 2QBYA 3U61B 1CT0I 5IZ7D 4L8RC 5FTJA 2ZM6M 2AU3A 1IY1A 4IIWA 3KDSE 2SGPI 3J2PB 1C1KA 5DYIA 2B8TA 4LF9M 1PTQA 3LVWA 1TBOA 1X74A 3KY9A 2V6ZM 3GLFA 4L15A 2ORVA 3SMSA 3QTLD 3GP1A 1D3YA 5EP4A 1YTPA 2KCXA 3BJIA 5FUVA 2Z3XA 1DD9A 1PJUA 3UGLA 3TPZA 5EX3A 3U6DA 2KEBA 2XF3A 5BR8M 3D8BA 3DA1A 3AL0C 2UU9M 4KHPM 1PCEA 2WCYA 2X8AA 3MJ5A 4GC5A 2E5RA 4B7FA 2CUZA 4II7A 2JYYA 4NRVA 3M6AA 1TDZA 5EXTA 3U6PA 3I4YA 4JN6A 3J7AS 1CGII 4KO8A 4QHTA 3FC3A 1V1HA 3SAWA 2CV0A 1N13A 2R65A 2UZ3A 2Z4RA 3FTDA 4ZPXA 3L29A 2CV2A 2KMPA 3U60A 1YU6C 4O6PB 3A98B 3SFZA 3PNVA 3HGIA 3PXGA 4DR5M 5C18A 4EDRA 2V53A 2XRCA 5ITQA 1L1TA 4YY3M 4JCVE 5IREB 4MGYE 3UGJA 3OL0A 4K0KM 1SXJE 2YFQA 2LEOA 3GLHA 1DO0A 2KZUA 3PVSA 4GHAA 2UXDM 2NU2I 2EUCA 1Q3BA 3GLHB 4NXNM 4DV3M 4NXMM 1Q39A 2BJWA 2X4AA 3M7GA 3GPUA 3B4VC 3TWKA 3HWSA 1KYIA 4QHSA 3DZDA 3GLGB 1N77A 4E2KA 1IBMM 1OVOA 4FD2A 3VKGA 2ENZA 2ARPF 1L1ZA 1X37A 1TH3A 3FTCA 3AJIB 2F4VM 2HCBA 2OD1A 4B3SM 3FUUA 3SEKC 4M9SA 1XBTA 3I4VA 4R7GA 3SC3A 2ZAMA 2OQ4A 3R8FA 2DWLA 1Y1CA 3RU0A 3FKEA 2VRWB 2LXEA 2N52A 5FUWA 3SARA 3KOWE 3SAVA 1KMAA 1YSYA 4OU7A 2QQCA 4G6ZA 3M0EA 3GLIA 1NNJA 1TH2A 5EJCA 1Z5AA 3GRRA 4LFAM 2DWZB 4WW0A 5LMUM 1MT1A 4JI2M 3VK7A 1SXJC 3HU1A 2K9HA 1IN6A 2RKOA 1XMQM 3GOXA 4DV4M 3GQ4A 4AG5A 1QZMA 4IBBA 4UXHA 1EE8A 1NY5A 1PM5A 3KS8A 1XX6A 1HNWM 1ZAEA 3CXLA 2Z7JA 5IWAM 2ENNA 4LZJA 1OYVI 1ZQ9A 1NVMA 1W5TA 3KS4A 3OTOM 4YHHM 2KMOA 3CF0A 4L16A 2YR0A 4JI8M 1IY5A 1CT2I 3T1YM 4MB7A 3L26A 4JYAM 4O6OA 1NNUC 1QVRA 5H37D 5CCLA 4L4UA 1SGNI 2FNAA 2CHGA 1IN8A 4UXJA 2A5YB 4XGIA 5CCMA 3SHGB 3GO8A 1J09A 4FVMA 3NBIA 4CHTB 3TQSA 4FW9A 1TURA 4X65M 4DUZM 2NU0I 1IN5A 1N75A 2F5PA 1BMOA 3CF2A 4NL4H 1R7RA 3AOEA 2CFOA 5FTMA 4OX9M 3UMMA 3U5ZA 1S3SA 5ITXA 2F5NA 4EDKA 4DV0M 3U5ZB 3HH2C 2XLJA 2KW0A 1KFVA 1TBNA 1XNRM 1G3IA 3GQ5A 3VE5A 1J7KA 2CJSC 3IG5A 3VDUA 1IW4A 1PTRA 3SYLA 1KBFA 1J5EM 3RGPA 4DUYM 4M0WA 4JI3M 1GL6A 3U61A 4DR4M 4UXIA 5HQ8A 1OJLA 3JAMS 4AQYM 4B3TM 1IBKM 1TGUA 1TIHA 4CGYB 1LR8A 1HR0M 1XMOM 2WVJA 3JR4A 4GHLA 1CHOI 3VDPA 3PDNA 2FOIC 2L7IA 5FUXA 4LJ7A 5KQ8A 3TWMA 1M8CA 2V1CC 1OMTA 1SGEI 2L8EA 4JI6M 4DR6M 5IT9S 1OMUA 1NSFA 3KW6A 1QAMA 1XXHB 3J27B 1L2BA 2E73A 5DYGA 1FJGM 4AKHA 2YQPA 3HU2A 4IJEA 1JR3D 4L78A 4LF4M 3UGDA 2AHMA 4IBKA 2LUYA 2SGDI 1IM2A 1QYRA 2KRUA 3L28A 4XBOA 2Y0QA 4D82A 4HL4A 3EIHA 4QNMA 3R9XB 1IXSB 2Y0TA 1UM8A 4LGYA 1W3SA 4GKJM 2KA6B 1E32A 4EIWA 1N36M 2F5OA 2KRKA 1Y1BA 4CISA 1XC8A 1JR3A 4GITA 3E2IA 4JI5M 2QENA 1MU5A 3IG8A 2DHRA 2C9OA 2BNKA 1T3TA 2W82A 3AFHA 1E94E 4KLNA 1R2YA 1NUBA 1SGPI 1IQPA 3Q8XA 4JI4M 2GKVA 4I4LA 2ELIA 3E9SA 1T6T1 4GI3C 3OXGA 4IBFA 4DR1M 2C99A 2FFJA 2H1RA 4LFBM 1CT4I 2R18A 5E6JA 2SGEI 2J9RA 3A46A 3KFUG 3UJNA 3U6OA 2R4JA 1HQCA 1LV7A 3SMPA 3QWPA 3GLGA 3SBJA 4P16A 1SGQI 3HHXA 3J7BA 3FTFA 4LG2A 2C5RA 2LNHC 4G4NA 2M5XA 1SXJD 3HHWA 3FTEA 2UUAM 4RF1A 1VDDA 3BOSA 4DR7M 2XEPA 4FWDA 7CATA 2Z4SA 4OVZA 5JHWC 2F3CI 4HLQA 3QWLA 4AG6A 4M0DA 1DGHB 3K92A 2Q2EB 1R79A 4EE1A 2QPAA 4OVZB 2A20A 4D81A 2R45A 1R0RI 4DV5M 3OXLA 4AW4A 2KZSA 4LJ6A 4JCVA 1KSFX 5ITTA 1Z5CA 1QANA 4B7GA 4DV2M 5KQDA 1SXJA 3HU3A 3AKZA 1L2DA 2QCUA 3MEKA 8CATA 1NJGA 2DZOB 1SXJB 4KODA 2D7GA 1R6BX 4B3MM 5KPRA 2KMRA 1V1IA 1QQWA 5EP3A 4MM3B 4NOOB 5A2QS 2J7NA 4D80A 1TDHA 1K3WA 1G41A 2N71A 1BUSA 2C96A 4G4OA 1HNZM 4I5SA 4JXJA 4Z6YA 5ITUA 1DO2A 3ZH9B 3A42A 1UVFA 3RGSA 5GKNA 3J80S 2ZBKA 1K3XA 3UZUA 2HL7A 4S12A 2LWXA 4PT5A 1I94M 2UUCM 2QZ4A 1IXRC 5F3WA 2ZBKB 1TBRR 2XGNA 1I4WA 3KP0E 1XWIA 1Q3CA 1NJFA 2GKRI 1GKIA 4GC9A 3KOZE 1X4SA 4G4QA 3ZCBB 3UFFA 4IBEA 2M5ZA 3D8LA 1Z6TA 5KPTA 3SHFA 5FLXS 3U6QA 4QNRA 4Z8XA 1E9RA 1IN7A 2HKJA 1DGGA 5KPZA 1R2ZA 2CHVA 4NSOB 2NU3I 3UEYA 1TOTA 3VLFB 2VQFM 4LJ4A 1ORYB 5KO3A 2M60A 1E9SA 3HHZA 2SGQI 2QP9X 3FUVA 1IY6A 1L2CA 2N1AB 1XHBA 3GPYA 3HKPA 4DV6M 2BUSA 2YQZA 2XFTA 4HGUA 2P5TA 1HJAI 1N78A 4E1RA 4B3RM 4LRSA 4DR3M 1Z7KB 3MHVC 4DV7M 4EDVA 2CV1A 2DIPA 3CF6E 1SGRI 2FNFX 4IBIA 2QQDA 1W5SA 3AOEC 2V1CA 2DVWB 3U6EA 1L8QA 4TUWA 3WHLA 4L9MA 3LQRA 2R4EA 1OFIA 1LR7A 2DB6A 4MGKE 1MX0A 1XXHA 4B6DA 4FCVA 3KVWA 1RFHA 3L2AA 2HHHM 2RGHA 2W0TA 3SGQI 1IY2A 3W0FA 3U6LA 1WXQA 5EQTA 4JI7M 2YUUA 3AOGA 3LVVA 2RGOA 3MK6A 4G4RA 4REZA 3RFWA 1HDLA 3DFZA 2QBYB 1G8PA 3U6MA 2J7OA 4GRIA 3FUTA 5DAEA 3VFDA 3VK8A 4OW0A 2GKTI 1D2NA 5EXPA 3GLFB 1PJJA 3PFIA 4FWHA 3KOXE 1HQYE 1SGYI 2OPFA 2R62A 3K1JA 1DS2I 5GUJA 3FUXA 3GRUA 3T38A 1N33M 3NWLA 4EDTA 1FARA 4DR2M 3VKHA 4LY6A 3TE6A 4BLCA 4AZFA 1FNNA 4PCZA 4E1PA 2ERWA 2ZAOA 1DDEA 4LRTA 1DGFA 4BBAA 2B0UC 2ODDA 3CTWB 3QAUA 3FYCA 1AN1I 1TUSA 1W4RA 2NU1I 2ERCA 1U5KA 2K47A 3U60B 3DOAA 4X64M 3JR5A 3C58A 1PPFI 2G5GX 2XZFA 2DWNA 2F5QA 4LFCM 1DGBA 2I7PA 4LJAA 3J81S 1DGHA 2EA0A 2FE8A 5JI2E 3UEJA 1K82A 4SGBI 2Q2EA 4NSRA 1QAOA 3A45A 1TH4A 1UUCA 2GVIA 5FSWA 2ZANA 5EXSA 4I8OA 3SGBI 5ITYA 1PJIA 2JA1A 3HJQA 2CEAA 4JI0M 4R3DA 3E59A 4GMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B39 A;  2AU3 A;  4EDV A;  4O6P B;  4E2K A;  1D3Y A;  4EDR A;  1DD9 A;  2V1C A;  3VDP A;  4EDK A;  1VDD A;  3D00 A;  1EQN A;  2Q2E A;  4EDG A;  5GUJ A;  3VE5 A;  4EE1 A;  4EDT A;  2ZBK A;  1T6T 1;  3VDU A;  4O6O A;  4JCV A;  1DDE A; 
#chains in the Genus database with same CATH topology
 1HT1 E;  5EP2 A;  4GIP A;  4LG2 A;  3LMM A;  3TL4 X;  3KSJ A;  4LJ8 A;  4IBJ A;  1DV0 A;  3UGI A;  1VQ1 A;  2X49 A;  4A24 A;  1D0K A;  4EDG A;  1AUA A;  3OXF A;  4A3V B;  4W5W A;  2XSZ D;  1GVN A;  3I51 A;  1MJG M;  2JXN A;  3QAH A;  1NHG C;  4LGM A;  1TBQ R;  1NY6 A;  3L25 A;  2CE7 A;  2GKR I;  4MGZ E;  3U6C A;  4AKG A;  2O5R A;  5BPV A;  3GQ3 A;  1EFU B;  3ZC7 B;  2UUB M;  1DS3 I;  2JA2 A;  1HNX M;  1XA6 A;  1UVG A;  4LF7 M;  3KXE C;  2F5S A;  1HT2 E;  1NHW C;  4I81 A;  2JXD A;  2Y21 A;  2LH0 A;  1XNQ M;  5LMN M;  2XZU A;  4LJ5 A;  4LZZ A;  2VF8 A;  1HPT A;  2J87 A;  3KSX A;  1FAQ A;  9WGA A;  1H6U A;  4X62 M;  3FD9 A;  3AV0 A;  4IBG A;  2N17 A;  2OVO A;  2JY6 B;  1CT0 I;  4L8R C;  5FTJ A;  2MH8 A;  2ZM6 M;  2AU3 A;  1IY1 A;  2B8T A;  1X74 A;  3GLF A;  4RKU F;  3SMS A;  3GP1 A;  1YTP A;  2KCX A;  5FUV A;  1HJP A;  1DD9 A;  2Z3X A;  1HEV A;  2XF3 A;  4KHP M;  2E5R A;  1JB0 F;  1OIZ A;  2O01 F;  2DI0 A;  3LCV B;  3J7A S;  4QHT A;  3SAW A;  2CV2 A;  3FTD A;  4O6P B;  3PNV A;  4DR5 M;  4EDR A;  5ITQ A;  2ZTC A;  3TO6 A;  2J5Y A;  3FSX A;  2KZU A;  2DNA A;  4GHA A;  1Q3B A;  4NXM M;  4DV3 M;  2UVO A;  2BWE A;  4QHS A;  3DZD A;  1N77 A;  2R44 A;  4FD2 A;  1L1Z A;  3FTC A;  2OD1 A;  3FUU A;  1XBT A;  3I4V A;  1Y1C A;  1Q02 A;  2N52 A;  4G6Z A;  5LMU M;  4JI2 M;  2LB7 A;  3E46 A;  1AIP C;  3HU1 A;  3GQ4 A;  1QZM A;  4IBB A;  1EE8 A;  1NY5 A;  1PM5 A;  3KS8 A;  1XX6 A;  1HNW M;  3CXL A;  2JP7 A;  3KS4 A;  3CF0 A;  3C9P A;  4JYA M;  5CCL A;  2CHG A;  1IN8 A;  4DNC A;  3R5B A;  4CHT B;  1MN3 A;  1TUR A;  4X65 M;  1R7R A;  3AOE A;  4OX9 M;  3HH2 C;  3C3E A;  1S20 A;  1XNR M;  3VE5 A;  2QNJ A;  3SYL A;  4DUY M;  1Y8G A;  1GL6 A;  5E3P A;  4B3T M;  2Y0M A;  4CGY B;  4F1I A;  1XMO M;  3VDP A;  3PDN A;  5KQ8 A;  2V1C C;  1R4G A;  1OMT A;  4DR6 M;  1OMU A;  2L4E A;  3J27 B;  1P9Z A;  2E73 A;  2YQP A;  2LVA A;  1JR3 D;  4CIZ A;  4HL4 A;  3EIH A;  1E32 A;  1MJA A;  2QEN A;  2C9O A;  2BNK A;  1T3T A;  1R2Y A;  1SGP I;  1IQP A;  4I4L A;  2ELI A;  1T6T 1;  2C99 A;  1CUK A;  2J9R A;  2CP8 A;  3KFU G;  1LV7 A;  3SMP A;  3GLG A;  2LNH C;  2M5X A;  2UUA M;  1VDD A;  4Q7J A;  3BOS A;  3TOA A;  7CAT A;  4OVZ A;  4HLQ A;  3QWL A;  1PJQ A;  4AG6 A;  4OVZ B;  2R45 A;  4DV5 M;  3OXL A;  4JCV A;  5ITT A;  2PQ8 A;  1QAN A;  4B7G A;  5KQD A;  2DZO B;  4KOD A;  2D7G A;  1R6B X;  5KPR A;  5A2Q S;  4JXJ A;  4Z6Y A;  3ZH9 B;  3J80 S;  2ZBK A;  3UZU A;  4PT5 A;  1I94 M;  1TBR R;  2ZBK B;  2XGN A;  3KP0 E;  1NJF A;  4G4Q A;  2M5Z A;  5KPT A;  5FLX S;  4QNR A;  4NC6 A;  1R2Z A;  2CHV A;  3UEY A;  4LJ4 A;  1WR1 B;  2QP9 X;  3HKP A;  2L2D A;  4E1R A;  4DR3 M;  1Z7K B;  3MHV C;  4DV7 M;  2LHG A;  2DIP A;  3CF6 E;  3U6E A;  1L8Q A;  4L9M A;  4R71 A;  4MGK E;  1MX0 A;  1XXH A;  4FCV A;  1ULK A;  3SGQ I;  3W0F A;  2RGO A;  4MPI A;  5EXP A;  3T6P A;  4FWH A;  3KOX E;  2OPF A;  2R62 A;  3GLH E;  2WSC F;  3T38 A;  4EDT A;  3VKH A;  3TE6 A;  2JZ1 A;  2ZAO A;  1DDE A;  2B0U C;  1DGF A;  3CTW B;  3QAU A;  1VG5 A;  1W4R A;  4X64 M;  2XZF A;  4LFC M;  2FE8 A;  3LW5 F;  5JI2 E;  2Q2E A;  4NSR A;  1QAO A;  3FSY A;  1QZE A;  4L6V 6;  2JWS A;  3A45 A;  2GVI A;  3GLI E;  1PJS A;  5ITY A;  4R3D A;  4GMQ A;  1VEK A;  3SAT A;  2X52 A;  1FJG M;  4LF5 M;  2C98 A;  1KBE A;  3EIE A;  3HJ8 A;  4QOS A;  1NV9 A;  4BB9 A;  3HHY A;  2LVP C;  4LJ9 A;  2L7H A;  3FRI A;  2R46 A;  1GL7 A;  2O25 A;  3E4R A;  3GRV A;  1G59 A;  1D0L A;  1IBL M;  3TJQ A;  2RRU A;  3K8Z A;  3GPX A;  1JQJ C;  4KT0 F;  2QQE A;  2QPO A;  3W0L B;  3GLI B;  5C1B A;  4QOZ C;  2DZN B;  3PNY A;  4RNA A;  3LCU A;  2DAE A;  3B89 A;  2DXI A;  2L09 A;  2OO9 A;  4FCT A;  1CE3 A;  1V92 A;  3B39 A;  4M9X A;  3R5D A;  5FUY A;  4RF0 A;  4B08 A;  4FCW A;  3SAS A;  4WUR A;  4JI1 M;  3GPP A;  4LCB A;  4DBG B;  1IY0 A;  1OFH A;  3D00 A;  4JV5 M;  1N34 M;  5DNY A;  4ITQ A;  4IJF A;  1YE9 A;  5EXX A;  1FYB A;  4AKI A;  2RC4 A;  1TTE A;  5FTN A;  3UK6 A;  1SGD I;  1WHC A;  2C9C A;  3U61 B;  5IZ7 D;  1OAO C;  3J2P B;  2DZL A;  3KY9 A;  4L15 A;  1JR3 E;  1PRB A;  3QTL D;  1D3Y A;  5EP4 A;  1Q9B A;  3UGL A;  3U6D A;  3IEC A;  3DA1 A;  3AL0 C;  2HWJ A;  2UU9 M;  1PCE A;  2X8A A;  4II7 A;  2JYY A;  5EXT A;  1CGI I;  4KO8 A;  1N13 A;  1NV8 A;  3U60 A;  1YU6 C;  2V53 A;  2HAK A;  1BVS A;  3UGJ A;  3OL0 A;  2YFQ A;  2BJW A;  3M7G A;  3TWK A;  4E2K A;  2LVO C;  2ENZ A;  1TH3 A;  4B3S M;  3R8F A;  4R7G A;  2ZAM A;  1A5T A;  3FKE A;  3KOW E;  2I5R A;  1TH2 A;  1MT1 A;  3GRR A;  1OTR A;  2K9H A;  2RKO A;  4DV4 M;  4AG5 A;  4Y28 F;  4LZJ A;  1ZQ9 A;  1PGY A;  1IY5 A;  4MB7 A;  1WKX A;  4L4U A;  4HEO A;  3I01 M;  3NBI A;  4FW9 A;  2JY8 A;  1BMO A;  2WSE F;  5FTM A;  3K9O A;  2F5N A;  2XLJ A;  1KFV A;  1TBN A;  1G3I A;  3GQ5 A;  1J7K A;  1IW4 A;  1J5E M;  3RGP A;  2MGW A;  4M0W A;  4JI3 M;  2K6B A;  5HQ8 A;  1OJL A;  3W67 A;  3JAM S;  1TGU A;  4WP4 A;  2WVJ A;  4GHL A;  1CHO I;  2FOI C;  2L7I A;  4LJ7 A;  1M8C A;  2L8E A;  1NSF A;  2L4F A;  1QAM A;  3KW6 A;  1L2B A;  2DKV A;  3HU2 A;  4IJE A;  4L78 A;  4IBK A;  2SGD I;  1QYR A;  4D82 A;  1UM8 A;  1W3S A;  1N36 M;  1XC8 A;  4GIT A;  4JI5 M;  3T1H M;  1MU5 A;  4KLN A;  1NUB A;  2QHO B;  3Q8X A;  3E9S A;  3B74 A;  2FFJ A;  2H1R A;  4LFB M;  1CT4 I;  2SGE I;  3U6O A;  2R4J A;  1HQC A;  3QWP A;  1TF0 B;  3SBJ A;  3HHX A;  2CWG A;  1F4I A;  1ZMU A;  1SXJ D;  2EKF A;  4RF1 A;  4DR7 M;  4FWD A;  1OAI A;  3C3D A;  1UFZ A;  1NXU A;  2LVQ D;  1Z5C A;  3MEK A;  1NO1 A;  1V1I A;  1TDH A;  1K3W A;  2N71 A;  4G4O A;  4I5S A;  1DO2 A;  2CWH A;  3A42 A;  2RIJ A;  3RGS A;  1K3X A;  2ORW A;  2LWX A;  1IXR C;  5F3W A;  1I4W A;  1Q3C A;  2LVN C;  4GC9 A;  3ZCB B;  2CWF A;  3MMP A;  1Z6T A;  2CRU A;  3U6Q A;  4Z8X A;  3VLF B;  5KO3 A;  1E9S A;  2SGQ I;  3GPY A;  4DV6 M;  2BUS A;  4HGU A;  2XFT A;  2P5T A;  1HJA I;  1GAB A;  4EDV A;  2CV1 A;  1GO5 A;  2LBC A;  1SGR I;  2FNF X;  3AOE C;  2V1C A;  2DVW B;  4TUW A;  3LQR A;  2R4E A;  2H5X A;  3HZJ A;  3KVW A;  1RFH A;  3L2A A;  2DAI A;  2HHH M;  2RGH A;  2YUU A;  3AOG A;  4REZ A;  1HDL A;  2QBY B;  1QDT A;  4GRI A;  1ZMW A;  4OW0 A;  5DFL A;  2GKT I;  1PJJ A;  1OQY A;  3PFI A;  2OOB A;  2MJ5 B;  3FUX A;  2FS1 A;  3NWL A;  4BLC A;  4AZF A;  1FNN A;  4PCZ A;  1R5L A;  1WGC A;  4AML A;  1AN1 I;  1P3Q Q;  2N35 A;  3JR5 A;  2G5G X;  2DWN A;  2JY7 A;  2F5Q A;  4SGB I;  1TR8 A;  4I8O A;  1PJI A;  4JI0 M;  5FTL A;  1N32 M;  2EO2 A;  3OVO A;  3WHK A;  3THG A;  4PDG A;  2KXE A;  3T15 A;  3HJS A;  5J8F A;  1H0Z A;  3R5C A;  3B7Z A;  2MRO B;  1LTM A;  5JI3 E;  2Y20 A;  2CWB A;  4NRW A;  4AI6 A;  2NU4 I;  1WGL A;  3BBZ A;  3UOE A;  4FWG A;  2V1U A;  2OOA A;  1M8B A;  4DV1 M;  1OIP A;  5ITX E;  1WGN A;  2CHQ A;  3FYD A;  2XSZ A;  2D7E A;  4MH0 E;  3KP1 E;  1Z5B A;  5ITR A;  2NQ8 C;  1QAQ A;  1G4A E;  4PD2 A;  4CJ6 A;  4MGI E;  3LQQ A;  5FTK A;  3ILK A;  2QQ0 A;  2UXB M;  5E26 A;  2D7H A;  1TGS I;  3QYE A;  1CSO I;  1LR9 A;  3GRY A;  4LF6 M;  3U6S A;  1CGJ I;  5HI7 A;  3K2L A;  3KDS E;  2SGP I;  1GJT A;  1C1K A;  3LVW A;  2ORV A;  3BJI A;  2KEB A;  3D8B A;  2GNO A;  3MJ5 A;  4GC5 A;  4B7F A;  1TDZ A;  2CV0 A;  2Z4R A;  4ZPX A;  3L29 A;  2KMP A;  3SFZ A;  3HGI A;  3PXG A;  1L1T A;  4YY3 M;  5IRE B;  2R6F A;  1SXJ E;  3H4J A;  3GLH A;  1DO0 A;  2NU2 I;  1VEG A;  3GLH B;  2LHC A;  1Q39 A;  2KNA A;  2GIV A;  3GPU A;  1KYI A;  3VKG A;  5L8R F;  1D0M A;  1X37 A;  2G3Q A;  2F4V M;  3SEK C;  2VDB B;  2DWL A;  1WGT A;  2VRW B;  3SAR A;  3SAV A;  1YSY A;  4OU7 A;  2QQC A;  2QQ8 A;  3GLI A;  5EJC A;  2DWZ B;  3VK7 A;  1SXJ C;  3GOX A;  3ZQJ A;  4UXH A;  1ZAE A;  2Z7J A;  3TO7 A;  5IWA M;  2ENN A;  1QUS A;  1OYV I;  3OTO M;  5E3R A;  4JI8 M;  1CT2 I;  3T1Y M;  3L26 A;  1NNU C;  5H37 D;  2FNA A;  4XGI A;  3SHG B;  3GO8 A;  1J09 A;  4FVM A;  4DUZ M;  2F5P A;  2CFO A;  3F92 A;  2CJS C;  1G71 A;  3U61 A;  4DR4 M;  4UXI A;  1IBK M;  2X3T A;  1TIH A;  1LR8 A;  1T43 A;  1MJB A;  3TWM A;  4JI6 M;  1ZV1 A;  4AKH A;  3UGD A;  4LF4 M;  2AHM A;  2MR9 A;  2KRU A;  1IXS A;  1C7Y A;  4QNM A;  3R9X B;  3FRH A;  1IXS B;  2Y0T A;  4LGY A;  2DAM A;  1Y1B A;  2KRK A;  1JR3 A;  3TO9 A;  1RU3 A;  3IG8 A;  3AFH A;  2W82 A;  2GKV A;  4IBF A;  2R18 A;  3A46 A;  3UJN A;  1ZMV A;  2DAG A;  1K7U A;  3FTF A;  4G4N A;  3HHW A;  3FTE A;  2XEP A;  5JHW C;  2Z4S A;  2F3C I;  4M0D A;  1DGH B;  4EE1 A;  2QPA A;  4D81 A;  2KZS A;  1KSF X;  4DV2 M;  2VF7 A;  3AKZ A;  2QCU A;  8CAT A;  2JZ0 A;  4B3M M;  3B7Q A;  1QQW A;  4MM3 B;  2J7N A;  1G41 A;  2C96 A;  1OKS A;  5ITU A;  5GKN A;  2HL7 A;  2UUC M;  2QZ4 A;  1GKI A;  1IN7 A;  2M60 A;  3FUV A;  1IY6 A;  1XHB A;  2YQZ A;  1N78 A;  2GQF A;  2FH0 A;  3GLF E;  1MJ9 A;  2APL A;  4IBI A;  2QQD A;  2JY5 A;  2R0I A;  2Z8Y M;  4B6D A;  2K9D A;  3LVV A;  3MK6 A;  2EJS A;  4G4R A;  2KHH A;  3RFW A;  3DFZ A;  1G8P A;  1T6O A;  3FUT A;  1D2N A;  3GLF B;  1HQY E;  1SGY I;  3K1J A;  5GUJ A;  1FAR A;  4BBA A;  2ODD A;  1U5K A;  7WGA A;  3DOA A;  3C58 A;  1PPF I;  2OZU A;  4LJA A;  1YLA A;  1UUC A;  2ZAN A;  5EXS A;  3SGB I;  3HJQ A;  2JZM A;  2LTU A;  4PDI A;  4GH9 A;  2UXC M;  2G8L A;  2K0B X;  2VQE M;  2ZTD A;  4IBD A;  3RE8 A;  4GKK M;  1IXZ A;  2YNM D;  4IBC A;  3B9P A;  2SGF I;  2WSF F;  3SAU A;  1GLN A;  3QYB A;  5EX0 A;  1WTJ A;  1YUB A;  2WGC A;  3FUW A;  4FKD A;  2P6A C;  2ROW A;  4B7H A;  2XH9 A;  2I7N A;  4LF8 M;  1EQN A;  2FCJ A;  1Y8F A;  3H4M A;  1Z59 A;  3B7N A;  2DEN A;  2KMQ A;  3FE3 A;  2L6O A;  3KOY E;  4G3O A;  3I04 M;  2E5L M;  2L7X A;  5EP1 A;  1K7T A;  1ULN A;  4OVO A;  3L27 A;  4MGH A;  2BJV A;  2VII A;  3K9P A;  2JW6 A;  3TWL A;  2XFS A;  4X66 M;  2DWM A;  1IN4 A;  3SYK A;  4M9Z A;  2QBY A;  4IIW A;  5DYI A;  4LF9 M;  1XB2 B;  1PTQ A;  1TBO A;  2V6Z M;  1PJU A;  3TPZ A;  5EX3 A;  5BR8 M;  2KNZ A;  2WCY A;  3IHP A;  1EIJ A;  2CUZ A;  4NRV A;  3M6A A;  2OU2 A;  3U6P A;  3I4Y A;  4JN6 A;  4F2L A;  3GLG E;  3FC3 A;  1V1H A;  2R65 A;  2UZ3 A;  3A98 B;  1K7V A;  5C18 A;  2XRC A;  4JCV E;  4MGY E;  4K0K M;  2LEO A;  3PVS A;  2UXD M;  2EUC A;  4NXN M;  2X4A A;  3B4V C;  2DKL A;  2JNH A;  3HWS A;  3GLG B;  1IBM M;  1OVO A;  2ARP F;  1QDR A;  3AJI B;  2HCB A;  2KNV A;  4M9S A;  3SC3 A;  2OQ4 A;  3RU0 A;  2LXE A;  4XK8 F;  1FY7 A;  5FUW A;  1KMA A;  3Q8G A;  3M0E A;  1NNJ A;  1Z5A A;  4LFA M;  4WW0 A;  1IN6 A;  1XMQ M;  1WIV A;  3NBX X;  1NVM A;  1W5T A;  2KMO A;  4YHH M;  4L16 A;  2YR0 A;  4O6O A;  1QVR A;  1SGN I;  4UXJ A;  2A5Y B;  5CCM A;  3TQS A;  2QSF X;  2NU0 I;  1IN5 A;  1N75 A;  3HX3 A;  3CF2 A;  4NL4 H;  1VDL A;  3E21 A;  3UMM A;  3U5Z A;  1S3S A;  2B3T A;  5ITX A;  4EDK A;  1XXH E;  4DV0 M;  3U5Z B;  2KW0 A;  2WZJ A;  3IG5 A;  3VDU A;  1PTR A;  1KBF A;  4AQY M;  1HR0 M;  1SG9 A;  3JR4 A;  5FUX A;  1SGE I;  5IT9 S;  1XXH B;  2DAK A;  5DYG A;  1V33 A;  4UN2 B;  2LUY A;  1QUT A;  1IM2 A;  3V76 A;  3L28 A;  4XBO A;  2Y0Q A;  4GKJ M;  2KA6 B;  4EIW A;  2F5O A;  4CIS A;  3E2I A;  2DHR A;  1E94 E;  4JI4 M;  4GI3 C;  3OXG A;  4DR1 M;  5E6J A;  1IFY A;  4P16 A;  1SGQ I;  3J7B A;  2C5R A;  1VEJ A;  1P9G A;  3K92 A;  2Q2E B;  1R79 A;  2DHY A;  2A20 A;  4WP2 A;  1R0R I;  4AW4 A;  4LJ6 A;  3R5A A;  1SXJ A;  3HU3 A;  1L2D A;  1NJG A;  1SXJ B;  1GJS A;  2KDL A;  2KMR A;  5EP3 A;  3TOB A;  4NOO B;  4D80 A;  1BUS A;  1HNZ M;  1UVF A;  1PJT A;  4GEW A;  4S12 A;  1Z2I A;  1XWI A;  1X4S A;  3KOZ E;  3UFF A;  4IBE A;  1ULM A;  3D8L A;  3HY5 A;  1WJ7 A;  5E3Q A;  3SHF A;  1E9R A;  2HKJ A;  1DGG A;  5KPZ A;  4NSO B;  2NU3 I;  1TOT A;  2VQF M;  1ORY B;  3HHZ A;  1L2C A;  2N1A B;  1V34 A;  4B3R M;  4LRS A;  3BXW A;  1W5S A;  3WHL A;  1OFI A;  1LR7 A;  2DB6 A;  4ANR A;  1UHA A;  2W0T A;  2BWB A;  1IY2 A;  3U6L A;  1WXQ A;  5EQT A;  4JI7 M;  3U6M A;  2J7O A;  2JUJ A;  3CGW A;  5DAE A;  3VFD A;  3VK8 A;  1DS2 I;  3GRU A;  1N33 M;  4DR2 M;  4LY6 A;  4P17 A;  4E1P A;  2ERW A;  4LRT A;  3FYC A;  1TUS A;  2NU1 I;  2ERC A;  2K47 A;  3U60 B;  1DGB A;  2I7P A;  3J81 S;  2EKK A;  1DGH A;  2EA0 A;  5J8C A;  3UEJ A;  1K82 A;  1TH4 A;  5FSW A;  3W68 A;  2JA1 A;  2CEA A;  3E59 A; 
#chains in the Genus database with same CATH homology
 1HT1 E;  5FTL A;  2JZM A;  3SAT A;  2EO2 A;  1N32 M;  5EP2 A;  4GIP A;  4LF5 M;  3LMM A;  2C98 A;  3TL4 X;  4PDI A;  3EIE A;  4GH9 A;  3HJ8 A;  4QOS A;  3WHK A;  3KSJ A;  1KBE A;  3OVO A;  2UXC M;  4BB9 A;  2ORW A;  3THG A;  4LJ8 A;  3HHY A;  4IBJ A;  4PDG A;  4LJ9 A;  3UGI A;  2L7H A;  2G8L A;  2R46 A;  2KXE A;  1GL7 A;  3T15 A;  3HJS A;  3E4R A;  2VQE M;  1H0Z A;  3GRV A;  2X49 A;  4IBD A;  4A24 A;  1G59 A;  4EDG A;  1IBL M;  3OXF A;  3RE8 A;  4A3V B;  3TJQ A;  4W5W A;  2XSZ D;  1GVN A;  3K8Z A;  5JI3 E;  1JQJ C;  2Y20 A;  3GPX A;  4GKK M;  3I51 A;  1IXZ A;  2YNM D;  4IBC A;  3B9P A;  2QQE A;  2SGF I;  4NRW A;  4AI6 A;  2NU4 I;  3W0L B;  2QPO A;  1NHG C;  4LGM A;  5C1B A;  3GLI B;  1NY6 A;  3SAU A;  4QOZ C;  1TBQ R;  3L25 A;  4FWG A;  2V1U A;  2CE7 A;  1M8B A;  4MGZ E;  2DZN B;  1GLN A;  3U6C A;  4AKG A;  2O5R A;  3PNY A;  4RNA A;  4DV1 M;  5ITX E;  2CHQ A;  3FYD A;  5EX0 A;  5BPV A;  3GQ3 A;  2XSZ A;  1YUB A;  2D7E A;  3FUW A;  4FKD A;  2P6A C;  2ROW A;  4B7H A;  2XH9 A;  2I7N A;  3ZC7 B;  2UUB M;  4LF8 M;  1DS3 I;  1EQN A;  2JA2 A;  1HNX M;  4MH0 E;  3KP1 E;  1XA6 A;  2DXI A;  3H4M A;  1Z5B A;  5ITR A;  1Z59 A;  1Y8F A;  1UVG A;  2NQ8 C;  2L09 A;  4LF7 M;  3KXE C;  2KMQ A;  4FCT A;  1QAQ A;  2F5S A;  1HT2 E;  1CE3 A;  1NHW C;  3B39 A;  1G4A E;  4M9X A;  2L6O A;  4I81 A;  2JXD A;  3KOY E;  5FUY A;  4RF0 A;  4B08 A;  4FCW A;  4PD2 A;  2E5L M;  2Y21 A;  3SAS A;  2LH0 A;  2L7X A;  1XNQ M;  5EP1 A;  4WUR A;  4MGI E;  5LMN M;  4OVO A;  3L27 A;  3LQQ A;  2XZU A;  5FTK A;  3GPP A;  4JI1 M;  4LJ5 A;  4LZZ A;  4MGH A;  4LCB A;  3ILK A;  3KSX A;  1HPT A;  2J87 A;  1FAQ A;  2BJV A;  2VII A;  2JW6 A;  1IY0 A;  2QQ0 A;  3TWL A;  1OFH A;  2XFS A;  1H6U A;  4X66 M;  5E26 A;  2UXB M;  2D7H A;  3D00 A;  1TGS I;  4JV5 M;  1N34 M;  2DWM A;  1IN4 A;  3SYK A;  5DNY A;  1CSO I;  4ITQ A;  4IJF A;  4X62 M;  1YE9 A;  4M9Z A;  5EXX A;  1FYB A;  1LR9 A;  3FD9 A;  3GRY A;  4AKI A;  3AV0 A;  5FTN A;  4IBG A;  3UK6 A;  3T1H M;  4LF6 M;  3U6S A;  1CGJ I;  5HI7 A;  2N17 A;  1SGD I;  3K2L A;  2OVO A;  2C9C A;  2QBY A;  3U61 B;  1CT0 I;  5IZ7 D;  4L8R C;  5FTJ A;  2ZM6 M;  2AU3 A;  1IY1 A;  4IIW A;  3KDS E;  2SGP I;  3J2P B;  1C1K A;  5DYI A;  2B8T A;  4LF9 M;  1PTQ A;  3LVW A;  1TBO A;  1X74 A;  3KY9 A;  2V6Z M;  3GLF A;  4L15 A;  2ORV A;  3SMS A;  3QTL D;  3GP1 A;  1D3Y A;  5EP4 A;  1YTP A;  2KCX A;  3BJI A;  5FUV A;  2Z3X A;  1DD9 A;  1PJU A;  3UGL A;  3TPZ A;  5EX3 A;  3U6D A;  2KEB A;  2XF3 A;  5BR8 M;  3D8B A;  3DA1 A;  3AL0 C;  2UU9 M;  4KHP M;  1PCE A;  2WCY A;  2X8A A;  3MJ5 A;  4GC5 A;  2E5R A;  4B7F A;  2CUZ A;  4II7 A;  2JYY A;  4NRV A;  3M6A A;  1TDZ A;  5EXT A;  3U6P A;  3I4Y A;  4JN6 A;  3J7A S;  1CGI I;  4KO8 A;  4QHT A;  3FC3 A;  1V1H A;  3SAW A;  2CV0 A;  1N13 A;  2R65 A;  2UZ3 A;  2Z4R A;  3FTD A;  4ZPX A;  3L29 A;  2CV2 A;  2KMP A;  3U60 A;  1YU6 C;  4O6P B;  3A98 B;  3SFZ A;  3PNV A;  3HGI A;  3PXG A;  4DR5 M;  5C18 A;  4EDR A;  2V53 A;  2XRC A;  5ITQ A;  1L1T A;  4YY3 M;  4JCV E;  5IRE B;  4MGY E;  3UGJ A;  3OL0 A;  4K0K M;  1SXJ E;  2YFQ A;  2LEO A;  3GLH A;  1DO0 A;  2KZU A;  3PVS A;  4GHA A;  2UXD M;  2NU2 I;  2EUC A;  1Q3B A;  3GLH B;  4NXN M;  4DV3 M;  4NXM M;  1Q39 A;  2BJW A;  2X4A A;  3M7G A;  3GPU A;  3B4V C;  3TWK A;  3HWS A;  1KYI A;  4QHS A;  3DZD A;  3GLG B;  1N77 A;  4E2K A;  1IBM M;  1OVO A;  4FD2 A;  3VKG A;  2ENZ A;  2ARP F;  1L1Z A;  1X37 A;  1TH3 A;  3FTC A;  3AJI B;  2F4V M;  2HCB A;  2OD1 A;  4B3S M;  3FUU A;  3SEK C;  4M9S A;  1XBT A;  3I4V A;  4R7G A;  3SC3 A;  2ZAM A;  2OQ4 A;  3R8F A;  2DWL A;  1Y1C A;  3RU0 A;  3FKE A;  2VRW B;  2LXE A;  2N52 A;  5FUW A;  3SAR A;  3KOW E;  3SAV A;  1KMA A;  1YSY A;  4OU7 A;  2QQC A;  4G6Z A;  3M0E A;  3GLI A;  1NNJ A;  1TH2 A;  5EJC A;  1Z5A A;  3GRR A;  4LFA M;  2DWZ B;  4WW0 A;  5LMU M;  1MT1 A;  4JI2 M;  3VK7 A;  1SXJ C;  3HU1 A;  2K9H A;  1IN6 A;  2RKO A;  1XMQ M;  3GOX A;  4DV4 M;  3GQ4 A;  4AG5 A;  1QZM A;  4IBB A;  4UXH A;  1EE8 A;  1NY5 A;  1PM5 A;  3KS8 A;  1XX6 A;  1HNW M;  1ZAE A;  3CXL A;  2Z7J A;  5IWA M;  2ENN A;  4LZJ A;  1OYV I;  1ZQ9 A;  1NVM A;  1W5T A;  3KS4 A;  3OTO M;  4YHH M;  2KMO A;  3CF0 A;  4L16 A;  2YR0 A;  4JI8 M;  1IY5 A;  1CT2 I;  3T1Y M;  4MB7 A;  3L26 A;  4JYA M;  4O6O A;  1NNU C;  1QVR A;  5H37 D;  5CCL A;  4L4U A;  1SGN I;  2FNA A;  2CHG A;  1IN8 A;  4UXJ A;  2A5Y B;  4XGI A;  5CCM A;  3SHG B;  3GO8 A;  1J09 A;  4FVM A;  3NBI A;  4CHT B;  3TQS A;  4FW9 A;  1TUR A;  4X65 M;  4DUZ M;  2NU0 I;  1IN5 A;  1N75 A;  2F5P A;  1BMO A;  3CF2 A;  4NL4 H;  1R7R A;  3AOE A;  2CFO A;  5FTM A;  4OX9 M;  3UMM A;  3U5Z A;  1S3S A;  5ITX A;  2F5N A;  4EDK A;  4DV0 M;  3U5Z B;  3HH2 C;  2XLJ A;  2KW0 A;  1KFV A;  1TBN A;  1XNR M;  1G3I A;  3GQ5 A;  3VE5 A;  1J7K A;  2CJS C;  3IG5 A;  3VDU A;  1IW4 A;  1PTR A;  3SYL A;  1KBF A;  1J5E M;  3RGP A;  4DUY M;  4M0W A;  4JI3 M;  1GL6 A;  3U61 A;  4DR4 M;  4UXI A;  5HQ8 A;  1OJL A;  3JAM S;  4AQY M;  4B3T M;  1IBK M;  1TGU A;  1TIH A;  4CGY B;  1LR8 A;  1HR0 M;  1XMO M;  2WVJ A;  3JR4 A;  4GHL A;  1CHO I;  3VDP A;  3PDN A;  2FOI C;  2L7I A;  5FUX A;  4LJ7 A;  5KQ8 A;  3TWM A;  1M8C A;  2V1C C;  1OMT A;  1SGE I;  2L8E A;  4JI6 M;  4DR6 M;  5IT9 S;  1OMU A;  1NSF A;  3KW6 A;  1QAM A;  1XXH B;  3J27 B;  1L2B A;  2E73 A;  5DYG A;  1FJG M;  4AKH A;  2YQP A;  3HU2 A;  4IJE A;  1JR3 D;  4L78 A;  4LF4 M;  3UGD A;  2AHM A;  4IBK A;  2LUY A;  2SGD I;  1IM2 A;  1QYR A;  2KRU A;  3L28 A;  4XBO A;  2Y0Q A;  4D82 A;  4HL4 A;  3EIH A;  4QNM A;  3R9X B;  1IXS B;  2Y0T A;  1UM8 A;  4LGY A;  1W3S A;  4GKJ M;  2KA6 B;  1E32 A;  4EIW A;  1N36 M;  2F5O A;  2KRK A;  1Y1B A;  4CIS A;  1XC8 A;  1JR3 A;  4GIT A;  3E2I A;  4JI5 M;  2QEN A;  1MU5 A;  3IG8 A;  2DHR A;  2C9O A;  2BNK A;  1T3T A;  2W82 A;  3AFH A;  1E94 E;  4KLN A;  1R2Y A;  1NUB A;  1SGP I;  1IQP A;  3Q8X A;  4JI4 M;  2GKV A;  4I4L A;  2ELI A;  3E9S A;  1T6T 1;  4GI3 C;  3OXG A;  4IBF A;  4DR1 M;  2C99 A;  2FFJ A;  2H1R A;  4LFB M;  1CT4 I;  2R18 A;  5E6J A;  2SGE I;  2J9R A;  3A46 A;  3KFU G;  3UJN A;  3U6O A;  2R4J A;  1HQC A;  1LV7 A;  3SMP A;  3QWP A;  3GLG A;  3SBJ A;  4P16 A;  1SGQ I;  3HHX A;  3J7B A;  3FTF A;  4LG2 A;  2C5R A;  2LNH C;  4G4N A;  2M5X A;  1SXJ D;  3HHW A;  3FTE A;  2UUA M;  4RF1 A;  1VDD A;  3BOS A;  4DR7 M;  2XEP A;  4FWD A;  7CAT A;  2Z4S A;  4OVZ A;  5JHW C;  2F3C I;  4HLQ A;  3QWL A;  4AG6 A;  4M0D A;  1DGH B;  3K92 A;  2Q2E B;  1R79 A;  4EE1 A;  2QPA A;  4OVZ B;  2A20 A;  4D81 A;  2R45 A;  1R0R I;  4DV5 M;  3OXL A;  4AW4 A;  2KZS A;  4LJ6 A;  4JCV A;  1KSF X;  5ITT A;  1Z5C A;  1QAN A;  4B7G A;  4DV2 M;  5KQD A;  1SXJ A;  3HU3 A;  3AKZ A;  1L2D A;  2QCU A;  3MEK A;  8CAT A;  1NJG A;  2DZO B;  1SXJ B;  4KOD A;  2D7G A;  1R6B X;  4B3M M;  5KPR A;  2KMR A;  1V1I A;  1QQW A;  5EP3 A;  4MM3 B;  4NOO B;  5A2Q S;  2J7N A;  4D80 A;  1TDH A;  1K3W A;  1G41 A;  2N71 A;  1BUS A;  2C96 A;  4G4O A;  1HNZ M;  4I5S A;  4JXJ A;  4Z6Y A;  5ITU A;  1DO2 A;  3ZH9 B;  3A42 A;  1UVF A;  3RGS A;  5GKN A;  3J80 S;  2ZBK A;  1K3X A;  3UZU A;  2HL7 A;  4S12 A;  2LWX A;  4PT5 A;  1I94 M;  2UUC M;  2QZ4 A;  1IXR C;  5F3W A;  2ZBK B;  1TBR R;  2XGN A;  1I4W A;  3KP0 E;  1XWI A;  1Q3C A;  1NJF A;  2GKR I;  1GKI A;  4GC9 A;  3KOZ E;  1X4S A;  4G4Q A;  3ZCB B;  3UFF A;  4IBE A;  2M5Z A;  3D8L A;  1Z6T A;  5KPT A;  3SHF A;  5FLX S;  3U6Q A;  4QNR A;  4Z8X A;  1E9R A;  1IN7 A;  2HKJ A;  1DGG A;  5KPZ A;  1R2Z A;  2CHV A;  4NSO B;  2NU3 I;  3UEY A;  1TOT A;  3VLF B;  2VQF M;  4LJ4 A;  1ORY B;  5KO3 A;  2M60 A;  1E9S A;  3HHZ A;  2SGQ I;  2QP9 X;  3FUV A;  1IY6 A;  1L2C A;  2N1A B;  1XHB A;  3GPY A;  3HKP A;  4DV6 M;  2BUS A;  2YQZ A;  2XFT A;  4HGU A;  2P5T A;  1HJA I;  1N78 A;  4E1R A;  4B3R M;  4LRS A;  4DR3 M;  1Z7K B;  3MHV C;  4DV7 M;  4EDV A;  2CV1 A;  2DIP A;  3CF6 E;  1SGR I;  2FNF X;  4IBI A;  2QQD A;  1W5S A;  3AOE C;  2V1C A;  2DVW B;  3U6E A;  1L8Q A;  4TUW A;  3WHL A;  4L9M A;  3LQR A;  2R4E A;  1OFI A;  1LR7 A;  2DB6 A;  4MGK E;  1MX0 A;  1XXH A;  4B6D A;  4FCV A;  3KVW A;  1RFH A;  3L2A A;  2HHH M;  2RGH A;  2W0T A;  3SGQ I;  1IY2 A;  3W0F A;  3U6L A;  1WXQ A;  5EQT A;  4JI7 M;  2YUU A;  3AOG A;  3LVV A;  2RGO A;  3MK6 A;  4G4R A;  4REZ A;  3RFW A;  1HDL A;  3DFZ A;  2QBY B;  1G8P A;  3U6M A;  2J7O A;  4GRI A;  3FUT A;  5DAE A;  3VFD A;  3VK8 A;  4OW0 A;  2GKT I;  1D2N A;  5EXP A;  3GLF B;  1PJJ A;  3PFI A;  4FWH A;  3KOX E;  1HQY E;  1SGY I;  2OPF A;  2R62 A;  3K1J A;  1DS2 I;  5GUJ A;  3FUX A;  3GRU A;  3T38 A;  1N33 M;  3NWL A;  4EDT A;  1FAR A;  4DR2 M;  3VKH A;  4LY6 A;  3TE6 A;  4BLC A;  4AZF A;  1FNN A;  4PCZ A;  4E1P A;  2ERW A;  2ZAO A;  1DDE A;  4LRT A;  1DGF A;  4BBA A;  2B0U C;  2ODD A;  3CTW B;  3QAU A;  3FYC A;  1AN1 I;  1TUS A;  1W4R A;  2NU1 I;  2ERC A;  1U5K A;  2K47 A;  3U60 B;  3DOA A;  4X64 M;  3JR5 A;  3C58 A;  1PPF I;  2G5G X;  2XZF A;  2DWN A;  2F5Q A;  4LFC M;  1DGB A;  2I7P A;  4LJA A;  3J81 S;  1DGH A;  2EA0 A;  2FE8 A;  5JI2 E;  3UEJ A;  1K82 A;  4SGB I;  2Q2E A;  4NSR A;  1QAO A;  3A45 A;  1TH4 A;  1UUC A;  2GVI A;  5FSW A;  2ZAN A;  5EXS A;  4I8O A;  3SGB I;  5ITY A;  1PJI A;  2JA1 A;  3HJQ A;  2CEA A;  4JI0 M;  4R3D A;  3E59 A;  4GMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...