3VDYA

B. subtilis ssbb/ssdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
101
Chain Sequence
b'HMFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYEVNVYVTEVLADTVRFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein ssbB
molecule tags Dna binding protein/dna
source organism Bacillus subtilis
publication title Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
pubmed doi rcsb
total genus 16
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3vdyA00
4IO9A 2IY5B 2VW9A 1C7YA 1YHQA 3A5ZB 3RNUA 3KOJA 2HHHL 2K52A 3HFZB 3BZKA 4LF7L 3K0XA 4DV6L 4A3IG 4B3MQ 2HQLA 1KIXA 1SLJA 3KF6A 1GM5A 1L0WA 1IBKL 3W1GA 3RN5A 3S2HH 1CSQA 4BY1G 4A3MG 4A3CH 3U4ZA 2B3GA 3KJOA 2AHOB 1V9PA 3FKIG 3GDEA 3CC7A 4LFBQ 2IX1A 1Z9FA 4L5QA 4DR5Q 4LUVA 2UU9Q 5JJLA 5LMNW 2UXCQ 1PYSB 2EQSA 1WJJA 2FXQA 3BJUA 3OTOL 2QEXA 5HGQA 3CCUA 1RL2A 1U5KA 3K8AA 4J15A 4EX5A 1NJIC 2OQKA 4BA2I 4BY7H 4GN3B 2NVXH 1NMFA 4DV1Q 3FP9A 3TEHB 2DUDA 3UDFA 1G6PA 1MKHA 2ZM6L 2JA5H 2ALYB 4NPSA 3PF4A 4DR2Q 1NTGA 4DUYQ 4RMFA 1ASZA 2F4VQ 3PUVA 5FLXc 2K14A 2E2HH 4DR4L 2I5LX 2Z0SA 3RZDH 1A8VA 1GVPA 4KLKA 3CQZH 1HR0Q 1VQPA 2R7DA 3I4NG 3F1ZA 4L5RC 1HNXL 2BA0A 3ULLA 3M9BA 4KI0A 4LF9Q 3H3VI 3CW2C 4X66Q 4B3RQ 4K0KQ 1PYBA 4JI5Q 4DV2Q 2R93G 4A3FH 1X54A 5IWAQ 1I3QH 1BBWA 2RHQB 4XTCS 1Q86C 1GO3E 2VQEL 4A75A 4LNQA 3PO3H 4TVAB 5AJ3Q 4LFAQ 4B3RL 4K0KL 3CMAA 2EXDA 4UP7A 5HY6A 4X65Q 1XMQL 3S16H 1HR0L 5C0XG 4JI7L 4OWWB 1CKOA 3F2DA 5DLQE 4JI1L 4P74A 2BH2A 4DR2L 4GNXA 4DV3Q 2CCZA 2ASBA 1VQAA 4GOPA 4DR3Q 5C0XJ 1E24A 4JBWA 4B3TQ 1OXTA 3Q8DA 2XTIA 1OXXK 1K9MC 4A3LH 1GKHA 3T1YQ 5C0XI 2AWNA 1VQDA 3E0EA 1XNQL 3NEMA 2YTVA 3CCJA 3EN2A 4RG1A 3J81i 1W3SA 4JI3Q 1N32L 4A3GH 4HIMA 2UXBQ 4DV0L 4HJ8A 4X6AH 2KCTA 5JEAG 3K80C 2C35B 4JI2L 1L1OA 3PO3G 1B8AA 2AWOA 3FHWA 4A3DG 1XPOA 1PH2A 1X9NA 1Y14B 1XMOL 1OXVA 1YJWA 2IX0A 4POGA 4DV3L 4IOCA 3TRZA 5IP7H 5C4XG 1VS0A 4JI1Q 2K4KA 3OW2A 1YJNA 4DR6L 1H95A 4GKJL 1IBMQ 4BXXH 3ULJA 4X64Q 1SE8A 4GLVB 3I56A 1Q82C 4JBMA 2K5HA 1FJGQ 3JAMc 3AFPA 1XMOQ 4DNIA 3S1RH 1UE6A 2IHEA 4UPAA 3HOXG 3BZCA 2MQHA 2GVBA 2E2JH 2A8VA 3ER0A 5GAGC 1XNRL 1Q1BA 3KF6B 4GKKL 4WJ3M 1HZAA 5BR8L 1N34Q 4BBRH 4PZ6A 5IP9G 2VZAA 2UXBL 1N32Q 4LF6Q 3RZOH 3TREA 3CCMA 2EIFA 1YEZA 3L2PA 4YCWA 1VQ8A 4IFDG 4JCVE 3NELA 4R1JA 3PIOA 4HIDA 4WJ4A 1YBYA 4A4IA 1YJ9A 5GAEC 4A93H 3CXCA 2ZJRA 3ULPA 4DAYB 5K36G 3ZJYC 4UY8C 3OYYA 4APVA 2BH8A 1XPUA 5IYCH 4BBSH 2OQ0A 1N9WA 3RLOA 2UUBL 2JA6H 3W5OA 3J80c 3J7A5 3UDIA 1TWFH 1VQIA 4GS3A 4OONA 3JAMi 1KC8C 4IPDA 2ZTCA 4JOIC 3S1NH 2Z6KA 1UE7A 4OO1G 1FJGL 3HOXH 1UEBA 4GNXB 1A62A 5IYBH 5FLMG 4MNOA 1LYLA 3NENA 1KRTA 4JBJA 3PO2G 1TXYA 1YHBA 2F3IA 4BBRG 1N33L 1S72A 2PI2A 3TS0A 1BBUA 2LXJA 1JB7A 4A93G 3T1YL 1CSPA 4FDBA 1S3OA 1P16A 3HOWH 2JQOA 2KHIA 4AYBE 3S1MH 1X3FA 2NZOA 1MJCA 1G291 2DGYA 1FL0A 1Q81C 4JG2A 1UE5A 3DLLA 1WCMG 1X3GA 3KJPA 4JI2Q 4A3MH 4BY1H 2JJQA 3IRBA 2LXKA 3J80i 3RN2A 1N8RC 2RF4A 2UUBQ 3J7ZC 3M4OH 1K8AC 2PQAB 1XNRQ 4KHPQ 1SROA 2CKZB 5FJ8G 1VQBA 2Z6KC 1K0RA 1PA6A 3T1HQ 4IFDI 2KHJA 3CPFA 1I50H 4QL5A 3PO2H 5LMUQ 5J3BA 4OX9L 3D31A 3L7ZC 1XTDA 3I2ZA 1VQFA 1SMXA 2JA7H 2OWOA 2ID0A 3CC4A 4P75A 3HKZE 1YIJA 1EWIA 4X64L 3JC66 5ELNA 5M3FH 4HJAA 3PF5A 1IBKQ 1YHAA 2L15A 5IT9c 3CCEA 1JE5A 3GTPH 3A5UA 1AE3A 1QVFA 1K8GA 4HJ9A 3HOZH 1X55A 1QVGA 3RLFA 1IYJB 1OXUA 1UE1A 4R4IA 4LF8L 2QA4A 3GTMH 5IYCG 4BBSG 5C3EG 3NBHB 4R4QA 4DR7L 1CUKA 4LUOA 1HR0W 3H3VH 1Q46A 4HIOA 1R9TH 1N34L 4DV4Q 3KDFA 1NE3A 5H1SE 1VQLA 2CWAA 5ELOA 4A3JG 1PH5A 3GTLH 2YYZA 5FJ8H 1MJEA 3GTGH 3STBD 1X56A 5EAYA 4BY7G 4DR1L 4ME3A 1JJCB 2A1AA 4LF4Q 4A3BG 4AH6A 2OTJA 1VQ4A 3CCQA 4DV5Q 1A63A 4JV5L 1CKNA 2NN6I 1FVIA 3L0OA 3TQYA 1V1QA 4AQYL 2B63G 4DV4L 3HOZG 2K5NA 3E9IA 3PSIA 2WP8J 4DUZQ 4A3KH 3H0GH 3G48A 1PH1A 4DV6Q 4B3ML 4JI3L 3I4NH 1VCIA 1JMCA 1W2BA 4TQUS 2HHHQ 4NXNL 3RR5A 4LF8Q 3AQQA 4R4CA 1QUQB 2R7FA 1HZCA 2Q2IA 3HKZG 4NB3A 3G6EA 4A3JH 4IOAA 1PH4A 2JA6G 1X6OA 2JEBI 2VQFL 4A3DH 2N78A 1B70B 2YTYA 2JK8A 2MNAA 1I94L 4L5SA 5IP7G 1PFSA 1PH7A 3GTKH 1Z47A 3HOVH 1EIYB 1NMGA 1BKBA 2JA8H 1VQJA 5GADC 4B3TL 1DGSA 5M5YH 4IJLA 1Y1WH 4DR1Q 1VQGA 3CCRA 2HIVA 1A0IA 5IYBG 1HH2P 4LFAL 1HJPA 1P8LA 4P71A 4DV0Q 1KAWA 1TWCH 1L1OC 2N8NA 1VQKA 1E7ZA 5GQOA 4GKKQ 2UUAL 3F2CA 4PZ7A 3G71A 3F2BA 3H0GG 1N36Q 1EUJA 1QUQA 2I5HA 1SRUA 4DR3L 1QZGA 3PGZA 1WFQA 3K81C 1VQ7A 3CAMA 2NZHA 2NN6G 3TS2A 3I7FA 3PUXA 3AFQA 5IYDG 5C44H 4KHZA 1PHJA 1IBML 1E3PA 3CC2A 4LF6L 4IJHA 3PUWA 4YCUA 3S2DH 2R92G 4JI7Q 1WCMH 1E22A 2MO0A 4DR4Q 4DR7Q 1I94Q 1AH9A 2LSSA 1X65A 2XGTA 2IHFA 3K7AH 3U58A 1HZ9A 4UP9A 1VQCA 4JC0A 1S40A 1T9HA 2D0OA 1Q7YC 3T1HL 4C3HH 4R4OA 4LFBL 1VQNA 3HOYG 3WWVA 4LWCA 5M3FG 1YI2A 1Q12A 2K5VA 4IPGA 4IFDJ 4A3GG 3GO5A 4A3IH 4HJ5A 2A19A 4LF5L 1K83H 1HNXQ 2JA5G 3RLNA 2R93H 1KQSA 4DR6Q 3KDFB 5JJKA 1RIPA 2WB1E 2JA9A 1KRSA 2D0PA 3F8TA 4JI8L 1AE2A 4DPGA 1GD7A 1HNZL 1EIFA 3S1QH 4ALPA 2OCEA 3UE0A 4DUZL 2ES2A 3SGIA 3D0FA 4Y7NH 1N36L 1Y1VG 2ZM6Q 2KENA 3J81j 3HOWG 3UDXA 4MTNA 1EOVA 3GD7A 1OXSC 2AKWB 1EQQA 2GVAA 4JBKA 1PH8A 2R7ZH 4JV5Q 4KHPL 4YY3L 2K50A 2OTLA 2YV5A 1VQ6A 3CCSA 1OTCA 2KBNA 4DK6C 2Y0SG 1ASYA 4JYAQ 3MEFA 2UU9L 1JT8A 3CF5A 4POFA 3CMEA 3UE1A 3PUZA 2F52A 2WFWA 1B7YB 3HKSA 2ZTDA 3S17H 1HNWQ 4YWMA 4OWTB 2E2IH 2JA7G 2Y0SE 1TWAH 3GTJH 5IE8A 2NVTH 3B6YA 3BU2A 3EBEA 1Y1WG 1IBLL 4DAMA 4X62L 1HZBA 3A74A 4JI4Q 4GLXA 2VNUD 1K73C 2E5LQ 3AEVA 1WOCA 1LUZA 1FGUA 5IY0A 1HNZQ 4GLAC 4LUZA 3CCLA 1JJGA 1MIUA 1WYDA 4P73A 5JJIA 3HOUH 2Q2TA 5M5WH 3M85A 4LFCL 1IBLQ 2VQEQ 3A0JA 3GTQH 4GOPB 5IWAL 1YVCA 4DV1L 1PV4A 4LF9L 3KYHC 4IPHA 1V43A 2ZTEA 3ERSX 5C3EH 3PCOB 4YHHQ 1EQRA 4YWKA 1XNQQ 2JE6I 1VQEA 3DM3A 2IT1A 1UWVA 3KLWA 1KD1C 1M90C 2WAQE 2WAQG 2R92H 1PH9A 3I4MH 2QGQA 3EIVA 4DKAC 2ATWA 4A3EG 4LFCQ 3HOVG 3S15H 4A76A 1PVOA 3PIPA 1EFWA 2K75A 2H5XA 3PUYA 4Y52H 3CD6A 4GKJQ 3KFUA 3KF8B 4GOPC 5BR8Q 2PI2E 2E5LL 2VUMH 4X65L 1YZ6A 3W1BA 5FLMH 4JI0Q 3M4QA 4A3LG 3I4OA 4QY7A 1N33Q 3UDGA 2MFIA 2VQFQ 5C4JH 2UXDL 1U0LA 4B3SL 4LF5Q 2HT1A 2D62A 5GAHC 3PV0A 1C0AA 4NXMQ 4EQ5A 1HNWL 2VL6A 3E9HA 1L2FA 4L5TA 1KXLA 2YU9H 1Q1EA 2HIXA 3FKIH 4P72A 1XJVA 3U50C 4NXNQ 4C3JH 1J6QA 1NBWA 2B29A 2MO1A 4GN5A 1SFOH 4JI6L 5JEAJ 4JI0L 5LMNL 1IL2A 3I55A 5M3MG 1QVCA 2CFMA 4PG3A 4YY3Q 3H15A 1PH6A 3ICEA 5M3MH 3U4VA 4C3IH 4R4TA 4A3BH 1I6HH 2N49A 3CCVA 2VS1A 3VDYA 4A3KG 3I4MG 2VUMG 4OWXB 3G4SA 2B63H 2UUCL 1BVSA 2BA1A 5LMNQ 2NVQH 4AYBG 4JI6Q 1LTLA 1TWGH 3M7NA 2GN5A 4JYAL 2R6GA 1XPRA 1X3EA 2UUCQ 2UUAQ 1J5EQ 2NVYH 3J81c 1O7IA 1D8LA 5AJ3L 1YITA 2PMZE 4DV7Q 4LW1A 4B3SQ 1YNXA 1L1OB 2WB1G 2RHSB 4DV5L 4PZ8A 2CWPA 4DV2L 4OO1I 4QJFA 4MZ9A 1E1TA 4BXXG 4AIMA 1Y1VH 1SR3A 2PNHA 1C9OA 2PQAA 4BA1I 4IPCA 5C4XH 5IYDH 4O0AA 4JI8Q 4XIGS 2ZJPA 4YCVA 1I5FA 3M4PA 1XMQQ 1KHIA 4A3EH 1LM0A 2F4VL 4OXPA 1Q8KA 1G51A 4YHHL 4PMWA 2JEAI 2CQOA 2Q2HA 5E7NA 1VQ5A 1WI5A 1VQMA 3K7UC 2JA8G 1KL9A 3LGJA 2UXDQ 4JI5L 3HOYH 4QIWE 1IZ6A 4X66L 2N3SA 4H02A 4HJ7A 2Q2UA 3M3YH 1J5EL 2I5MX 4JOIA 1VQOA 3GTOH 3S14H 3STBC 4A3FG 4GN4B 1PH3A 1IXRA 2KCMA 4HIKA 4UP8A 1TWHH 3HOUG 4O2DA 4A3CG 2E8GA 5IP9H 4DUYL 1JJ2A 1CKMA 5C44G 2R7ZG 4AQYQ 2RCNA 1VQHA 1NY4A 4DK3C 4YWLA 2ZJQA 5GROA 4DV7L 4GNXC 1M1KC 2VY3A 4OX9Q 5LMUL 2I0QA 1K3RA 4QGUA 4LF4L 1E1OA 3MXNB 3OTOQ 2UXCL 3CPWA 3CP0A 4LF7Q 4QQBX 1VQ9A 4JI4L 4DR5L 4X62Q 1D7QA 1CKNB 2YTXA 4C2MH 3AYHB 1QZHA 4NXML 2AMCB 2V1CC 5M5XH 1SN8A 3S24A 1EYGA
chains in the Genus database with same CATH superfamily
5E3FA 5ELBA 3JAML 3KOJA 3T4AC 3QO2A 3RNUA 3HFZB 1A6XA 4EQOA 3KLSX 4U68A 3HEJA 3NBHA 4XT1B 1CHQD 4BBRB 1LLRD 3U4ZA 1KDCA 2N88A 3FKIG 2IX1A 4L5QA 4LUVA 1SE4A 4F8MA 4CJ0B 3VR6A 5LMNW 1PYSB 2NN6H 1K8MA 3CCUA 4J15A 2OQKA 1H9JA 2VXWA 3FMCA 4N8FA 3VA7A 4HMJA 3MVVA 1EY0A 4DUYQ 2F4VQ 2K14A 3RZDH 1A8VA 1PFBA 1A2UA 3CQZH 1EWHA 3MXNA 2BA0A 3P1HA 4JI5Q 4A3FH 2RQXA 4Q5VA 1I3QH 4A75A 3PO3H 1AEXA 4LNQA 2KHSA 3RMHA 3CMAA 5C4XB 4I7AA 2EXDA 5L37A 3K59A 1CKOA 2CHBD 3A7LA 4P74A 5IGDA 1RODA 2ASBA 2MPMA 3ONAB 4J8QA 5C0XJ 1E24A 4B3TQ 1OXTA 1DOMA 5CGKA 2EPBA 2F03A 1SAPA 4A3LH 2WKDA 3E0EA 1VQDA 3A54A 3NEMA 4RG1A 1PMRA 2MP1A 4DV0L 4X6AH 4XQQA 2KCCA 3K80C 1PTOC 2NTSA 4DAYA 2QDLA 1L1OA 1TIID 3FHWA 3X3NA 5JVG3 1EIGA 1PH2A 1YJWA 5IP7H 4JI1Q 3OW2A 4GKJL 4BXXH 5M5XB 3ULJA 2CW0C 4KN4C 3T13A 4KKSA 4C56C 1XMOQ 2RVLA 2E2JH 3GV6A 4PNYA 4KTAA 2KA7A 1GOZA 5GAGC 1XNRL 2E2JB 3SE0A 5BR8L 1LTRD 4RGTA 1N34Q 3G7LA 1EZ8A 4LF6Q 5KYIA 3MZ5A 1LACA 5D14A 2EZVA 1YEZA 3ITPA 3L2PA 2EE1A 1GUSA 3NELA 4WJ4A 3PIOA 1Z7TA 4DFAA 4UY8C 3OYYA 4APVA 1DM0B 1F2YA 1STNA 2F0LA 4KJOA 4ZRZA 3RLOA 3BG3A 3TMEA 3W5OA 4HAEA 3J7A5 4GS3A 1STYA 3JAMi 4JOIC 4HCEA 4QMGA 2LY7A 3UI2A 2K01A 1FJGL 5C3WA 1LYLA 1KRTA 4BBRG 4DXGA 1S72A 3TS0A 1BBUA 2LXJA 4Y7NB 4A93G 5CV6A 1HQRD 4AYBE 3S1MH 2NZOA 3Q24A 1FL0A 1WCMG 1X3GA 5KEEA 3CRKC 1B53A 2K6AA 3J80i 1EL0A 3TP8A 2UUBQ 3J7ZC 2PW7A 2F0TA 1SROA 5FJ8G 4U673 4ZKCB 1PA6A 1VDZA 4IFDI 2KHJA 3CPFA 1ILQA 1I50H 3PO2H 2FMCA 2F3VA 3NWSA 2JA7H 1PRTD 2EY1A 4A3KB 1PZKD 4JK1C 4X64L 2JA7B 2A6HC 2HDLA 5FO9B 1WTHA 1JE5A 2KECA 3A5UA 1AE3A 5C5MA 4HJ9A 1ICWA 2BE5D 1VF7A 3W3AA 1OXUA 2QA4A 1I3QB 3SHLA 3GTMB 4ZYSA 3NBHB 1EYDA 4R4QA 3TP7A 4LUOA 2WIIB 4KY7A 1R9TH 1VQLA 1XYIA 2F4IA 4UDUC 1PH5A 1IKMA 3BVZA 2YYZA 4CJ2C 5KIXA 5EAYA 4BY7G 4DR1L 4ME3A 2BDNA 3CCQA 4DV5Q 1CKNA 3R2IA 1FVIA 3TQYA 1TR5A 1BO0A 2EYHA 3H0GH 1PH1A 4B3ML 2E74C 1STBA 2HHHQ 5CV7A 3RR5A 3AQQA 3NE5B 1QUQB 3GV3A 2R7FA 4AYBB 4IUPA 1VF5C 1XWEA 4A3JH 2F0GA 2EYJA 1PH4A 1WCMB 3MWYW 1X32A 1HFGA 4R8NA 2ICEC 2JK8A 2YTYA 4L5SA 3HOVB 1PFSA 5KRUA 2JA8H 5GADC 4B3TL 4LMQD 1Y1WH 4IJLA 1A0IA 1TVXA 3J7AF 4LFAL 1SNQA 3NBIA 4P71A 1TWGB 2TSSA 1M4VA 1VQKA 3HOWB 3DWQA 3F2CA 3OW7A 2K05A 3G71A 2JP1A 2Z4IA 3T56B 1CQFA 1SRUA 2PW5A 1HXYD 4DR3L 1QZGA 3KLRA 5DAUA 4QIWB 5IYDG 5JJZA 1IBML 4KHZA 4NMZA 4QCLA 2L4NA 4IJHA 4YCUA 5C44B 2RCFA 2K5WA 1I94Q 2WAQB 2A74C 2EYOA 3U58A 1SYCA 3FPPA 1SNCA 1S40A 2D0OA 3T1HL 1Q8IA 3TZDA 4R4OA 4C3HH 3H09A 5I9OA 1VQNA 3HOYG 4LWCA 3BZDB 4IPGA 5M5YB 1PLFA 3DEPA 1H9SB 2XIWA 4LF5L 2JA5G 3RLNA 2R93H 2M2LA 3J81E 5JJKA 2WB1E 1LTAD 4RFBA 1BUVT 1BDOA 2D2CC 5EGTA 3SGIA 1N36L 1Y1VG 2ZM6Q 1OXSC 3PIP3 4JV5Q 1LT3D 2JN4A 3HRZC 4RH6A 3SK5A 1VQ6A 1B50A 1OTCA 2KBNA 5I4DA 4BY1B 1NR4A 1TY0A 4JYAQ 2UU9L 1WTPA 3UE1A 5G3LD 3IFTA 1HTLD 4YWMA 4OWTB 2Y0SE 1TWAH 2K33A 3B6YA 3BU2A 4FXKC 1PFMA 1SMYD 4GLXA 4DAPA 1K73C 5IGBA 1CI3M 1CQVA 2E5LQ 3AEVA 1HNZQ 4ZUIA 1K8OA 1VMPA 2KUMA 3CCLA 1JJGA 5M5WH 5IWAL 1YVCA 4LF9L 1SFOB 2B2VC 3ERSX 1EY7A 2ZTEA 4R9WA 3R93A 5C3EH 3PCOB 4QUFA 1VQEA 3DM3A 4FP5D 3TP6A 1I6HB 1KD1C 1SE2A 3CKIB 2JYOA 2WAQE 4V190 3NTIA 1YNNC 5JVH3 1PH9A 2ATWA 1HRJA 5FLXL 3S15H 1LABA 4B9WA 3BS1A 3CD6A 1JOQA 3K5OA 4GOPC 1UAPA 2PI2E 4GZYC 3EA6A 4X65L 4JI0Q 2KEDA 3HGBA 3E6ZX 2VB3X 2MFIA 3ZYYX 2VQFQ 2HT1A 1EYCA 1DYQA 4IUUA 3T53B 4NXMQ 1EWCA 2EJGC 1ONLA 1SNMA 1W6JA 2WINB 1AN8A 3U50C 3J80E 4JI0L 2CQAA 1B1ZA 2OT2A 1D1KA 1I4XA 1ET6A 4YY3Q 4PG3A 4H7BA 4A3BH 4TSSA 3DWPA 4A3KG 2VUMG 4OWXB 3ND8A 1L0YB 2UUCL 5EPLA 1SXTA 4EQPA 3SDZA 2NVQH 1LTLA 1TWGH 5CR3A 4IUQA 3R8BA 1EZ6A 3S9WA 1J5EQ 1EU3A 3J81c 2M9VA 4LW1A 2WACA 5C4JB 2WB1G 2K28A 4OO1I 2RBMA 3NTKA 1KDAA 5CORA 3KUPA 2PNHA 1NUCA 2A6HD 5IGEA 3M4PA 4N8X1 1JC7A 1Q8KA 2L0CA 3GTJB 3D4WA 2Q2HA 5E7NA 2DNCA 4RHSA 2J0TD 4C3IG 5M3MB 4WFN3 3M3YB 5KYLA 3SK6A 4MN3A 4JOIA 2G9HD 1HA6A 1U9RA 2R93B 2MHVA 1TWHH 2E8GA 5IP9H 4DUYL 4FO2A 1JJ2A 1VQHA 2ZJQA 2P5ZX 4GNXC 5LMUL 2I0QA 1CT1D 2XN9C 3MA2B 5F2DA 1E1OA 3MXNB 2UXCL 3DEOA 3CP0A 4LF7Q 4QQBX 4DR5L 1D7QA 4OIKA 1QCBD 4B08A 3S1NB 3I70A 5FK9C 4ZQ3A 4PZ8A 3QJYA 5M5XH 1EYGA 3OWEB 5I6YA 3L3OC 1YHQA 3KK7A 2EYLA 2HHHL 2F0FA 2K52A 2M00A 2X69A 3P75A 4DV6L 2A6EC 1SLJA 1JOKA 3IFDA 3KF6A 1GM5A 3I8ZA 3W1GA 3RN5A 1QB5D 2Y0SB 5C4HA 3GDEA 4LFBQ 3C46A 1Z9FA 4DR5Q 2QILA 4G7ZC 2K03A 1SDFA 2UXCQ 3S17H 5HGQA 1I4GA 1U5KA 2XSCA 3G6JB 4EX5A 3A56A 2NVXB 4BY7H 3S17B 1S5CD 4FF4A 4GN3B 1NMFA 3FP9A 3TEHB 2Z8LA 3UDFA 1G6ZA 1BCPC 2E2HB 1MSGA 2ALYB 1TWFB 1BXTA 2XWJB 3T51B 4DR2Q 3PUVA 4F7XA 2E2HH 4DR4L 2Z0SA 1GVPA 4KLKA 3TP5A 1VQPA 2FJ2A 3VYUA 1HNXL 3ULLA 5JOBA 2R93G 1PYBA 4DV2Q 1X54A 1BBWA 4C1NI 4LFAQ 2K7VA 5ISRA 5EPKA 1UEAB 1ZXTA 4X65Q 5C0XG 4JI7L 1PYWD 3EJIA 1K0SA 3F2DA 2BH2A 1HHVA 2LKVA 4DV3Q 5CV8A 4CDFC 4JBWA 1EU4A 1PRTC 2XTIA 1OXXK 1GKHA 2B2YC 3T1YQ 5C0XI 3VYRA 3PO2B 1EQVA 2AWNA 1GUWA 1B44D 2YTVA 4H44C 1HUNA 3DMUA 1N32L 1JOOA 4HIMA 5JEAG 2F0HA 4JI2L 4HCSA 3PO3G 1XPOA 4A3FB 1O78A 1PRTF 1Y14B 3OMGA 5CYUA 1OXVA 2IX0A 5D3IB 4DV3L 5CV5A 1FYCA 5IGCA 2F0EA 5C4XG 1VS0A 1YJNA 4DR6L 3LWUA 5DNFA 1PZID 1Q82C 1SE8A 4GLVB 1II3A 1BQQT 1KNEA 2K5HA 1FJGQ 3F2UA 2B2YA 1UE6A 4UPAA 1BBXC 3BZCA 5CMDA 2MQHA 2GVBA 3TDQA 2KJXA 3ER0A 1A2TA 3KF6B 4GKKL 4WJ3M 4M1UB 1F2ZA 3S2HB 2UXBL 1D6EC 3D6CA 1AZPA 4JCVE 4R1JA 4KKTA 4DF7A 1YBYA 4A93H 3ULPA 5K36G 3ZJYC 1ZYRD 1XPUA 3MAQA 3L9AX 5IYCH 1X3PA 4FNFA 2UUBL 1EOTA 3H91A 3WDNA 5BN3A 1VMCA 1KC8C 4CDDC 3S1NH 2FHTA 1UE7A 3MXGA 1S5ED 1UEBA 2EJMA 3EVQA 3C1FA 3NSWA 5FLMG 3PO2G 4EGVA 4MTKA 1N33L 2PI2A 3T1YL 3HOWH 4FDBA 2JQOA 2DJFC 1G291 2KCNA 1R9TB 1Q81C 4JG2A 3DLLA 3KJPA 1CZWA 3FPUB 1D2BA 1ZYRC 2PCFB 1N8RC 3OSOA 1LV9A 1F9PA 1XNRQ 4OGQC 1ZKOA 4CDEC 5LMUQ 3D31A 3HKZE 2IW3A 4HR7B 2IJ0A 3JC66 1HUMA 1LTSD 1IBKQ 5DM73 5CBAE 5IT9c 3CCEA 4V0BA 1YNJC 2NUCA 1QVGA 1UE1A 4LF8L 3GTQB 2F0QA 5IYCG 4K6DA 4RKLA 4IN3A 2ICIA 4DR7L 3H3VH 4MIUA 1Q46A 4DV4Q 3KDFA 1NE3A 1RDPD 4A3JG 1MJEA 5FJ8H 4CBVA 1CZGA 1X56A 4L8JA 2A1AA 4LF4Q 4A3BG 1KDBA 4K2LA 2OTJA 4K8IA 2IWHA 1VQ4A 4XQJA 1A63A 4K5XA 4JV5L 3L0OA 1NAPA 3FRPB 4TKOB 1RJTA 3HOZG 2L9HA 3A8JE 3LX0A 3G48A 4J1MA 4DV6Q 5EJWA 3I4NH 1JMCA 1W2BA 3KF8A 1FR3A 1HZCA 4LK1C 2Q2IA 3G6EA 2JA6B 4WORA 1X6OA 2RSOA 2IX3A 1B70B 2MNAA 5C3EB 1I94L 2G9DA 1NMGA 3SEBA 2PMZB 4DR1Q 4HN7A 4DK1A 3K58A 1TWCH 3K6OA 2UUAL 1SYDA 1MSHA 3F2BA 3H0GG 5FO7B 1KLGD 3H0GB 1Y69U 1EYAA 1D5ZC 3PGZA 4O1NA 1EIHA 2B2TC 2NZHA 3A8KE 3LNNA 4EQNA 1MGSA 3Q0AA 2QDBA 4E6IA 1PHJA 3AFQA 3S2DB 5JPNC 1E3PA 3NHHA 3S2DH 2R92G 4JI7Q 3I91A 1E22A 1EY6A 1I50B 1H9MA 2LSSA 2XGTA 1HZ9A 1FD7D 4JC0A 4KJNA 1FNUA 2J4XA 3WWVA 1MI2A 2K5VA 4A3GG 4DGZA 3HOXB 3GTPB 2ZXPA 1XXGA 4DR6Q 3KDFB 4NDXA 1RIPA 1KRSA 3N6RA 1HNZL 3U9SA 1GD7A 1EIFA 3DHQA 4XT3B 4ALPA 4OEMB 1H9SA 1ESRA 3D0FA 4G7HC 2ES2A 3J81j 4IURA 3GD7A 2AKWB 2GVAA 3OWFA 2V4DA 1AP0A 4YY3L 4LAAA 3CCSA 2Y0SG 1JT8A 2EY2A 3MEFA 5DM63 2DY7A 3CMEA 2F52A 1B7YB 3HKSA 4UHVA 2XVSA 1LTGD 1BOSA 2ZTDA 2NVTB 4RCNA 3GTJH 2NVTH 1IBLL 2VNUD 1I4RA 4DAMA 1HZBA 5IOCA 4JI4Q 4DXFA 5I2YA 2F0KA 4RGMA 1LUZA 2IPKD 4L63B 3OMCA 1MIUA 4P73A 1Q90A 3OIQA 3BDCA 2VQEQ 1IBLQ 3GTQH 4DV1L 4OELB 1DOLA 2A69C 4IPHA 4FXDA 2L55A 3I73A 3K0YA 4YHHQ 1GXDC 2JE6I 1SJED 3DXJC 3QG1A 1M90C 3KLWA 3AMUA 2O2LD 2N55A 4M8AA 1AFPA 3EIVA 4DKAC 4A3EG 3GTGB 4LFCQ 1O7LA 3HOVG 1PVOA 3PIPA 1EFWA 4Y52H 4K5VA 2JXMB 3JAME 4GKJQ 2C5CA 5BR8Q 4ZCKA 2E5LL 2EY6A 2VUMH 1YZ6A 3W1BA 1JB3A 5FLMH 3M4QA 4QY7A 3UDGA 3I4NB 1U0LA 4CKEA 4B3SL 2D62A 1HNWL 3M7GA 4ODGA 2YU9H 4NXNQ 4P72A 4J6HA 1J6QA 1TY2A 4GN5A 1SFOH 1RTNA 4JI6L 1IL2A 5LMNL 4A3DB 1R4QB 3BVGA 4C3IB 5M3MG 1PH6A 4C3HG 5M3MH 1EEID 3U4VA 5A2QE 3CCVA 1LTBD 1XTCD 1WTQA 2B63H 2B8GA 3KBXA 4JI6Q 1TWHB 2GN5A 5ELFA 3GP7A 2R6GA 1XPRA 4HEDA 5IIFA 1X3QA 2F0UA 2NVYH 1D8LA 2CW0D 1YNXA 4XYOA 4DV5L 2O5IC 2CWPA 4DV2L 1F2MA 1E1TA 5K36H 1SR3A 4IPCA 2X6GA 4JI8Q 2ZJPA 2RDFA 5IT9L 4A3EH 2EY5A 3J81L 2F4VL 4OXPA 1D5MC 1I4PA 4PMWA 2JEAI 4RA8A 1KL9A 4JI5L 1Y8NB 4QIWE 1IZ6A 2D5DA 4H02A 2Q2UA 2KEEA 1RKNA 2I5MX 4C1NK 3S14H 3STBC 4A3FG 4GN4B 1CHPD 3RZOB 5FO8B 1IXRA 4O2DA 4A3CG 1CKMA 2R7ZG 4AQYQ 3I4LA 4DK3C 4YWLA 4KMUC 4KHVA 1U4PA 1U4LA 5EPJA 1K3RA 4QGUA 4LF4L 1STAA 2KQ3A 1RD9D 5T1GA 3AB9A 1NR2A 3K5NA 4JI4L 4X62Q 1CKNB 2XWBB 2EXZA 3S24A 4PQXA 5I2XA 3BDOA 4DNTB 2VW9A 2F0DA 2RSNA 4LF7L 3BZKA 4A3IG 4B3MQ 4G4KA 5LL6S 1F9RA 1R4PB 4X3KA 3NQIA 1IBKL 3S2HH 4BY1G 1BF4A 5E4WC 3KJOA 2AHOB 1F9QA 3CC7A 3HKZB 2UU9Q 1TS4A 5JJLA 1GUNA 3BJUA 2FXQA 1WJJA 3OTOL 1RL2A 4BA2I 3K8AA 4BBSB 1GUOA 4DV1Q 1CA6A 4ZKBB 4TRDA 1G6PA 1SE3A 2ZM6L 4NPSA 2NVQB 1NTGA 1E2ZA 4RMFA 2K1BA 2I5LX 4RHRA 1HR0Q 3I4NG 1F77A 1O7ZA 3CQZB 3M9BA 4KI0A 5JAVA 3J80L 4B3RQ 4K0KQ 1GHJA 5IWAQ 4LF9Q 4KV6A 1GO3E 3OPOA 3P7JA 2VQEL 1KLUD 3N52A 1TU2B 2B2WC 4B3RL 4K0KL 3S16B 3A8IE 3J7YW 1XMQL 3S16H 1HR0L 1YNND 4X3SA 4H0LC 4C3JB 1CM9A 1SYBA 4JI1L 3U9OA 1NNXA 5CBEE 3J7AV 4GOPA 1GUGA 5G3LF 3Q8DA 2F0OA 3PIO3 1BCPD 2HCCA 1Q3LA 1XNQL 3CCJA 1ENFA 1OO9B 1W3SA 4JI3Q 2UXBQ 4HJ8A 1DD2A 1L0XB 2C35B 1S5BD 1IW7C 5HURA 4HSPA 4A3JB 1X9NA 3DUZA 3BVMA 5BN5A 4POGA 4IOCA 3TRZA 4ZLTF 1H95A 5KNBA 2JA8B 4OHJA 1G2TA 4XQNA 4X64Q 3I56A 4JBMA 1STEA 1EQTA 3AFPA 2EYFA 2NTTA 2QCPX 4DNIA 3S1RH 2IHEA 3HOXG 3Q23A 2F0VA 5HGTA 1EY4A 3TSSA 1Z6HA 2VZAA 4LJZC 1N32Q 3RZOH 4YIJA 3QOLA 3TREA 2EIFA 1C4QA 3C3LA 2EYMA 4FVMA 1VQ8A 2BDOA 4HIDA 5GAEC 4UAIA 4ZK9B 4DAYB 1S5DD 2BH8A 4CJ1B 4CKCA 1QE6A 2OQ0A 3MXPA 2JA6H 2AQ2B 1PDQA 2JSOA 4HTHA 4K14A 5FKAC 1TWFH 1VQIA 3UDIA 1PFNA 4IPDA 1JICA 5AFWA 1ENCA 4OO1G 5D65A 4A3IB 1U4RA 4K2KA 1MBYA 5IYBH 1DXMA 1LTID 3D8GA 1I6VC 4MNOA 4CDCC 4JBJA 1TXYA 1YHBA 5EKIA 2EVBA 2F1MA 1JB7A 2KHIA 4K6LA 1X3FA 1PTOB 2PZTA 2X6LA 1UE5A 2K5QA 4DNRB 4ID6A 4BY1H 2JJQA 4G7OC 1WD0A 1TKWB 3RD4A 2RF4A 2SNMA 1K8AC 3QIAA 2RA4A 2CKZB 1ENAA 3T1HQ 3NP8A 3L7ZC 1XTDA 4ILWA 1VQFA 1SMXA 2OWOA 3CC4A 4KKUA 4P75A 4WRDA 5EBDA 3TBIB 1GJXA 5M3FH 3QB3A 5JEAH 3PF5A 2QKIC 1H9RA 2A5HA 3VR3A 1QOHA 3HOZH 1IYJB 1V1PA 4R4IA 3GTMH 2R3ZA 2DY8A 3DM1A 5C3EG 1M8AA 4HIOA 1Y8PB 2CWAA 2Q8RE 5ELOA 1E2WA 3GTLH 3STBD 2I46A 4AH6A 2HUGA 1V1PB 3ERQA 2B2UC 2NN6I 3EROA 1V1QA 4AQYL 2B63G 1G8ZD 3E9IA 3PSIA 1GHKA 2D9UA 5J1ZA 4R8IA 4F87A 4NXNL 4A93B 1G91A 3IKJA 5KGUA 1JE4A 3HKZG 3QOJA 1JWMD 5TSSA 3IL8A 4RWSC 2A73B 1IHZA 3SR1A 1D5XC 5I6WA 4CHTB 5IP7G 3HOVH 4RAUC 3TN2A 1BKBA 1VQJA 2B8FA 1DGSA 5D3DA 1I4HA 5FLXE 1VQGA 3CCRA 2HIVA 1HH2P 1Y1WB 4DAVA 1HJPA 1P8LA 1QILA 1KAWA 1E7ZA 4GKKQ 1STHA 3D3RA 2EOTA 1ESFA 1PZJD 2R7ZB 5KNDA 3NWTA 1TQOA 4IQZA 1EUJA 1QUQA 2I5HA 1K3BC 1CA5A 1JWUD 3I3CA 3I7FA 4LF6L 1SNDA 5C44H 3PUWA 4I65A 2H4OA 2NB0A 1AH9A 4UP9A 1VQCA 1T9HA 1Q7YC 2HDMA 1YI2A 1WTOA 5T1IA 1Q12A 4IFDJ 4A3IH 3GTOB 4HJ5A 2A19A 1HNXQ 1B3AA 2SNSA 1KQSA 2JA9A 4DPGA 3F8TA 4JI8L 1AE2A 1KAAA 3D4DA 1SYEA 4NP5A 3UE0A 4DUZL 4Y7NH 2KENA 1I4QA 3UDXA 4MTNA 4CKBA 1F9SA 4JBKA 1HTPA 4KHPL 2OTLA 3V05A 4DK6C 3K5LA 3CF5A 2KVMA 4POFA 2AUKA 3O13A 4XYQA 1QNKA 3D6WA 5J39A 2JA7G 3K7AB 3EBEA 1Y1WG 1TWAB 4X62L 3A74A 2WKCA 2DNEA 1TS3A 4WJWA 5M3FB 1K28A 1FGUA 1K83B 1TS2A 1IYVA 4PMCA 4GLAC 4LUZA 4N9TA 3HOUH 3HOZB 2YU9B 2B2VA 2PPBC 3A0JA 2NZ1D 4GOPB 1YNJD 1PV4A 1EFID 1JQYD 3KYHC 1V43A 5IGGA 3GTKB 2R61A 3SVMA 4YWKA 1TT2A 2LMCB 2WV6D 4FF3A 2IT1A 3I4MB 1UWVA 3Q6SA 2WAQG 3MFGA 3I4MH 2QGQA 2B63B 4C2MB 1WTVA 2H5XA 5CC4A 2E2IB 3KFUA 3KF8B 4IUVA 4A3LG 2KOLA 2HQEA 3I4OA 1BR9A 3HP3A 1O7YA 3WOEA 4LF5Q 1RCVD 3PV0A 2VL6A 3E9HA 1PTOF 4KD3A 1KXLA 1Q1EA 2HIXA 3FKIH 5CV9A 4NKLA 2MO1A 1NBWA 2RKSA 5C3XA 1LO5D 1WTWA 3I55A 3IAYA 3P20A 1QVCA 2CFMA 2ZT9C 1SEBD 3ICEA 3H6MA 1SNOA 2SEBD 4R4TA 3SXHA 1O80A 3FDTA 5FOBB 3VA5A 2R92B 2Z4HA 2K5DA 1BVSA 5LMNQ 3M7NA 5CV4A 5C4ZA 1X3EA 2G5DA 5K5PA 2UUCQ 1J8IA 2UUAQ 4RCOA 2GA4B 1O7IA 1AW7A 5AJ3L 1YITA 4C3JG 4B3SQ 1L1OB 2LS01 4AIMA 3GQBA 3KBGA 1JWSD 2K04A 2PQAA 4BA1I 5C4XH 4O0AA 5IYDH 4QF4A 4XIGS 1I5FA 2QF7A 1B4OA 1KHIA 1LM0A 1B2TA 1JR0D 4YHHL 1F2LA 3E3XA 3EQLC 1LT4D 3K7UC 3MHBA 3LGJA 2UXDQ 3HOYH 3X3MA 4X66L 4HJ7A 2E75C 3VR5A 1J5EL 3M3YH 3GTOH 1EEFD 2EJFC 4P2CB 4KY5A 4UP8A 5EQ0A 2ZXRA 2EDGA 2B39A 3MFYA 2AQ1B 3QWNA 2RCNA 1NY4A 4DV7L 2K32A 1DONA 5A35A 1DZ1A 3OTOQ 2XRSD 1PRTB 2ZXOA 3M4YA 4ULLA 4DA2A 2V1CC 3PF4A 4IO9A 3HZXA 2IY5B 5EBCA 3R3OA 5KNCA 1C7YA 3A5ZB 1UNSA 4ZUJA 2VUMB 4FXGC 3K0XA 1HQMC 1KABA 2HQLA 2XRQD 1KIXA 4KK7A 1L0WA 2PQEA 2MUYA 1CSQA 4A3MG 4A3CH 2C9OA 2B3GA 1V9PA 4JW0A 5M5WB 4X3TA 1SSOA 5C6AA 2CH4A 2EQSA 2QEXA 3MEHA 3T16A 4JVZA 1NJIC 4DN4M 2FINB 1A3VA 2NVXH 2DUDA 3NK9A 1MKHA 2JA5H 1S4ZA 1ASZA 5FLXc 2JA5B 3NQTA 2FFKB 1RTOA 4N9PA 4DU9A 2R7DA 2NVYB 3F1ZA 4L5RC 4K8JA 3H3VI 2L5TA 3CW2C 4X66Q 1DJRD 2H1EA 1Q86C 2RHQB 4XTCS 1IW7D 2AUJD 4TVAB 5AJ3Q 2SDFA 2HCIA 1H9KA 2FMMA 5HY6A 4UP7A 3DWAA 4A3EB 4OWWB 3FKIB 5DLQE 3R2TA 3SK4A 4DR2L 1A15A 1IKLA 4GNXA 2CCZA 1VQAA 1PXUA 4DR3Q 1CTMA 3CU7A 4X3UA 1C48A 2O5JC 1K9MC 3S14B 1EY5A 4PV1C 1T5EA 1NCVA 1CK1A 4A3GB 3EN2A 3J81i 4A3GH 2KCTA 3W2DA 3E0JA 1B8AA 3A7AB 2AWOA 2F0MA 3K5MA 1A3TA 4A3DG 1HFNA 1BCPF 1W6KA 5IODA 4Z9CB 1XMOL 2BOSA 3D4RA 2A69D 2K4KA 1IBMQ 3MTSA 4FYDA 3GTLB 4S3SA 3JAMc 4BWGB 3BYYB 3E5SA 2A8VA 3C1EA 1B3QA 4KD4A 1Q1BA 1HZAA 2XNAC 4BBRH 4PZ6A 1ET9A 5IP9G 1WD1A 2NWGA 1EY8A 1PTOH 3CCMA 3V96A 2F0JA 4YCWA 4IFDG 3EFXD 1HPCA 4A4IA 1SYGA 1YJ9A 3CXCA 2ZJRA 5DEHA 1WVLA 1J9OA 4BBSH 2EYPA 1FNWA 1N9WA 3SK8A 3J80c 3HS0C 2Z6BA 1QJOA 3FVQA 5COYA 4OONA 2ZTCA 4K5WA 3RZDB 2Z6KA 3HOXH 1T5XD 1QWYA 4GNXB 1A62A 5M9OA 3NENA 1QNUA 1LT6D 2F3IA 5JPMC 2ENBA 3Q22A 2VB2X 1CSPA 1S3OA 1P16A 3OHXC 1RHPA 1MJCA 1HA5A 2DGYA 1A3UA 4JI2Q 2LFNA 1LTTD 3OIPA 4A3MH 3HG9A 3IRBA 2LXKA 3M4OB 2L12A 5IGFA 3RN2A 3M4OH 3AU7A 2PNRC 2PQAB 3I90A 4RGNA 4KHPQ 1VQBA 2Z6KC 1EY9A 1K0RA 3QR8A 4QL5A 2DJGC 5J3BA 4OX9L 3I2ZA 2ID0A 5J22A 1BNZA 1YIJA 1EWIA 1FGBD 2F0NA 4L6TB 5ELNA 2RDHA 4HJAA 1QG7A 1YHAA 4DK0A 2L15A 1E2VA 4RKBA 2Q8TA 1QVFA 1K8GA 1KTKA 1X55A 3RLFA 1HCZA 4NW2A 3URYA 4BBSG 3RUZA 3K57A 1SYFA 3NXWA 1CUKA 1HR0W 1N34L 1RF2D 5H1SE 1D1IA 2Z9HA 3S1RB 3GTGH 4MHEA 2A68C 2MGSA 1JJCB 4EVOA 2AQ3B 4XXEA 3KLSA 3PQIA 1SJHD 1ILPA 4DV4L 2K5NA 4DUZQ 2WP8J 3NPPA 4A3KH 1MHWC 4JI3L 1VCIA 5LL6X 3TZUA 4TQUS 4LF8Q 4RGOS 4R4CA 3VYSA 1WTRA 4NB3A 2F3WA 1SNPA 4IOAA 2JA6G 2JEBI 2VQFL 4A3DH 2N78A 1E0BA 1V8QA 1PH7A 3GTKH 1Z47A 1EIYB 2NBFA 5M5YH 5IYBG 1JORA 4DV0Q 1L1OC 4OL7A 2N8NA 1TWCB 5GQOA 5EKKA 2MJ8A 4PZ7A 3S1MB 1Y8OB 2NYZD 4XDXA 4B9XA 1N36Q 3FEWX 1NSNS 1FNVA 4G57A 1WFQA 3K81C 5C0XH 1VQ7A 2CH4W 2TMPA 3CAMA 5E4XA 4ZAIA 1IYUA 2NN6G 3TS2A 3PUXA 3CC2A 5BN4A 4IFDH 4ME5A 1AZQA 1WCMH 2MO0A 4DR4Q 2PO4A 4HSVA 3ND9A 4HMIA 4DR7Q 1X65A 2IHFA 3K7AH 4JPBW 5A2QL 4LFBL 1PTOD 5M3FG 3GO5A 1TS5A 1K83H 3NTHA 1DCZA 3GTPH 1UUPA 2D0PA 5C5LA 3S1QH 4FF1A 2OCEA 3S1QB 1ZEQX 3HOWG 2B2UA 4OIJA 4O42A 1KNAA 1EOVA 1EQQA 2HD3A 4ABNA 2R7ZH 1LT5D 1PH8A 2L11A 2K50A 3MC0B 2YV5A 2O4XA 2I07B 1XX8A 1SBBB 4A3MB 1ASYA 4OO1H 3PUZA 4IUNA 2WFWA 3S15B 2PZUA 1HNWQ 2E2IH 1SMYC 1S5FD 5IE8A 1CFMA 3HOYB 1WOCA 2DN8A 5IY0A 3PMFA 4KY6A 3CHBD 1WYDA 5JJIA 2Q2TA 3M85A 4LFCL 3VR2A 2B2WA 3I72A 3A55A 5I9PA 1EQRA 1XNQQ 2E76C 4A3BB 1U4MA 5NUCA 2R92H 3MXUA 1ML0D 4A76A 2K75A 3PUYA 2Q8IB 2F0WA 2A68D 4IUTA 4F88A 1IL8A 1N33Q 2SOBA 4I7ZC 3PO3B 5C4JH 2UXDL 4IZ8A 5GAHC 5LHY1 1C0AA 1B9MA 4EQ5A 3VYTA 1L2FA 1MD2D 4L5TA 4CGYB 1XJVA 4C3JH 4QUCA 2B29A 4Q0FA 5JEAJ 4IALA 4C3HB 3H15A 4QB4A 2OXPA 1G2SA 4C3IH 1I6HH 2N49A 4BY7B 1JCKB 4FF2A 2VS1A 3VDYA 3V2TA 3I4MG 2CVRA 3G4SA 3H3VC 3C2PA 2BA1A 4AYBG 4JYAL 4PMBA 5ELDA 3WOFA 3OOCA 2RDGA 1STGA 4H13C 5IT9E 2PZWA 1ICFB 2F0PA 2PMZE 3H94A 4DV7Q 1WTXA 2RHSB 2PYKA 4QJFA 2F0SA 4MZ9A 4BXXG 1Y1VH 3BYTB 2IL8A 1C9OA 1Y1VB 2OF1A 4YCVA 1DOKA 1XMQQ 1G51A 2F0IA 5EKLA 2CQOA 1GUTA 1VQ5A 1WI5A 1VQMA 2JA8G 3BDLA 2N3SA 2A6ED 2J7ZA 1VQOA 3LWEA 1PH3A 2KCMA 3HOUB 4HIKA 2Z1CA 3HOUG 2B2TA 3VR4A 4KN7C 1C8CA 5C44G 4BS9A 5GROA 1M1KC 2VY3A 4OX9Q 3CRLC 2QEJC 5ELEA 2BE5C 2WB1B 5ELCA 2L1BA 3CPWA 3NUCA 1VQ9A 5E1FA 1B9NA 1BCPB 2YTXA 4C2MH 3AYHB 1V1OA 2QW7A 1QZHA 4NXML 2AMCB 2OEOA 1SN8A 2E2DC 2BCOA
chains in the Genus database with same CATH topology
4IO9A 2IY5B 2VW9A 1C7YA 1YHQA 3A5ZB 3RNUA 3KOJA 2HHHL 2K52A 3HFZB 3BZKA 4LF7L 3K0XA 4DV6L 4A3IG 4B3MQ 2HQLA 1KIXA 1SLJA 3KF6A 1GM5A 1L0WA 1IBKL 3W1GA 3RN5A 3S2HH 1CSQA 4BY1G 4A3MG 4A3CH 3U4ZA 2B3GA 3KJOA 2AHOB 1V9PA 3FKIG 3GDEA 3CC7A 4LFBQ 2IX1A 1Z9FA 4L5QA 4DR5Q 4LUVA 2UU9Q 5JJLA 5LMNW 2UXCQ 1PYSB 2EQSA 1WJJA 2FXQA 3BJUA 3OTOL 2QEXA 5HGQA 3CCUA 1RL2A 1U5KA 3K8AA 4J15A 4EX5A 1NJIC 2OQKA 4BA2I 4BY7H 4GN3B 2NVXH 1NMFA 4DV1Q 3FP9A 3TEHB 2DUDA 3UDFA 1G6PA 1MKHA 2ZM6L 2JA5H 2ALYB 4NPSA 3PF4A 4DR2Q 1NTGA 4DUYQ 4RMFA 1ASZA 2F4VQ 3PUVA 5FLXc 2K14A 2E2HH 4DR4L 2I5LX 2Z0SA 3RZDH 1A8VA 1GVPA 4KLKA 3CQZH 1HR0Q 1VQPA 2R7DA 3I4NG 3F1ZA 4L5RC 1HNXL 2BA0A 3ULLA 3M9BA 4KI0A 4LF9Q 3H3VI 3CW2C 4X66Q 4B3RQ 4K0KQ 1PYBA 4JI5Q 4DV2Q 2R93G 4A3FH 1X54A 5IWAQ 1I3QH 1BBWA 2RHQB 4XTCS 1Q86C 1GO3E 2VQEL 4A75A 4LNQA 3PO3H 4TVAB 5AJ3Q 4LFAQ 4B3RL 4K0KL 3CMAA 2EXDA 4UP7A 5HY6A 4X65Q 1XMQL 3S16H 1HR0L 5C0XG 4JI7L 4OWWB 1CKOA 3F2DA 5DLQE 4JI1L 4P74A 2BH2A 4DR2L 4GNXA 4DV3Q 2CCZA 2ASBA 1VQAA 4GOPA 4DR3Q 5C0XJ 1E24A 4JBWA 4B3TQ 1OXTA 3Q8DA 2XTIA 1OXXK 1K9MC 4A3LH 1GKHA 3T1YQ 5C0XI 2AWNA 1VQDA 3E0EA 1XNQL 3NEMA 2YTVA 3CCJA 3EN2A 4RG1A 3J81i 1W3SA 4JI3Q 1N32L 4A3GH 4HIMA 2UXBQ 4DV0L 4HJ8A 4X6AH 2KCTA 5JEAG 3K80C 2C35B 4JI2L 1L1OA 3PO3G 1B8AA 2AWOA 3FHWA 4A3DG 1XPOA 1PH2A 1X9NA 1Y14B 1XMOL 1OXVA 1YJWA 2IX0A 4POGA 4DV3L 4IOCA 3TRZA 5IP7H 5C4XG 1VS0A 4JI1Q 2K4KA 3OW2A 1YJNA 4DR6L 1H95A 4GKJL 1IBMQ 4BXXH 3ULJA 4X64Q 1SE8A 4GLVB 3I56A 1Q82C 4JBMA 2K5HA 1FJGQ 3JAMc 3AFPA 1XMOQ 4DNIA 3S1RH 1UE6A 2IHEA 4UPAA 3HOXG 3BZCA 2MQHA 2GVBA 2E2JH 2A8VA 3ER0A 5GAGC 1XNRL 1Q1BA 3KF6B 4GKKL 4WJ3M 1HZAA 5BR8L 1N34Q 4BBRH 4PZ6A 5IP9G 2VZAA 2UXBL 1N32Q 4LF6Q 3RZOH 3TREA 3CCMA 2EIFA 1YEZA 3L2PA 4YCWA 1VQ8A 4IFDG 4JCVE 3NELA 4R1JA 3PIOA 4HIDA 4WJ4A 1YBYA 4A4IA 1YJ9A 5GAEC 4A93H 3CXCA 2ZJRA 3ULPA 4DAYB 5K36G 3ZJYC 4UY8C 3OYYA 4APVA 2BH8A 1XPUA 5IYCH 4BBSH 2OQ0A 1N9WA 3RLOA 2UUBL 2JA6H 3W5OA 3J80c 3J7A5 3UDIA 1TWFH 1VQIA 4GS3A 4OONA 3JAMi 1KC8C 4IPDA 2ZTCA 4JOIC 3S1NH 2Z6KA 1UE7A 4OO1G 1FJGL 3HOXH 1UEBA 4GNXB 1A62A 5IYBH 5FLMG 4MNOA 1LYLA 3NENA 1KRTA 4JBJA 3PO2G 1TXYA 1YHBA 2F3IA 4BBRG 1N33L 1S72A 2PI2A 3TS0A 1BBUA 2LXJA 1JB7A 4A93G 3T1YL 1CSPA 4FDBA 1S3OA 1P16A 3HOWH 2JQOA 2KHIA 4AYBE 3S1MH 1X3FA 2NZOA 1MJCA 1G291 2DGYA 1FL0A 1Q81C 4JG2A 1UE5A 3DLLA 1WCMG 1X3GA 3KJPA 4JI2Q 4A3MH 4BY1H 2JJQA 3IRBA 2LXKA 3J80i 3RN2A 1N8RC 2RF4A 2UUBQ 3J7ZC 3M4OH 1K8AC 2PQAB 1XNRQ 4KHPQ 1SROA 2CKZB 5FJ8G 1VQBA 2Z6KC 1K0RA 1PA6A 3T1HQ 4IFDI 2KHJA 3CPFA 1I50H 4QL5A 3PO2H 5LMUQ 5J3BA 4OX9L 3D31A 3L7ZC 1XTDA 3I2ZA 1VQFA 1SMXA 2JA7H 2OWOA 2ID0A 3CC4A 4P75A 3HKZE 1YIJA 1EWIA 4X64L 3JC66 5ELNA 5M3FH 4HJAA 3PF5A 1IBKQ 1YHAA 2L15A 5IT9c 3CCEA 1JE5A 3GTPH 3A5UA 1AE3A 1QVFA 1K8GA 4HJ9A 3HOZH 1X55A 1QVGA 3RLFA 1IYJB 1OXUA 1UE1A 4R4IA 4LF8L 2QA4A 3GTMH 5IYCG 4BBSG 5C3EG 3NBHB 4R4QA 4DR7L 1CUKA 4LUOA 1HR0W 3H3VH 1Q46A 4HIOA 1R9TH 1N34L 4DV4Q 3KDFA 1NE3A 5H1SE 1VQLA 2CWAA 5ELOA 4A3JG 1PH5A 3GTLH 2YYZA 5FJ8H 1MJEA 3GTGH 3STBD 1X56A 5EAYA 4BY7G 4DR1L 4ME3A 1JJCB 2A1AA 4LF4Q 4A3BG 4AH6A 2OTJA 1VQ4A 3CCQA 4DV5Q 1A63A 4JV5L 1CKNA 2NN6I 1FVIA 3L0OA 3TQYA 1V1QA 4AQYL 2B63G 4DV4L 3HOZG 2K5NA 3E9IA 3PSIA 2WP8J 4DUZQ 4A3KH 3H0GH 3G48A 1PH1A 4DV6Q 4B3ML 4JI3L 3I4NH 1VCIA 1JMCA 1W2BA 4TQUS 2HHHQ 4NXNL 3RR5A 4LF8Q 3AQQA 4R4CA 1QUQB 2R7FA 1HZCA 2Q2IA 3HKZG 4NB3A 3G6EA 4A3JH 4IOAA 1PH4A 2JA6G 1X6OA 2JEBI 2VQFL 4A3DH 2N78A 1B70B 2YTYA 2JK8A 2MNAA 1I94L 4L5SA 5IP7G 1PFSA 1PH7A 3GTKH 1Z47A 3HOVH 1EIYB 1NMGA 1BKBA 2JA8H 1VQJA 5GADC 4B3TL 1DGSA 5M5YH 4IJLA 1Y1WH 4DR1Q 1VQGA 3CCRA 2HIVA 1A0IA 5IYBG 1HH2P 4LFAL 1HJPA 1P8LA 4P71A 4DV0Q 1KAWA 1TWCH 1L1OC 2N8NA 1VQKA 1E7ZA 5GQOA 4GKKQ 2UUAL 3F2CA 4PZ7A 3G71A 3F2BA 3H0GG 1N36Q 1EUJA 1QUQA 2I5HA 1SRUA 4DR3L 1QZGA 3PGZA 1WFQA 3K81C 1VQ7A 3CAMA 2NZHA 2NN6G 3TS2A 3I7FA 3PUXA 3AFQA 5IYDG 5C44H 4KHZA 1PHJA 1IBML 1E3PA 3CC2A 4LF6L 4IJHA 3PUWA 4YCUA 3S2DH 2R92G 4JI7Q 1WCMH 1E22A 2MO0A 4DR4Q 4DR7Q 1I94Q 1AH9A 2LSSA 1X65A 2XGTA 2IHFA 3K7AH 3U58A 1HZ9A 4UP9A 1VQCA 4JC0A 1S40A 1T9HA 2D0OA 1Q7YC 3T1HL 4C3HH 4R4OA 4LFBL 1VQNA 3HOYG 3WWVA 4LWCA 5M3FG 1YI2A 1Q12A 2K5VA 4IPGA 4IFDJ 4A3GG 3GO5A 4A3IH 4HJ5A 2A19A 4LF5L 1K83H 1HNXQ 2JA5G 3RLNA 2R93H 1KQSA 4DR6Q 3KDFB 5JJKA 1RIPA 2WB1E 2JA9A 1KRSA 2D0PA 3F8TA 4JI8L 1AE2A 4DPGA 1GD7A 1HNZL 1EIFA 3S1QH 4ALPA 2OCEA 3UE0A 4DUZL 2ES2A 3SGIA 3D0FA 4Y7NH 1N36L 1Y1VG 2ZM6Q 2KENA 3J81j 3HOWG 3UDXA 4MTNA 1EOVA 3GD7A 1OXSC 2AKWB 1EQQA 2GVAA 4JBKA 1PH8A 2R7ZH 4JV5Q 4KHPL 4YY3L 2K50A 2OTLA 2YV5A 1VQ6A 3CCSA 1OTCA 2KBNA 4DK6C 2Y0SG 1ASYA 4JYAQ 3MEFA 2UU9L 1JT8A 3CF5A 4POFA 3CMEA 3UE1A 3PUZA 2F52A 2WFWA 1B7YB 3HKSA 2ZTDA 3S17H 1HNWQ 4YWMA 4OWTB 2E2IH 2JA7G 2Y0SE 1TWAH 3GTJH 5IE8A 2NVTH 3B6YA 3BU2A 3EBEA 1Y1WG 1IBLL 4DAMA 4X62L 1HZBA 3A74A 4JI4Q 4GLXA 2VNUD 1K73C 2E5LQ 3AEVA 1WOCA 1LUZA 1FGUA 5IY0A 1HNZQ 4GLAC 4LUZA 3CCLA 1JJGA 1MIUA 1WYDA 4P73A 5JJIA 3HOUH 2Q2TA 5M5WH 3M85A 4LFCL 1IBLQ 2VQEQ 3A0JA 3GTQH 4GOPB 5IWAL 1YVCA 4DV1L 1PV4A 4LF9L 3KYHC 4IPHA 1V43A 2ZTEA 3ERSX 5C3EH 3PCOB 4YHHQ 1EQRA 4YWKA 1XNQQ 2JE6I 1VQEA 3DM3A 2IT1A 1UWVA 3KLWA 1KD1C 1M90C 2WAQE 2WAQG 2R92H 1PH9A 3I4MH 2QGQA 3EIVA 4DKAC 2ATWA 4A3EG 4LFCQ 3HOVG 3S15H 4A76A 1PVOA 3PIPA 1EFWA 2K75A 2H5XA 3PUYA 4Y52H 3CD6A 4GKJQ 3KFUA 3KF8B 4GOPC 5BR8Q 2PI2E 2E5LL 2VUMH 4X65L 1YZ6A 3W1BA 5FLMH 4JI0Q 3M4QA 4A3LG 3I4OA 4QY7A 1N33Q 3UDGA 2MFIA 2VQFQ 5C4JH 2UXDL 1U0LA 4B3SL 4LF5Q 2HT1A 2D62A 5GAHC 3PV0A 1C0AA 4NXMQ 4EQ5A 1HNWL 2VL6A 3E9HA 1L2FA 4L5TA 1KXLA 2YU9H 1Q1EA 2HIXA 3FKIH 4P72A 1XJVA 3U50C 4NXNQ 4C3JH 1J6QA 1NBWA 2B29A 2MO1A 4GN5A 1SFOH 4JI6L 5JEAJ 4JI0L 5LMNL 1IL2A 3I55A 5M3MG 1QVCA 2CFMA 4PG3A 4YY3Q 3H15A 1PH6A 3ICEA 5M3MH 3U4VA 4C3IH 4R4TA 4A3BH 1I6HH 2N49A 3CCVA 2VS1A 3VDYA 4A3KG 3I4MG 2VUMG 4OWXB 3G4SA 2B63H 2UUCL 1BVSA 2BA1A 5LMNQ 2NVQH 4AYBG 4JI6Q 1LTLA 1TWGH 3M7NA 2GN5A 4JYAL 2R6GA 1XPRA 1X3EA 2UUCQ 2UUAQ 1J5EQ 2NVYH 3J81c 1O7IA 1D8LA 5AJ3L 1YITA 2PMZE 4DV7Q 4LW1A 4B3SQ 1YNXA 1L1OB 2WB1G 2RHSB 4DV5L 4PZ8A 2CWPA 4DV2L 4OO1I 4QJFA 4MZ9A 1E1TA 4BXXG 4AIMA 1Y1VH 1SR3A 2PNHA 1C9OA 2PQAA 4BA1I 4IPCA 5C4XH 5IYDH 4O0AA 4JI8Q 4XIGS 2ZJPA 4YCVA 1I5FA 3M4PA 1XMQQ 1KHIA 4A3EH 1LM0A 2F4VL 4OXPA 1Q8KA 1G51A 4YHHL 4PMWA 2JEAI 2CQOA 2Q2HA 5E7NA 1VQ5A 1WI5A 1VQMA 3K7UC 2JA8G 1KL9A 3LGJA 2UXDQ 4JI5L 3HOYH 4QIWE 1IZ6A 4X66L 2N3SA 4H02A 4HJ7A 2Q2UA 3M3YH 1J5EL 2I5MX 4JOIA 1VQOA 3GTOH 3S14H 3STBC 4A3FG 4GN4B 1PH3A 1IXRA 2KCMA 4HIKA 4UP8A 1TWHH 3HOUG 4O2DA 4A3CG 2E8GA 5IP9H 4DUYL 1JJ2A 1CKMA 5C44G 2R7ZG 4AQYQ 2RCNA 1VQHA 1NY4A 4DK3C 4YWLA 2ZJQA 5GROA 4DV7L 4GNXC 1M1KC 2VY3A 4OX9Q 5LMUL 2I0QA 1K3RA 4QGUA 4LF4L 1E1OA 3MXNB 3OTOQ 2UXCL 3CPWA 3CP0A 4LF7Q 4QQBX 1VQ9A 4JI4L 4DR5L 4X62Q 1D7QA 1CKNB 2YTXA 4C2MH 3AYHB 1QZHA 4NXML 2AMCB 2V1CC 5M5XH 1SN8A 3S24A 1EYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 A;  2IY5 B;  2VW9 A;  1C7Y A;  1YHQ A;  3A5Z B;  3RNU A;  3KOJ A;  2HHH L;  2K52 A;  3HFZ B;  3BZK A;  4LF7 L;  3K0X A;  4DV6 L;  4A3I G;  4B3M Q;  2HQL A;  1KIX A;  1SLJ A;  3KF6 A;  1GM5 A;  1L0W A;  1IBK L;  3W1G A;  3RN5 A;  3S2H H;  1CSQ A;  4BY1 G;  4A3M G;  4A3C H;  3U4Z A;  2B3G A;  3KJO A;  2AHO B;  1V9P A;  3FKI G;  3GDE A;  3CC7 A;  4LFB Q;  2IX1 A;  1Z9F A;  4L5Q A;  4DR5 Q;  4LUV A;  2UU9 Q;  5JJL A;  5LMN W;  2UXC Q;  1PYS B;  2EQS A;  1WJJ A;  2FXQ A;  3BJU A;  3OTO L;  2QEX A;  5HGQ A;  3CCU A;  1RL2 A;  1U5K A;  3K8A A;  4J15 A;  4EX5 A;  1NJI C;  2OQK A;  4BA2 I;  4BY7 H;  4GN3 B;  2NVX H;  1NMF A;  4DV1 Q;  3FP9 A;  3TEH B;  2DUD A;  3UDF A;  1G6P A;  1MKH A;  2ZM6 L;  2JA5 H;  2ALY B;  4NPS A;  3PF4 A;  4DR2 Q;  1NTG A;  4DUY Q;  4RMF A;  1ASZ A;  2F4V Q;  3PUV A;  5FLX c;  2K14 A;  2E2H H;  4DR4 L;  2I5L X;  2Z0S A;  3RZD H;  1A8V A;  1GVP A;  4KLK A;  3CQZ H;  1HR0 Q;  1VQP A;  2R7D A;  3I4N G;  3F1Z A;  4L5R C;  1HNX L;  2BA0 A;  3ULL A;  3M9B A;  4KI0 A;  4LF9 Q;  3H3V I;  3CW2 C;  4X66 Q;  4B3R Q;  4K0K Q;  1PYB A;  4JI5 Q;  4DV2 Q;  2R93 G;  4A3F H;  1X54 A;  5IWA Q;  1I3Q H;  1BBW A;  2RHQ B;  4XTC S;  1Q86 C;  1GO3 E;  2VQE L;  4A75 A;  4LNQ A;  3PO3 H;  4TVA B;  5AJ3 Q;  4LFA Q;  4B3R L;  4K0K L;  3CMA A;  2EXD A;  4UP7 A;  5HY6 A;  4X65 Q;  1XMQ L;  3S16 H;  1HR0 L;  5C0X G;  4JI7 L;  4OWW B;  1CKO A;  3F2D A;  5DLQ E;  4JI1 L;  4P74 A;  2BH2 A;  4DR2 L;  4GNX A;  4DV3 Q;  2CCZ A;  2ASB A;  1VQA A;  4GOP A;  4DR3 Q;  5C0X J;  1E24 A;  4JBW A;  4B3T Q;  1OXT A;  3Q8D A;  2XTI A;  1OXX K;  1K9M C;  4A3L H;  1GKH A;  3T1Y Q;  5C0X I;  2AWN A;  1VQD A;  3E0E A;  1XNQ L;  3NEM A;  2YTV A;  3CCJ A;  3EN2 A;  4RG1 A;  3J81 i;  1W3S A;  4JI3 Q;  1N32 L;  4A3G H;  4HIM A;  2UXB Q;  4DV0 L;  4HJ8 A;  4X6A H;  2KCT A;  5JEA G;  3K80 C;  2C35 B;  4JI2 L;  1L1O A;  3PO3 G;  1B8A A;  2AWO A;  3FHW A;  4A3D G;  1XPO A;  1PH2 A;  1X9N A;  1Y14 B;  1XMO L;  1OXV A;  1YJW A;  2IX0 A;  4POG A;  4DV3 L;  4IOC A;  3TRZ A;  5IP7 H;  5C4X G;  1VS0 A;  4JI1 Q;  2K4K A;  3OW2 A;  1YJN A;  4DR6 L;  1H95 A;  4GKJ L;  1IBM Q;  4BXX H;  3ULJ A;  4X64 Q;  1SE8 A;  4GLV B;  3I56 A;  1Q82 C;  4JBM A;  2K5H A;  1FJG Q;  3JAM c;  3AFP A;  1XMO Q;  4DNI A;  3S1R H;  1UE6 A;  2IHE A;  4UPA A;  3HOX G;  3BZC A;  2MQH A;  2GVB A;  2E2J H;  2A8V A;  3ER0 A;  5GAG C;  1XNR L;  1Q1B A;  3KF6 B;  4GKK L;  4WJ3 M;  1HZA A;  5BR8 L;  1N34 Q;  4BBR H;  4PZ6 A;  5IP9 G;  2VZA A;  2UXB L;  1N32 Q;  4LF6 Q;  3RZO H;  3TRE A;  3CCM A;  2EIF A;  1YEZ A;  3L2P A;  4YCW A;  1VQ8 A;  4IFD G;  4JCV E;  3NEL A;  4R1J A;  3PIO A;  4HID A;  4WJ4 A;  1YBY A;  4A4I A;  1YJ9 A;  5GAE C;  4A93 H;  3CXC A;  2ZJR A;  3ULP A;  4DAY B;  5K36 G;  3ZJY C;  4UY8 C;  3OYY A;  4APV A;  2BH8 A;  1XPU A;  5IYC H;  4BBS H;  2OQ0 A;  1N9W A;  3RLO A;  2UUB L;  2JA6 H;  3W5O A;  3J80 c;  3J7A 5;  3UDI A;  1TWF H;  1VQI A;  4GS3 A;  4OON A;  3JAM i;  1KC8 C;  4IPD A;  2ZTC A;  4JOI C;  3S1N H;  2Z6K A;  1UE7 A;  4OO1 G;  1FJG L;  3HOX H;  1UEB A;  4GNX B;  1A62 A;  5IYB H;  5FLM G;  4MNO A;  1LYL A;  3NEN A;  1KRT A;  4JBJ A;  3PO2 G;  1TXY A;  1YHB A;  2F3I A;  4BBR G;  1N33 L;  1S72 A;  2PI2 A;  3TS0 A;  1BBU A;  2LXJ A;  1JB7 A;  4A93 G;  3T1Y L;  1CSP A;  4FDB A;  1S3O A;  1P16 A;  3HOW H;  2JQO A;  2KHI A;  4AYB E;  3S1M H;  1X3F A;  2NZO A;  1MJC A;  1G29 1;  2DGY A;  1FL0 A;  1Q81 C;  4JG2 A;  1UE5 A;  3DLL A;  1WCM G;  1X3G A;  3KJP A;  4JI2 Q;  4A3M H;  4BY1 H;  2JJQ A;  3IRB A;  2LXK A;  3J80 i;  3RN2 A;  1N8R C;  2RF4 A;  2UUB Q;  3J7Z C;  3M4O H;  1K8A C;  2PQA B;  1XNR Q;  4KHP Q;  1SRO A;  2CKZ B;  5FJ8 G;  1VQB A;  2Z6K C;  1K0R A;  1PA6 A;  3T1H Q;  4IFD I;  2KHJ A;  3CPF A;  1I50 H;  4QL5 A;  3PO2 H;  5LMU Q;  5J3B A;  4OX9 L;  3D31 A;  3L7Z C;  1XTD A;  3I2Z A;  1VQF A;  1SMX A;  2JA7 H;  2OWO A;  2ID0 A;  3CC4 A;  4P75 A;  3HKZ E;  1YIJ A;  1EWI A;  4X64 L;  3JC6 6;  5ELN A;  5M3F H;  4HJA A;  3PF5 A;  1IBK Q;  1YHA A;  2L15 A;  5IT9 c;  3CCE A;  1JE5 A;  3GTP H;  3A5U A;  1AE3 A;  1QVF A;  1K8G A;  4HJ9 A;  3HOZ H;  1X55 A;  1QVG A;  3RLF A;  1IYJ B;  1OXU A;  1UE1 A;  4R4I A;  4LF8 L;  2QA4 A;  3GTM H;  5IYC G;  4BBS G;  5C3E G;  3NBH B;  4R4Q A;  4DR7 L;  1CUK A;  4LUO A;  1HR0 W;  3H3V H;  1Q46 A;  4HIO A;  1R9T H;  1N34 L;  4DV4 Q;  3KDF A;  1NE3 A;  5H1S E;  1VQL A;  2CWA A;  5ELO A;  4A3J G;  1PH5 A;  3GTL H;  2YYZ A;  5FJ8 H;  1MJE A;  3GTG H;  3STB D;  1X56 A;  5EAY A;  4BY7 G;  4DR1 L;  4ME3 A;  1JJC B;  2A1A A;  4LF4 Q;  4A3B G;  4AH6 A;  2OTJ A;  1VQ4 A;  3CCQ A;  4DV5 Q;  1A63 A;  4JV5 L;  1CKN A;  2NN6 I;  1FVI A;  3L0O A;  3TQY A;  1V1Q A;  4AQY L;  2B63 G;  4DV4 L;  3HOZ G;  2K5N A;  3E9I A;  3PSI A;  2WP8 J;  4DUZ Q;  4A3K H;  3H0G H;  3G48 A;  1PH1 A;  4DV6 Q;  4B3M L;  4JI3 L;  3I4N H;  1VCI A;  1JMC A;  1W2B A;  4TQU S;  2HHH Q;  4NXN L;  3RR5 A;  4LF8 Q;  3AQQ A;  4R4C A;  1QUQ B;  2R7F A;  1HZC A;  2Q2I A;  3HKZ G;  4NB3 A;  3G6E A;  4A3J H;  4IOA A;  1PH4 A;  2JA6 G;  1X6O A;  2JEB I;  2VQF L;  4A3D H;  2N78 A;  1B70 B;  2YTY A;  2JK8 A;  2MNA A;  1I94 L;  4L5S A;  5IP7 G;  1PFS A;  1PH7 A;  3GTK H;  1Z47 A;  3HOV H;  1EIY B;  1NMG A;  1BKB A;  2JA8 H;  1VQJ A;  5GAD C;  4B3T L;  1DGS A;  5M5Y H;  4IJL A;  1Y1W H;  4DR1 Q;  1VQG A;  3CCR A;  2HIV A;  1A0I A;  5IYB G;  1HH2 P;  4LFA L;  1HJP A;  1P8L A;  4P71 A;  4DV0 Q;  1KAW A;  1TWC H;  1L1O C;  2N8N A;  1VQK A;  1E7Z A;  5GQO A;  4GKK Q;  2UUA L;  3F2C A;  4PZ7 A;  3G71 A;  3F2B A;  3H0G G;  1N36 Q;  1EUJ A;  1QUQ A;  2I5H A;  1SRU A;  4DR3 L;  1QZG A;  3PGZ A;  1WFQ A;  3K81 C;  1VQ7 A;  3CAM A;  2NZH A;  2NN6 G;  3TS2 A;  3I7F A;  3PUX A;  3AFQ A;  5IYD G;  5C44 H;  4KHZ A;  1PHJ A;  1IBM L;  1E3P A;  3CC2 A;  4LF6 L;  4IJH A;  3PUW A;  4YCU A;  3S2D H;  2R92 G;  4JI7 Q;  1WCM H;  1E22 A;  2MO0 A;  4DR4 Q;  4DR7 Q;  1I94 Q;  1AH9 A;  2LSS A;  1X65 A;  2XGT A;  2IHF A;  3K7A H;  3U58 A;  1HZ9 A;  4UP9 A;  1VQC A;  4JC0 A;  1S40 A;  1T9H A;  2D0O A;  1Q7Y C;  3T1H L;  4C3H H;  4R4O A;  4LFB L;  1VQN A;  3HOY G;  3WWV A;  4LWC A;  5M3F G;  1YI2 A;  1Q12 A;  2K5V A;  4IPG A;  4IFD J;  4A3G G;  3GO5 A;  4A3I H;  4HJ5 A;  2A19 A;  4LF5 L;  1K83 H;  1HNX Q;  2JA5 G;  3RLN A;  2R93 H;  1KQS A;  4DR6 Q;  3KDF B;  5JJK A;  1RIP A;  2WB1 E;  2JA9 A;  1KRS A;  2D0P A;  3F8T A;  4JI8 L;  1AE2 A;  4DPG A;  1GD7 A;  1HNZ L;  1EIF A;  3S1Q H;  4ALP A;  2OCE A;  3UE0 A;  4DUZ L;  2ES2 A;  3SGI A;  3D0F A;  4Y7N H;  1N36 L;  1Y1V G;  2ZM6 Q;  2KEN A;  3J81 j;  3HOW G;  3UDX A;  4MTN A;  1EOV A;  3GD7 A;  1OXS C;  2AKW B;  1EQQ A;  2GVA A;  4JBK A;  1PH8 A;  2R7Z H;  4JV5 Q;  4KHP L;  4YY3 L;  2K50 A;  2OTL A;  2YV5 A;  1VQ6 A;  3CCS A;  1OTC A;  2KBN A;  4DK6 C;  2Y0S G;  1ASY A;  4JYA Q;  3MEF A;  2UU9 L;  1JT8 A;  3CF5 A;  4POF A;  3CME A;  3UE1 A;  3PUZ A;  2F52 A;  2WFW A;  1B7Y B;  3HKS A;  2ZTD A;  3S17 H;  1HNW Q;  4YWM A;  4OWT B;  2E2I H;  2JA7 G;  2Y0S E;  1TWA H;  3GTJ H;  5IE8 A;  2NVT H;  3B6Y A;  3BU2 A;  3EBE A;  1Y1W G;  1IBL L;  4DAM A;  4X62 L;  1HZB A;  3A74 A;  4JI4 Q;  4GLX A;  2VNU D;  1K73 C;  2E5L Q;  3AEV A;  1WOC A;  1LUZ A;  1FGU A;  5IY0 A;  1HNZ Q;  4GLA C;  4LUZ A;  3CCL A;  1JJG A;  1MIU A;  1WYD A;  4P73 A;  5JJI A;  3HOU H;  2Q2T A;  5M5W H;  3M85 A;  4LFC L;  1IBL Q;  2VQE Q;  3A0J A;  3GTQ H;  4GOP B;  5IWA L;  1YVC A;  4DV1 L;  1PV4 A;  4LF9 L;  3KYH C;  4IPH A;  1V43 A;  2ZTE A;  3ERS X;  5C3E H;  3PCO B;  4YHH Q;  1EQR A;  4YWK A;  1XNQ Q;  2JE6 I;  1VQE A;  3DM3 A;  2IT1 A;  1UWV A;  3KLW A;  1KD1 C;  1M90 C;  2WAQ E;  2WAQ G;  2R92 H;  1PH9 A;  3I4M H;  2QGQ A;  3EIV A;  4DKA C;  2ATW A;  4A3E G;  4LFC Q;  3HOV G;  3S15 H;  4A76 A;  1PVO A;  3PIP A;  1EFW A;  2K75 A;  2H5X A;  3PUY A;  4Y52 H;  3CD6 A;  4GKJ Q;  3KFU A;  3KF8 B;  4GOP C;  5BR8 Q;  2PI2 E;  2E5L L;  2VUM H;  4X65 L;  1YZ6 A;  3W1B A;  5FLM H;  4JI0 Q;  3M4Q A;  4A3L G;  3I4O A;  4QY7 A;  1N33 Q;  3UDG A;  2MFI A;  2VQF Q;  5C4J H;  2UXD L;  1U0L A;  4B3S L;  4LF5 Q;  2HT1 A;  2D62 A;  5GAH C;  3PV0 A;  1C0A A;  4NXM Q;  4EQ5 A;  1HNW L;  2VL6 A;  3E9H A;  1L2F A;  4L5T A;  1KXL A;  2YU9 H;  1Q1E A;  2HIX A;  3FKI H;  4P72 A;  1XJV A;  3U50 C;  4NXN Q;  4C3J H;  1J6Q A;  1NBW A;  2B29 A;  2MO1 A;  4GN5 A;  1SFO H;  4JI6 L;  5JEA J;  4JI0 L;  5LMN L;  1IL2 A;  3I55 A;  5M3M G;  1QVC A;  2CFM A;  4PG3 A;  4YY3 Q;  3H15 A;  1PH6 A;  3ICE A;  5M3M H;  3U4V A;  4C3I H;  4R4T A;  4A3B H;  1I6H H;  2N49 A;  3CCV A;  2VS1 A;  3VDY A;  4A3K G;  3I4M G;  2VUM G;  4OWX B;  3G4S A;  2B63 H;  2UUC L;  1BVS A;  2BA1 A;  5LMN Q;  2NVQ H;  4AYB G;  4JI6 Q;  1LTL A;  1TWG H;  3M7N A;  2GN5 A;  4JYA L;  2R6G A;  1XPR A;  1X3E A;  2UUC Q;  2UUA Q;  1J5E Q;  2NVY H;  3J81 c;  1O7I A;  1D8L A;  5AJ3 L;  1YIT A;  2PMZ E;  4DV7 Q;  4LW1 A;  4B3S Q;  1YNX A;  1L1O B;  2WB1 G;  2RHS B;  4DV5 L;  4PZ8 A;  2CWP A;  4DV2 L;  4OO1 I;  4QJF A;  4MZ9 A;  1E1T A;  4BXX G;  4AIM A;  1Y1V H;  1SR3 A;  2PNH A;  1C9O A;  2PQA A;  4BA1 I;  4IPC A;  5C4X H;  5IYD H;  4O0A A;  4JI8 Q;  4XIG S;  2ZJP A;  4YCV A;  1I5F A;  3M4P A;  1XMQ Q;  1KHI A;  4A3E H;  1LM0 A;  2F4V L;  4OXP A;  1Q8K A;  1G51 A;  4YHH L;  4PMW A;  2JEA I;  2CQO A;  2Q2H A;  5E7N A;  1VQ5 A;  1WI5 A;  1VQM A;  3K7U C;  2JA8 G;  1KL9 A;  3LGJ A;  2UXD Q;  4JI5 L;  3HOY H;  4QIW E;  1IZ6 A;  4X66 L;  2N3S A;  4H02 A;  4HJ7 A;  2Q2U A;  3M3Y H;  1J5E L;  2I5M X;  4JOI A;  1VQO A;  3GTO H;  3S14 H;  3STB C;  4A3F G;  4GN4 B;  1PH3 A;  1IXR A;  2KCM A;  4HIK A;  4UP8 A;  1TWH H;  3HOU G;  4O2D A;  4A3C G;  2E8G A;  5IP9 H;  4DUY L;  1JJ2 A;  1CKM A;  5C44 G;  2R7Z G;  4AQY Q;  2RCN A;  1VQH A;  1NY4 A;  4DK3 C;  4YWL A;  2ZJQ A;  5GRO A;  4DV7 L;  4GNX C;  1M1K C;  2VY3 A;  4OX9 Q;  5LMU L;  2I0Q A;  1K3R A;  4QGU A;  4LF4 L;  1E1O A;  3MXN B;  3OTO Q;  2UXC L;  3CPW A;  3CP0 A;  4LF7 Q;  4QQB X;  1VQ9 A;  4JI4 L;  4DR5 L;  4X62 Q;  1D7Q A;  1CKN B;  2YTX A;  4C2M H;  3AYH B;  1QZH A;  4NXM L;  2AMC B;  2V1C C;  5M5X H;  1SN8 A;  3S24 A;  1EYG A; 
#chains in the Genus database with same CATH topology
 5E3F A;  5ELB A;  3JAM L;  3KOJ A;  3T4A C;  3QO2 A;  3RNU A;  3HFZ B;  1A6X A;  4EQO A;  3KLS X;  4U68 A;  3HEJ A;  3NBH A;  4XT1 B;  1CHQ D;  4BBR B;  1LLR D;  3U4Z A;  1KDC A;  2N88 A;  3FKI G;  2IX1 A;  4L5Q A;  4LUV A;  1SE4 A;  4F8M A;  4CJ0 B;  3VR6 A;  5LMN W;  1PYS B;  2NN6 H;  1K8M A;  3CCU A;  4J15 A;  2OQK A;  1H9J A;  2VXW A;  3FMC A;  4N8F A;  3VA7 A;  4HMJ A;  3MVV A;  1EY0 A;  4DUY Q;  2F4V Q;  2K14 A;  3RZD H;  1A8V A;  1PFB A;  1A2U A;  3CQZ H;  1EWH A;  3MXN A;  2BA0 A;  3P1H A;  4JI5 Q;  4A3F H;  2RQX A;  4Q5V A;  1I3Q H;  4A75 A;  3PO3 H;  1AEX A;  4LNQ A;  2KHS A;  3RMH A;  3CMA A;  5C4X B;  4I7A A;  2EXD A;  5L37 A;  3K59 A;  1CKO A;  2CHB D;  3A7L A;  4P74 A;  5IGD A;  1ROD A;  2ASB A;  2MPM A;  3ONA B;  4J8Q A;  5C0X J;  1E24 A;  4B3T Q;  1OXT A;  1DOM A;  5CGK A;  2EPB A;  2F03 A;  1SAP A;  4A3L H;  2WKD A;  3E0E A;  1VQD A;  3A54 A;  3NEM A;  4RG1 A;  1PMR A;  2MP1 A;  4DV0 L;  4X6A H;  4XQQ A;  2KCC A;  3K80 C;  1PTO C;  2NTS A;  4DAY A;  2QDL A;  1L1O A;  1TII D;  3FHW A;  3X3N A;  5JVG 3;  1EIG A;  1PH2 A;  1YJW A;  5IP7 H;  4JI1 Q;  3OW2 A;  4GKJ L;  4BXX H;  5M5X B;  3ULJ A;  2CW0 C;  4KN4 C;  3T13 A;  4KKS A;  4C56 C;  1XMO Q;  2RVL A;  2E2J H;  3GV6 A;  4PNY A;  4KTA A;  2KA7 A;  1GOZ A;  5GAG C;  1XNR L;  2E2J B;  3SE0 A;  5BR8 L;  1LTR D;  4RGT A;  1N34 Q;  3G7L A;  1EZ8 A;  4LF6 Q;  5KYI A;  3MZ5 A;  1LAC A;  5D14 A;  2EZV A;  1YEZ A;  3ITP A;  3L2P A;  2EE1 A;  1GUS A;  3NEL A;  4WJ4 A;  3PIO A;  1Z7T A;  4DFA A;  4UY8 C;  3OYY A;  4APV A;  1DM0 B;  1F2Y A;  1STN A;  2F0L A;  4KJO A;  4ZRZ A;  3RLO A;  3BG3 A;  3TME A;  3W5O A;  4HAE A;  3J7A 5;  4GS3 A;  1STY A;  3JAM i;  4JOI C;  4HCE A;  4QMG A;  2LY7 A;  3UI2 A;  2K01 A;  1FJG L;  5C3W A;  1LYL A;  1KRT A;  4BBR G;  4DXG A;  1S72 A;  3TS0 A;  1BBU A;  2LXJ A;  4Y7N B;  4A93 G;  5CV6 A;  1HQR D;  4AYB E;  3S1M H;  2NZO A;  3Q24 A;  1FL0 A;  1WCM G;  1X3G A;  5KEE A;  3CRK C;  1B53 A;  2K6A A;  3J80 i;  1EL0 A;  3TP8 A;  2UUB Q;  3J7Z C;  2PW7 A;  2F0T A;  1SRO A;  5FJ8 G;  4U67 3;  4ZKC B;  1PA6 A;  1VDZ A;  4IFD I;  2KHJ A;  3CPF A;  1ILQ A;  1I50 H;  3PO2 H;  2FMC A;  2F3V A;  3NWS A;  2JA7 H;  1PRT D;  2EY1 A;  4A3K B;  1PZK D;  4JK1 C;  4X64 L;  2JA7 B;  2A6H C;  2HDL A;  5FO9 B;  1WTH A;  1JE5 A;  2KEC A;  3A5U A;  1AE3 A;  5C5M A;  4HJ9 A;  1ICW A;  2BE5 D;  1VF7 A;  3W3A A;  1OXU A;  2QA4 A;  1I3Q B;  3SHL A;  3GTM B;  4ZYS A;  3NBH B;  1EYD A;  4R4Q A;  3TP7 A;  4LUO A;  2WII B;  4KY7 A;  1R9T H;  1VQL A;  1XYI A;  2F4I A;  4UDU C;  1PH5 A;  1IKM A;  3BVZ A;  2YYZ A;  4CJ2 C;  5KIX A;  5EAY A;  4BY7 G;  4DR1 L;  4ME3 A;  2BDN A;  3CCQ A;  4DV5 Q;  1CKN A;  3R2I A;  1FVI A;  3TQY A;  1TR5 A;  1BO0 A;  2EYH A;  3H0G H;  1PH1 A;  4B3M L;  2E74 C;  1STB A;  2HHH Q;  5CV7 A;  3RR5 A;  3AQQ A;  3NE5 B;  1QUQ B;  3GV3 A;  2R7F A;  4AYB B;  4IUP A;  1VF5 C;  1XWE A;  4A3J H;  2F0G A;  2EYJ A;  1PH4 A;  1WCM B;  3MWY W;  1X32 A;  1HFG A;  4R8N A;  2ICE C;  2JK8 A;  2YTY A;  4L5S A;  3HOV B;  1PFS A;  5KRU A;  2JA8 H;  5GAD C;  4B3T L;  4LMQ D;  1Y1W H;  4IJL A;  1A0I A;  1TVX A;  3J7A F;  4LFA L;  1SNQ A;  3NBI A;  4P71 A;  1TWG B;  2TSS A;  1M4V A;  1VQK A;  3HOW B;  3DWQ A;  3F2C A;  3OW7 A;  2K05 A;  3G71 A;  2JP1 A;  2Z4I A;  3T56 B;  1CQF A;  1SRU A;  2PW5 A;  1HXY D;  4DR3 L;  1QZG A;  3KLR A;  5DAU A;  4QIW B;  5IYD G;  5JJZ A;  1IBM L;  4KHZ A;  4NMZ A;  4QCL A;  2L4N A;  4IJH A;  4YCU A;  5C44 B;  2RCF A;  2K5W A;  1I94 Q;  2WAQ B;  2A74 C;  2EYO A;  3U58 A;  1SYC A;  3FPP A;  1SNC A;  1S40 A;  2D0O A;  3T1H L;  1Q8I A;  3TZD A;  4R4O A;  4C3H H;  3H09 A;  5I9O A;  1VQN A;  3HOY G;  4LWC A;  3BZD B;  4IPG A;  5M5Y B;  1PLF A;  3DEP A;  1H9S B;  2XIW A;  4LF5 L;  2JA5 G;  3RLN A;  2R93 H;  2M2L A;  3J81 E;  5JJK A;  2WB1 E;  1LTA D;  4RFB A;  1BUV T;  1BDO A;  2D2C C;  5EGT A;  3SGI A;  1N36 L;  1Y1V G;  2ZM6 Q;  1OXS C;  3PIP 3;  4JV5 Q;  1LT3 D;  2JN4 A;  3HRZ C;  4RH6 A;  3SK5 A;  1VQ6 A;  1B50 A;  1OTC A;  2KBN A;  5I4D A;  4BY1 B;  1NR4 A;  1TY0 A;  4JYA Q;  2UU9 L;  1WTP A;  3UE1 A;  5G3L D;  3IFT A;  1HTL D;  4YWM A;  4OWT B;  2Y0S E;  1TWA H;  2K33 A;  3B6Y A;  3BU2 A;  4FXK C;  1PFM A;  1SMY D;  4GLX A;  4DAP A;  1K73 C;  5IGB A;  1CI3 M;  1CQV A;  2E5L Q;  3AEV A;  1HNZ Q;  4ZUI A;  1K8O A;  1VMP A;  2KUM A;  3CCL A;  1JJG A;  5M5W H;  5IWA L;  1YVC A;  4LF9 L;  1SFO B;  2B2V C;  3ERS X;  1EY7 A;  2ZTE A;  4R9W A;  3R93 A;  5C3E H;  3PCO B;  4QUF A;  1VQE A;  3DM3 A;  4FP5 D;  3TP6 A;  1I6H B;  1KD1 C;  1SE2 A;  3CKI B;  2JYO A;  2WAQ E;  4V19 0;  3NTI A;  1YNN C;  5JVH 3;  1PH9 A;  2ATW A;  1HRJ A;  5FLX L;  3S15 H;  1LAB A;  4B9W A;  3BS1 A;  3CD6 A;  1JOQ A;  3K5O A;  4GOP C;  1UAP A;  2PI2 E;  4GZY C;  3EA6 A;  4X65 L;  4JI0 Q;  2KED A;  3HGB A;  3E6Z X;  2VB3 X;  2MFI A;  3ZYY X;  2VQF Q;  2HT1 A;  1EYC A;  1DYQ A;  4IUU A;  3T53 B;  4NXM Q;  1EWC A;  2EJG C;  1ONL A;  1SNM A;  1W6J A;  2WIN B;  1AN8 A;  3U50 C;  3J80 E;  4JI0 L;  2CQA A;  1B1Z A;  2OT2 A;  1D1K A;  1I4X A;  1ET6 A;  4YY3 Q;  4PG3 A;  4H7B A;  4A3B H;  4TSS A;  3DWP A;  4A3K G;  2VUM G;  4OWX B;  3ND8 A;  1L0Y B;  2UUC L;  5EPL A;  1SXT A;  4EQP A;  3SDZ A;  2NVQ H;  1LTL A;  1TWG H;  5CR3 A;  4IUQ A;  3R8B A;  1EZ6 A;  3S9W A;  1J5E Q;  1EU3 A;  3J81 c;  2M9V A;  4LW1 A;  2WAC A;  5C4J B;  2WB1 G;  2K28 A;  4OO1 I;  2RBM A;  3NTK A;  1KDA A;  5COR A;  3KUP A;  2PNH A;  1NUC A;  2A6H D;  5IGE A;  3M4P A;  4N8X 1;  1JC7 A;  1Q8K A;  2L0C A;  3GTJ B;  3D4W A;  2Q2H A;  5E7N A;  2DNC A;  4RHS A;  2J0T D;  4C3I G;  5M3M B;  4WFN 3;  3M3Y B;  5KYL A;  3SK6 A;  4MN3 A;  4JOI A;  2G9H D;  1HA6 A;  1U9R A;  2R93 B;  2MHV A;  1TWH H;  2E8G A;  5IP9 H;  4DUY L;  4FO2 A;  1JJ2 A;  1VQH A;  2ZJQ A;  2P5Z X;  4GNX C;  5LMU L;  2I0Q A;  1CT1 D;  2XN9 C;  3MA2 B;  5F2D A;  1E1O A;  3MXN B;  2UXC L;  3DEO A;  3CP0 A;  4LF7 Q;  4QQB X;  4DR5 L;  1D7Q A;  4OIK A;  1QCB D;  4B08 A;  3S1N B;  3I70 A;  5FK9 C;  4ZQ3 A;  4PZ8 A;  3QJY A;  5M5X H;  1EYG A;  3OWE B;  5I6Y A;  3L3O C;  1YHQ A;  3KK7 A;  2EYL A;  2HHH L;  2F0F A;  2K52 A;  2M00 A;  2X69 A;  3P75 A;  4DV6 L;  2A6E C;  1SLJ A;  1JOK A;  3IFD A;  3KF6 A;  1GM5 A;  3I8Z A;  3W1G A;  3RN5 A;  1QB5 D;  2Y0S B;  5C4H A;  3GDE A;  4LFB Q;  3C46 A;  1Z9F A;  4DR5 Q;  2QIL A;  4G7Z C;  2K03 A;  1SDF A;  2UXC Q;  3S17 H;  5HGQ A;  1I4G A;  1U5K A;  2XSC A;  3G6J B;  4EX5 A;  3A56 A;  2NVX B;  4BY7 H;  3S17 B;  1S5C D;  4FF4 A;  4GN3 B;  1NMF A;  3FP9 A;  3TEH B;  2Z8L A;  3UDF A;  1G6Z A;  1BCP C;  2E2H B;  1MSG A;  2ALY B;  1TWF B;  1BXT A;  2XWJ B;  3T51 B;  4DR2 Q;  3PUV A;  4F7X A;  2E2H H;  4DR4 L;  2Z0S A;  1GVP A;  4KLK A;  3TP5 A;  1VQP A;  2FJ2 A;  3VYU A;  1HNX L;  3ULL A;  5JOB A;  2R93 G;  1PYB A;  4DV2 Q;  1X54 A;  1BBW A;  4C1N I;  4LFA Q;  2K7V A;  5ISR A;  5EPK A;  1UEA B;  1ZXT A;  4X65 Q;  5C0X G;  4JI7 L;  1PYW D;  3EJI A;  1K0S A;  3F2D A;  2BH2 A;  1HHV A;  2LKV A;  4DV3 Q;  5CV8 A;  4CDF C;  4JBW A;  1EU4 A;  1PRT C;  2XTI A;  1OXX K;  1GKH A;  2B2Y C;  3T1Y Q;  5C0X I;  3VYR A;  3PO2 B;  1EQV A;  2AWN A;  1GUW A;  1B44 D;  2YTV A;  4H44 C;  1HUN A;  3DMU A;  1N32 L;  1JOO A;  4HIM A;  5JEA G;  2F0H A;  4JI2 L;  4HCS A;  3PO3 G;  1XPO A;  4A3F B;  1O78 A;  1PRT F;  1Y14 B;  3OMG A;  5CYU A;  1OXV A;  2IX0 A;  5D3I B;  4DV3 L;  5CV5 A;  1FYC A;  5IGC A;  2F0E A;  5C4X G;  1VS0 A;  1YJN A;  4DR6 L;  3LWU A;  5DNF A;  1PZI D;  1Q82 C;  1SE8 A;  4GLV B;  1II3 A;  1BQQ T;  1KNE A;  2K5H A;  1FJG Q;  3F2U A;  2B2Y A;  1UE6 A;  4UPA A;  1BBX C;  3BZC A;  5CMD A;  2MQH A;  2GVB A;  3TDQ A;  2KJX A;  3ER0 A;  1A2T A;  3KF6 B;  4GKK L;  4WJ3 M;  4M1U B;  1F2Z A;  3S2H B;  2UXB L;  1D6E C;  3D6C A;  1AZP A;  4JCV E;  4R1J A;  4KKT A;  4DF7 A;  1YBY A;  4A93 H;  3ULP A;  5K36 G;  3ZJY C;  1ZYR D;  1XPU A;  3MAQ A;  3L9A X;  5IYC H;  1X3P A;  4FNF A;  2UUB L;  1EOT A;  3H91 A;  3WDN A;  5BN3 A;  1VMC A;  1KC8 C;  4CDD C;  3S1N H;  2FHT A;  1UE7 A;  3MXG A;  1S5E D;  1UEB A;  2EJM A;  3EVQ A;  3C1F A;  3NSW A;  5FLM G;  3PO2 G;  4EGV A;  4MTK A;  1N33 L;  2PI2 A;  3T1Y L;  3HOW H;  4FDB A;  2JQO A;  2DJF C;  1G29 1;  2KCN A;  1R9T B;  1Q81 C;  4JG2 A;  3DLL A;  3KJP A;  1CZW A;  3FPU B;  1D2B A;  1ZYR C;  2PCF B;  1N8R C;  3OSO A;  1LV9 A;  1F9P A;  1XNR Q;  4OGQ C;  1ZKO A;  4CDE C;  5LMU Q;  3D31 A;  3HKZ E;  2IW3 A;  4HR7 B;  2IJ0 A;  3JC6 6;  1HUM A;  1LTS D;  1IBK Q;  5DM7 3;  5CBA E;  5IT9 c;  3CCE A;  4V0B A;  1YNJ C;  2NUC A;  1QVG A;  1UE1 A;  4LF8 L;  3GTQ B;  2F0Q A;  5IYC G;  4K6D A;  4RKL A;  4IN3 A;  2ICI A;  4DR7 L;  3H3V H;  4MIU A;  1Q46 A;  4DV4 Q;  3KDF A;  1NE3 A;  1RDP D;  4A3J G;  1MJE A;  5FJ8 H;  4CBV A;  1CZG A;  1X56 A;  4L8J A;  2A1A A;  4LF4 Q;  4A3B G;  1KDB A;  4K2L A;  2OTJ A;  4K8I A;  2IWH A;  1VQ4 A;  4XQJ A;  1A63 A;  4K5X A;  4JV5 L;  3L0O A;  1NAP A;  3FRP B;  4TKO B;  1RJT A;  3HOZ G;  2L9H A;  3A8J E;  3LX0 A;  3G48 A;  4J1M A;  4DV6 Q;  5EJW A;  3I4N H;  1JMC A;  1W2B A;  3KF8 A;  1FR3 A;  1HZC A;  4LK1 C;  2Q2I A;  3G6E A;  2JA6 B;  4WOR A;  1X6O A;  2RSO A;  2IX3 A;  1B70 B;  2MNA A;  5C3E B;  1I94 L;  2G9D A;  1NMG A;  3SEB A;  2PMZ B;  4DR1 Q;  4HN7 A;  4DK1 A;  3K58 A;  1TWC H;  3K6O A;  2UUA L;  1SYD A;  1MSH A;  3F2B A;  3H0G G;  5FO7 B;  1KLG D;  3H0G B;  1Y69 U;  1EYA A;  1D5Z C;  3PGZ A;  4O1N A;  1EIH A;  2B2T C;  2NZH A;  3A8K E;  3LNN A;  4EQN A;  1MGS A;  3Q0A A;  2QDB A;  4E6I A;  1PHJ A;  3AFQ A;  3S2D B;  5JPN C;  1E3P A;  3NHH A;  3S2D H;  2R92 G;  4JI7 Q;  3I91 A;  1E22 A;  1EY6 A;  1I50 B;  1H9M A;  2LSS A;  2XGT A;  1HZ9 A;  1FD7 D;  4JC0 A;  4KJN A;  1FNU A;  2J4X A;  3WWV A;  1MI2 A;  2K5V A;  4A3G G;  4DGZ A;  3HOX B;  3GTP B;  2ZXP A;  1XXG A;  4DR6 Q;  3KDF B;  4NDX A;  1RIP A;  1KRS A;  3N6R A;  1HNZ L;  3U9S A;  1GD7 A;  1EIF A;  3DHQ A;  4XT3 B;  4ALP A;  4OEM B;  1H9S A;  1ESR A;  3D0F A;  4G7H C;  2ES2 A;  3J81 j;  4IUR A;  3GD7 A;  2AKW B;  2GVA A;  3OWF A;  2V4D A;  1AP0 A;  4YY3 L;  4LAA A;  3CCS A;  2Y0S G;  1JT8 A;  2EY2 A;  3MEF A;  5DM6 3;  2DY7 A;  3CME A;  2F52 A;  1B7Y B;  3HKS A;  4UHV A;  2XVS A;  1LTG D;  1BOS A;  2ZTD A;  2NVT B;  4RCN A;  3GTJ H;  2NVT H;  1IBL L;  2VNU D;  1I4R A;  4DAM A;  1HZB A;  5IOC A;  4JI4 Q;  4DXF A;  5I2Y A;  2F0K A;  4RGM A;  1LUZ A;  2IPK D;  4L63 B;  3OMC A;  1MIU A;  4P73 A;  1Q90 A;  3OIQ A;  3BDC A;  2VQE Q;  1IBL Q;  3GTQ H;  4DV1 L;  4OEL B;  1DOL A;  2A69 C;  4IPH A;  4FXD A;  2L55 A;  3I73 A;  3K0Y A;  4YHH Q;  1GXD C;  2JE6 I;  1SJE D;  3DXJ C;  3QG1 A;  1M90 C;  3KLW A;  3AMU A;  2O2L D;  2N55 A;  4M8A A;  1AFP A;  3EIV A;  4DKA C;  4A3E G;  3GTG B;  4LFC Q;  1O7L A;  3HOV G;  1PVO A;  3PIP A;  1EFW A;  4Y52 H;  4K5V A;  2JXM B;  3JAM E;  4GKJ Q;  2C5C A;  5BR8 Q;  4ZCK A;  2E5L L;  2EY6 A;  2VUM H;  1YZ6 A;  3W1B A;  1JB3 A;  5FLM H;  3M4Q A;  4QY7 A;  3UDG A;  3I4N B;  1U0L A;  4CKE A;  4B3S L;  2D62 A;  1HNW L;  3M7G A;  4ODG A;  2YU9 H;  4NXN Q;  4P72 A;  4J6H A;  1J6Q A;  1TY2 A;  4GN5 A;  1SFO H;  1RTN A;  4JI6 L;  1IL2 A;  5LMN L;  4A3D B;  1R4Q B;  3BVG A;  4C3I B;  5M3M G;  1PH6 A;  4C3H G;  5M3M H;  1EEI D;  3U4V A;  5A2Q E;  3CCV A;  1LTB D;  1XTC D;  1WTQ A;  2B63 H;  2B8G A;  3KBX A;  4JI6 Q;  1TWH B;  2GN5 A;  5ELF A;  3GP7 A;  2R6G A;  1XPR A;  4HED A;  5IIF A;  1X3Q A;  2F0U A;  2NVY H;  1D8L A;  2CW0 D;  1YNX A;  4XYO A;  4DV5 L;  2O5I C;  2CWP A;  4DV2 L;  1F2M A;  1E1T A;  5K36 H;  1SR3 A;  4IPC A;  2X6G A;  4JI8 Q;  2ZJP A;  2RDF A;  5IT9 L;  4A3E H;  2EY5 A;  3J81 L;  2F4V L;  4OXP A;  1D5M C;  1I4P A;  4PMW A;  2JEA I;  4RA8 A;  1KL9 A;  4JI5 L;  1Y8N B;  4QIW E;  1IZ6 A;  2D5D A;  4H02 A;  2Q2U A;  2KEE A;  1RKN A;  2I5M X;  4C1N K;  3S14 H;  3STB C;  4A3F G;  4GN4 B;  1CHP D;  3RZO B;  5FO8 B;  1IXR A;  4O2D A;  4A3C G;  1CKM A;  2R7Z G;  4AQY Q;  3I4L A;  4DK3 C;  4YWL A;  4KMU C;  4KHV A;  1U4P A;  1U4L A;  5EPJ A;  1K3R A;  4QGU A;  4LF4 L;  1STA A;  2KQ3 A;  1RD9 D;  5T1G A;  3AB9 A;  1NR2 A;  3K5N A;  4JI4 L;  4X62 Q;  1CKN B;  2XWB B;  2EXZ A;  3S24 A;  4PQX A;  5I2X A;  3BDO A;  4DNT B;  2VW9 A;  2F0D A;  2RSN A;  4LF7 L;  3BZK A;  4A3I G;  4B3M Q;  4G4K A;  5LL6 S;  1F9R A;  1R4P B;  4X3K A;  3NQI A;  1IBK L;  3S2H H;  4BY1 G;  1BF4 A;  5E4W C;  3KJO A;  2AHO B;  1F9Q A;  3CC7 A;  3HKZ B;  2UU9 Q;  1TS4 A;  5JJL A;  1GUN A;  3BJU A;  2FXQ A;  1WJJ A;  3OTO L;  1RL2 A;  4BA2 I;  3K8A A;  4BBS B;  1GUO A;  4DV1 Q;  1CA6 A;  4ZKB B;  4TRD A;  1G6P A;  1SE3 A;  2ZM6 L;  4NPS A;  2NVQ B;  1NTG A;  1E2Z A;  4RMF A;  2K1B A;  2I5L X;  4RHR A;  1HR0 Q;  3I4N G;  1F77 A;  1O7Z A;  3CQZ B;  3M9B A;  4KI0 A;  5JAV A;  3J80 L;  4B3R Q;  4K0K Q;  1GHJ A;  5IWA Q;  4LF9 Q;  4KV6 A;  1GO3 E;  3OPO A;  3P7J A;  2VQE L;  1KLU D;  3N52 A;  1TU2 B;  2B2W C;  4B3R L;  4K0K L;  3S16 B;  3A8I E;  3J7Y W;  1XMQ L;  3S16 H;  1HR0 L;  1YNN D;  4X3S A;  4H0L C;  4C3J B;  1CM9 A;  1SYB A;  4JI1 L;  3U9O A;  1NNX A;  5CBE E;  3J7A V;  4GOP A;  1GUG A;  5G3L F;  3Q8D A;  2F0O A;  3PIO 3;  1BCP D;  2HCC A;  1Q3L A;  1XNQ L;  3CCJ A;  1ENF A;  1OO9 B;  1W3S A;  4JI3 Q;  2UXB Q;  4HJ8 A;  1DD2 A;  1L0X B;  2C35 B;  1S5B D;  1IW7 C;  5HUR A;  4HSP A;  4A3J B;  1X9N A;  3DUZ A;  3BVM A;  5BN5 A;  4POG A;  4IOC A;  3TRZ A;  4ZLT F;  1H95 A;  5KNB A;  2JA8 B;  4OHJ A;  1G2T A;  4XQN A;  4X64 Q;  3I56 A;  4JBM A;  1STE A;  1EQT A;  3AFP A;  2EYF A;  2NTT A;  2QCP X;  4DNI A;  3S1R H;  2IHE A;  3HOX G;  3Q23 A;  2F0V A;  5HGT A;  1EY4 A;  3TSS A;  1Z6H A;  2VZA A;  4LJZ C;  1N32 Q;  3RZO H;  4YIJ A;  3QOL A;  3TRE A;  2EIF A;  1C4Q A;  3C3L A;  2EYM A;  4FVM A;  1VQ8 A;  2BDO A;  4HID A;  5GAE C;  4UAI A;  4ZK9 B;  4DAY B;  1S5D D;  2BH8 A;  4CJ1 B;  4CKC A;  1QE6 A;  2OQ0 A;  3MXP A;  2JA6 H;  2AQ2 B;  1PDQ A;  2JSO A;  4HTH A;  4K14 A;  5FKA C;  1TWF H;  1VQI A;  3UDI A;  1PFN A;  4IPD A;  1JIC A;  5AFW A;  1ENC A;  4OO1 G;  5D65 A;  4A3I B;  1U4R A;  4K2K A;  1MBY A;  5IYB H;  1DXM A;  1LTI D;  3D8G A;  1I6V C;  4MNO A;  4CDC C;  4JBJ A;  1TXY A;  1YHB A;  5EKI A;  2EVB A;  2F1M A;  1JB7 A;  2KHI A;  4K6L A;  1X3F A;  1PTO B;  2PZT A;  2X6L A;  1UE5 A;  2K5Q A;  4DNR B;  4ID6 A;  4BY1 H;  2JJQ A;  4G7O C;  1WD0 A;  1TKW B;  3RD4 A;  2RF4 A;  2SNM A;  1K8A C;  3QIA A;  2RA4 A;  2CKZ B;  1ENA A;  3T1H Q;  3NP8 A;  3L7Z C;  1XTD A;  4ILW A;  1VQF A;  1SMX A;  2OWO A;  3CC4 A;  4KKU A;  4P75 A;  4WRD A;  5EBD A;  3TBI B;  1GJX A;  5M3F H;  3QB3 A;  5JEA H;  3PF5 A;  2QKI C;  1H9R A;  2A5H A;  3VR3 A;  1QOH A;  3HOZ H;  1IYJ B;  1V1P A;  4R4I A;  3GTM H;  2R3Z A;  2DY8 A;  3DM1 A;  5C3E G;  1M8A A;  4HIO A;  1Y8P B;  2CWA A;  2Q8R E;  5ELO A;  1E2W A;  3GTL H;  3STB D;  2I46 A;  4AH6 A;  2HUG A;  1V1P B;  3ERQ A;  2B2U C;  2NN6 I;  3ERO A;  1V1Q A;  4AQY L;  2B63 G;  1G8Z D;  3E9I A;  3PSI A;  1GHK A;  2D9U A;  5J1Z A;  4R8I A;  4F87 A;  4NXN L;  4A93 B;  1G91 A;  3IKJ A;  5KGU A;  1JE4 A;  3HKZ G;  3QOJ A;  1JWM D;  5TSS A;  3IL8 A;  4RWS C;  2A73 B;  1IHZ A;  3SR1 A;  1D5X C;  5I6W A;  4CHT B;  5IP7 G;  3HOV H;  4RAU C;  3TN2 A;  1BKB A;  1VQJ A;  2B8F A;  1DGS A;  5D3D A;  1I4H A;  5FLX E;  1VQG A;  3CCR A;  2HIV A;  1HH2 P;  1Y1W B;  4DAV A;  1HJP A;  1P8L A;  1QIL A;  1KAW A;  1E7Z A;  4GKK Q;  1STH A;  3D3R A;  2EOT A;  1ESF A;  1PZJ D;  2R7Z B;  5KND A;  3NWT A;  1TQO A;  4IQZ A;  1EUJ A;  1QUQ A;  2I5H A;  1K3B C;  1CA5 A;  1JWU D;  3I3C A;  3I7F A;  4LF6 L;  1SND A;  5C44 H;  3PUW A;  4I65 A;  2H4O A;  2NB0 A;  1AH9 A;  4UP9 A;  1VQC A;  1T9H A;  1Q7Y C;  2HDM A;  1YI2 A;  1WTO A;  5T1I A;  1Q12 A;  4IFD J;  4A3I H;  3GTO B;  4HJ5 A;  2A19 A;  1HNX Q;  1B3A A;  2SNS A;  1KQS A;  2JA9 A;  4DPG A;  3F8T A;  4JI8 L;  1AE2 A;  1KAA A;  3D4D A;  1SYE A;  4NP5 A;  3UE0 A;  4DUZ L;  4Y7N H;  2KEN A;  1I4Q A;  3UDX A;  4MTN A;  4CKB A;  1F9S A;  4JBK A;  1HTP A;  4KHP L;  2OTL A;  3V05 A;  4DK6 C;  3K5L A;  3CF5 A;  2KVM A;  4POF A;  2AUK A;  3O13 A;  4XYQ A;  1QNK A;  3D6W A;  5J39 A;  2JA7 G;  3K7A B;  3EBE A;  1Y1W G;  1TWA B;  4X62 L;  3A74 A;  2WKC A;  2DNE A;  1TS3 A;  4WJW A;  5M3F B;  1K28 A;  1FGU A;  1K83 B;  1TS2 A;  1IYV A;  4PMC A;  4GLA C;  4LUZ A;  4N9T A;  3HOU H;  3HOZ B;  2YU9 B;  2B2V A;  2PPB C;  3A0J A;  2NZ1 D;  4GOP B;  1YNJ D;  1PV4 A;  1EFI D;  1JQY D;  3KYH C;  1V43 A;  5IGG A;  3GTK B;  2R61 A;  3SVM A;  4YWK A;  1TT2 A;  2LMC B;  2WV6 D;  4FF3 A;  2IT1 A;  3I4M B;  1UWV A;  3Q6S A;  2WAQ G;  3MFG A;  3I4M H;  2QGQ A;  2B63 B;  4C2M B;  1WTV A;  2H5X A;  5CC4 A;  2E2I B;  3KFU A;  3KF8 B;  4IUV A;  4A3L G;  2KOL A;  2HQE A;  3I4O A;  1BR9 A;  3HP3 A;  1O7Y A;  3WOE A;  4LF5 Q;  1RCV D;  3PV0 A;  2VL6 A;  3E9H A;  1PTO F;  4KD3 A;  1KXL A;  1Q1E A;  2HIX A;  3FKI H;  5CV9 A;  4NKL A;  2MO1 A;  1NBW A;  2RKS A;  5C3X A;  1LO5 D;  1WTW A;  3I55 A;  3IAY A;  3P20 A;  1QVC A;  2CFM A;  2ZT9 C;  1SEB D;  3ICE A;  3H6M A;  1SNO A;  2SEB D;  4R4T A;  3SXH A;  1O80 A;  3FDT A;  5FOB B;  3VA5 A;  2R92 B;  2Z4H A;  2K5D A;  1BVS A;  5LMN Q;  3M7N A;  5CV4 A;  5C4Z A;  1X3E A;  2G5D A;  5K5P A;  2UUC Q;  1J8I A;  2UUA Q;  4RCO A;  2GA4 B;  1O7I A;  1AW7 A;  5AJ3 L;  1YIT A;  4C3J G;  4B3S Q;  1L1O B;  2LS0 1;  4AIM A;  3GQB A;  3KBG A;  1JWS D;  2K04 A;  2PQA A;  4BA1 I;  5C4X H;  4O0A A;  5IYD H;  4QF4 A;  4XIG S;  1I5F A;  2QF7 A;  1B4O A;  1KHI A;  1LM0 A;  1B2T A;  1JR0 D;  4YHH L;  1F2L A;  3E3X A;  3EQL C;  1LT4 D;  3K7U C;  3MHB A;  3LGJ A;  2UXD Q;  3HOY H;  3X3M A;  4X66 L;  4HJ7 A;  2E75 C;  3VR5 A;  1J5E L;  3M3Y H;  3GTO H;  1EEF D;  2EJF C;  4P2C B;  4KY5 A;  4UP8 A;  5EQ0 A;  2ZXR A;  2EDG A;  2B39 A;  3MFY A;  2AQ1 B;  3QWN A;  2RCN A;  1NY4 A;  4DV7 L;  2K32 A;  1DON A;  5A35 A;  1DZ1 A;  3OTO Q;  2XRS D;  1PRT B;  2ZXO A;  3M4Y A;  4ULL A;  4DA2 A;  2V1C C;  3PF4 A;  4IO9 A;  3HZX A;  2IY5 B;  5EBC A;  3R3O A;  5KNC A;  1C7Y A;  3A5Z B;  1UNS A;  4ZUJ A;  2VUM B;  4FXG C;  3K0X A;  1HQM C;  1KAB A;  2HQL A;  2XRQ D;  1KIX A;  4KK7 A;  1L0W A;  2PQE A;  2MUY A;  1CSQ A;  4A3M G;  4A3C H;  2C9O A;  2B3G A;  1V9P A;  4JW0 A;  5M5W B;  4X3T A;  1SSO A;  5C6A A;  2CH4 A;  2EQS A;  2QEX A;  3MEH A;  3T16 A;  4JVZ A;  1NJI C;  4DN4 M;  2FIN B;  1A3V A;  2NVX H;  2DUD A;  3NK9 A;  1MKH A;  2JA5 H;  1S4Z A;  1ASZ A;  5FLX c;  2JA5 B;  3NQT A;  2FFK B;  1RTO A;  4N9P A;  4DU9 A;  2R7D A;  2NVY B;  3F1Z A;  4L5R C;  4K8J A;  3H3V I;  2L5T A;  3CW2 C;  4X66 Q;  1DJR D;  2H1E A;  1Q86 C;  2RHQ B;  4XTC S;  1IW7 D;  2AUJ D;  4TVA B;  5AJ3 Q;  2SDF A;  2HCI A;  1H9K A;  2FMM A;  5HY6 A;  4UP7 A;  3DWA A;  4A3E B;  4OWW B;  3FKI B;  5DLQ E;  3R2T A;  3SK4 A;  4DR2 L;  1A15 A;  1IKL A;  4GNX A;  2CCZ A;  1VQA A;  1PXU A;  4DR3 Q;  1CTM A;  3CU7 A;  4X3U A;  1C48 A;  2O5J C;  1K9M C;  3S14 B;  1EY5 A;  4PV1 C;  1T5E A;  1NCV A;  1CK1 A;  4A3G B;  3EN2 A;  3J81 i;  4A3G H;  2KCT A;  3W2D A;  3E0J A;  1B8A A;  3A7A B;  2AWO A;  2F0M A;  3K5M A;  1A3T A;  4A3D G;  1HFN A;  1BCP F;  1W6K A;  5IOD A;  4Z9C B;  1XMO L;  2BOS A;  3D4R A;  2A69 D;  2K4K A;  1IBM Q;  3MTS A;  4FYD A;  3GTL B;  4S3S A;  3JAM c;  4BWG B;  3BYY B;  3E5S A;  2A8V A;  3C1E A;  1B3Q A;  4KD4 A;  1Q1B A;  1HZA A;  2XNA C;  4BBR H;  4PZ6 A;  1ET9 A;  5IP9 G;  1WD1 A;  2NWG A;  1EY8 A;  1PTO H;  3CCM A;  3V96 A;  2F0J A;  4YCW A;  4IFD G;  3EFX D;  1HPC A;  4A4I A;  1SYG A;  1YJ9 A;  3CXC A;  2ZJR A;  5DEH A;  1WVL A;  1J9O A;  4BBS H;  2EYP A;  1FNW A;  1N9W A;  3SK8 A;  3J80 c;  3HS0 C;  2Z6B A;  1QJO A;  3FVQ A;  5COY A;  4OON A;  2ZTC A;  4K5W A;  3RZD B;  2Z6K A;  3HOX H;  1T5X D;  1QWY A;  4GNX B;  1A62 A;  5M9O A;  3NEN A;  1QNU A;  1LT6 D;  2F3I A;  5JPM C;  2ENB A;  3Q22 A;  2VB2 X;  1CSP A;  1S3O A;  1P16 A;  3OHX C;  1RHP A;  1MJC A;  1HA5 A;  2DGY A;  1A3U A;  4JI2 Q;  2LFN A;  1LTT D;  3OIP A;  4A3M H;  3HG9 A;  3IRB A;  2LXK A;  3M4O B;  2L12 A;  5IGF A;  3RN2 A;  3M4O H;  3AU7 A;  2PNR C;  2PQA B;  3I90 A;  4RGN A;  4KHP Q;  1VQB A;  2Z6K C;  1EY9 A;  1K0R A;  3QR8 A;  4QL5 A;  2DJG C;  5J3B A;  4OX9 L;  3I2Z A;  2ID0 A;  5J22 A;  1BNZ A;  1YIJ A;  1EWI A;  1FGB D;  2F0N A;  4L6T B;  5ELN A;  2RDH A;  4HJA A;  1QG7 A;  1YHA A;  4DK0 A;  2L15 A;  1E2V A;  4RKB A;  2Q8T A;  1QVF A;  1K8G A;  1KTK A;  1X55 A;  3RLF A;  1HCZ A;  4NW2 A;  3URY A;  4BBS G;  3RUZ A;  3K57 A;  1SYF A;  3NXW A;  1CUK A;  1HR0 W;  1N34 L;  1RF2 D;  5H1S E;  1D1I A;  2Z9H A;  3S1R B;  3GTG H;  4MHE A;  2A68 C;  2MGS A;  1JJC B;  4EVO A;  2AQ3 B;  4XXE A;  3KLS A;  3PQI A;  1SJH D;  1ILP A;  4DV4 L;  2K5N A;  4DUZ Q;  2WP8 J;  3NPP A;  4A3K H;  1MHW C;  4JI3 L;  1VCI A;  5LL6 X;  3TZU A;  4TQU S;  4LF8 Q;  4RGO S;  4R4C A;  3VYS A;  1WTR A;  4NB3 A;  2F3W A;  1SNP A;  4IOA A;  2JA6 G;  2JEB I;  2VQF L;  4A3D H;  2N78 A;  1E0B A;  1V8Q A;  1PH7 A;  3GTK H;  1Z47 A;  1EIY B;  2NBF A;  5M5Y H;  5IYB G;  1JOR A;  4DV0 Q;  1L1O C;  4OL7 A;  2N8N A;  1TWC B;  5GQO A;  5EKK A;  2MJ8 A;  4PZ7 A;  3S1M B;  1Y8O B;  2NYZ D;  4XDX A;  4B9X A;  1N36 Q;  3FEW X;  1NSN S;  1FNV A;  4G57 A;  1WFQ A;  3K81 C;  5C0X H;  1VQ7 A;  2CH4 W;  2TMP A;  3CAM A;  5E4X A;  4ZAI A;  1IYU A;  2NN6 G;  3TS2 A;  3PUX A;  3CC2 A;  5BN4 A;  4IFD H;  4ME5 A;  1AZQ A;  1WCM H;  2MO0 A;  4DR4 Q;  2PO4 A;  4HSV A;  3ND9 A;  4HMI A;  4DR7 Q;  1X65 A;  2IHF A;  3K7A H;  4JPB W;  5A2Q L;  4LFB L;  1PTO D;  5M3F G;  3GO5 A;  1TS5 A;  1K83 H;  3NTH A;  1DCZ A;  3GTP H;  1UUP A;  2D0P A;  5C5L A;  3S1Q H;  4FF1 A;  2OCE A;  3S1Q B;  1ZEQ X;  3HOW G;  2B2U A;  4OIJ A;  4O42 A;  1KNA A;  1EOV A;  1EQQ A;  2HD3 A;  4ABN A;  2R7Z H;  1LT5 D;  1PH8 A;  2L11 A;  2K50 A;  3MC0 B;  2YV5 A;  2O4X A;  2I07 B;  1XX8 A;  1SBB B;  4A3M B;  1ASY A;  4OO1 H;  3PUZ A;  4IUN A;  2WFW A;  3S15 B;  2PZU A;  1HNW Q;  2E2I H;  1SMY C;  1S5F D;  5IE8 A;  1CFM A;  3HOY B;  1WOC A;  2DN8 A;  5IY0 A;  3PMF A;  4KY6 A;  3CHB D;  1WYD A;  5JJI A;  2Q2T A;  3M85 A;  4LFC L;  3VR2 A;  2B2W A;  3I72 A;  3A55 A;  5I9P A;  1EQR A;  1XNQ Q;  2E76 C;  4A3B B;  1U4M A;  5NUC A;  2R92 H;  3MXU A;  1ML0 D;  4A76 A;  2K75 A;  3PUY A;  2Q8I B;  2F0W A;  2A68 D;  4IUT A;  4F88 A;  1IL8 A;  1N33 Q;  2SOB A;  4I7Z C;  3PO3 B;  5C4J H;  2UXD L;  4IZ8 A;  5GAH C;  5LHY 1;  1C0A A;  1B9M A;  4EQ5 A;  3VYT A;  1L2F A;  1MD2 D;  4L5T A;  4CGY B;  1XJV A;  4C3J H;  4QUC A;  2B29 A;  4Q0F A;  5JEA J;  4IAL A;  4C3H B;  3H15 A;  4QB4 A;  2OXP A;  1G2S A;  4C3I H;  1I6H H;  2N49 A;  4BY7 B;  1JCK B;  4FF2 A;  2VS1 A;  3VDY A;  3V2T A;  3I4M G;  2CVR A;  3G4S A;  3H3V C;  3C2P A;  2BA1 A;  4AYB G;  4JYA L;  4PMB A;  5ELD A;  3WOF A;  3OOC A;  2RDG A;  1STG A;  4H13 C;  5IT9 E;  2PZW A;  1ICF B;  2F0P A;  2PMZ E;  3H94 A;  4DV7 Q;  1WTX A;  2RHS B;  2PYK A;  4QJF A;  2F0S A;  4MZ9 A;  4BXX G;  1Y1V H;  3BYT B;  2IL8 A;  1C9O A;  1Y1V B;  2OF1 A;  4YCV A;  1DOK A;  1XMQ Q;  1G51 A;  2F0I A;  5EKL A;  2CQO A;  1GUT A;  1VQ5 A;  1WI5 A;  1VQM A;  2JA8 G;  3BDL A;  2N3S A;  2A6E D;  2J7Z A;  1VQO A;  3LWE A;  1PH3 A;  2KCM A;  3HOU B;  4HIK A;  2Z1C A;  3HOU G;  2B2T A;  3VR4 A;  4KN7 C;  1C8C A;  5C44 G;  4BS9 A;  5GRO A;  1M1K C;  2VY3 A;  4OX9 Q;  3CRL C;  2QEJ C;  5ELE A;  2BE5 C;  2WB1 B;  5ELC A;  2L1B A;  3CPW A;  3NUC A;  1VQ9 A;  5E1F A;  1B9N A;  1BCP B;  2YTX A;  4C2M H;  3AYH B;  1V1O A;  2QW7 A;  1QZH A;  4NXM L;  2AMC B;  2OEO A;  1SN8 A;  2E2D C;  2BCO A; 
#chains in the Genus database with same CATH homology
 4IO9 A;  2IY5 B;  2VW9 A;  1C7Y A;  1YHQ A;  3A5Z B;  3RNU A;  3KOJ A;  2HHH L;  2K52 A;  3HFZ B;  3BZK A;  4LF7 L;  3K0X A;  4DV6 L;  4A3I G;  4B3M Q;  2HQL A;  1KIX A;  1SLJ A;  3KF6 A;  1GM5 A;  1L0W A;  1IBK L;  3W1G A;  3RN5 A;  3S2H H;  1CSQ A;  4BY1 G;  4A3M G;  4A3C H;  3U4Z A;  2B3G A;  3KJO A;  2AHO B;  1V9P A;  3FKI G;  3GDE A;  3CC7 A;  4LFB Q;  2IX1 A;  1Z9F A;  4L5Q A;  4DR5 Q;  4LUV A;  2UU9 Q;  5JJL A;  5LMN W;  2UXC Q;  1PYS B;  2EQS A;  1WJJ A;  2FXQ A;  3BJU A;  3OTO L;  2QEX A;  5HGQ A;  3CCU A;  1RL2 A;  1U5K A;  3K8A A;  4J15 A;  4EX5 A;  1NJI C;  2OQK A;  4BA2 I;  4BY7 H;  4GN3 B;  2NVX H;  1NMF A;  4DV1 Q;  3FP9 A;  3TEH B;  2DUD A;  3UDF A;  1G6P A;  1MKH A;  2ZM6 L;  2JA5 H;  2ALY B;  4NPS A;  3PF4 A;  4DR2 Q;  1NTG A;  4DUY Q;  4RMF A;  1ASZ A;  2F4V Q;  3PUV A;  5FLX c;  2K14 A;  2E2H H;  4DR4 L;  2I5L X;  2Z0S A;  3RZD H;  1A8V A;  1GVP A;  4KLK A;  3CQZ H;  1HR0 Q;  1VQP A;  2R7D A;  3I4N G;  3F1Z A;  4L5R C;  1HNX L;  2BA0 A;  3ULL A;  3M9B A;  4KI0 A;  4LF9 Q;  3H3V I;  3CW2 C;  4X66 Q;  4B3R Q;  4K0K Q;  1PYB A;  4JI5 Q;  4DV2 Q;  2R93 G;  4A3F H;  1X54 A;  5IWA Q;  1I3Q H;  1BBW A;  2RHQ B;  4XTC S;  1Q86 C;  1GO3 E;  2VQE L;  4A75 A;  4LNQ A;  3PO3 H;  4TVA B;  5AJ3 Q;  4LFA Q;  4B3R L;  4K0K L;  3CMA A;  2EXD A;  4UP7 A;  5HY6 A;  4X65 Q;  1XMQ L;  3S16 H;  1HR0 L;  5C0X G;  4JI7 L;  4OWW B;  1CKO A;  3F2D A;  5DLQ E;  4JI1 L;  4P74 A;  2BH2 A;  4DR2 L;  4GNX A;  4DV3 Q;  2CCZ A;  2ASB A;  1VQA A;  4GOP A;  4DR3 Q;  5C0X J;  1E24 A;  4JBW A;  4B3T Q;  1OXT A;  3Q8D A;  2XTI A;  1OXX K;  1K9M C;  4A3L H;  1GKH A;  3T1Y Q;  5C0X I;  2AWN A;  1VQD A;  3E0E A;  1XNQ L;  3NEM A;  2YTV A;  3CCJ A;  3EN2 A;  4RG1 A;  3J81 i;  1W3S A;  4JI3 Q;  1N32 L;  4A3G H;  4HIM A;  2UXB Q;  4DV0 L;  4HJ8 A;  4X6A H;  2KCT A;  5JEA G;  3K80 C;  2C35 B;  4JI2 L;  1L1O A;  3PO3 G;  1B8A A;  2AWO A;  3FHW A;  4A3D G;  1XPO A;  1PH2 A;  1X9N A;  1Y14 B;  1XMO L;  1OXV A;  1YJW A;  2IX0 A;  4POG A;  4DV3 L;  4IOC A;  3TRZ A;  5IP7 H;  5C4X G;  1VS0 A;  4JI1 Q;  2K4K A;  3OW2 A;  1YJN A;  4DR6 L;  1H95 A;  4GKJ L;  1IBM Q;  4BXX H;  3ULJ A;  4X64 Q;  1SE8 A;  4GLV B;  3I56 A;  1Q82 C;  4JBM A;  2K5H A;  1FJG Q;  3JAM c;  3AFP A;  1XMO Q;  4DNI A;  3S1R H;  1UE6 A;  2IHE A;  4UPA A;  3HOX G;  3BZC A;  2MQH A;  2GVB A;  2E2J H;  2A8V A;  3ER0 A;  5GAG C;  1XNR L;  1Q1B A;  3KF6 B;  4GKK L;  4WJ3 M;  1HZA A;  5BR8 L;  1N34 Q;  4BBR H;  4PZ6 A;  5IP9 G;  2VZA A;  2UXB L;  1N32 Q;  4LF6 Q;  3RZO H;  3TRE A;  3CCM A;  2EIF A;  1YEZ A;  3L2P A;  4YCW A;  1VQ8 A;  4IFD G;  4JCV E;  3NEL A;  4R1J A;  3PIO A;  4HID A;  4WJ4 A;  1YBY A;  4A4I A;  1YJ9 A;  5GAE C;  4A93 H;  3CXC A;  2ZJR A;  3ULP A;  4DAY B;  5K36 G;  3ZJY C;  4UY8 C;  3OYY A;  4APV A;  2BH8 A;  1XPU A;  5IYC H;  4BBS H;  2OQ0 A;  1N9W A;  3RLO A;  2UUB L;  2JA6 H;  3W5O A;  3J80 c;  3J7A 5;  3UDI A;  1TWF H;  1VQI A;  4GS3 A;  4OON A;  3JAM i;  1KC8 C;  4IPD A;  2ZTC A;  4JOI C;  3S1N H;  2Z6K A;  1UE7 A;  4OO1 G;  1FJG L;  3HOX H;  1UEB A;  4GNX B;  1A62 A;  5IYB H;  5FLM G;  4MNO A;  1LYL A;  3NEN A;  1KRT A;  4JBJ A;  3PO2 G;  1TXY A;  1YHB A;  2F3I A;  4BBR G;  1N33 L;  1S72 A;  2PI2 A;  3TS0 A;  1BBU A;  2LXJ A;  1JB7 A;  4A93 G;  3T1Y L;  1CSP A;  4FDB A;  1S3O A;  1P16 A;  3HOW H;  2JQO A;  2KHI A;  4AYB E;  3S1M H;  1X3F A;  2NZO A;  1MJC A;  1G29 1;  2DGY A;  1FL0 A;  1Q81 C;  4JG2 A;  1UE5 A;  3DLL A;  1WCM G;  1X3G A;  3KJP A;  4JI2 Q;  4A3M H;  4BY1 H;  2JJQ A;  3IRB A;  2LXK A;  3J80 i;  3RN2 A;  1N8R C;  2RF4 A;  2UUB Q;  3J7Z C;  3M4O H;  1K8A C;  2PQA B;  1XNR Q;  4KHP Q;  1SRO A;  2CKZ B;  5FJ8 G;  1VQB A;  2Z6K C;  1K0R A;  1PA6 A;  3T1H Q;  4IFD I;  2KHJ A;  3CPF A;  1I50 H;  4QL5 A;  3PO2 H;  5LMU Q;  5J3B A;  4OX9 L;  3D31 A;  3L7Z C;  1XTD A;  3I2Z A;  1VQF A;  1SMX A;  2JA7 H;  2OWO A;  2ID0 A;  3CC4 A;  4P75 A;  3HKZ E;  1YIJ A;  1EWI A;  4X64 L;  3JC6 6;  5ELN A;  5M3F H;  4HJA A;  3PF5 A;  1IBK Q;  1YHA A;  2L15 A;  5IT9 c;  3CCE A;  1JE5 A;  3GTP H;  3A5U A;  1AE3 A;  1QVF A;  1K8G A;  4HJ9 A;  3HOZ H;  1X55 A;  1QVG A;  3RLF A;  1IYJ B;  1OXU A;  1UE1 A;  4R4I A;  4LF8 L;  2QA4 A;  3GTM H;  5IYC G;  4BBS G;  5C3E G;  3NBH B;  4R4Q A;  4DR7 L;  1CUK A;  4LUO A;  1HR0 W;  3H3V H;  1Q46 A;  4HIO A;  1R9T H;  1N34 L;  4DV4 Q;  3KDF A;  1NE3 A;  5H1S E;  1VQL A;  2CWA A;  5ELO A;  4A3J G;  1PH5 A;  3GTL H;  2YYZ A;  5FJ8 H;  1MJE A;  3GTG H;  3STB D;  1X56 A;  5EAY A;  4BY7 G;  4DR1 L;  4ME3 A;  1JJC B;  2A1A A;  4LF4 Q;  4A3B G;  4AH6 A;  2OTJ A;  1VQ4 A;  3CCQ A;  4DV5 Q;  1A63 A;  4JV5 L;  1CKN A;  2NN6 I;  1FVI A;  3L0O A;  3TQY A;  1V1Q A;  4AQY L;  2B63 G;  4DV4 L;  3HOZ G;  2K5N A;  3E9I A;  3PSI A;  2WP8 J;  4DUZ Q;  4A3K H;  3H0G H;  3G48 A;  1PH1 A;  4DV6 Q;  4B3M L;  4JI3 L;  3I4N H;  1VCI A;  1JMC A;  1W2B A;  4TQU S;  2HHH Q;  4NXN L;  3RR5 A;  4LF8 Q;  3AQQ A;  4R4C A;  1QUQ B;  2R7F A;  1HZC A;  2Q2I A;  3HKZ G;  4NB3 A;  3G6E A;  4A3J H;  4IOA A;  1PH4 A;  2JA6 G;  1X6O A;  2JEB I;  2VQF L;  4A3D H;  2N78 A;  1B70 B;  2YTY A;  2JK8 A;  2MNA A;  1I94 L;  4L5S A;  5IP7 G;  1PFS A;  1PH7 A;  3GTK H;  1Z47 A;  3HOV H;  1EIY B;  1NMG A;  1BKB A;  2JA8 H;  1VQJ A;  5GAD C;  4B3T L;  1DGS A;  5M5Y H;  4IJL A;  1Y1W H;  4DR1 Q;  1VQG A;  3CCR A;  2HIV A;  1A0I A;  5IYB G;  1HH2 P;  4LFA L;  1HJP A;  1P8L A;  4P71 A;  4DV0 Q;  1KAW A;  1TWC H;  1L1O C;  2N8N A;  1VQK A;  1E7Z A;  5GQO A;  4GKK Q;  2UUA L;  3F2C A;  4PZ7 A;  3G71 A;  3F2B A;  3H0G G;  1N36 Q;  1EUJ A;  1QUQ A;  2I5H A;  1SRU A;  4DR3 L;  1QZG A;  3PGZ A;  1WFQ A;  3K81 C;  1VQ7 A;  3CAM A;  2NZH A;  2NN6 G;  3TS2 A;  3I7F A;  3PUX A;  3AFQ A;  5IYD G;  5C44 H;  4KHZ A;  1PHJ A;  1IBM L;  1E3P A;  3CC2 A;  4LF6 L;  4IJH A;  3PUW A;  4YCU A;  3S2D H;  2R92 G;  4JI7 Q;  1WCM H;  1E22 A;  2MO0 A;  4DR4 Q;  4DR7 Q;  1I94 Q;  1AH9 A;  2LSS A;  1X65 A;  2XGT A;  2IHF A;  3K7A H;  3U58 A;  1HZ9 A;  4UP9 A;  1VQC A;  4JC0 A;  1S40 A;  1T9H A;  2D0O A;  1Q7Y C;  3T1H L;  4C3H H;  4R4O A;  4LFB L;  1VQN A;  3HOY G;  3WWV A;  4LWC A;  5M3F G;  1YI2 A;  1Q12 A;  2K5V A;  4IPG A;  4IFD J;  4A3G G;  3GO5 A;  4A3I H;  4HJ5 A;  2A19 A;  4LF5 L;  1K83 H;  1HNX Q;  2JA5 G;  3RLN A;  2R93 H;  1KQS A;  4DR6 Q;  3KDF B;  5JJK A;  1RIP A;  2WB1 E;  2JA9 A;  1KRS A;  2D0P A;  3F8T A;  4JI8 L;  1AE2 A;  4DPG A;  1GD7 A;  1HNZ L;  1EIF A;  3S1Q H;  4ALP A;  2OCE A;  3UE0 A;  4DUZ L;  2ES2 A;  3SGI A;  3D0F A;  4Y7N H;  1N36 L;  1Y1V G;  2ZM6 Q;  2KEN A;  3J81 j;  3HOW G;  3UDX A;  4MTN A;  1EOV A;  3GD7 A;  1OXS C;  2AKW B;  1EQQ A;  2GVA A;  4JBK A;  1PH8 A;  2R7Z H;  4JV5 Q;  4KHP L;  4YY3 L;  2K50 A;  2OTL A;  2YV5 A;  1VQ6 A;  3CCS A;  1OTC A;  2KBN A;  4DK6 C;  2Y0S G;  1ASY A;  4JYA Q;  3MEF A;  2UU9 L;  1JT8 A;  3CF5 A;  4POF A;  3CME A;  3UE1 A;  3PUZ A;  2F52 A;  2WFW A;  1B7Y B;  3HKS A;  2ZTD A;  3S17 H;  1HNW Q;  4YWM A;  4OWT B;  2E2I H;  2JA7 G;  2Y0S E;  1TWA H;  3GTJ H;  5IE8 A;  2NVT H;  3B6Y A;  3BU2 A;  3EBE A;  1Y1W G;  1IBL L;  4DAM A;  4X62 L;  1HZB A;  3A74 A;  4JI4 Q;  4GLX A;  2VNU D;  1K73 C;  2E5L Q;  3AEV A;  1WOC A;  1LUZ A;  1FGU A;  5IY0 A;  1HNZ Q;  4GLA C;  4LUZ A;  3CCL A;  1JJG A;  1MIU A;  1WYD A;  4P73 A;  5JJI A;  3HOU H;  2Q2T A;  5M5W H;  3M85 A;  4LFC L;  1IBL Q;  2VQE Q;  3A0J A;  3GTQ H;  4GOP B;  5IWA L;  1YVC A;  4DV1 L;  1PV4 A;  4LF9 L;  3KYH C;  4IPH A;  1V43 A;  2ZTE A;  3ERS X;  5C3E H;  3PCO B;  4YHH Q;  1EQR A;  4YWK A;  1XNQ Q;  2JE6 I;  1VQE A;  3DM3 A;  2IT1 A;  1UWV A;  3KLW A;  1KD1 C;  1M90 C;  2WAQ E;  2WAQ G;  2R92 H;  1PH9 A;  3I4M H;  2QGQ A;  3EIV A;  4DKA C;  2ATW A;  4A3E G;  4LFC Q;  3HOV G;  3S15 H;  4A76 A;  1PVO A;  3PIP A;  1EFW A;  2K75 A;  2H5X A;  3PUY A;  4Y52 H;  3CD6 A;  4GKJ Q;  3KFU A;  3KF8 B;  4GOP C;  5BR8 Q;  2PI2 E;  2E5L L;  2VUM H;  4X65 L;  1YZ6 A;  3W1B A;  5FLM H;  4JI0 Q;  3M4Q A;  4A3L G;  3I4O A;  4QY7 A;  1N33 Q;  3UDG A;  2MFI A;  2VQF Q;  5C4J H;  2UXD L;  1U0L A;  4B3S L;  4LF5 Q;  2HT1 A;  2D62 A;  5GAH C;  3PV0 A;  1C0A A;  4NXM Q;  4EQ5 A;  1HNW L;  2VL6 A;  3E9H A;  1L2F A;  4L5T A;  1KXL A;  2YU9 H;  1Q1E A;  2HIX A;  3FKI H;  4P72 A;  1XJV A;  3U50 C;  4NXN Q;  4C3J H;  1J6Q A;  1NBW A;  2B29 A;  2MO1 A;  4GN5 A;  1SFO H;  4JI6 L;  5JEA J;  4JI0 L;  5LMN L;  1IL2 A;  3I55 A;  5M3M G;  1QVC A;  2CFM A;  4PG3 A;  4YY3 Q;  3H15 A;  1PH6 A;  3ICE A;  5M3M H;  3U4V A;  4C3I H;  4R4T A;  4A3B H;  1I6H H;  2N49 A;  3CCV A;  2VS1 A;  3VDY A;  4A3K G;  3I4M G;  2VUM G;  4OWX B;  3G4S A;  2B63 H;  2UUC L;  1BVS A;  2BA1 A;  5LMN Q;  2NVQ H;  4AYB G;  4JI6 Q;  1LTL A;  1TWG H;  3M7N A;  2GN5 A;  4JYA L;  2R6G A;  1XPR A;  1X3E A;  2UUC Q;  2UUA Q;  1J5E Q;  2NVY H;  3J81 c;  1O7I A;  1D8L A;  5AJ3 L;  1YIT A;  2PMZ E;  4DV7 Q;  4LW1 A;  4B3S Q;  1YNX A;  1L1O B;  2WB1 G;  2RHS B;  4DV5 L;  4PZ8 A;  2CWP A;  4DV2 L;  4OO1 I;  4QJF A;  4MZ9 A;  1E1T A;  4BXX G;  4AIM A;  1Y1V H;  1SR3 A;  2PNH A;  1C9O A;  2PQA A;  4BA1 I;  4IPC A;  5C4X H;  5IYD H;  4O0A A;  4JI8 Q;  4XIG S;  2ZJP A;  4YCV A;  1I5F A;  3M4P A;  1XMQ Q;  1KHI A;  4A3E H;  1LM0 A;  2F4V L;  4OXP A;  1Q8K A;  1G51 A;  4YHH L;  4PMW A;  2JEA I;  2CQO A;  2Q2H A;  5E7N A;  1VQ5 A;  1WI5 A;  1VQM A;  3K7U C;  2JA8 G;  1KL9 A;  3LGJ A;  2UXD Q;  4JI5 L;  3HOY H;  4QIW E;  1IZ6 A;  4X66 L;  2N3S A;  4H02 A;  4HJ7 A;  2Q2U A;  3M3Y H;  1J5E L;  2I5M X;  4JOI A;  1VQO A;  3GTO H;  3S14 H;  3STB C;  4A3F G;  4GN4 B;  1PH3 A;  1IXR A;  2KCM A;  4HIK A;  4UP8 A;  1TWH H;  3HOU G;  4O2D A;  4A3C G;  2E8G A;  5IP9 H;  4DUY L;  1JJ2 A;  1CKM A;  5C44 G;  2R7Z G;  4AQY Q;  2RCN A;  1VQH A;  1NY4 A;  4DK3 C;  4YWL A;  2ZJQ A;  5GRO A;  4DV7 L;  4GNX C;  1M1K C;  2VY3 A;  4OX9 Q;  5LMU L;  2I0Q A;  1K3R A;  4QGU A;  4LF4 L;  1E1O A;  3MXN B;  3OTO Q;  2UXC L;  3CPW A;  3CP0 A;  4LF7 Q;  4QQB X;  1VQ9 A;  4JI4 L;  4DR5 L;  4X62 Q;  1D7Q A;  1CKN B;  2YTX A;  4C2M H;  3AYH B;  1QZH A;  4NXM L;  2AMC B;  2V1C C;  5M5X H;  1SN8 A;  3S24 A;  1EYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...