3VDYA

B. subtilis ssbb/ssdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
101
Chain Sequence
HMFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYEVNVYVTEVLADTVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein ssbB
publication title Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
total genus 16
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3vdyA00
3F8TA 4LFCQ 1CSPA 3PSIA 5LMUQ 1PH7A 1Z47A 4QJFA 2MO0A 2K5VA 1IL2A 4IOAA 4JOIC 4JI3Q 5ELNA 1GM5A 1A62A 1OXUA 4GN3B 2HT1A 3GTKH 1UE5A 3FP9A 4LFAQ 4B3RQ 4K0KQ 4DR7L 3J81c 5E7NA 2HHHQ 1Y1VG 2UUCL 3PF5A 2AWOA 1YJNA 1G51A 2UUAL 2V1CC 3JAMc 2A8VA 1IZ6A 1EQQA 2K75A 4NXML 1QUQA 2VQFQ 1VQBA 2ZJRA 4A3FH 4UY8C 1IXRA 3CPFA 3UE0A 3H15A 4A3CH 4JV5L 2DUDA 3CCLA 4DR5Q 3CP0A 2JA5G 1BVSA 2I5MX 3BJUA 3J80c 2VW9A 1PA6A 2EXDA 2R92H 3ULJA 1VS0A 1XMQQ 1XPOA 1GO3E 1YVCA 4A3KH 3U50C 4IOCA 4A3FG 3AEVA 4HJ9A 1WOCA 2ZJPA 2K14A 4IJHA 2KCTA 2VQEL 1VQ5A 4X65Q 2HQLA 2PI2E 3HKSA 4AYBE 1E1OA 2YTXA 1EFWA 4BA2I 1W2BA 2RCNA 4LF9L 3Q8DA 5FLMH 1Q1EA 2JEBI 5FLXc 5AJ3L 1XNRQ 2CKZB 2NZHA 4DR1Q 3ICEA 2N3SA 3RZDH 1TXYA 4B3ML 1XPRA 1UE1A 4A3DH 5IYDH 2KBNA 3F2BA 4A3GH 3CCVA 2F4VQ 3TQYA 4LUOA 1JJCB 4GS3A 2JA9A 5GAEC 3OYYA 3KF6B 1FJGQ 4A4IA 4DUYL 4Y52H 2K50A 1P8LA 1I5FA 4R1JA 3PIOA 2ZTEA 5LMNL 5C3EH 3ULPA 4JI2L 4LF6L 3M7NA 5FLMG 1WCMG 1MJEA 4DUZQ 4DV3L 1X65A 1KC8C 2A1AA 2UXBL 4A3DG 5IYDG 3B6YA 1KQSA 4A3GG 3PUXA 1IBLQ 3S1NH 2JA6H 1D8LA 2ID0A 2R7FA 1YHAA 5C4JH 4JI0L 2ZJQA 1LYLA 1HNWL 1LUZA 4DAMA 1A63A 1W3SA 4JI6L 2UXDQ 5IT9c 3CCQA 5GADC 1MIUA 3PV0A 4JBMA 1JJGA 2Q2IA 5IY0A 1Q1BA 1SN8A 4X66L 4LFBL 1HZAA 2JA6G 4AYBG 4PMWA 4O2DA 4HJAA 5LMNW 1E22A 1PH2A 1NY4A 4A3JH 1SR3A 5EAYA 4EQ5A 5IWAQ 3PUZA 1PH3A 1N34L 1N33L 1Z9FA 4JOIA 4HIDA 1SRUA 1HJPA 4FDBA 1EOVA 2F52A 2R6GA 2BH8A 2RF4A 5ELOA 5M5WH 1VQOA 3CC4A 2XTIA 3AQQA 4DV7L 1PH5A 4LF4Q 2E5LL 4A76A 3PO2G 2Z0SA 3I7FA 1VQNA 3PCOB 1A8VA 4B3TL 3A74A 1R9TH 4JBJA 1KXLA 1XTDA 4GNXB 1J5EL 4DR7Q 1I6HH 1EUJA 1HNXQ 4P73A 3HOZH 3UDFA 5J3BA 2UUCQ 2QEXA 1TWFH 1WFQA 3PGZA 3HOWH 1BBWA 4OO1I 3AFPA 4O0AA 3M85A 2MFIA 1G6PA 4UP7A 4B3SL 2WP8J 5IP9G 1VQ7A 3CQZH 1QVCA 4JI1L 3F1ZA 3EIVA 1JB7A 4JV5Q 1KHIA 4IJLA 3OW2A 1IBMQ 1VQKA 2Q2TA 4IFDJ 3I4OA 1VQFA 4X62Q 3HOZG 4EX5A 3NENA 3T1HL 3T1YQ 3CW2C 4AH6A 3CCMA 3BU2A 2VZAA 1XNQL 1FL0A 4QL5A 1EYGA 3F2DA 2HIVA 1VQLA 3GTOH 1A0IA 3PUVA 4HIKA 1O7IA 3CMAA 3S24A 5IYCG 3A0JA 4LF7L 2PI2A 4A93H 4BXXH 4JYAL 4PZ8A 2VQEQ 4JI8Q 4DV4Q 3I4MH 3K7AH 4JBWA 4DV5L 1PV4A 5JEAJ 4MNOA 1Y1VH 4TQUS 1V1QA 2PNHA 3M4QA 3K81C 1YBYA 3GO5A 4YHHL 3I4NH 4RMFA 2QGQA 3KJOA 3H3VI 2I0QA 3S2HH 4A93G 4BXXG 5DLQE 3I4MG 4AQYQ 3IRBA 3CD6A 2FXQA 1Q7YC 4XTCS 3I56A 1JMCA 2JA5H 4L5QA 4JI4Q 1M1KC 5LMNQ 3J81i 3A5UA 5C44G 4R4IA 4DV3Q 1GD7A 4APVA 4DR4Q 4WJ3M 3J81j 2OQKA 3I4NG 3U4ZA 3CCJA 3HFZB 1IYJB 4OX9Q 4GLVB 5H1SE 3ERSX 1HZCA 2VUMG 2LXKA 1Y1WH 2JJQA 3S1QH 1QVGA 2RHQB 4JI0Q 1D7QA 4NXNQ 1VQGA 4WJ4A 4A75A 4LNQA 4OWXB 4C2MH 4JI6Q 3JC66 2B3GA 3PUYA 2KENA 3CCUA 1PH9A 2YV5A 1L2FA 2EIFA 3BZCA 3STBD 4JI5L 1HNZL 2E2HH 3KFUA 2GVAA 3S14H 4KHPL 1GKHA 3D0FA 4X66Q 4Y7NH 3CMEA 1UE6A 1Y1WG 2ASBA 3GTPH 3WWVA 2JA8H 4XIGS 3E0EA 4JCVE 2MO1A 4BBRH 1N34Q 4R4QA 4GNXC 2IHFA 3CXCA 3M9BA 1AH9A 1N36L 1VQJA 2K52A 2WFWA 3PIPA 3S1RH 1WI5A 4L5SA 1WCMH 1EWIA 3TS2A 1E7ZA 3W5OA 2NVYH 4YCWA 1VQHA 4A3IH 4GOPB 1XMOQ 2EQSA 2JA8G 3RR5A 4YCUA 3KYHC 2WAQE 1PH4A 4BBRG 3U58A 1NJIC 2GN5A 1X9NA 1HR0L 3W1BA 3ZJYC 2ZM6Q 4DV0Q 3J7ZC 3TS0A 4LUZA 4LF8L 5C0XJ 2E2IH 1J5EQ 2UU9L 4DV2Q 2OQ0A 3GDEA 4J15A 2Z6KA 5IYBH 3RLFA 3TREA 4A3IG 3GTJH 2GVBA 4P72A 4LW1A 4DV1L 4BBSH 3HOUH 2N49A 3H0GH 1B70B 3KF6A 4LFCL 4R4OA 5M5XH 4MZ9A 1P16A 5LMUL 1JE5A 4A3LH 2CQOA 5M3FG 5JJIA 1KAWA 4BY1G 2VNUD 1TWCH 3DM3A 4X64Q 2N8NA 1K3RA 5IYBG 1U0LA 1HZBA 4RG1A 4C3JH 2I5HA 2UUBQ 4LFAL 2IX1A 4K0KL 5BR8Q 1HR0W 3E9IA 1K8AC 4YWKA 1PH1A 3MEFA 3PO2H 1WYDA 1CKNB 4HJ5A 2HHHL 4BBSG 5M3MH 4DR2Q 2CCZA 2BH2A 3HOUG 2D0OA 3H0GG 4LF7Q 4JYAQ 1YJWA 3OTOQ 4A3LG 1NTGA 1YJ9A 1LM0A 3RN5A 3L2PA 4DV5Q 4DPGA 2VQFL 4OWWB 1CKMA 2JE6I 1N32L 5GQOA 5GROA 2CWAA 1X55A 1VQMA 2WAQG 1K0RA 2AWNA 4DR5L 5JJLA 2PMZE 3GD7A 4IO9A 1I3QH 4R4CA 2IT1A 4PG3A 4HJ7A 2NVTH 3GTGH 4GLXA 2JK8A 4R4TA 4UP8A 2DGYA 3STBC 5IP9H 5M3MG 1XJVA 2B63G 2YTYA 4MTNA 3CCEA 4DR6L 2IHEA 1EIYB 1ASYA 5JEAG 1S40A 1C0AA 1AE2A 1E24A 3UDXA 1PH8A 2R93G 1WJJA 3NBHB 4X65L 2UUAQ 4A3BH 1C7YA 5JJKA 4C3HH 1JT8A 1KIXA 1I50H 1X3FA 4JG2A 3EN2A 1CUKA 1I94L 4GN5A 4C3IH 3I55A 4NXMQ 2RHSB 5IYCH 3S16H 4DR1L 1VCIA 4OO1G 5C4XH 1OXTA 3EBEA 1NMGA 4GNXA 2PQAB 4LUVA 2Z6KC 2NVQH 1Q46A 2AKWB 5GAHC 4OWTB 1K83H 4A3BG 1Q12A 5HY6A 3NEMA 4GOPC 3L0OA 3HOXH 3VDYA 4JI5Q 1YEZA 1X3GA 1X3EA 4KHPQ 1PFSA 1FGUA 1Y14B 4YWLA 3G6EA 4GKKL 4QQBX 4NB3A 4BY7H 5C4XG 3SGIA 1IBLL 2NVXH 1N36Q 3H3VH 4POFA 1YI2A 1VQ8A 4LF9Q 3BZKA 3ER0A 5C44H 5AJ3Q 3I2ZA 3HOXG 1YZ6A 4BA1I 3KDFB 1L1OB 1X6OA 3W1GA 4GKJL 4B3MQ 3L7ZC 2UXDL 2KHJA 2VUMH 4PZ7A 1T9HA 4UP9A 2VL6A 3D31A 4BY7G 1HR0Q 1HH2P 2ZTDA 3LGJA 4L5TA 1H95A 1QVFA 3S1MH 1BBUA 4DUYQ 3U4VA 1U5KA 4LF6Q 1PVOA 5K36G 1VQDA 2AMCB 4NPSA 4JI2Q 1UE7A 5IWAL 2JEAI 3PO3H 4LF5L 2IX0A 5C0XI 4LWCA 2UXBQ 3JAMi 1SMXA 2HIXA 4DK6C 3S17H 1FVIA 3M4OH 1SFOH 1G291 2XGTA 4LF4L 1MKHA 4JI7L 4UPAA 1TWAH 1UWVA 5FJ8G 5C0XG 3RN2A 1VQ6A 1HNWQ 1SLJA 4HIOA 4JC0A 4YCVA 1QUQB 1K8GA 1Q8KA 1IBKL 3K0XA 3PO3G 3CC2A 3J80i 2KCMA 2E2JH 4TVAB 1PH6A 3HOVH 1VQ4A 3S15H 4JBKA 1HNXL 1VQCA 5HGQA 4LFBQ 3CPWA 2LXJA 4KHZA 1BKBA 2MNAA 2JA7H 3K80C 1N33Q 3TEHB 2ES2A 2YYZA 5IP7H 2K5HA 1V9PA 2OTLA 3PF4A 2R7DA 1MJCA 3DLLA 4A3EH 4L5RC 2R92G 1E1TA 3KF8B 1N32Q 1GVPA 2CWPA 4DV7Q 1IBML 3HOVG 2BA1A 4DR3L 2E5LQ 2UXCL 4X62L 4IPGA 1VQAA 3T1YL 1VQ9A 2JA7G 3RLOA 1YIJA 2D0PA 4B3TQ 2ZTCA 5IP7G 1LTLA 3G71A 1KD1C 4DR6Q 2C35B 1N8RC 5M3FH 4IPDA 2H5XA 4A3EG 1C9OA 4BY1H 1UEBA 3S2DH 4A3CG 1TWGH 2OCEA 3K7UC 4JI8L 4DV4L 2D62A 4YY3L 4GOPA 4B3SQ 3GTLH 2K4KA 4DV6L 1I94Q 1E3PA 1YNXA 1PYSB 2VS1A 3NELA 4JI1Q 1M90C 1QZHA 4POGA 4A3KG 2NN6I 4DK3C 4HJ8A 3T1HQ 4JI3L 1OXVA 3RZOH 1Q82C 4B3RL 4AQYL 1VQEA 1VQIA 1L1OC 4IFDI 2R7ZH 1XNQQ 4QGUA 4JI4L 4DAYB 2WB1E 1CSQA 1CKOA 1NMFA 1X56A 2NN6G 3KJPA 3CC7A 1B8AA 3KLWA 1YHQA 2QA4A 5M5YH 4DR4L 3F2CA 4GKKQ 2B63H 1EQRA 4IFDG 1XPUA 4IPCA 4OX9L 3HKZE 3CF5A 4KI0A 4P71A 4NXNL 2R7ZG 3HOYH 2R93H 1N9WA 2Y0SE 1PHJA 4YHHQ 3A5ZB 1HZ9A 1B7YB 1X54A 5C3EG 1Q81C 1OTCA 3MXNB 1CKNA 4GKJQ 2OTJA 1J6QA 1SE8A 2LSSA 2IY5B 1KL9A 1XMQL 1KRSA 4QIWE 4YWMA 3TRZA 4AIMA 4ALPA 2AHOB 2NZOA 4GLAC 3HOYG 1PYBA 2YTVA 4PZ6A 4LF5Q 4KLKA 3M4PA 4P74A 2Q2UA 3FKIH 1TWHH 2Q2HA 4HIMA 1RIPA 1DGSA 4DNIA 1XNRL 2L15A 2VY3A 4JI7Q 3RNUA 3CCSA 1XMOL 1YITA 2F4VL 2WB1G 1IBKQ 4A3JG 1L0WA 2B29A 1NE3A 2N78A 2ZM6L 4DV0L 3FHWA 1S72A 1FJGL 4H02A 2A19A 4OXPA 3FKIG 3UE1A 1HNZQ 4A3MH 4QY7A 1RL2A 1V43A 4DV2L 4DUZL 1K73C 3HKZG 2YU9H 2E8GA 2F3IA 3CAMA 2Y0SG 1EIFA 2PQAA 4DKAC 2ALYB 2MQHA 5GAGC 3M3YH 3G4SA 4X6AH 4DR3Q 2UXCQ 4A3MG 1OXXK 1K9MC 1S3OA 1QZGA 1YHBA 4X64L 2ATWA 3UDIA 2UUBL 3UDGA 3HOWG 4IPHA 5BR8L 4GN4B 3AFQA 3ULLA 5IE8A 5FJ8H 2CFMA 2KHIA 3J7A5 1AE3A 1NBWA 4LF8Q 3GTMH 1SROA 3AYHB 4DR2L 1ASZA 2UU9Q 1VQPA 3OTOL 3GTQH 2OWOA 2JQOA 1OXSC 3KDFA 1L1OA 3K8AA 4YY3Q 1KRTA 4DV1Q 1Q86C 4P75A 3E9HA 3G48A 3KOJA 2I5LX 1JJ2A 4DV6Q 4OONA 3RLNA 3CCRA 2BA0A 2K5NA 3PUWA 4ME3A
chains in the Genus database with same CATH superfamily
3F8TA 2E2DC 2XNAC 1Z47A 1IL2A 4TRDA 4JI3Q 5ELNA 1DOLA 1OXUA 4FF4A 2BDNA 1D2BA 1JQYD 1YJNA 3A7LA 1CHPD 4WJWA 4HTHA 3H15A 1H9SB 2N55A 3SE0A 3CCLA 3CP0A 2PW7A 2FFKB 2R92H 2NVQB 3R3OA 1XMQQ 2K5QA 3HOXB 2AUJD 1F9PA 2VQEL 1VQ5A 5LL6X 4RHRA 1E1OA 2NBFA 4PV1C 4BA2I 2R92G 2RCNA 5FLMH 1XNRQ 2CKZB 4DR1Q 1ZYRC 4OL7A 1TXYA 2NTSA 1XPRA 1UE1A 4F87A 5C4HA 5IYDH 2F0UA 2VUMB 1EEFD 1CI3M 4R1JA 1JC7A 5LMNL 2ZTEA 5C3EH 5FLMG 4OIJA 2UXBL 5IYDG 4RWSC 3B6YA 3LWEA 2CH4A 1IBLQ 2R7FA 4JI0L 5E4WC 1WVLA 1LYLA 2L1BA 1TWAB 4DAYA 1SYDA 3J7YW 2A6EC 3CCQA 4JBMA 1RHPA 1JJGA 5IY0A 1Q1BA 5IGBA 1HZAA 2FMCA 3S15B 4N8FA 2JA7B 1Z9FA 1TS4A 1SRUA 1K0SA 4S3SA 3NHHA 2R6GA 1VQOA 2BH8A 4IUPA 1F9RA 4UAIA 4DV7L 1HFNA 2Z0SA 2NVYB 4F8MA 5NUCA 2EY2A 1HA5A 4DR7Q 1EUJA 1HNXQ 5EKKA 5J3BA 1O78A 2B2VC 3PGZA 3HOWH 3S2DB 3AFPA 4O0AA 3LNNA 3M85A 2MFIA 5ELFA 1JE4A 3FRPB 1QVCA 1R4QB 3F1ZA 3V05A 3EIVA 4IJLA 3OW2A 2Q2TA 1FD7D 4IFDJ 2B2WA 4AH6A 3GTOH 2HIVA 3SK5A 4CDCC 4HIKA 1O7IA 1EZ8A 3S24A 5IYCG 3A0JA 4A93H 4BXXH 4IN3A 4X3SA 4F7XA 5M5YB 3ERQA 3I4MH 4DV4Q 3OOCA 4HN7A 1EL0A 1SNOA 1Y1VH 1X3QA 5FO7B 1GHKA 1V1QA 3K81C 2HCIA 4RMFA 2QGQA 3KJOA 2I0QA 1PTOF 3O13A 3I4LA 4A93G 3K58A 4BXXG 3I4MG 4L63B 3NUCA 1JMCA 3J81i 5C44G 4WJ3M 1V1PA 5KRUA 3CCJA 5J39A 4HCSA 4WFN3 1IYJB 2LXKA 2JJQA 1D7QA 4WJ4A 4A75A 2ZXOA 2KECA 4MN3A 4C2MH 3AU7A 1JWMD 4CDFC 4JI6Q 2B3GA 3FVQA 3CCUA 1L2FA 4JI5L 3URYA 4PNYA 3CMEA 3GTPH 1D1KA 4XIGS 1FYCA 1F2MA 1PRTB 1SYEA 4BBRH 2WACA 4R4QA 5CBAE 4GNXC 2IHFA 2YU9B 3M9BA 1TVXA 1F9SA 1EU4A 1VQJA 2K52A 2WFWA 4LMQD 3PIPA 2QILA 4X3UA 3E5SA 3M3YB 1JOQA 3DWAA 3W5OA 4Q0FA 4GOPB 2EQSA 3HEJA 3M7GA 5FOBB 3EVQA 1PH4A 3KYHC 1HR0L 3G7LA 4BBRG 3U58A 1NJIC 4DV0Q 1LLRD 2L11A 2EDGA 5IOCA 1RD9D 5CV8A 2Z9HA 3GDEA 1W6KA 3R2TA 1QE6A 4CDDC 3TREA 2PCFB 1AN8A 4H13C 3V96A 1Q3LA 3H0GH 1B70B 2M00A 4G7ZC 3KF6A 1WTWA 2KJXA 1P16A 2F03A 3EJIA 1BR9A 4BY1G 1TWCH 2N8NA 3NWTA 4B9WA 4C3JH 1VF5C 5BR8Q 1QNKA 3MEFA 5JAVA 1D1IA 3DWQA 2CCZA 2BH2A 3H0GG 2D2CC 3I90A 1CKMA 2JE6I 1N32L 4C3JG 1VQMA 1K0RA 2AWNA 1D6EC 2NVTH 3DUZA 4GLXA 4R4TA 4UP8A 3STBC 5IP9H 5AFWA 2R92B 2B2TC 2EOTA 4TKOB 1RF2D 3K5OA 3F2UA 3UDXA 4ZKCB 4XXEA 5JPMC 1WJJA 4A3BH 1KIXA 2NTTA 1LABA 4GN5A 4C3IH 4NXMQ 2TMPA 3T51B 4DR1L 1VCIA 4M1UB 5DM63 4FF1A 1BO0A 1EYDA 1TY0A 1QG7A 1K83H 1BF4A 1Q12A 5I9OA 1XYIA 3NEMA 4A3BG 1CFMA 1JICA 3VDYA 1F2ZA 1X3GA 2F3VA 4KHPQ 1FGUA 1Y14B 4C3IG 1JB3A 3GP7A 3ND8A 1H9RA 5C3EB 4DF7A 4QQBX 3SGIA 1IBLL 2NVXH 4K2LA 2NB0A 3H3VH 3BZDB 1G8ZD 3BZKA 4ZYSA 2JP1A 1S5ED 3KDFB 3NSWA 1X6OA 5CORA 5KNDA 2CQAA 4PZ7A 3MVVA 3LGJA 2F0QA 3S1MH 4DUYQ 2AMCB 4JI2Q 1TR5A 1SJED 4ZLTF 2IX0A 3W2DA 2HIXA 2K7VA 3S17H 1G291 2XGTA 1LTGD 3DHQA 2F0FA 1AZQA 1HNWQ 1SLJA 1KLUD 4JC0A 2J4XA 5K5PA 3K0XA 2Y0SB 3CC2A 3J80i 3VR3A 2K03A 1LT6D 4TVAB 3HOVH 1XX8A 1HNXL 5HGQA 4KHZA 1BKBA 3KBGA 5IP7H 2VB2X 3HOWB 2Z4HA 5I2XA 3DLLA 3QOLA 4L5RC 1E1TA 3KF8B 4PMCA 3HOVG 4DR3L 5IGFA 3JAME 3NK9A 4V0BA 1VQ9A 4FYDA 2N88A 1EY7A 3RLOA 2D0PA 4B3TQ 5IP7G 4XT3B 3GTOB 2NZ1D 5M9OA 5M3FH 2H5XA 2K5WA 1HFGA 3GTMB 1C9OA 4A3CG 1TWGH 3T53B 4DV4L 4A93B 1HUMA 3I4MB 3I73A 2DY7A 2HD3A 3BDOA 4B3SQ 4H7BA 3QB3A 3P20A 4JI1Q 1M90C 1Y1VB 1QZHA 3A8KE 2SDFA 2KEDA 2B2UA 4KY7A 3T1HQ 3RZOH 1T5XD 5FLXE 1IHZA 1L1OC 1NMFA 1K8OA 3KJPA 1PFMA 1B8AA 3VR6A 3F2CA 2B63H 4RKBA 4DGZA 1QWYA 2PZTA 3FEWX 2PNRC 1W6JA 3H6MA 4P71A 3AB9A 2HQEA 2Y0SE 1PTOD 2D5DA 3A5ZB 4YHHQ 4GKJQ 1O80A 4C2MB 3LWUA 1LTSD 2DNEA 3H94A 2X6LA 2BE5C 3DEOA 1B1ZA 1PZKD 2QKIC 4GLAC 3GTPB 2YTVA 4PZ6A 2KUMA 4KLKA 4BBRB 1TT2A 1B9NA 1MHWC 2L15A 2VY3A 4JI7Q 3RNUA 1PRTF 3NTKA 4FF3A 2WB1G 1IBKQ 2B29A 1NE3A 5CMDA 4DV0L 1S72A 3NBHA 3IFTA 1HNZQ 4A3MH 2KEEA 4DUZL 3HKZG 4LK1C 2E8GA 1SXTA 2F3IA 1L0YB 3TP5A 1Y8OB 2MQHA 5CV5A 5DAUA 4X6AH 4A3MG 2F0NA 1C48A 5FO9B 1SNMA 1YHBA 2HDMA 3NBIA 3MXPA 5FK9C 1TWCB 5BR8L 3ULLA 4C3JB 5FJ8H 2CFMA 3J7A5 4RGOS 1YNJD 2UU9Q 1HUNA 4KKSA 2DN8A 3A55A 4XQQA 1D5MC 1KRTA 4DV1Q 1Q86C 3E9HA 3KOJA 1QOHA 4OONA 3PUWA 4ME3A 2A68C 4LFCQ 5LMUQ 1PH7A 4QJFA 2MO0A 2NVTB 2X69A 1GM5A 2ICIA 3P7JA 4QCLA 3FP9A 4LFAQ 3VA5A 4K0KQ 3MZ5A 2UUCL 5HURA 2AWOA 1G51A 2PYKA 2K05A 3SEBA 3D4WA 1IZ6A 4A3BB 1WD0A 1EQQA 2K75A 3V2TA 4NXML 1QUQA 1A3TA 1VQBA 4CJ2C 4UY8C 4C3IB 4JV5L 2Z1CA 1SYFA 2G5DA 4X3TA 5CYUA 3J80c 1I4PA 3BYYB 1VDZA 3A56A 3ULJA 1K83B 1GO3E 3PMFA 5T1GA 1BBXC 2K14A 4IJHA 3R2IA 1EOTA 2B2WC 2YTXA 2NVXB 2JEBI 2MUYA 4K5XA 3EQLC 5A2QL 2KBNA 3F2BA 2PO4A 4A3GH 2F4VQ 1YNNC 4GS3A 4KV6A 5KNBA 3UI2A 1FJGQ 1SNCA 4DUYL 4DNRB 1FNUA 1I5FA 1P8LA 3KLSX 5KYIA 3S1MB 4JI2L 1EFID 1WCMG 1LTRD 4KKUA 1KQSA 4A3GG 1TY2A 2PQEA 2F0VA 1LTAD 3MWYW 1SSOA 3S17B 2ID0A 1VF7A 1YHAA 3X3NA 1A15A 5C4JH 1HNWL 2DY8A 4DAMA 2KA7A 5I4DA 4OGQC 5GADC 4NDXA 4NKLA 2K32A 2Q2IA 3HOVB 1SN8A 4X66L 3A7AB 3J81L 2MHVA 4AYBG 4PMWA 5E1FA 1N34L 1SR3A 3NXWA 1PH3A 3PUZA 2JA8B 4HIDA 1STYA 3ITPA 4HSPA 1M4VA 1EOVA 2K04A 1RKNA 5M5WH 3VR2A 3CC4A 1KNEA 4A76A 3PO2G 1VQNA 4MIUA 2QF7A 4G7OC 4B3TL 4GZYC 2FHTA 3A74A 1R9TH 4HMJA 1J5EL 1I6HH 3DWPA 5M3FB 3K5MA 1DD2A 1BBWA 1TWGB 1I4HA 1G6PA 5I6WA 4B3SL 4JI1L 3C1FA 1U4RA 1JB7A 1LTID 4ZK9B 1DXMA 4X62Q 2WKCA 3EA6A 3NENA 3NTHA 3CW2C 5C5LA 3T1HL 4U673 3BU2A 4K5VA 3RZOB 1HRJA 4XYOA 5EPJA 4XT1B 2RA4A 4JYAL 4MHEA 3MXUA 2B63B 1XXGA 4JBWA 2EJGC 2BCOA 3TP7A 1SYGA 2PNHA 4LJZC 4YHHL 3I4NH 2A5HA 5IGCA 1EY8A 1EU3A 1G6ZA 1QB5D 3CD6A 4YIJA 1Q7YC 1EY5A 4JI4Q 3A5UA 4DV3Q 1GD7A 2WB1B 4DR4Q 3I4NG 3X3MA 2Q8IB 4OX9Q 3ERSX 1Y8NB 1Y1WH 2RBMA 1S4ZA 2MGSA 1QVGA 1E2VA 1VQGA 5CV9A 3HKZB 1WTRA 2F0GA 1SNPA 1XTCD 2F3WA 2PMZB 1I4XA 2KENA 2YV5A 3BZCA 1HNZL 1GKHA 3D0FA 4Y7NH 4A3MB 1Y1WG 2A73B 1Q90A 3E0EA 2MO1A 1IYVA 1H9SA 1ZEQX 1WI5A 2G9DA 1E7ZA 1PRTD 1VQHA 2EPBA 4A3IH 1STNA 4K2KA 3FPUB 4KY6A 3D3RA 2ZM6Q 3J7ZC 3TS0A 4WRDA 5C0XJ 2UU9L 1ICFB 4DV2Q 2Z6KA 1AP0A 1TQOA 4A3IG 3GTJH 2EJFC 4CKEA 3OPOA 4J8QA 4DV1L 1PFNA 2DJGC 2N49A 1ONLA 3D4DA 4LFCL 4A3LH 5LMUL 3U9OA 5JJIA 4FNFA 3DM3A 1K3RA 3T56B 1U0LA 4LFAL 2IX1A 4K0KL 2I46A 4QB4A 4YWKA 1PH1A 1CKNB 1WYDA 4HJ5A 5M3MH 4DR2Q 4LF7Q 4A3LG 1EQTA 3OWFA 3VR5A 1YJ9A 1LM0A 4DV5Q 1GHJA 2RSOA 3TDQA 4LAAA 5GROA 2WAQG 2PMZE 4IO9A 1I3QH 4R4CA 5A35A 1Y8PB 2DGYA 3DEPA 5M3MG 3J80L 1XJVA 4BS9A 3H91A 3MA2B 1JR0D 1EIYB 1ASYA 1S40A 1B3QA 2OXPA 1E0BA 1E24A 3SDZA 1PH8A 2R93G 2XWJB 1ILPA 1C7YA 1VMCA 1X3FA 3EN2A 5ELDA 3BVZA 1DYQA 3S16H 5IYCH 2F0SA 5C4XH 1OXTA 4QF4A 1NMGA 2PQAB 4A3GB 1K28A 2AKWB 3MXGA 3U9SA 2EVBA 5JPNC 1X3EA 2NUCA 2F0KA 4YWLA 3G6EA 1T5EA 4GKKL 5IGGA 3PIP3 1NCVA 4NB3A 2B2UC 4BY7H 5C4XG 1DONA 2NWGA 1N36Q 1JWUD 4ZKBB 4LF9Q 3ER0A 4AYBB 5C44H 5AJ3Q 1IL8A 5C4JB 1DZ1A 3L9AX 4B3MQ 3L7ZC 1NR4A 2KHJA 2E74C 4BY7G 1H95A 5C0XH 1PMRA 4XQJA 1QVFA 3U4VA 2EYOA 3PO3H 1UE7A 2JEAI 5C0XI 4LWCA 4C56C 1TS5A 1SMXA 1FVIA 4RAUC 1SFOH 1RDPD 3M4OH 5M5WB 4UPAA 1UWVA 5C0XG 3RN2A 1EIGA 4YCVA 1Q8KA 3PO3G 1FR3A 3LX0A 4CDEC 1GUSA 2A69D 2VB3X 1R9TB 1VQCA 1I6HB 4QIWB 3CPWA 1N33Q 3TEHB 1V9PA 3PF4A 3T16A 2AQ2B 4A3EH 1NNXA 2CWPA 1DJRD 3MEHA 5E4XA 2QDBA 4QMGA 4X62L 4IPGA 1BXTA 3ND9A 4H44C 1LT3D 3G71A 4DR6Q 1RTOA 4A3EG 5JJZA 1G91A 4BY1H 1S5FD 1D5XC 1LO5D 2OCEA 3K7UC 1EZ6A 2D62A 4YY3L 5C6AA 1GUNA 4GOPA 2NN6H 2DJFC 4DV6L 1I94Q 1E3PA 4POGA 4IFDH 4A3KG 2NN6I 4HJ8A 3I4NB 1ET6A 1LTTD 2D9UA 4JI3L 1KTKA 4IFDI 2R7ZH 4JI4L 1BCPB 2NN6G 1PZID 3KLWA 2J0TD 3P1HA 2QA4A 4DR4L 1JORA 4Z9CB 4IFDG 1Z6HA 4CJ1B 4OX9L 3E3XA 4G7HC 5CBEE 1EEID 3CF5A 1Y1WB 2R7ZG 1N9WA 3SR1A 3IFDA 1X54A 1B7YB 1JOKA 1SE3A 2EYHA 1J6QA 1SJHD 1KABA 1KL9A 4IALA 1XMQL 1KAAA 4QIWE 4YWMA 1SAPA 3TRZA 4Y7NB 2AHOB 3HG9A 4LF5Q 3R93A 2F0JA 4P74A 2Q2UA 3FKIH 1ET9A 4DNIA 4DXFA 1XNRL 4I7AA 3VA7A 1MSGA 4E6IA 5ELBA 1SMYD 4A3IB 1YITA 1J8IA 2WIIB 5IIFA 4A3JG 3BVGA 2R3ZA 2ZM6L 3FHWA 2NYZD 4H02A 2GA4B 2A19A 3FKIG 3UE1A 2F0EA 2HCCA 1ILQA 1RL2A 1V43A 4DV2L 2M9VA 4IQZA 3CAMA 1A2UA 1UAPA 1FGBD 5JVH3 3GTJB 5EKLA 4DKAC 2ICEC 1AZPA 1QILA 3OIQA 3S9WA 2UXCQ 1QZGA 2ATWA 3BYTB 1NR2A 3UDIA 2V4DA 1NSNS 1UUPA 2KHIA 1AE3A 3CRLC 4DR2L 2ZXPA 1ASZA 1VQPA 1H9JA 5M3MB 2XWBB 1OXSC 4ZRZA 2RVLA 3KDFA 3VYRA 3VYTA 3C3LA 3RUZA 1PTOC 2BA0A 2K5NA 1EYAA 3PSIA 1I3QB 3OW7A 2K5VA 3PIO3 1IKMA 3N6RA 5J22A 1A62A 4QUFA 4B3RQ 3GTKH 4DR7L 1QNUA 1II3A 3J81c 5E7NA 2HHHQ 2A8VA 2L55A 2VQFQ 4A3FH 3OMGA 1EIHA 3UE0A 1IYUA 1RTNA 3BS1A 4JW0A 3S16B 4A3CH 2DUDA 2JA5G 1BVSA 3OHXC 3I3CA 3BJUA 5C4XB 3DXJC 2EY6A 1AW7A 2EXDA 1VS0A 2F4IA 3HGBA 3QIAA 2SEBD 1XPOA 1YVCA 4A3FG 4HJ9A 1WOCA 2ZJPA 2A6HD 1Y69U 3KF8A 2CH4W 4BY7B 2HQLA 2PI2E 3HKSA 5C5MA 1EFWA 5CC4A 3KK7A 5FO8B 2MP1A 4LF9L 3MTSA 5AJ3L 1HA6A 1KDBA 2NZHA 3K57A 2BDOA 5C44B 1GXDC 3RZDH 4B3ML 4A3DH 5EBDA 3CCVA 4LUOA 1JJCB 2XSCA 1CA5A 3OYYA 1YNJC 2K5DA 3GV3A 1HHVA 5TSSA 2K50A 3PIOA 4V190 1OO9B 1X65A 2F0TA 1KC8C 3PO3B 2A1AA 1JCKB 4A3DG 3QOJA 3P75A 1D8LA 3M4OB 1SFOB 4TSSA 1E2ZA 2F0PA 1Q8IA 1LUZA 3TZDA 2MPMA 1A63A 1W3SA 3D8GA 2JSOA 2F0MA 4KMUC 4JI6L 3C46A 5IT9c 2UXDQ 1MIUA 1PXUA 4O2DA 1E22A 1O7LA 1NY4A 2F0DA 2K01A 5EAYA 4EQ5A 1N33L 1HTPA 5J1ZA 4JOIA 4FDBA 1HJPA 2RF4A 1TIID 3WOFA 1MGSA 2XTIA 1B3AA 4A3EB 1PH5A 4LF4Q 3RMHA 1A8VA 4O42A 4JBJA 1KXLA 5EPKA 4GNXB 4P73A 3UDFA 5IODA 4HSVA 4I65A 1TWFH 1WFQA 4BY1B 4OO1I 4EQNA 4UP7A 2EYPA 2WP8J 1VQ7A 5EBCA 3H0GB 1G2SA 3I4OA 1VQFA 4IZ8A 4EX5A 2IL8A 3T1YQ 1SYBA 2JYOA 3CCMA 2LY7A 2C5CA 1FL0A 1VQLA 2R7ZB 4JPBW 2HDLA 3PUVA 1PFBA 2IW3A 3CMAA 1H9MA 3IL8A 4PZ8A 1CTMA 1GUGA 2VQEQ 3K7AH 4C1NI 3A54A 1STHA 5JEAJ 4MNOA 1ZKOA 1BCPF 4ZCKA 4TQUS 2B39A 3M4QA 3IAYA 1HQMC 4ABNA 3S2HH 5DLQE 4RHSA 4AQYQ 3IRBA 2FXQA 4XTCS 3I56A 5A2QE 5LMNQ 5F2DA 4R4IA 4APVA 1JWSD 3J81j 5EJWA 2VUMG 1HZCA 2L9HA 3FKIB 3KBXA 3VR4A 4JI0Q 1C8CA 1CQFA 4LNQA 1B9MA 1STGA 3JC66 4F88A 3K5LA 3PUYA 1EY4A 3KLSA 1UEAB 2E2HH 4KHPL 2QEJC 1UE6A 4K8JA 1CK1A 1U4PA 2ASBA 2O5JC 4PQXA 2E76C 4NP5A 1CT1D 3J7AF 1GJXA 3CXCA 1AH9A 3S1RH 3J81E 4L5SA 1WCMH 1EWIA 2F0IA 3Q6SA 2H4OA 2SOBA 1U4LA 2NVYH 4YCWA 4B08A 3RR5A 4YCUA 3NE5B 1VMPA 2GN5A 5KEEA 3W1BA 4XDXA 1WTVA 4RA8A 1DM0B 2E2IH 2CHBD 3D6WA 3RLFA 4RKLA 4R8NA 3HOUH 5I6YA 2EY1A 4R4OA 5M5XH 1JE5A 3QR8A 2CQOA 2VNUD 4RG1A 4ID6A 2I5HA 4RGTA 1K8AC 3GTKB 2PZUA 3G6JB 3PO2H 2HHHL 3E0JA 1CZGA 1RJTA 3HOUG 4DAPA 1YJWA 3OTOQ 1NTGA 3RN5A 2VXWA 3L2PA 1GUOA 2VQFL 4OWWB 2CWAA 4A3FB 1BNZA 3GTGH 4HJ7A 2HUGA 4PG3A 1BDOA 2JK8A 1IW7D 2QCPX 2A68D 1SDFA 5BN4A 2KOLA 4DK0A 4MTNA 3CCEA 2IHEA 2LFNA 2PPBC 5JEAG 1C0AA 3K0YA 2WINB 5KIXA 5CV4A 1ESRA 2UUAQ 5JJKA 4XYQA 4C3HH 1I50H 1PLFA 2RCFA 2O2LD 3OSOA 1PRTC 2RHSB 1SNDA 1ENAA 3BDCA 4DK1A 3EBEA 3RZDB 4A3DB 4LUVA 1EY0A 1Q46A 5DNFA 1GOZA 4DNTB 2RSNA 5HY6A 4C3HG 4GOPC 3L0OA 4JI5Q 1AFPA 1SE4A 3GQBA 2FMMA 3TP6A 4KHVA 4HMIA 1Z7TA 4POFA 1YI2A 5K36H 2B2YA 3I2ZA 1L1OB 4M8AA 3W1GA 4GKJL 2UXDL 3NPPA 5IT9L 1T9HA 4UP9A 2VL6A 3D31A 1HR0Q 1HH2P 4N9TA 4IUUA 4L5TA 1I6VC 1BBUA 4LF6Q 1PVOA 5K36G 3SVMA 4FXGC 2J7ZA 2L4NA 3JAMi 4DK6C 3QJYA 4LF4L 4JI7L 2G9HD 2KQ3A 1IBKL 3Q24A 3VYUA 2E2JH 3K6OA 1R4PB 4KTAA 4KKTA 1VQ4A 4JBKA 4LFBQ 4K6LA 3Q23A 3FMCA 1ENFA 2F0LA 3CHBD 4J1MA 1NAPA 1TWFB 4U68A 1B2TA 2R7DA 3D4RA 4WORA 4FP5D 2K6AA 4CJ0B 5C4ZA 1N32Q 2E5LQ 2OF1A 1VQAA 2WV6D 2FINB 3T1YL 1KDAA 1A2TA 2ZTCA 1LTLA 2C35B 1N8RC 4N9PA 3C2PA 3DMUA 4IPDA 1HXYD 3J80E 1UEBA 3KUPA 4DA2A 1STBA 1EQVA 1I4QA 3K7AB 1BUVT 1SNQA 2K4KA 4KY5A 3GTLH 2VS1A 3NELA 2EYFA 4FXDA 5T1IA 1KNAA 2CW0D 2EE1A 1BOSA 1ESFA 1EWCA 1Q82C 4AQYL 3S2HB 3D6CA 1XNQQ 4QGUA 1HPCA 4IUTA 2WB1E 1CKOA 4DAYB 1ML0D 1XPUA 3Q22A 2LMCB 1BCPD 3HKZE 4P2CB 5D3DA 4Q5VA 4ILWA 2R93H 3HOYH 5JOBA 3WOEA 5C3EG 2JXMB 3MXNB 1CKNA 2A69C 2LSSA 1O7YA 2BOSA 4AIMA 2E2HB 3A8JE 4ALPA 2F1MA 2NZOA 4IUVA 5FKAC 3HOYG 3M4PA 3NTIA 5D65A 1TWHH 4HIMA 2SNMA 3MXNA 3S1RB 1WCMB 3CCSA 4FF2A 3I91A 2F4VL 2XN9C 4DFAA 2N78A 1F2YA 1FJGL 4O1NA 4OXPA 4QY7A 2E2IB 2RDFA 1WD1A 2KCNA 1M8AA 1X3PA 2Y0SG 4DU9A 4N8X1 3M4YA 2PQAA 3TZUA 2ALYB 5GAGC 3G4SA 3HOUB 4KJOA 4DXGA 1WTXA 4DR3Q 1K9MC 2AUKA 1S3OA 1ZYRD 5M5XB 4C1NK 4ZUJA 1J9OA 5CGKA 5ELEA 4KK7A 3K5NA 3HOWG 4IPHA 4GN4B 5IE8A 4ZQ3A 4LF8Q 3GTMH 3PO2B 4L8JA 1K3BC 3OTOL 3GTQH 2OWOA 1C4QA 1JJ2A 1LT4D 2B8GA 2I5LX 1V1PB 1NUCA 1CSPA 3GTGB 1XWEA 4JOIC 4OEMB 2HT1A 4GN3B 2A6ED 1UE5A 3NQIA 4CBVA 1LV9A 1U9RA 1Y1VG 3PF5A 2UUAL 2V1CC 3JAMc 4C3HB 1I50B 2C9OA 2ZJRA 1IXRA 3BDLA 2K33A 3CPFA 1SMYC 4DR5Q 2PW5A 2I5MX 4CKBA 4RH6A 1PA6A 2VW9A 2IX3A 3TBIB 3W3AA 2QW7A 1A3UA 3R8BA 4H0LC 4A3KH 3U50C 4IOCA 3AEVA 1ICWA 1CZWA 2QDLA 1GUTA 2KCTA 4X65Q 4AYBE 1WTOA 4OELB 1W2BA 3Q8DA 1Q1EA 5FLXc 1HQRD 1U4MA 3ICEA 2N3SA 4BWGB 3I72A 5IGDA 3Q0AA 1O7ZA 3TQYA 1B50A 2JA9A 5GAEC 3KF6B 4A4IA 2B8FA 4Y52H 3ULPA 3M7NA 4LF6L 1LT5D 3ONAB 1MJEA 4DUZQ 4DV3L 1STEA 5DEHA 4ZUIA 4QUCA 3PUXA 3S1NH 5EKIA 2JA6H 2LS01 1KLGD 2ZJQA 2CVRA 1PDQA 3PV0A 1EWHA 2E2JB 1F77A 4LFBL 2JA6G 1S5DD 4HJAA 1PH2A 5LMNW 4HCEA 4A3JH 5IWAQ 1MSHA 3N52A 1ENCA 1L0XB 5D3IB 2F52A 5ELOA 4K6DA 3AQQA 2E5LL 4G57A 3I7FA 1A6XA 3PCOB 3I70A 2M2LA 3H09A 1TU2B 1XTDA 3FDTA 2A6HC 2IJ0A 3HOZH 1F9QA 2UUCQ 2P5ZX 2QEXA 2Z6BA 1FNWA 1EYCA 3NP8A 1G2TA 5IP9G 3CQZH 2RDGA 3SK8A 3GTLB 4JV5Q 1KHIA 1IBMQ 1DOKA 2RKSA 4FXKC 3HOZG 3H3VC 4CHTB 2VZAA 1XNQL 1EYGA 4QL5A 3F2DA 4ODGA 2WAQB 1A0IA 1CM9A 1PZJD 4KD4A 2TSSA 1PYWD 4LF7L 2PI2A 1QCBD 5LHY1 4R8IA 4I7ZC 4JI8Q 1PV4A 4DV5L 3E6ZX 1GUWA 4ZAIA 2E75C 1YBYA 3GO5A 3HOYB 2R93B 5CR3A 3IKJA 1TS3A 3H3VI 1JOOA 5BN3A 4R9WA 2H1EA 4RGNA 1CQVA 1MI2A 2JA5H 4L5QA 3MAQA 1M1KC 1IKLA 1TKWB 1PTOH 4DAVA 2OQKA 3U4ZA 2IPKD 3HFZB 3NQTA 4GLVB 2OT2A 4K14A 4K5WA 2KCCA 5H1SE 1TWHB 3S1QH 2RHQB 4NXNQ 3GV6A 1SEBD 2Z8LA 4KD3A 4OWXB 1PH9A 3STBD 2EIFA 3S14H 3KFUA 2GVAA 4X66Q 2IWHA 2ENBA 3WWVA 2JA8H 3FPPA 2EJMA 4JCVE 1N34Q 3MFGA 3QWNA 2EZVA 2I07B 2XIWA 1N36L 5HGTA 2DNCA 3TS2A 3HP3A 4JK1C 2B2VA 3HZXA 1XMOQ 5JVG3 4RFBA 5I2YA 1CA6A 1HCZA 2XVSA 2JA8G 4IOAA 2WAQE 1VQKA 3SK4A 1X9NA 2K28A 3ZJYC 4LUZA 4LF8L 3ZYYX 1UNSA 2B2YC 1J5EQ 5LL6S 4HR7B 1MD2D 2OQ0A 5E3FA 4J15A 2ZT9C 4RCOA 5IYBH 5G3LF 3GTQB 2GVBA 2AQ3B 4P72A 4LW1A 2XRSD 1ZXTA 2L0CA 1TS2A 4BBSH 4MZ9A 5M3FG 1KAWA 4X64Q 2ZXRA 5IYBG 5KNCA 1HZBA 2UUBQ 2WKDA 1HR0W 3E9IA 2F0OA 5EQ0A 1B44D 2O5IC 3J7AV 4NMZA 3RD4A 4BBSG 2MJ8A 1S5CD 2D0OA 4JYAQ 1I4GA 4OIKA 1HTLD 3JAML 2RQXA 4DPGA 5IGEA 1SBBB 5GQOA 1X55A 4DR5L 4J6HA 1SYCA 5JJLA 3GD7A 5EGTA 2IT1A 4KJNA 2R61A 5KGUA 3CU7A 5ELCA 2B63G 2YTYA 4FO2A 4DR6L 4OO1H 2AQ1B 4ME5A 1AE2A 4A3KB 1S5BD 3NBHB 4X65L 1JT8A 3CRKC 4JG2A 3T13A 2KHSA 1CUKA 1K8MA 3I55A 1I94L 4RCNA 5FLXL 4OO1G 2L12A 4GNXA 1WTPA 3EROA 2Z6KC 2NVQH 5GAHC 4OWTB 3OWEB 2K1BA 3HOXH 1YEZA 1PFSA 1DCZA 4G4KA 1F2LA 2Q8RE 4IUQA 1I4RA 1X32A 2EY5A 4CGYB 3SXHA 3DM1A 3NWSA 3S1NB 1VQ8A 3KLRA 2JA6B 3A8IE 3EFXD 3HOXG 1YZ6A 4BA1I 3T4AC 3QG1A 2VUMH 2RDHA 2ZTDA 3QO2A 1SE2A 1U5KA 3OIPA 1VQDA 3MHBA 4NPSA 5IWAL 2EXZA 2EYMA 4LF5L 4A3JB 2UXBQ 3HRZC 1LACA 2A74C 4X3KA 1MKHA 1V8QA 1TWAH 4DN4M 5FJ8G 1IW7C 1VQ6A 4CKCA 1EY6A 4HIOA 4B9XA 1QUQB 1K8GA 3TMEA 3L3OC 2KCMA 5KYLA 1PH6A 3AMUA 3S15H 2BE5D 2LXJA 2MNAA 1B4OA 3HOZB 5EPLA 2JA7H 3K80C 2ES2A 4UHVA 1E2WA 1RCVD 2YYZA 2K5HA 2OTLA 4IURA 4OHJA 2B2TA 1MJCA 5CV7A 3CQZB 1H9KA 2FJ2A 1GVPA 3TP8A 4DV7Q 1IBML 2BA1A 2UXCL 5BN5A 2OEOA 1V1OA 5D14A 1AEXA 2EYJA 2JA7G 1YIJA 1STAA 5DM73 1KD1C 4EVOA 5CV6A 3HS0C 3BVMA 1BQQT 5C3WA 1A3VA 3S2DH 1CHQD 4HAEA 4NW2A 4JI8L 3CKIB 4KN7C 4KN4C 1YNXA 1PYSB 4EQPA 1MBYA 4DK3C 1DOMA 1OXVA 4B3RL 1VQEA 1VQIA 1FNVA 4EGVA 1CSQA 1X56A 3CC7A 1YHQA 2JA5B 1LTBD 2Z4IA 5I9PA 5M5YH 4MTKA 4GKKQ 1EQRA 2LKVA 3VYSA 1PTOB 4IPCA 5JEAH 4IUNA 4KI0A 3I8ZA 2F0HA 3TSSA 4NXNL 3S1QB 1PHJA 4JVZA 2Q8TA 1HZ9A 1OTCA 1Q81C 3PQIA 2OTJA 1SE8A 2IY5B 1KRSA 3S14B 5IT9E 2F0WA 3TN2A 1PYBA 4UDUC 4RGMA 1D5ZC 2Q2HA 4ULLA 4XQNA 1RIPA 1DGSA 4L6TB 1WTHA 3OMCA 3SK6A 1XMOL 2PZWA 1L0WA 1RODA 1EY9A 2L5TA 2SNSA 3C1EA 3WDNA 1K73C 1KDCA 4HEDA 2YU9H 2KVMA 5COYA 1EIFA 2EYLA 3M3YH 3MFYA 4K8IA 4BBSB 2CW0C 3K59A 1OXXK 3BG3A 4PMBA 4X64L 3MC0B 2UUBL 3UDGA 4EQOA 5L37A 1YNND 3AFQA 1NBWA 1SROA 3AYHB 5ISRA 1WTQA 5G3LD 5C3XA 2O4XA 1BCPC 2X6GA 2JQOA 1L1OA 3K8AA 4YY3Q 4FVMA 4P75A 3G48A 1B53A 4DV6Q 3RLNA 3CCRA 2JN4A 3SHLA 1QJOA 2XRQD
chains in the Genus database with same CATH topology
3F8TA 4LFCQ 1CSPA 3PSIA 5LMUQ 1PH7A 1Z47A 4QJFA 2MO0A 2K5VA 1IL2A 4IOAA 4JOIC 4JI3Q 5ELNA 1GM5A 1A62A 1OXUA 4GN3B 2HT1A 3GTKH 1UE5A 3FP9A 4LFAQ 4B3RQ 4K0KQ 4DR7L 3J81c 5E7NA 2HHHQ 1Y1VG 2UUCL 3PF5A 2AWOA 1YJNA 1G51A 2UUAL 2V1CC 3JAMc 2A8VA 1IZ6A 1EQQA 2K75A 4NXML 1QUQA 2VQFQ 1VQBA 2ZJRA 4A3FH 4UY8C 1IXRA 3CPFA 3UE0A 3H15A 4A3CH 4JV5L 2DUDA 3CCLA 4DR5Q 3CP0A 2JA5G 1BVSA 2I5MX 3BJUA 3J80c 2VW9A 1PA6A 2EXDA 2R92H 3ULJA 1VS0A 1XMQQ 1XPOA 1GO3E 1YVCA 4A3KH 3U50C 4IOCA 4A3FG 3AEVA 4HJ9A 1WOCA 2ZJPA 2K14A 4IJHA 2KCTA 2VQEL 1VQ5A 4X65Q 2HQLA 2PI2E 3HKSA 4AYBE 1E1OA 2YTXA 1EFWA 4BA2I 1W2BA 2RCNA 4LF9L 3Q8DA 5FLMH 1Q1EA 2JEBI 5FLXc 5AJ3L 1XNRQ 2CKZB 2NZHA 4DR1Q 3ICEA 2N3SA 3RZDH 1TXYA 4B3ML 1XPRA 1UE1A 4A3DH 5IYDH 2KBNA 3F2BA 4A3GH 3CCVA 2F4VQ 3TQYA 4LUOA 1JJCB 4GS3A 2JA9A 5GAEC 3OYYA 3KF6B 1FJGQ 4A4IA 4DUYL 4Y52H 2K50A 1P8LA 1I5FA 4R1JA 3PIOA 2ZTEA 5LMNL 5C3EH 3ULPA 4JI2L 4LF6L 3M7NA 5FLMG 1WCMG 1MJEA 4DUZQ 4DV3L 1X65A 1KC8C 2A1AA 2UXBL 4A3DG 5IYDG 3B6YA 1KQSA 4A3GG 3PUXA 1IBLQ 3S1NH 2JA6H 1D8LA 2ID0A 2R7FA 1YHAA 5C4JH 4JI0L 2ZJQA 1LYLA 1HNWL 1LUZA 4DAMA 1A63A 1W3SA 4JI6L 2UXDQ 5IT9c 3CCQA 5GADC 1MIUA 3PV0A 4JBMA 1JJGA 2Q2IA 5IY0A 1Q1BA 1SN8A 4X66L 4LFBL 1HZAA 2JA6G 4AYBG 4PMWA 4O2DA 4HJAA 5LMNW 1E22A 1PH2A 1NY4A 4A3JH 1SR3A 5EAYA 4EQ5A 5IWAQ 3PUZA 1PH3A 1N34L 1N33L 1Z9FA 4JOIA 4HIDA 1SRUA 1HJPA 4FDBA 1EOVA 2F52A 2R6GA 2BH8A 2RF4A 5ELOA 5M5WH 1VQOA 3CC4A 2XTIA 3AQQA 4DV7L 1PH5A 4LF4Q 2E5LL 4A76A 3PO2G 2Z0SA 3I7FA 1VQNA 3PCOB 1A8VA 4B3TL 3A74A 1R9TH 4JBJA 1KXLA 1XTDA 4GNXB 1J5EL 4DR7Q 1I6HH 1EUJA 1HNXQ 4P73A 3HOZH 3UDFA 5J3BA 2UUCQ 2QEXA 1TWFH 1WFQA 3PGZA 3HOWH 1BBWA 4OO1I 3AFPA 4O0AA 3M85A 2MFIA 1G6PA 4UP7A 4B3SL 2WP8J 5IP9G 1VQ7A 3CQZH 1QVCA 4JI1L 3F1ZA 3EIVA 1JB7A 4JV5Q 1KHIA 4IJLA 3OW2A 1IBMQ 1VQKA 2Q2TA 4IFDJ 3I4OA 1VQFA 4X62Q 3HOZG 4EX5A 3NENA 3T1HL 3T1YQ 3CW2C 4AH6A 3CCMA 3BU2A 2VZAA 1XNQL 1FL0A 4QL5A 1EYGA 3F2DA 2HIVA 1VQLA 3GTOH 1A0IA 3PUVA 4HIKA 1O7IA 3CMAA 3S24A 5IYCG 3A0JA 4LF7L 2PI2A 4A93H 4BXXH 4JYAL 4PZ8A 2VQEQ 4JI8Q 4DV4Q 3I4MH 3K7AH 4JBWA 4DV5L 1PV4A 5JEAJ 4MNOA 1Y1VH 4TQUS 1V1QA 2PNHA 3M4QA 3K81C 1YBYA 3GO5A 4YHHL 3I4NH 4RMFA 2QGQA 3KJOA 3H3VI 2I0QA 3S2HH 4A93G 4BXXG 5DLQE 3I4MG 4AQYQ 3IRBA 3CD6A 2FXQA 1Q7YC 4XTCS 3I56A 1JMCA 2JA5H 4L5QA 4JI4Q 1M1KC 5LMNQ 3J81i 3A5UA 5C44G 4R4IA 4DV3Q 1GD7A 4APVA 4DR4Q 4WJ3M 3J81j 2OQKA 3I4NG 3U4ZA 3CCJA 3HFZB 1IYJB 4OX9Q 4GLVB 5H1SE 3ERSX 1HZCA 2VUMG 2LXKA 1Y1WH 2JJQA 3S1QH 1QVGA 2RHQB 4JI0Q 1D7QA 4NXNQ 1VQGA 4WJ4A 4A75A 4LNQA 4OWXB 4C2MH 4JI6Q 3JC66 2B3GA 3PUYA 2KENA 3CCUA 1PH9A 2YV5A 1L2FA 2EIFA 3BZCA 3STBD 4JI5L 1HNZL 2E2HH 3KFUA 2GVAA 3S14H 4KHPL 1GKHA 3D0FA 4X66Q 4Y7NH 3CMEA 1UE6A 1Y1WG 2ASBA 3GTPH 3WWVA 2JA8H 4XIGS 3E0EA 4JCVE 2MO1A 4BBRH 1N34Q 4R4QA 4GNXC 2IHFA 3CXCA 3M9BA 1AH9A 1N36L 1VQJA 2K52A 2WFWA 3PIPA 3S1RH 1WI5A 4L5SA 1WCMH 1EWIA 3TS2A 1E7ZA 3W5OA 2NVYH 4YCWA 1VQHA 4A3IH 4GOPB 1XMOQ 2EQSA 2JA8G 3RR5A 4YCUA 3KYHC 2WAQE 1PH4A 4BBRG 3U58A 1NJIC 2GN5A 1X9NA 1HR0L 3W1BA 3ZJYC 2ZM6Q 4DV0Q 3J7ZC 3TS0A 4LUZA 4LF8L 5C0XJ 2E2IH 1J5EQ 2UU9L 4DV2Q 2OQ0A 3GDEA 4J15A 2Z6KA 5IYBH 3RLFA 3TREA 4A3IG 3GTJH 2GVBA 4P72A 4LW1A 4DV1L 4BBSH 3HOUH 2N49A 3H0GH 1B70B 3KF6A 4LFCL 4R4OA 5M5XH 4MZ9A 1P16A 5LMUL 1JE5A 4A3LH 2CQOA 5M3FG 5JJIA 1KAWA 4BY1G 2VNUD 1TWCH 3DM3A 4X64Q 2N8NA 1K3RA 5IYBG 1U0LA 1HZBA 4RG1A 4C3JH 2I5HA 2UUBQ 4LFAL 2IX1A 4K0KL 5BR8Q 1HR0W 3E9IA 1K8AC 4YWKA 1PH1A 3MEFA 3PO2H 1WYDA 1CKNB 4HJ5A 2HHHL 4BBSG 5M3MH 4DR2Q 2CCZA 2BH2A 3HOUG 2D0OA 3H0GG 4LF7Q 4JYAQ 1YJWA 3OTOQ 4A3LG 1NTGA 1YJ9A 1LM0A 3RN5A 3L2PA 4DV5Q 4DPGA 2VQFL 4OWWB 1CKMA 2JE6I 1N32L 5GQOA 5GROA 2CWAA 1X55A 1VQMA 2WAQG 1K0RA 2AWNA 4DR5L 5JJLA 2PMZE 3GD7A 4IO9A 1I3QH 4R4CA 2IT1A 4PG3A 4HJ7A 2NVTH 3GTGH 4GLXA 2JK8A 4R4TA 4UP8A 2DGYA 3STBC 5IP9H 5M3MG 1XJVA 2B63G 2YTYA 4MTNA 3CCEA 4DR6L 2IHEA 1EIYB 1ASYA 5JEAG 1S40A 1C0AA 1AE2A 1E24A 3UDXA 1PH8A 2R93G 1WJJA 3NBHB 4X65L 2UUAQ 4A3BH 1C7YA 5JJKA 4C3HH 1JT8A 1KIXA 1I50H 1X3FA 4JG2A 3EN2A 1CUKA 1I94L 4GN5A 4C3IH 3I55A 4NXMQ 2RHSB 5IYCH 3S16H 4DR1L 1VCIA 4OO1G 5C4XH 1OXTA 3EBEA 1NMGA 4GNXA 2PQAB 4LUVA 2Z6KC 2NVQH 1Q46A 2AKWB 5GAHC 4OWTB 1K83H 4A3BG 1Q12A 5HY6A 3NEMA 4GOPC 3L0OA 3HOXH 3VDYA 4JI5Q 1YEZA 1X3GA 1X3EA 4KHPQ 1PFSA 1FGUA 1Y14B 4YWLA 3G6EA 4GKKL 4QQBX 4NB3A 4BY7H 5C4XG 3SGIA 1IBLL 2NVXH 1N36Q 3H3VH 4POFA 1YI2A 1VQ8A 4LF9Q 3BZKA 3ER0A 5C44H 5AJ3Q 3I2ZA 3HOXG 1YZ6A 4BA1I 3KDFB 1L1OB 1X6OA 3W1GA 4GKJL 4B3MQ 3L7ZC 2UXDL 2KHJA 2VUMH 4PZ7A 1T9HA 4UP9A 2VL6A 3D31A 4BY7G 1HR0Q 1HH2P 2ZTDA 3LGJA 4L5TA 1H95A 1QVFA 3S1MH 1BBUA 4DUYQ 3U4VA 1U5KA 4LF6Q 1PVOA 5K36G 1VQDA 2AMCB 4NPSA 4JI2Q 1UE7A 5IWAL 2JEAI 3PO3H 4LF5L 2IX0A 5C0XI 4LWCA 2UXBQ 3JAMi 1SMXA 2HIXA 4DK6C 3S17H 1FVIA 3M4OH 1SFOH 1G291 2XGTA 4LF4L 1MKHA 4JI7L 4UPAA 1TWAH 1UWVA 5FJ8G 5C0XG 3RN2A 1VQ6A 1HNWQ 1SLJA 4HIOA 4JC0A 4YCVA 1QUQB 1K8GA 1Q8KA 1IBKL 3K0XA 3PO3G 3CC2A 3J80i 2KCMA 2E2JH 4TVAB 1PH6A 3HOVH 1VQ4A 3S15H 4JBKA 1HNXL 1VQCA 5HGQA 4LFBQ 3CPWA 2LXJA 4KHZA 1BKBA 2MNAA 2JA7H 3K80C 1N33Q 3TEHB 2ES2A 2YYZA 5IP7H 2K5HA 1V9PA 2OTLA 3PF4A 2R7DA 1MJCA 3DLLA 4A3EH 4L5RC 2R92G 1E1TA 3KF8B 1N32Q 1GVPA 2CWPA 4DV7Q 1IBML 3HOVG 2BA1A 4DR3L 2E5LQ 2UXCL 4X62L 4IPGA 1VQAA 3T1YL 1VQ9A 2JA7G 3RLOA 1YIJA 2D0PA 4B3TQ 2ZTCA 5IP7G 1LTLA 3G71A 1KD1C 4DR6Q 2C35B 1N8RC 5M3FH 4IPDA 2H5XA 4A3EG 1C9OA 4BY1H 1UEBA 3S2DH 4A3CG 1TWGH 2OCEA 3K7UC 4JI8L 4DV4L 2D62A 4YY3L 4GOPA 4B3SQ 3GTLH 2K4KA 4DV6L 1I94Q 1E3PA 1YNXA 1PYSB 2VS1A 3NELA 4JI1Q 1M90C 1QZHA 4POGA 4A3KG 2NN6I 4DK3C 4HJ8A 3T1HQ 4JI3L 1OXVA 3RZOH 1Q82C 4B3RL 4AQYL 1VQEA 1VQIA 1L1OC 4IFDI 2R7ZH 1XNQQ 4QGUA 4JI4L 4DAYB 2WB1E 1CSQA 1CKOA 1NMFA 1X56A 2NN6G 3KJPA 3CC7A 1B8AA 3KLWA 1YHQA 2QA4A 5M5YH 4DR4L 3F2CA 4GKKQ 2B63H 1EQRA 4IFDG 1XPUA 4IPCA 4OX9L 3HKZE 3CF5A 4KI0A 4P71A 4NXNL 2R7ZG 3HOYH 2R93H 1N9WA 2Y0SE 1PHJA 4YHHQ 3A5ZB 1HZ9A 1B7YB 1X54A 5C3EG 1Q81C 1OTCA 3MXNB 1CKNA 4GKJQ 2OTJA 1J6QA 1SE8A 2LSSA 2IY5B 1KL9A 1XMQL 1KRSA 4QIWE 4YWMA 3TRZA 4AIMA 4ALPA 2AHOB 2NZOA 4GLAC 3HOYG 1PYBA 2YTVA 4PZ6A 4LF5Q 4KLKA 3M4PA 4P74A 2Q2UA 3FKIH 1TWHH 2Q2HA 4HIMA 1RIPA 1DGSA 4DNIA 1XNRL 2L15A 2VY3A 4JI7Q 3RNUA 3CCSA 1XMOL 1YITA 2F4VL 2WB1G 1IBKQ 4A3JG 1L0WA 2B29A 1NE3A 2N78A 2ZM6L 4DV0L 3FHWA 1S72A 1FJGL 4H02A 2A19A 4OXPA 3FKIG 3UE1A 1HNZQ 4A3MH 4QY7A 1RL2A 1V43A 4DV2L 4DUZL 1K73C 3HKZG 2YU9H 2E8GA 2F3IA 3CAMA 2Y0SG 1EIFA 2PQAA 4DKAC 2ALYB 2MQHA 5GAGC 3M3YH 3G4SA 4X6AH 4DR3Q 2UXCQ 4A3MG 1OXXK 1K9MC 1S3OA 1QZGA 1YHBA 4X64L 2ATWA 3UDIA 2UUBL 3UDGA 3HOWG 4IPHA 5BR8L 4GN4B 3AFQA 3ULLA 5IE8A 5FJ8H 2CFMA 2KHIA 3J7A5 1AE3A 1NBWA 4LF8Q 3GTMH 1SROA 3AYHB 4DR2L 1ASZA 2UU9Q 1VQPA 3OTOL 3GTQH 2OWOA 2JQOA 1OXSC 3KDFA 1L1OA 3K8AA 4YY3Q 1KRTA 4DV1Q 1Q86C 4P75A 3E9HA 3G48A 3KOJA 2I5LX 1JJ2A 4DV6Q 4OONA 3RLNA 3CCRA 2BA0A 2K5NA 3PUWA 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8T A;  4LFC Q;  1CSP A;  3PSI A;  5LMU Q;  1PH7 A;  1Z47 A;  4QJF A;  2MO0 A;  2K5V A;  1IL2 A;  4IOA A;  4JOI C;  4JI3 Q;  5ELN A;  1GM5 A;  1A62 A;  1OXU A;  4GN3 B;  2HT1 A;  3GTK H;  1UE5 A;  3FP9 A;  4LFA Q;  4B3R Q;  4K0K Q;  4DR7 L;  3J81 c;  5E7N A;  2HHH Q;  1Y1V G;  2UUC L;  3PF5 A;  2AWO A;  1YJN A;  1G51 A;  2UUA L;  2V1C C;  3JAM c;  2A8V A;  1IZ6 A;  1EQQ A;  2K75 A;  4NXM L;  1QUQ A;  2VQF Q;  1VQB A;  2ZJR A;  4A3F H;  4UY8 C;  1IXR A;  3CPF A;  3UE0 A;  3H15 A;  4A3C H;  4JV5 L;  2DUD A;  3CCL A;  4DR5 Q;  3CP0 A;  2JA5 G;  1BVS A;  2I5M X;  3BJU A;  3J80 c;  2VW9 A;  1PA6 A;  2EXD A;  2R92 H;  3ULJ A;  1VS0 A;  1XMQ Q;  1XPO A;  1GO3 E;  1YVC A;  4A3K H;  3U50 C;  4IOC A;  4A3F G;  3AEV A;  4HJ9 A;  1WOC A;  2ZJP A;  2K14 A;  4IJH A;  2KCT A;  2VQE L;  1VQ5 A;  4X65 Q;  2HQL A;  2PI2 E;  3HKS A;  4AYB E;  1E1O A;  2YTX A;  1EFW A;  4BA2 I;  1W2B A;  2RCN A;  4LF9 L;  3Q8D A;  5FLM H;  1Q1E A;  2JEB I;  5FLX c;  5AJ3 L;  1XNR Q;  2CKZ B;  2NZH A;  4DR1 Q;  3ICE A;  2N3S A;  3RZD H;  1TXY A;  4B3M L;  1XPR A;  1UE1 A;  4A3D H;  5IYD H;  2KBN A;  3F2B A;  4A3G H;  3CCV A;  2F4V Q;  3TQY A;  4LUO A;  1JJC B;  4GS3 A;  2JA9 A;  5GAE C;  3OYY A;  3KF6 B;  1FJG Q;  4A4I A;  4DUY L;  4Y52 H;  2K50 A;  1P8L A;  1I5F A;  4R1J A;  3PIO A;  2ZTE A;  5LMN L;  5C3E H;  3ULP A;  4JI2 L;  4LF6 L;  3M7N A;  5FLM G;  1WCM G;  1MJE A;  4DUZ Q;  4DV3 L;  1X65 A;  1KC8 C;  2A1A A;  2UXB L;  4A3D G;  5IYD G;  3B6Y A;  1KQS A;  4A3G G;  3PUX A;  1IBL Q;  3S1N H;  2JA6 H;  1D8L A;  2ID0 A;  2R7F A;  1YHA A;  5C4J H;  4JI0 L;  2ZJQ A;  1LYL A;  1HNW L;  1LUZ A;  4DAM A;  1A63 A;  1W3S A;  4JI6 L;  2UXD Q;  5IT9 c;  3CCQ A;  5GAD C;  1MIU A;  3PV0 A;  4JBM A;  1JJG A;  2Q2I A;  5IY0 A;  1Q1B A;  1SN8 A;  4X66 L;  4LFB L;  1HZA A;  2JA6 G;  4AYB G;  4PMW A;  4O2D A;  4HJA A;  5LMN W;  1E22 A;  1PH2 A;  1NY4 A;  4A3J H;  1SR3 A;  5EAY A;  4EQ5 A;  5IWA Q;  3PUZ A;  1PH3 A;  1N34 L;  1N33 L;  1Z9F A;  4JOI A;  4HID A;  1SRU A;  1HJP A;  4FDB A;  1EOV A;  2F52 A;  2R6G A;  2BH8 A;  2RF4 A;  5ELO A;  5M5W H;  1VQO A;  3CC4 A;  2XTI A;  3AQQ A;  4DV7 L;  1PH5 A;  4LF4 Q;  2E5L L;  4A76 A;  3PO2 G;  2Z0S A;  3I7F A;  1VQN A;  3PCO B;  1A8V A;  4B3T L;  3A74 A;  1R9T H;  4JBJ A;  1KXL A;  1XTD A;  4GNX B;  1J5E L;  4DR7 Q;  1I6H H;  1EUJ A;  1HNX Q;  4P73 A;  3HOZ H;  3UDF A;  5J3B A;  2UUC Q;  2QEX A;  1TWF H;  1WFQ A;  3PGZ A;  3HOW H;  1BBW A;  4OO1 I;  3AFP A;  4O0A A;  3M85 A;  2MFI A;  1G6P A;  4UP7 A;  4B3S L;  2WP8 J;  5IP9 G;  1VQ7 A;  3CQZ H;  1QVC A;  4JI1 L;  3F1Z A;  3EIV A;  1JB7 A;  4JV5 Q;  1KHI A;  4IJL A;  3OW2 A;  1IBM Q;  1VQK A;  2Q2T A;  4IFD J;  3I4O A;  1VQF A;  4X62 Q;  3HOZ G;  4EX5 A;  3NEN A;  3T1H L;  3T1Y Q;  3CW2 C;  4AH6 A;  3CCM A;  3BU2 A;  2VZA A;  1XNQ L;  1FL0 A;  4QL5 A;  1EYG A;  3F2D A;  2HIV A;  1VQL A;  3GTO H;  1A0I A;  3PUV A;  4HIK A;  1O7I A;  3CMA A;  3S24 A;  5IYC G;  3A0J A;  4LF7 L;  2PI2 A;  4A93 H;  4BXX H;  4JYA L;  4PZ8 A;  2VQE Q;  4JI8 Q;  4DV4 Q;  3I4M H;  3K7A H;  4JBW A;  4DV5 L;  1PV4 A;  5JEA J;  4MNO A;  1Y1V H;  4TQU S;  1V1Q A;  2PNH A;  3M4Q A;  3K81 C;  1YBY A;  3GO5 A;  4YHH L;  3I4N H;  4RMF A;  2QGQ A;  3KJO A;  3H3V I;  2I0Q A;  3S2H H;  4A93 G;  4BXX G;  5DLQ E;  3I4M G;  4AQY Q;  3IRB A;  3CD6 A;  2FXQ A;  1Q7Y C;  4XTC S;  3I56 A;  1JMC A;  2JA5 H;  4L5Q A;  4JI4 Q;  1M1K C;  5LMN Q;  3J81 i;  3A5U A;  5C44 G;  4R4I A;  4DV3 Q;  1GD7 A;  4APV A;  4DR4 Q;  4WJ3 M;  3J81 j;  2OQK A;  3I4N G;  3U4Z A;  3CCJ A;  3HFZ B;  1IYJ B;  4OX9 Q;  4GLV B;  5H1S E;  3ERS X;  1HZC A;  2VUM G;  2LXK A;  1Y1W H;  2JJQ A;  3S1Q H;  1QVG A;  2RHQ B;  4JI0 Q;  1D7Q A;  4NXN Q;  1VQG A;  4WJ4 A;  4A75 A;  4LNQ A;  4OWX B;  4C2M H;  4JI6 Q;  3JC6 6;  2B3G A;  3PUY A;  2KEN A;  3CCU A;  1PH9 A;  2YV5 A;  1L2F A;  2EIF A;  3BZC A;  3STB D;  4JI5 L;  1HNZ L;  2E2H H;  3KFU A;  2GVA A;  3S14 H;  4KHP L;  1GKH A;  3D0F A;  4X66 Q;  4Y7N H;  3CME A;  1UE6 A;  1Y1W G;  2ASB A;  3GTP H;  3WWV A;  2JA8 H;  4XIG S;  3E0E A;  4JCV E;  2MO1 A;  4BBR H;  1N34 Q;  4R4Q A;  4GNX C;  2IHF A;  3CXC A;  3M9B A;  1AH9 A;  1N36 L;  1VQJ A;  2K52 A;  2WFW A;  3PIP A;  3S1R H;  1WI5 A;  4L5S A;  1WCM H;  1EWI A;  3TS2 A;  1E7Z A;  3W5O A;  2NVY H;  4YCW A;  1VQH A;  4A3I H;  4GOP B;  1XMO Q;  2EQS A;  2JA8 G;  3RR5 A;  4YCU A;  3KYH C;  2WAQ E;  1PH4 A;  4BBR G;  3U58 A;  1NJI C;  2GN5 A;  1X9N A;  1HR0 L;  3W1B A;  3ZJY C;  2ZM6 Q;  4DV0 Q;  3J7Z C;  3TS0 A;  4LUZ A;  4LF8 L;  5C0X J;  2E2I H;  1J5E Q;  2UU9 L;  4DV2 Q;  2OQ0 A;  3GDE A;  4J15 A;  2Z6K A;  5IYB H;  3RLF A;  3TRE A;  4A3I G;  3GTJ H;  2GVB A;  4P72 A;  4LW1 A;  4DV1 L;  4BBS H;  3HOU H;  2N49 A;  3H0G H;  1B70 B;  3KF6 A;  4LFC L;  4R4O A;  5M5X H;  4MZ9 A;  1P16 A;  5LMU L;  1JE5 A;  4A3L H;  2CQO A;  5M3F G;  5JJI A;  1KAW A;  4BY1 G;  2VNU D;  1TWC H;  3DM3 A;  4X64 Q;  2N8N A;  1K3R A;  5IYB G;  1U0L A;  1HZB A;  4RG1 A;  4C3J H;  2I5H A;  2UUB Q;  4LFA L;  2IX1 A;  4K0K L;  5BR8 Q;  1HR0 W;  3E9I A;  1K8A C;  4YWK A;  1PH1 A;  3MEF A;  3PO2 H;  1WYD A;  1CKN B;  4HJ5 A;  2HHH L;  4BBS G;  5M3M H;  4DR2 Q;  2CCZ A;  2BH2 A;  3HOU G;  2D0O A;  3H0G G;  4LF7 Q;  4JYA Q;  1YJW A;  3OTO Q;  4A3L G;  1NTG A;  1YJ9 A;  1LM0 A;  3RN5 A;  3L2P A;  4DV5 Q;  4DPG A;  2VQF L;  4OWW B;  1CKM A;  2JE6 I;  1N32 L;  5GQO A;  5GRO A;  2CWA A;  1X55 A;  1VQM A;  2WAQ G;  1K0R A;  2AWN A;  4DR5 L;  5JJL A;  2PMZ E;  3GD7 A;  4IO9 A;  1I3Q H;  4R4C A;  2IT1 A;  4PG3 A;  4HJ7 A;  2NVT H;  3GTG H;  4GLX A;  2JK8 A;  4R4T A;  4UP8 A;  2DGY A;  3STB C;  5IP9 H;  5M3M G;  1XJV A;  2B63 G;  2YTY A;  4MTN A;  3CCE A;  4DR6 L;  2IHE A;  1EIY B;  1ASY A;  5JEA G;  1S40 A;  1C0A A;  1AE2 A;  1E24 A;  3UDX A;  1PH8 A;  2R93 G;  1WJJ A;  3NBH B;  4X65 L;  2UUA Q;  4A3B H;  1C7Y A;  5JJK A;  4C3H H;  1JT8 A;  1KIX A;  1I50 H;  1X3F A;  4JG2 A;  3EN2 A;  1CUK A;  1I94 L;  4GN5 A;  4C3I H;  3I55 A;  4NXM Q;  2RHS B;  5IYC H;  3S16 H;  4DR1 L;  1VCI A;  4OO1 G;  5C4X H;  1OXT A;  3EBE A;  1NMG A;  4GNX A;  2PQA B;  4LUV A;  2Z6K C;  2NVQ H;  1Q46 A;  2AKW B;  5GAH C;  4OWT B;  1K83 H;  4A3B G;  1Q12 A;  5HY6 A;  3NEM A;  4GOP C;  3L0O A;  3HOX H;  3VDY A;  4JI5 Q;  1YEZ A;  1X3G A;  1X3E A;  4KHP Q;  1PFS A;  1FGU A;  1Y14 B;  4YWL A;  3G6E A;  4GKK L;  4QQB X;  4NB3 A;  4BY7 H;  5C4X G;  3SGI A;  1IBL L;  2NVX H;  1N36 Q;  3H3V H;  4POF A;  1YI2 A;  1VQ8 A;  4LF9 Q;  3BZK A;  3ER0 A;  5C44 H;  5AJ3 Q;  3I2Z A;  3HOX G;  1YZ6 A;  4BA1 I;  3KDF B;  1L1O B;  1X6O A;  3W1G A;  4GKJ L;  4B3M Q;  3L7Z C;  2UXD L;  2KHJ A;  2VUM H;  4PZ7 A;  1T9H A;  4UP9 A;  2VL6 A;  3D31 A;  4BY7 G;  1HR0 Q;  1HH2 P;  2ZTD A;  3LGJ A;  4L5T A;  1H95 A;  1QVF A;  3S1M H;  1BBU A;  4DUY Q;  3U4V A;  1U5K A;  4LF6 Q;  1PVO A;  5K36 G;  1VQD A;  2AMC B;  4NPS A;  4JI2 Q;  1UE7 A;  5IWA L;  2JEA I;  3PO3 H;  4LF5 L;  2IX0 A;  5C0X I;  4LWC A;  2UXB Q;  3JAM i;  1SMX A;  2HIX A;  4DK6 C;  3S17 H;  1FVI A;  3M4O H;  1SFO H;  1G29 1;  2XGT A;  4LF4 L;  1MKH A;  4JI7 L;  4UPA A;  1TWA H;  1UWV A;  5FJ8 G;  5C0X G;  3RN2 A;  1VQ6 A;  1HNW Q;  1SLJ A;  4HIO A;  4JC0 A;  4YCV A;  1QUQ B;  1K8G A;  1Q8K A;  1IBK L;  3K0X A;  3PO3 G;  3CC2 A;  3J80 i;  2KCM A;  2E2J H;  4TVA B;  1PH6 A;  3HOV H;  1VQ4 A;  3S15 H;  4JBK A;  1HNX L;  1VQC A;  5HGQ A;  4LFB Q;  3CPW A;  2LXJ A;  4KHZ A;  1BKB A;  2MNA A;  2JA7 H;  3K80 C;  1N33 Q;  3TEH B;  2ES2 A;  2YYZ A;  5IP7 H;  2K5H A;  1V9P A;  2OTL A;  3PF4 A;  2R7D A;  1MJC A;  3DLL A;  4A3E H;  4L5R C;  2R92 G;  1E1T A;  3KF8 B;  1N32 Q;  1GVP A;  2CWP A;  4DV7 Q;  1IBM L;  3HOV G;  2BA1 A;  4DR3 L;  2E5L Q;  2UXC L;  4X62 L;  4IPG A;  1VQA A;  3T1Y L;  1VQ9 A;  2JA7 G;  3RLO A;  1YIJ A;  2D0P A;  4B3T Q;  2ZTC A;  5IP7 G;  1LTL A;  3G71 A;  1KD1 C;  4DR6 Q;  2C35 B;  1N8R C;  5M3F H;  4IPD A;  2H5X A;  4A3E G;  1C9O A;  4BY1 H;  1UEB A;  3S2D H;  4A3C G;  1TWG H;  2OCE A;  3K7U C;  4JI8 L;  4DV4 L;  2D62 A;  4YY3 L;  4GOP A;  4B3S Q;  3GTL H;  2K4K A;  4DV6 L;  1I94 Q;  1E3P A;  1YNX A;  1PYS B;  2VS1 A;  3NEL A;  4JI1 Q;  1M90 C;  1QZH A;  4POG A;  4A3K G;  2NN6 I;  4DK3 C;  4HJ8 A;  3T1H Q;  4JI3 L;  1OXV A;  3RZO H;  1Q82 C;  4B3R L;  4AQY L;  1VQE A;  1VQI A;  1L1O C;  4IFD I;  2R7Z H;  1XNQ Q;  4QGU A;  4JI4 L;  4DAY B;  2WB1 E;  1CSQ A;  1CKO A;  1NMF A;  1X56 A;  2NN6 G;  3KJP A;  3CC7 A;  1B8A A;  3KLW A;  1YHQ A;  2QA4 A;  5M5Y H;  4DR4 L;  3F2C A;  4GKK Q;  2B63 H;  1EQR A;  4IFD G;  1XPU A;  4IPC A;  4OX9 L;  3HKZ E;  3CF5 A;  4KI0 A;  4P71 A;  4NXN L;  2R7Z G;  3HOY H;  2R93 H;  1N9W A;  2Y0S E;  1PHJ A;  4YHH Q;  3A5Z B;  1HZ9 A;  1B7Y B;  1X54 A;  5C3E G;  1Q81 C;  1OTC A;  3MXN B;  1CKN A;  4GKJ Q;  2OTJ A;  1J6Q A;  1SE8 A;  2LSS A;  2IY5 B;  1KL9 A;  1XMQ L;  1KRS A;  4QIW E;  4YWM A;  3TRZ A;  4AIM A;  4ALP A;  2AHO B;  2NZO A;  4GLA C;  3HOY G;  1PYB A;  2YTV A;  4PZ6 A;  4LF5 Q;  4KLK A;  3M4P A;  4P74 A;  2Q2U A;  3FKI H;  1TWH H;  2Q2H A;  4HIM A;  1RIP A;  1DGS A;  4DNI A;  1XNR L;  2L15 A;  2VY3 A;  4JI7 Q;  3RNU A;  3CCS A;  1XMO L;  1YIT A;  2F4V L;  2WB1 G;  1IBK Q;  4A3J G;  1L0W A;  2B29 A;  1NE3 A;  2N78 A;  2ZM6 L;  4DV0 L;  3FHW A;  1S72 A;  1FJG L;  4H02 A;  2A19 A;  4OXP A;  3FKI G;  3UE1 A;  1HNZ Q;  4A3M H;  4QY7 A;  1RL2 A;  1V43 A;  4DV2 L;  4DUZ L;  1K73 C;  3HKZ G;  2YU9 H;  2E8G A;  2F3I A;  3CAM A;  2Y0S G;  1EIF A;  2PQA A;  4DKA C;  2ALY B;  2MQH A;  5GAG C;  3M3Y H;  3G4S A;  4X6A H;  4DR3 Q;  2UXC Q;  4A3M G;  1OXX K;  1K9M C;  1S3O A;  1QZG A;  1YHB A;  4X64 L;  2ATW A;  3UDI A;  2UUB L;  3UDG A;  3HOW G;  4IPH A;  5BR8 L;  4GN4 B;  3AFQ A;  3ULL A;  5IE8 A;  5FJ8 H;  2CFM A;  2KHI A;  3J7A 5;  1AE3 A;  1NBW A;  4LF8 Q;  3GTM H;  1SRO A;  3AYH B;  4DR2 L;  1ASZ A;  2UU9 Q;  1VQP A;  3OTO L;  3GTQ H;  2OWO A;  2JQO A;  1OXS C;  3KDF A;  1L1O A;  3K8A A;  4YY3 Q;  1KRT A;  4DV1 Q;  1Q86 C;  4P75 A;  3E9H A;  3G48 A;  3KOJ A;  2I5L X;  1JJ2 A;  4DV6 Q;  4OON A;  3RLN A;  3CCR A;  2BA0 A;  2K5N A;  3PUW A;  4ME3 A; 
#chains in the Genus database with same CATH topology
 3F8T A;  2E2D C;  2XNA C;  1Z47 A;  1IL2 A;  4TRD A;  4JI3 Q;  5ELN A;  1DOL A;  1OXU A;  4FF4 A;  2BDN A;  1D2B A;  1JQY D;  1YJN A;  3A7L A;  1CHP D;  4WJW A;  4HTH A;  3H15 A;  1H9S B;  2N55 A;  3SE0 A;  3CCL A;  3CP0 A;  2PW7 A;  2FFK B;  2R92 H;  2NVQ B;  3R3O A;  1XMQ Q;  2K5Q A;  3HOX B;  2AUJ D;  1F9P A;  2VQE L;  1VQ5 A;  5LL6 X;  4RHR A;  1E1O A;  2NBF A;  4PV1 C;  4BA2 I;  2R92 G;  2RCN A;  5FLM H;  1XNR Q;  2CKZ B;  4DR1 Q;  1ZYR C;  4OL7 A;  1TXY A;  2NTS A;  1XPR A;  1UE1 A;  4F87 A;  5C4H A;  5IYD H;  2F0U A;  2VUM B;  1EEF D;  1CI3 M;  4R1J A;  1JC7 A;  5LMN L;  2ZTE A;  5C3E H;  5FLM G;  4OIJ A;  2UXB L;  5IYD G;  4RWS C;  3B6Y A;  3LWE A;  2CH4 A;  1IBL Q;  2R7F A;  4JI0 L;  5E4W C;  1WVL A;  1LYL A;  2L1B A;  1TWA B;  4DAY A;  1SYD A;  3J7Y W;  2A6E C;  3CCQ A;  4JBM A;  1RHP A;  1JJG A;  5IY0 A;  1Q1B A;  5IGB A;  1HZA A;  2FMC A;  3S15 B;  4N8F A;  2JA7 B;  1Z9F A;  1TS4 A;  1SRU A;  1K0S A;  4S3S A;  3NHH A;  2R6G A;  1VQO A;  2BH8 A;  4IUP A;  1F9R A;  4UAI A;  4DV7 L;  1HFN A;  2Z0S A;  2NVY B;  4F8M A;  5NUC A;  2EY2 A;  1HA5 A;  4DR7 Q;  1EUJ A;  1HNX Q;  5EKK A;  5J3B A;  1O78 A;  2B2V C;  3PGZ A;  3HOW H;  3S2D B;  3AFP A;  4O0A A;  3LNN A;  3M85 A;  2MFI A;  5ELF A;  1JE4 A;  3FRP B;  1QVC A;  1R4Q B;  3F1Z A;  3V05 A;  3EIV A;  4IJL A;  3OW2 A;  2Q2T A;  1FD7 D;  4IFD J;  2B2W A;  4AH6 A;  3GTO H;  2HIV A;  3SK5 A;  4CDC C;  4HIK A;  1O7I A;  1EZ8 A;  3S24 A;  5IYC G;  3A0J A;  4A93 H;  4BXX H;  4IN3 A;  4X3S A;  4F7X A;  5M5Y B;  3ERQ A;  3I4M H;  4DV4 Q;  3OOC A;  4HN7 A;  1EL0 A;  1SNO A;  1Y1V H;  1X3Q A;  5FO7 B;  1GHK A;  1V1Q A;  3K81 C;  2HCI A;  4RMF A;  2QGQ A;  3KJO A;  2I0Q A;  1PTO F;  3O13 A;  3I4L A;  4A93 G;  3K58 A;  4BXX G;  3I4M G;  4L63 B;  3NUC A;  1JMC A;  3J81 i;  5C44 G;  4WJ3 M;  1V1P A;  5KRU A;  3CCJ A;  5J39 A;  4HCS A;  4WFN 3;  1IYJ B;  2LXK A;  2JJQ A;  1D7Q A;  4WJ4 A;  4A75 A;  2ZXO A;  2KEC A;  4MN3 A;  4C2M H;  3AU7 A;  1JWM D;  4CDF C;  4JI6 Q;  2B3G A;  3FVQ A;  3CCU A;  1L2F A;  4JI5 L;  3URY A;  4PNY A;  3CME A;  3GTP H;  1D1K A;  4XIG S;  1FYC A;  1F2M A;  1PRT B;  1SYE A;  4BBR H;  2WAC A;  4R4Q A;  5CBA E;  4GNX C;  2IHF A;  2YU9 B;  3M9B A;  1TVX A;  1F9S A;  1EU4 A;  1VQJ A;  2K52 A;  2WFW A;  4LMQ D;  3PIP A;  2QIL A;  4X3U A;  3E5S A;  3M3Y B;  1JOQ A;  3DWA A;  3W5O A;  4Q0F A;  4GOP B;  2EQS A;  3HEJ A;  3M7G A;  5FOB B;  3EVQ A;  1PH4 A;  3KYH C;  1HR0 L;  3G7L A;  4BBR G;  3U58 A;  1NJI C;  4DV0 Q;  1LLR D;  2L11 A;  2EDG A;  5IOC A;  1RD9 D;  5CV8 A;  2Z9H A;  3GDE A;  1W6K A;  3R2T A;  1QE6 A;  4CDD C;  3TRE A;  2PCF B;  1AN8 A;  4H13 C;  3V96 A;  1Q3L A;  3H0G H;  1B70 B;  2M00 A;  4G7Z C;  3KF6 A;  1WTW A;  2KJX A;  1P16 A;  2F03 A;  3EJI A;  1BR9 A;  4BY1 G;  1TWC H;  2N8N A;  3NWT A;  4B9W A;  4C3J H;  1VF5 C;  5BR8 Q;  1QNK A;  3MEF A;  5JAV A;  1D1I A;  3DWQ A;  2CCZ A;  2BH2 A;  3H0G G;  2D2C C;  3I90 A;  1CKM A;  2JE6 I;  1N32 L;  4C3J G;  1VQM A;  1K0R A;  2AWN A;  1D6E C;  2NVT H;  3DUZ A;  4GLX A;  4R4T A;  4UP8 A;  3STB C;  5IP9 H;  5AFW A;  2R92 B;  2B2T C;  2EOT A;  4TKO B;  1RF2 D;  3K5O A;  3F2U A;  3UDX A;  4ZKC B;  4XXE A;  5JPM C;  1WJJ A;  4A3B H;  1KIX A;  2NTT A;  1LAB A;  4GN5 A;  4C3I H;  4NXM Q;  2TMP A;  3T51 B;  4DR1 L;  1VCI A;  4M1U B;  5DM6 3;  4FF1 A;  1BO0 A;  1EYD A;  1TY0 A;  1QG7 A;  1K83 H;  1BF4 A;  1Q12 A;  5I9O A;  1XYI A;  3NEM A;  4A3B G;  1CFM A;  1JIC A;  3VDY A;  1F2Z A;  1X3G A;  2F3V A;  4KHP Q;  1FGU A;  1Y14 B;  4C3I G;  1JB3 A;  3GP7 A;  3ND8 A;  1H9R A;  5C3E B;  4DF7 A;  4QQB X;  3SGI A;  1IBL L;  2NVX H;  4K2L A;  2NB0 A;  3H3V H;  3BZD B;  1G8Z D;  3BZK A;  4ZYS A;  2JP1 A;  1S5E D;  3KDF B;  3NSW A;  1X6O A;  5COR A;  5KND A;  2CQA A;  4PZ7 A;  3MVV A;  3LGJ A;  2F0Q A;  3S1M H;  4DUY Q;  2AMC B;  4JI2 Q;  1TR5 A;  1SJE D;  4ZLT F;  2IX0 A;  3W2D A;  2HIX A;  2K7V A;  3S17 H;  1G29 1;  2XGT A;  1LTG D;  3DHQ A;  2F0F A;  1AZQ A;  1HNW Q;  1SLJ A;  1KLU D;  4JC0 A;  2J4X A;  5K5P A;  3K0X A;  2Y0S B;  3CC2 A;  3J80 i;  3VR3 A;  2K03 A;  1LT6 D;  4TVA B;  3HOV H;  1XX8 A;  1HNX L;  5HGQ A;  4KHZ A;  1BKB A;  3KBG A;  5IP7 H;  2VB2 X;  3HOW B;  2Z4H A;  5I2X A;  3DLL A;  3QOL A;  4L5R C;  1E1T A;  3KF8 B;  4PMC A;  3HOV G;  4DR3 L;  5IGF A;  3JAM E;  3NK9 A;  4V0B A;  1VQ9 A;  4FYD A;  2N88 A;  1EY7 A;  3RLO A;  2D0P A;  4B3T Q;  5IP7 G;  4XT3 B;  3GTO B;  2NZ1 D;  5M9O A;  5M3F H;  2H5X A;  2K5W A;  1HFG A;  3GTM B;  1C9O A;  4A3C G;  1TWG H;  3T53 B;  4DV4 L;  4A93 B;  1HUM A;  3I4M B;  3I73 A;  2DY7 A;  2HD3 A;  3BDO A;  4B3S Q;  4H7B A;  3QB3 A;  3P20 A;  4JI1 Q;  1M90 C;  1Y1V B;  1QZH A;  3A8K E;  2SDF A;  2KED A;  2B2U A;  4KY7 A;  3T1H Q;  3RZO H;  1T5X D;  5FLX E;  1IHZ A;  1L1O C;  1NMF A;  1K8O A;  3KJP A;  1PFM A;  1B8A A;  3VR6 A;  3F2C A;  2B63 H;  4RKB A;  4DGZ A;  1QWY A;  2PZT A;  3FEW X;  2PNR C;  1W6J A;  3H6M A;  4P71 A;  3AB9 A;  2HQE A;  2Y0S E;  1PTO D;  2D5D A;  3A5Z B;  4YHH Q;  4GKJ Q;  1O80 A;  4C2M B;  3LWU A;  1LTS D;  2DNE A;  3H94 A;  2X6L A;  2BE5 C;  3DEO A;  1B1Z A;  1PZK D;  2QKI C;  4GLA C;  3GTP B;  2YTV A;  4PZ6 A;  2KUM A;  4KLK A;  4BBR B;  1TT2 A;  1B9N A;  1MHW C;  2L15 A;  2VY3 A;  4JI7 Q;  3RNU A;  1PRT F;  3NTK A;  4FF3 A;  2WB1 G;  1IBK Q;  2B29 A;  1NE3 A;  5CMD A;  4DV0 L;  1S72 A;  3NBH A;  3IFT A;  1HNZ Q;  4A3M H;  2KEE A;  4DUZ L;  3HKZ G;  4LK1 C;  2E8G A;  1SXT A;  2F3I A;  1L0Y B;  3TP5 A;  1Y8O B;  2MQH A;  5CV5 A;  5DAU A;  4X6A H;  4A3M G;  2F0N A;  1C48 A;  5FO9 B;  1SNM A;  1YHB A;  2HDM A;  3NBI A;  3MXP A;  5FK9 C;  1TWC B;  5BR8 L;  3ULL A;  4C3J B;  5FJ8 H;  2CFM A;  3J7A 5;  4RGO S;  1YNJ D;  2UU9 Q;  1HUN A;  4KKS A;  2DN8 A;  3A55 A;  4XQQ A;  1D5M C;  1KRT A;  4DV1 Q;  1Q86 C;  3E9H A;  3KOJ A;  1QOH A;  4OON A;  3PUW A;  4ME3 A;  2A68 C;  4LFC Q;  5LMU Q;  1PH7 A;  4QJF A;  2MO0 A;  2NVT B;  2X69 A;  1GM5 A;  2ICI A;  3P7J A;  4QCL A;  3FP9 A;  4LFA Q;  3VA5 A;  4K0K Q;  3MZ5 A;  2UUC L;  5HUR A;  2AWO A;  1G51 A;  2PYK A;  2K05 A;  3SEB A;  3D4W A;  1IZ6 A;  4A3B B;  1WD0 A;  1EQQ A;  2K75 A;  3V2T A;  4NXM L;  1QUQ A;  1A3T A;  1VQB A;  4CJ2 C;  4UY8 C;  4C3I B;  4JV5 L;  2Z1C A;  1SYF A;  2G5D A;  4X3T A;  5CYU A;  3J80 c;  1I4P A;  3BYY B;  1VDZ A;  3A56 A;  3ULJ A;  1K83 B;  1GO3 E;  3PMF A;  5T1G A;  1BBX C;  2K14 A;  4IJH A;  3R2I A;  1EOT A;  2B2W C;  2YTX A;  2NVX B;  2JEB I;  2MUY A;  4K5X A;  3EQL C;  5A2Q L;  2KBN A;  3F2B A;  2PO4 A;  4A3G H;  2F4V Q;  1YNN C;  4GS3 A;  4KV6 A;  5KNB A;  3UI2 A;  1FJG Q;  1SNC A;  4DUY L;  4DNR B;  1FNU A;  1I5F A;  1P8L A;  3KLS X;  5KYI A;  3S1M B;  4JI2 L;  1EFI D;  1WCM G;  1LTR D;  4KKU A;  1KQS A;  4A3G G;  1TY2 A;  2PQE A;  2F0V A;  1LTA D;  3MWY W;  1SSO A;  3S17 B;  2ID0 A;  1VF7 A;  1YHA A;  3X3N A;  1A15 A;  5C4J H;  1HNW L;  2DY8 A;  4DAM A;  2KA7 A;  5I4D A;  4OGQ C;  5GAD C;  4NDX A;  4NKL A;  2K32 A;  2Q2I A;  3HOV B;  1SN8 A;  4X66 L;  3A7A B;  3J81 L;  2MHV A;  4AYB G;  4PMW A;  5E1F A;  1N34 L;  1SR3 A;  3NXW A;  1PH3 A;  3PUZ A;  2JA8 B;  4HID A;  1STY A;  3ITP A;  4HSP A;  1M4V A;  1EOV A;  2K04 A;  1RKN A;  5M5W H;  3VR2 A;  3CC4 A;  1KNE A;  4A76 A;  3PO2 G;  1VQN A;  4MIU A;  2QF7 A;  4G7O C;  4B3T L;  4GZY C;  2FHT A;  3A74 A;  1R9T H;  4HMJ A;  1J5E L;  1I6H H;  3DWP A;  5M3F B;  3K5M A;  1DD2 A;  1BBW A;  1TWG B;  1I4H A;  1G6P A;  5I6W A;  4B3S L;  4JI1 L;  3C1F A;  1U4R A;  1JB7 A;  1LTI D;  4ZK9 B;  1DXM A;  4X62 Q;  2WKC A;  3EA6 A;  3NEN A;  3NTH A;  3CW2 C;  5C5L A;  3T1H L;  4U67 3;  3BU2 A;  4K5V A;  3RZO B;  1HRJ A;  4XYO A;  5EPJ A;  4XT1 B;  2RA4 A;  4JYA L;  4MHE A;  3MXU A;  2B63 B;  1XXG A;  4JBW A;  2EJG C;  2BCO A;  3TP7 A;  1SYG A;  2PNH A;  4LJZ C;  4YHH L;  3I4N H;  2A5H A;  5IGC A;  1EY8 A;  1EU3 A;  1G6Z A;  1QB5 D;  3CD6 A;  4YIJ A;  1Q7Y C;  1EY5 A;  4JI4 Q;  3A5U A;  4DV3 Q;  1GD7 A;  2WB1 B;  4DR4 Q;  3I4N G;  3X3M A;  2Q8I B;  4OX9 Q;  3ERS X;  1Y8N B;  1Y1W H;  2RBM A;  1S4Z A;  2MGS A;  1QVG A;  1E2V A;  1VQG A;  5CV9 A;  3HKZ B;  1WTR A;  2F0G A;  1SNP A;  1XTC D;  2F3W A;  2PMZ B;  1I4X A;  2KEN A;  2YV5 A;  3BZC A;  1HNZ L;  1GKH A;  3D0F A;  4Y7N H;  4A3M B;  1Y1W G;  2A73 B;  1Q90 A;  3E0E A;  2MO1 A;  1IYV A;  1H9S A;  1ZEQ X;  1WI5 A;  2G9D A;  1E7Z A;  1PRT D;  1VQH A;  2EPB A;  4A3I H;  1STN A;  4K2K A;  3FPU B;  4KY6 A;  3D3R A;  2ZM6 Q;  3J7Z C;  3TS0 A;  4WRD A;  5C0X J;  2UU9 L;  1ICF B;  4DV2 Q;  2Z6K A;  1AP0 A;  1TQO A;  4A3I G;  3GTJ H;  2EJF C;  4CKE A;  3OPO A;  4J8Q A;  4DV1 L;  1PFN A;  2DJG C;  2N49 A;  1ONL A;  3D4D A;  4LFC L;  4A3L H;  5LMU L;  3U9O A;  5JJI A;  4FNF A;  3DM3 A;  1K3R A;  3T56 B;  1U0L A;  4LFA L;  2IX1 A;  4K0K L;  2I46 A;  4QB4 A;  4YWK A;  1PH1 A;  1CKN B;  1WYD A;  4HJ5 A;  5M3M H;  4DR2 Q;  4LF7 Q;  4A3L G;  1EQT A;  3OWF A;  3VR5 A;  1YJ9 A;  1LM0 A;  4DV5 Q;  1GHJ A;  2RSO A;  3TDQ A;  4LAA A;  5GRO A;  2WAQ G;  2PMZ E;  4IO9 A;  1I3Q H;  4R4C A;  5A35 A;  1Y8P B;  2DGY A;  3DEP A;  5M3M G;  3J80 L;  1XJV A;  4BS9 A;  3H91 A;  3MA2 B;  1JR0 D;  1EIY B;  1ASY A;  1S40 A;  1B3Q A;  2OXP A;  1E0B A;  1E24 A;  3SDZ A;  1PH8 A;  2R93 G;  2XWJ B;  1ILP A;  1C7Y A;  1VMC A;  1X3F A;  3EN2 A;  5ELD A;  3BVZ A;  1DYQ A;  3S16 H;  5IYC H;  2F0S A;  5C4X H;  1OXT A;  4QF4 A;  1NMG A;  2PQA B;  4A3G B;  1K28 A;  2AKW B;  3MXG A;  3U9S A;  2EVB A;  5JPN C;  1X3E A;  2NUC A;  2F0K A;  4YWL A;  3G6E A;  1T5E A;  4GKK L;  5IGG A;  3PIP 3;  1NCV A;  4NB3 A;  2B2U C;  4BY7 H;  5C4X G;  1DON A;  2NWG A;  1N36 Q;  1JWU D;  4ZKB B;  4LF9 Q;  3ER0 A;  4AYB B;  5C44 H;  5AJ3 Q;  1IL8 A;  5C4J B;  1DZ1 A;  3L9A X;  4B3M Q;  3L7Z C;  1NR4 A;  2KHJ A;  2E74 C;  4BY7 G;  1H95 A;  5C0X H;  1PMR A;  4XQJ A;  1QVF A;  3U4V A;  2EYO A;  3PO3 H;  1UE7 A;  2JEA I;  5C0X I;  4LWC A;  4C56 C;  1TS5 A;  1SMX A;  1FVI A;  4RAU C;  1SFO H;  1RDP D;  3M4O H;  5M5W B;  4UPA A;  1UWV A;  5C0X G;  3RN2 A;  1EIG A;  4YCV A;  1Q8K A;  3PO3 G;  1FR3 A;  3LX0 A;  4CDE C;  1GUS A;  2A69 D;  2VB3 X;  1R9T B;  1VQC A;  1I6H B;  4QIW B;  3CPW A;  1N33 Q;  3TEH B;  1V9P A;  3PF4 A;  3T16 A;  2AQ2 B;  4A3E H;  1NNX A;  2CWP A;  1DJR D;  3MEH A;  5E4X A;  2QDB A;  4QMG A;  4X62 L;  4IPG A;  1BXT A;  3ND9 A;  4H44 C;  1LT3 D;  3G71 A;  4DR6 Q;  1RTO A;  4A3E G;  5JJZ A;  1G91 A;  4BY1 H;  1S5F D;  1D5X C;  1LO5 D;  2OCE A;  3K7U C;  1EZ6 A;  2D62 A;  4YY3 L;  5C6A A;  1GUN A;  4GOP A;  2NN6 H;  2DJF C;  4DV6 L;  1I94 Q;  1E3P A;  4POG A;  4IFD H;  4A3K G;  2NN6 I;  4HJ8 A;  3I4N B;  1ET6 A;  1LTT D;  2D9U A;  4JI3 L;  1KTK A;  4IFD I;  2R7Z H;  4JI4 L;  1BCP B;  2NN6 G;  1PZI D;  3KLW A;  2J0T D;  3P1H A;  2QA4 A;  4DR4 L;  1JOR A;  4Z9C B;  4IFD G;  1Z6H A;  4CJ1 B;  4OX9 L;  3E3X A;  4G7H C;  5CBE E;  1EEI D;  3CF5 A;  1Y1W B;  2R7Z G;  1N9W A;  3SR1 A;  3IFD A;  1X54 A;  1B7Y B;  1JOK A;  1SE3 A;  2EYH A;  1J6Q A;  1SJH D;  1KAB A;  1KL9 A;  4IAL A;  1XMQ L;  1KAA A;  4QIW E;  4YWM A;  1SAP A;  3TRZ A;  4Y7N B;  2AHO B;  3HG9 A;  4LF5 Q;  3R93 A;  2F0J A;  4P74 A;  2Q2U A;  3FKI H;  1ET9 A;  4DNI A;  4DXF A;  1XNR L;  4I7A A;  3VA7 A;  1MSG A;  4E6I A;  5ELB A;  1SMY D;  4A3I B;  1YIT A;  1J8I A;  2WII B;  5IIF A;  4A3J G;  3BVG A;  2R3Z A;  2ZM6 L;  3FHW A;  2NYZ D;  4H02 A;  2GA4 B;  2A19 A;  3FKI G;  3UE1 A;  2F0E A;  2HCC A;  1ILQ A;  1RL2 A;  1V43 A;  4DV2 L;  2M9V A;  4IQZ A;  3CAM A;  1A2U A;  1UAP A;  1FGB D;  5JVH 3;  3GTJ B;  5EKL A;  4DKA C;  2ICE C;  1AZP A;  1QIL A;  3OIQ A;  3S9W A;  2UXC Q;  1QZG A;  2ATW A;  3BYT B;  1NR2 A;  3UDI A;  2V4D A;  1NSN S;  1UUP A;  2KHI A;  1AE3 A;  3CRL C;  4DR2 L;  2ZXP A;  1ASZ A;  1VQP A;  1H9J A;  5M3M B;  2XWB B;  1OXS C;  4ZRZ A;  2RVL A;  3KDF A;  3VYR A;  3VYT A;  3C3L A;  3RUZ A;  1PTO C;  2BA0 A;  2K5N A;  1EYA A;  3PSI A;  1I3Q B;  3OW7 A;  2K5V A;  3PIO 3;  1IKM A;  3N6R A;  5J22 A;  1A62 A;  4QUF A;  4B3R Q;  3GTK H;  4DR7 L;  1QNU A;  1II3 A;  3J81 c;  5E7N A;  2HHH Q;  2A8V A;  2L55 A;  2VQF Q;  4A3F H;  3OMG A;  1EIH A;  3UE0 A;  1IYU A;  1RTN A;  3BS1 A;  4JW0 A;  3S16 B;  4A3C H;  2DUD A;  2JA5 G;  1BVS A;  3OHX C;  3I3C A;  3BJU A;  5C4X B;  3DXJ C;  2EY6 A;  1AW7 A;  2EXD A;  1VS0 A;  2F4I A;  3HGB A;  3QIA A;  2SEB D;  1XPO A;  1YVC A;  4A3F G;  4HJ9 A;  1WOC A;  2ZJP A;  2A6H D;  1Y69 U;  3KF8 A;  2CH4 W;  4BY7 B;  2HQL A;  2PI2 E;  3HKS A;  5C5M A;  1EFW A;  5CC4 A;  3KK7 A;  5FO8 B;  2MP1 A;  4LF9 L;  3MTS A;  5AJ3 L;  1HA6 A;  1KDB A;  2NZH A;  3K57 A;  2BDO A;  5C44 B;  1GXD C;  3RZD H;  4B3M L;  4A3D H;  5EBD A;  3CCV A;  4LUO A;  1JJC B;  2XSC A;  1CA5 A;  3OYY A;  1YNJ C;  2K5D A;  3GV3 A;  1HHV A;  5TSS A;  2K50 A;  3PIO A;  4V19 0;  1OO9 B;  1X65 A;  2F0T A;  1KC8 C;  3PO3 B;  2A1A A;  1JCK B;  4A3D G;  3QOJ A;  3P75 A;  1D8L A;  3M4O B;  1SFO B;  4TSS A;  1E2Z A;  2F0P A;  1Q8I A;  1LUZ A;  3TZD A;  2MPM A;  1A63 A;  1W3S A;  3D8G A;  2JSO A;  2F0M A;  4KMU C;  4JI6 L;  3C46 A;  5IT9 c;  2UXD Q;  1MIU A;  1PXU A;  4O2D A;  1E22 A;  1O7L A;  1NY4 A;  2F0D A;  2K01 A;  5EAY A;  4EQ5 A;  1N33 L;  1HTP A;  5J1Z A;  4JOI A;  4FDB A;  1HJP A;  2RF4 A;  1TII D;  3WOF A;  1MGS A;  2XTI A;  1B3A A;  4A3E B;  1PH5 A;  4LF4 Q;  3RMH A;  1A8V A;  4O42 A;  4JBJ A;  1KXL A;  5EPK A;  4GNX B;  4P73 A;  3UDF A;  5IOD A;  4HSV A;  4I65 A;  1TWF H;  1WFQ A;  4BY1 B;  4OO1 I;  4EQN A;  4UP7 A;  2EYP A;  2WP8 J;  1VQ7 A;  5EBC A;  3H0G B;  1G2S A;  3I4O A;  1VQF A;  4IZ8 A;  4EX5 A;  2IL8 A;  3T1Y Q;  1SYB A;  2JYO A;  3CCM A;  2LY7 A;  2C5C A;  1FL0 A;  1VQL A;  2R7Z B;  4JPB W;  2HDL A;  3PUV A;  1PFB A;  2IW3 A;  3CMA A;  1H9M A;  3IL8 A;  4PZ8 A;  1CTM A;  1GUG A;  2VQE Q;  3K7A H;  4C1N I;  3A54 A;  1STH A;  5JEA J;  4MNO A;  1ZKO A;  1BCP F;  4ZCK A;  4TQU S;  2B39 A;  3M4Q A;  3IAY A;  1HQM C;  4ABN A;  3S2H H;  5DLQ E;  4RHS A;  4AQY Q;  3IRB A;  2FXQ A;  4XTC S;  3I56 A;  5A2Q E;  5LMN Q;  5F2D A;  4R4I A;  4APV A;  1JWS D;  3J81 j;  5EJW A;  2VUM G;  1HZC A;  2L9H A;  3FKI B;  3KBX A;  3VR4 A;  4JI0 Q;  1C8C A;  1CQF A;  4LNQ A;  1B9M A;  1STG A;  3JC6 6;  4F88 A;  3K5L A;  3PUY A;  1EY4 A;  3KLS A;  1UEA B;  2E2H H;  4KHP L;  2QEJ C;  1UE6 A;  4K8J A;  1CK1 A;  1U4P A;  2ASB A;  2O5J C;  4PQX A;  2E76 C;  4NP5 A;  1CT1 D;  3J7A F;  1GJX A;  3CXC A;  1AH9 A;  3S1R H;  3J81 E;  4L5S A;  1WCM H;  1EWI A;  2F0I A;  3Q6S A;  2H4O A;  2SOB A;  1U4L A;  2NVY H;  4YCW A;  4B08 A;  3RR5 A;  4YCU A;  3NE5 B;  1VMP A;  2GN5 A;  5KEE A;  3W1B A;  4XDX A;  1WTV A;  4RA8 A;  1DM0 B;  2E2I H;  2CHB D;  3D6W A;  3RLF A;  4RKL A;  4R8N A;  3HOU H;  5I6Y A;  2EY1 A;  4R4O A;  5M5X H;  1JE5 A;  3QR8 A;  2CQO A;  2VNU D;  4RG1 A;  4ID6 A;  2I5H A;  4RGT A;  1K8A C;  3GTK B;  2PZU A;  3G6J B;  3PO2 H;  2HHH L;  3E0J A;  1CZG A;  1RJT A;  3HOU G;  4DAP A;  1YJW A;  3OTO Q;  1NTG A;  3RN5 A;  2VXW A;  3L2P A;  1GUO A;  2VQF L;  4OWW B;  2CWA A;  4A3F B;  1BNZ A;  3GTG H;  4HJ7 A;  2HUG A;  4PG3 A;  1BDO A;  2JK8 A;  1IW7 D;  2QCP X;  2A68 D;  1SDF A;  5BN4 A;  2KOL A;  4DK0 A;  4MTN A;  3CCE A;  2IHE A;  2LFN A;  2PPB C;  5JEA G;  1C0A A;  3K0Y A;  2WIN B;  5KIX A;  5CV4 A;  1ESR A;  2UUA Q;  5JJK A;  4XYQ A;  4C3H H;  1I50 H;  1PLF A;  2RCF A;  2O2L D;  3OSO A;  1PRT C;  2RHS B;  1SND A;  1ENA A;  3BDC A;  4DK1 A;  3EBE A;  3RZD B;  4A3D B;  4LUV A;  1EY0 A;  1Q46 A;  5DNF A;  1GOZ A;  4DNT B;  2RSN A;  5HY6 A;  4C3H G;  4GOP C;  3L0O A;  4JI5 Q;  1AFP A;  1SE4 A;  3GQB A;  2FMM A;  3TP6 A;  4KHV A;  4HMI A;  1Z7T A;  4POF A;  1YI2 A;  5K36 H;  2B2Y A;  3I2Z A;  1L1O B;  4M8A A;  3W1G A;  4GKJ L;  2UXD L;  3NPP A;  5IT9 L;  1T9H A;  4UP9 A;  2VL6 A;  3D31 A;  1HR0 Q;  1HH2 P;  4N9T A;  4IUU A;  4L5T A;  1I6V C;  1BBU A;  4LF6 Q;  1PVO A;  5K36 G;  3SVM A;  4FXG C;  2J7Z A;  2L4N A;  3JAM i;  4DK6 C;  3QJY A;  4LF4 L;  4JI7 L;  2G9H D;  2KQ3 A;  1IBK L;  3Q24 A;  3VYU A;  2E2J H;  3K6O A;  1R4P B;  4KTA A;  4KKT A;  1VQ4 A;  4JBK A;  4LFB Q;  4K6L A;  3Q23 A;  3FMC A;  1ENF A;  2F0L A;  3CHB D;  4J1M A;  1NAP A;  1TWF B;  4U68 A;  1B2T A;  2R7D A;  3D4R A;  4WOR A;  4FP5 D;  2K6A A;  4CJ0 B;  5C4Z A;  1N32 Q;  2E5L Q;  2OF1 A;  1VQA A;  2WV6 D;  2FIN B;  3T1Y L;  1KDA A;  1A2T A;  2ZTC A;  1LTL A;  2C35 B;  1N8R C;  4N9P A;  3C2P A;  3DMU A;  4IPD A;  1HXY D;  3J80 E;  1UEB A;  3KUP A;  4DA2 A;  1STB A;  1EQV A;  1I4Q A;  3K7A B;  1BUV T;  1SNQ A;  2K4K A;  4KY5 A;  3GTL H;  2VS1 A;  3NEL A;  2EYF A;  4FXD A;  5T1I A;  1KNA A;  2CW0 D;  2EE1 A;  1BOS A;  1ESF A;  1EWC A;  1Q82 C;  4AQY L;  3S2H B;  3D6C A;  1XNQ Q;  4QGU A;  1HPC A;  4IUT A;  2WB1 E;  1CKO A;  4DAY B;  1ML0 D;  1XPU A;  3Q22 A;  2LMC B;  1BCP D;  3HKZ E;  4P2C B;  5D3D A;  4Q5V A;  4ILW A;  2R93 H;  3HOY H;  5JOB A;  3WOE A;  5C3E G;  2JXM B;  3MXN B;  1CKN A;  2A69 C;  2LSS A;  1O7Y A;  2BOS A;  4AIM A;  2E2H B;  3A8J E;  4ALP A;  2F1M A;  2NZO A;  4IUV A;  5FKA C;  3HOY G;  3M4P A;  3NTI A;  5D65 A;  1TWH H;  4HIM A;  2SNM A;  3MXN A;  3S1R B;  1WCM B;  3CCS A;  4FF2 A;  3I91 A;  2F4V L;  2XN9 C;  4DFA A;  2N78 A;  1F2Y A;  1FJG L;  4O1N A;  4OXP A;  4QY7 A;  2E2I B;  2RDF A;  1WD1 A;  2KCN A;  1M8A A;  1X3P A;  2Y0S G;  4DU9 A;  4N8X 1;  3M4Y A;  2PQA A;  3TZU A;  2ALY B;  5GAG C;  3G4S A;  3HOU B;  4KJO A;  4DXG A;  1WTX A;  4DR3 Q;  1K9M C;  2AUK A;  1S3O A;  1ZYR D;  5M5X B;  4C1N K;  4ZUJ A;  1J9O A;  5CGK A;  5ELE A;  4KK7 A;  3K5N A;  3HOW G;  4IPH A;  4GN4 B;  5IE8 A;  4ZQ3 A;  4LF8 Q;  3GTM H;  3PO2 B;  4L8J A;  1K3B C;  3OTO L;  3GTQ H;  2OWO A;  1C4Q A;  1JJ2 A;  1LT4 D;  2B8G A;  2I5L X;  1V1P B;  1NUC A;  1CSP A;  3GTG B;  1XWE A;  4JOI C;  4OEM B;  2HT1 A;  4GN3 B;  2A6E D;  1UE5 A;  3NQI A;  4CBV A;  1LV9 A;  1U9R A;  1Y1V G;  3PF5 A;  2UUA L;  2V1C C;  3JAM c;  4C3H B;  1I50 B;  2C9O A;  2ZJR A;  1IXR A;  3BDL A;  2K33 A;  3CPF A;  1SMY C;  4DR5 Q;  2PW5 A;  2I5M X;  4CKB A;  4RH6 A;  1PA6 A;  2VW9 A;  2IX3 A;  3TBI B;  3W3A A;  2QW7 A;  1A3U A;  3R8B A;  4H0L C;  4A3K H;  3U50 C;  4IOC A;  3AEV A;  1ICW A;  1CZW A;  2QDL A;  1GUT A;  2KCT A;  4X65 Q;  4AYB E;  1WTO A;  4OEL B;  1W2B A;  3Q8D A;  1Q1E A;  5FLX c;  1HQR D;  1U4M A;  3ICE A;  2N3S A;  4BWG B;  3I72 A;  5IGD A;  3Q0A A;  1O7Z A;  3TQY A;  1B50 A;  2JA9 A;  5GAE C;  3KF6 B;  4A4I A;  2B8F A;  4Y52 H;  3ULP A;  3M7N A;  4LF6 L;  1LT5 D;  3ONA B;  1MJE A;  4DUZ Q;  4DV3 L;  1STE A;  5DEH A;  4ZUI A;  4QUC A;  3PUX A;  3S1N H;  5EKI A;  2JA6 H;  2LS0 1;  1KLG D;  2ZJQ A;  2CVR A;  1PDQ A;  3PV0 A;  1EWH A;  2E2J B;  1F77 A;  4LFB L;  2JA6 G;  1S5D D;  4HJA A;  1PH2 A;  5LMN W;  4HCE A;  4A3J H;  5IWA Q;  1MSH A;  3N52 A;  1ENC A;  1L0X B;  5D3I B;  2F52 A;  5ELO A;  4K6D A;  3AQQ A;  2E5L L;  4G57 A;  3I7F A;  1A6X A;  3PCO B;  3I70 A;  2M2L A;  3H09 A;  1TU2 B;  1XTD A;  3FDT A;  2A6H C;  2IJ0 A;  3HOZ H;  1F9Q A;  2UUC Q;  2P5Z X;  2QEX A;  2Z6B A;  1FNW A;  1EYC A;  3NP8 A;  1G2T A;  5IP9 G;  3CQZ H;  2RDG A;  3SK8 A;  3GTL B;  4JV5 Q;  1KHI A;  1IBM Q;  1DOK A;  2RKS A;  4FXK C;  3HOZ G;  3H3V C;  4CHT B;  2VZA A;  1XNQ L;  1EYG A;  4QL5 A;  3F2D A;  4ODG A;  2WAQ B;  1A0I A;  1CM9 A;  1PZJ D;  4KD4 A;  2TSS A;  1PYW D;  4LF7 L;  2PI2 A;  1QCB D;  5LHY 1;  4R8I A;  4I7Z C;  4JI8 Q;  1PV4 A;  4DV5 L;  3E6Z X;  1GUW A;  4ZAI A;  2E75 C;  1YBY A;  3GO5 A;  3HOY B;  2R93 B;  5CR3 A;  3IKJ A;  1TS3 A;  3H3V I;  1JOO A;  5BN3 A;  4R9W A;  2H1E A;  4RGN A;  1CQV A;  1MI2 A;  2JA5 H;  4L5Q A;  3MAQ A;  1M1K C;  1IKL A;  1TKW B;  1PTO H;  4DAV A;  2OQK A;  3U4Z A;  2IPK D;  3HFZ B;  3NQT A;  4GLV B;  2OT2 A;  4K14 A;  4K5W A;  2KCC A;  5H1S E;  1TWH B;  3S1Q H;  2RHQ B;  4NXN Q;  3GV6 A;  1SEB D;  2Z8L A;  4KD3 A;  4OWX B;  1PH9 A;  3STB D;  2EIF A;  3S14 H;  3KFU A;  2GVA A;  4X66 Q;  2IWH A;  2ENB A;  3WWV A;  2JA8 H;  3FPP A;  2EJM A;  4JCV E;  1N34 Q;  3MFG A;  3QWN A;  2EZV A;  2I07 B;  2XIW A;  1N36 L;  5HGT A;  2DNC A;  3TS2 A;  3HP3 A;  4JK1 C;  2B2V A;  3HZX A;  1XMO Q;  5JVG 3;  4RFB A;  5I2Y A;  1CA6 A;  1HCZ A;  2XVS A;  2JA8 G;  4IOA A;  2WAQ E;  1VQK A;  3SK4 A;  1X9N A;  2K28 A;  3ZJY C;  4LUZ A;  4LF8 L;  3ZYY X;  1UNS A;  2B2Y C;  1J5E Q;  5LL6 S;  4HR7 B;  1MD2 D;  2OQ0 A;  5E3F A;  4J15 A;  2ZT9 C;  4RCO A;  5IYB H;  5G3L F;  3GTQ B;  2GVB A;  2AQ3 B;  4P72 A;  4LW1 A;  2XRS D;  1ZXT A;  2L0C A;  1TS2 A;  4BBS H;  4MZ9 A;  5M3F G;  1KAW A;  4X64 Q;  2ZXR A;  5IYB G;  5KNC A;  1HZB A;  2UUB Q;  2WKD A;  1HR0 W;  3E9I A;  2F0O A;  5EQ0 A;  1B44 D;  2O5I C;  3J7A V;  4NMZ A;  3RD4 A;  4BBS G;  2MJ8 A;  1S5C D;  2D0O A;  4JYA Q;  1I4G A;  4OIK A;  1HTL D;  3JAM L;  2RQX A;  4DPG A;  5IGE A;  1SBB B;  5GQO A;  1X55 A;  4DR5 L;  4J6H A;  1SYC A;  5JJL A;  3GD7 A;  5EGT A;  2IT1 A;  4KJN A;  2R61 A;  5KGU A;  3CU7 A;  5ELC A;  2B63 G;  2YTY A;  4FO2 A;  4DR6 L;  4OO1 H;  2AQ1 B;  4ME5 A;  1AE2 A;  4A3K B;  1S5B D;  3NBH B;  4X65 L;  1JT8 A;  3CRK C;  4JG2 A;  3T13 A;  2KHS A;  1CUK A;  1K8M A;  3I55 A;  1I94 L;  4RCN A;  5FLX L;  4OO1 G;  2L12 A;  4GNX A;  1WTP A;  3ERO A;  2Z6K C;  2NVQ H;  5GAH C;  4OWT B;  3OWE B;  2K1B A;  3HOX H;  1YEZ A;  1PFS A;  1DCZ A;  4G4K A;  1F2L A;  2Q8R E;  4IUQ A;  1I4R A;  1X32 A;  2EY5 A;  4CGY B;  3SXH A;  3DM1 A;  3NWS A;  3S1N B;  1VQ8 A;  3KLR A;  2JA6 B;  3A8I E;  3EFX D;  3HOX G;  1YZ6 A;  4BA1 I;  3T4A C;  3QG1 A;  2VUM H;  2RDH A;  2ZTD A;  3QO2 A;  1SE2 A;  1U5K A;  3OIP A;  1VQD A;  3MHB A;  4NPS A;  5IWA L;  2EXZ A;  2EYM A;  4LF5 L;  4A3J B;  2UXB Q;  3HRZ C;  1LAC A;  2A74 C;  4X3K A;  1MKH A;  1V8Q A;  1TWA H;  4DN4 M;  5FJ8 G;  1IW7 C;  1VQ6 A;  4CKC A;  1EY6 A;  4HIO A;  4B9X A;  1QUQ B;  1K8G A;  3TME A;  3L3O C;  2KCM A;  5KYL A;  1PH6 A;  3AMU A;  3S15 H;  2BE5 D;  2LXJ A;  2MNA A;  1B4O A;  3HOZ B;  5EPL A;  2JA7 H;  3K80 C;  2ES2 A;  4UHV A;  1E2W A;  1RCV D;  2YYZ A;  2K5H A;  2OTL A;  4IUR A;  4OHJ A;  2B2T A;  1MJC A;  5CV7 A;  3CQZ B;  1H9K A;  2FJ2 A;  1GVP A;  3TP8 A;  4DV7 Q;  1IBM L;  2BA1 A;  2UXC L;  5BN5 A;  2OEO A;  1V1O A;  5D14 A;  1AEX A;  2EYJ A;  2JA7 G;  1YIJ A;  1STA A;  5DM7 3;  1KD1 C;  4EVO A;  5CV6 A;  3HS0 C;  3BVM A;  1BQQ T;  5C3W A;  1A3V A;  3S2D H;  1CHQ D;  4HAE A;  4NW2 A;  4JI8 L;  3CKI B;  4KN7 C;  4KN4 C;  1YNX A;  1PYS B;  4EQP A;  1MBY A;  4DK3 C;  1DOM A;  1OXV A;  4B3R L;  1VQE A;  1VQI A;  1FNV A;  4EGV A;  1CSQ A;  1X56 A;  3CC7 A;  1YHQ A;  2JA5 B;  1LTB D;  2Z4I A;  5I9P A;  5M5Y H;  4MTK A;  4GKK Q;  1EQR A;  2LKV A;  3VYS A;  1PTO B;  4IPC A;  5JEA H;  4IUN A;  4KI0 A;  3I8Z A;  2F0H A;  3TSS A;  4NXN L;  3S1Q B;  1PHJ A;  4JVZ A;  2Q8T A;  1HZ9 A;  1OTC A;  1Q81 C;  3PQI A;  2OTJ A;  1SE8 A;  2IY5 B;  1KRS A;  3S14 B;  5IT9 E;  2F0W A;  3TN2 A;  1PYB A;  4UDU C;  4RGM A;  1D5Z C;  2Q2H A;  4ULL A;  4XQN A;  1RIP A;  1DGS A;  4L6T B;  1WTH A;  3OMC A;  3SK6 A;  1XMO L;  2PZW A;  1L0W A;  1ROD A;  1EY9 A;  2L5T A;  2SNS A;  3C1E A;  3WDN A;  1K73 C;  1KDC A;  4HED A;  2YU9 H;  2KVM A;  5COY A;  1EIF A;  2EYL A;  3M3Y H;  3MFY A;  4K8I A;  4BBS B;  2CW0 C;  3K59 A;  1OXX K;  3BG3 A;  4PMB A;  4X64 L;  3MC0 B;  2UUB L;  3UDG A;  4EQO A;  5L37 A;  1YNN D;  3AFQ A;  1NBW A;  1SRO A;  3AYH B;  5ISR A;  1WTQ A;  5G3L D;  5C3X A;  2O4X A;  1BCP C;  2X6G A;  2JQO A;  1L1O A;  3K8A A;  4YY3 Q;  4FVM A;  4P75 A;  3G48 A;  1B53 A;  4DV6 Q;  3RLN A;  3CCR A;  2JN4 A;  3SHL A;  1QJO A;  2XRQ D; 
#chains in the Genus database with same CATH homology
 3F8T A;  4LFC Q;  1CSP A;  3PSI A;  5LMU Q;  1PH7 A;  1Z47 A;  4QJF A;  2MO0 A;  2K5V A;  1IL2 A;  4IOA A;  4JOI C;  4JI3 Q;  5ELN A;  1GM5 A;  1A62 A;  1OXU A;  4GN3 B;  2HT1 A;  3GTK H;  1UE5 A;  3FP9 A;  4LFA Q;  4B3R Q;  4K0K Q;  4DR7 L;  3J81 c;  5E7N A;  2HHH Q;  1Y1V G;  2UUC L;  3PF5 A;  2AWO A;  1YJN A;  1G51 A;  2UUA L;  2V1C C;  3JAM c;  2A8V A;  1IZ6 A;  1EQQ A;  2K75 A;  4NXM L;  1QUQ A;  2VQF Q;  1VQB A;  2ZJR A;  4A3F H;  4UY8 C;  1IXR A;  3CPF A;  3UE0 A;  3H15 A;  4A3C H;  4JV5 L;  2DUD A;  3CCL A;  4DR5 Q;  3CP0 A;  2JA5 G;  1BVS A;  2I5M X;  3BJU A;  3J80 c;  2VW9 A;  1PA6 A;  2EXD A;  2R92 H;  3ULJ A;  1VS0 A;  1XMQ Q;  1XPO A;  1GO3 E;  1YVC A;  4A3K H;  3U50 C;  4IOC A;  4A3F G;  3AEV A;  4HJ9 A;  1WOC A;  2ZJP A;  2K14 A;  4IJH A;  2KCT A;  2VQE L;  1VQ5 A;  4X65 Q;  2HQL A;  2PI2 E;  3HKS A;  4AYB E;  1E1O A;  2YTX A;  1EFW A;  4BA2 I;  1W2B A;  2RCN A;  4LF9 L;  3Q8D A;  5FLM H;  1Q1E A;  2JEB I;  5FLX c;  5AJ3 L;  1XNR Q;  2CKZ B;  2NZH A;  4DR1 Q;  3ICE A;  2N3S A;  3RZD H;  1TXY A;  4B3M L;  1XPR A;  1UE1 A;  4A3D H;  5IYD H;  2KBN A;  3F2B A;  4A3G H;  3CCV A;  2F4V Q;  3TQY A;  4LUO A;  1JJC B;  4GS3 A;  2JA9 A;  5GAE C;  3OYY A;  3KF6 B;  1FJG Q;  4A4I A;  4DUY L;  4Y52 H;  2K50 A;  1P8L A;  1I5F A;  4R1J A;  3PIO A;  2ZTE A;  5LMN L;  5C3E H;  3ULP A;  4JI2 L;  4LF6 L;  3M7N A;  5FLM G;  1WCM G;  1MJE A;  4DUZ Q;  4DV3 L;  1X65 A;  1KC8 C;  2A1A A;  2UXB L;  4A3D G;  5IYD G;  3B6Y A;  1KQS A;  4A3G G;  3PUX A;  1IBL Q;  3S1N H;  2JA6 H;  1D8L A;  2ID0 A;  2R7F A;  1YHA A;  5C4J H;  4JI0 L;  2ZJQ A;  1LYL A;  1HNW L;  1LUZ A;  4DAM A;  1A63 A;  1W3S A;  4JI6 L;  2UXD Q;  5IT9 c;  3CCQ A;  5GAD C;  1MIU A;  3PV0 A;  4JBM A;  1JJG A;  2Q2I A;  5IY0 A;  1Q1B A;  1SN8 A;  4X66 L;  4LFB L;  1HZA A;  2JA6 G;  4AYB G;  4PMW A;  4O2D A;  4HJA A;  5LMN W;  1E22 A;  1PH2 A;  1NY4 A;  4A3J H;  1SR3 A;  5EAY A;  4EQ5 A;  5IWA Q;  3PUZ A;  1PH3 A;  1N34 L;  1N33 L;  1Z9F A;  4JOI A;  4HID A;  1SRU A;  1HJP A;  4FDB A;  1EOV A;  2F52 A;  2R6G A;  2BH8 A;  2RF4 A;  5ELO A;  5M5W H;  1VQO A;  3CC4 A;  2XTI A;  3AQQ A;  4DV7 L;  1PH5 A;  4LF4 Q;  2E5L L;  4A76 A;  3PO2 G;  2Z0S A;  3I7F A;  1VQN A;  3PCO B;  1A8V A;  4B3T L;  3A74 A;  1R9T H;  4JBJ A;  1KXL A;  1XTD A;  4GNX B;  1J5E L;  4DR7 Q;  1I6H H;  1EUJ A;  1HNX Q;  4P73 A;  3HOZ H;  3UDF A;  5J3B A;  2UUC Q;  2QEX A;  1TWF H;  1WFQ A;  3PGZ A;  3HOW H;  1BBW A;  4OO1 I;  3AFP A;  4O0A A;  3M85 A;  2MFI A;  1G6P A;  4UP7 A;  4B3S L;  2WP8 J;  5IP9 G;  1VQ7 A;  3CQZ H;  1QVC A;  4JI1 L;  3F1Z A;  3EIV A;  1JB7 A;  4JV5 Q;  1KHI A;  4IJL A;  3OW2 A;  1IBM Q;  1VQK A;  2Q2T A;  4IFD J;  3I4O A;  1VQF A;  4X62 Q;  3HOZ G;  4EX5 A;  3NEN A;  3T1H L;  3T1Y Q;  3CW2 C;  4AH6 A;  3CCM A;  3BU2 A;  2VZA A;  1XNQ L;  1FL0 A;  4QL5 A;  1EYG A;  3F2D A;  2HIV A;  1VQL A;  3GTO H;  1A0I A;  3PUV A;  4HIK A;  1O7I A;  3CMA A;  3S24 A;  5IYC G;  3A0J A;  4LF7 L;  2PI2 A;  4A93 H;  4BXX H;  4JYA L;  4PZ8 A;  2VQE Q;  4JI8 Q;  4DV4 Q;  3I4M H;  3K7A H;  4JBW A;  4DV5 L;  1PV4 A;  5JEA J;  4MNO A;  1Y1V H;  4TQU S;  1V1Q A;  2PNH A;  3M4Q A;  3K81 C;  1YBY A;  3GO5 A;  4YHH L;  3I4N H;  4RMF A;  2QGQ A;  3KJO A;  3H3V I;  2I0Q A;  3S2H H;  4A93 G;  4BXX G;  5DLQ E;  3I4M G;  4AQY Q;  3IRB A;  3CD6 A;  2FXQ A;  1Q7Y C;  4XTC S;  3I56 A;  1JMC A;  2JA5 H;  4L5Q A;  4JI4 Q;  1M1K C;  5LMN Q;  3J81 i;  3A5U A;  5C44 G;  4R4I A;  4DV3 Q;  1GD7 A;  4APV A;  4DR4 Q;  4WJ3 M;  3J81 j;  2OQK A;  3I4N G;  3U4Z A;  3CCJ A;  3HFZ B;  1IYJ B;  4OX9 Q;  4GLV B;  5H1S E;  3ERS X;  1HZC A;  2VUM G;  2LXK A;  1Y1W H;  2JJQ A;  3S1Q H;  1QVG A;  2RHQ B;  4JI0 Q;  1D7Q A;  4NXN Q;  1VQG A;  4WJ4 A;  4A75 A;  4LNQ A;  4OWX B;  4C2M H;  4JI6 Q;  3JC6 6;  2B3G A;  3PUY A;  2KEN A;  3CCU A;  1PH9 A;  2YV5 A;  1L2F A;  2EIF A;  3BZC A;  3STB D;  4JI5 L;  1HNZ L;  2E2H H;  3KFU A;  2GVA A;  3S14 H;  4KHP L;  1GKH A;  3D0F A;  4X66 Q;  4Y7N H;  3CME A;  1UE6 A;  1Y1W G;  2ASB A;  3GTP H;  3WWV A;  2JA8 H;  4XIG S;  3E0E A;  4JCV E;  2MO1 A;  4BBR H;  1N34 Q;  4R4Q A;  4GNX C;  2IHF A;  3CXC A;  3M9B A;  1AH9 A;  1N36 L;  1VQJ A;  2K52 A;  2WFW A;  3PIP A;  3S1R H;  1WI5 A;  4L5S A;  1WCM H;  1EWI A;  3TS2 A;  1E7Z A;  3W5O A;  2NVY H;  4YCW A;  1VQH A;  4A3I H;  4GOP B;  1XMO Q;  2EQS A;  2JA8 G;  3RR5 A;  4YCU A;  3KYH C;  2WAQ E;  1PH4 A;  4BBR G;  3U58 A;  1NJI C;  2GN5 A;  1X9N A;  1HR0 L;  3W1B A;  3ZJY C;  2ZM6 Q;  4DV0 Q;  3J7Z C;  3TS0 A;  4LUZ A;  4LF8 L;  5C0X J;  2E2I H;  1J5E Q;  2UU9 L;  4DV2 Q;  2OQ0 A;  3GDE A;  4J15 A;  2Z6K A;  5IYB H;  3RLF A;  3TRE A;  4A3I G;  3GTJ H;  2GVB A;  4P72 A;  4LW1 A;  4DV1 L;  4BBS H;  3HOU H;  2N49 A;  3H0G H;  1B70 B;  3KF6 A;  4LFC L;  4R4O A;  5M5X H;  4MZ9 A;  1P16 A;  5LMU L;  1JE5 A;  4A3L H;  2CQO A;  5M3F G;  5JJI A;  1KAW A;  4BY1 G;  2VNU D;  1TWC H;  3DM3 A;  4X64 Q;  2N8N A;  1K3R A;  5IYB G;  1U0L A;  1HZB A;  4RG1 A;  4C3J H;  2I5H A;  2UUB Q;  4LFA L;  2IX1 A;  4K0K L;  5BR8 Q;  1HR0 W;  3E9I A;  1K8A C;  4YWK A;  1PH1 A;  3MEF A;  3PO2 H;  1WYD A;  1CKN B;  4HJ5 A;  2HHH L;  4BBS G;  5M3M H;  4DR2 Q;  2CCZ A;  2BH2 A;  3HOU G;  2D0O A;  3H0G G;  4LF7 Q;  4JYA Q;  1YJW A;  3OTO Q;  4A3L G;  1NTG A;  1YJ9 A;  1LM0 A;  3RN5 A;  3L2P A;  4DV5 Q;  4DPG A;  2VQF L;  4OWW B;  1CKM A;  2JE6 I;  1N32 L;  5GQO A;  5GRO A;  2CWA A;  1X55 A;  1VQM A;  2WAQ G;  1K0R A;  2AWN A;  4DR5 L;  5JJL A;  2PMZ E;  3GD7 A;  4IO9 A;  1I3Q H;  4R4C A;  2IT1 A;  4PG3 A;  4HJ7 A;  2NVT H;  3GTG H;  4GLX A;  2JK8 A;  4R4T A;  4UP8 A;  2DGY A;  3STB C;  5IP9 H;  5M3M G;  1XJV A;  2B63 G;  2YTY A;  4MTN A;  3CCE A;  4DR6 L;  2IHE A;  1EIY B;  1ASY A;  5JEA G;  1S40 A;  1C0A A;  1AE2 A;  1E24 A;  3UDX A;  1PH8 A;  2R93 G;  1WJJ A;  3NBH B;  4X65 L;  2UUA Q;  4A3B H;  1C7Y A;  5JJK A;  4C3H H;  1JT8 A;  1KIX A;  1I50 H;  1X3F A;  4JG2 A;  3EN2 A;  1CUK A;  1I94 L;  4GN5 A;  4C3I H;  3I55 A;  4NXM Q;  2RHS B;  5IYC H;  3S16 H;  4DR1 L;  1VCI A;  4OO1 G;  5C4X H;  1OXT A;  3EBE A;  1NMG A;  4GNX A;  2PQA B;  4LUV A;  2Z6K C;  2NVQ H;  1Q46 A;  2AKW B;  5GAH C;  4OWT B;  1K83 H;  4A3B G;  1Q12 A;  5HY6 A;  3NEM A;  4GOP C;  3L0O A;  3HOX H;  3VDY A;  4JI5 Q;  1YEZ A;  1X3G A;  1X3E A;  4KHP Q;  1PFS A;  1FGU A;  1Y14 B;  4YWL A;  3G6E A;  4GKK L;  4QQB X;  4NB3 A;  4BY7 H;  5C4X G;  3SGI A;  1IBL L;  2NVX H;  1N36 Q;  3H3V H;  4POF A;  1YI2 A;  1VQ8 A;  4LF9 Q;  3BZK A;  3ER0 A;  5C44 H;  5AJ3 Q;  3I2Z A;  3HOX G;  1YZ6 A;  4BA1 I;  3KDF B;  1L1O B;  1X6O A;  3W1G A;  4GKJ L;  4B3M Q;  3L7Z C;  2UXD L;  2KHJ A;  2VUM H;  4PZ7 A;  1T9H A;  4UP9 A;  2VL6 A;  3D31 A;  4BY7 G;  1HR0 Q;  1HH2 P;  2ZTD A;  3LGJ A;  4L5T A;  1H95 A;  1QVF A;  3S1M H;  1BBU A;  4DUY Q;  3U4V A;  1U5K A;  4LF6 Q;  1PVO A;  5K36 G;  1VQD A;  2AMC B;  4NPS A;  4JI2 Q;  1UE7 A;  5IWA L;  2JEA I;  3PO3 H;  4LF5 L;  2IX0 A;  5C0X I;  4LWC A;  2UXB Q;  3JAM i;  1SMX A;  2HIX A;  4DK6 C;  3S17 H;  1FVI A;  3M4O H;  1SFO H;  1G29 1;  2XGT A;  4LF4 L;  1MKH A;  4JI7 L;  4UPA A;  1TWA H;  1UWV A;  5FJ8 G;  5C0X G;  3RN2 A;  1VQ6 A;  1HNW Q;  1SLJ A;  4HIO A;  4JC0 A;  4YCV A;  1QUQ B;  1K8G A;  1Q8K A;  1IBK L;  3K0X A;  3PO3 G;  3CC2 A;  3J80 i;  2KCM A;  2E2J H;  4TVA B;  1PH6 A;  3HOV H;  1VQ4 A;  3S15 H;  4JBK A;  1HNX L;  1VQC A;  5HGQ A;  4LFB Q;  3CPW A;  2LXJ A;  4KHZ A;  1BKB A;  2MNA A;  2JA7 H;  3K80 C;  1N33 Q;  3TEH B;  2ES2 A;  2YYZ A;  5IP7 H;  2K5H A;  1V9P A;  2OTL A;  3PF4 A;  2R7D A;  1MJC A;  3DLL A;  4A3E H;  4L5R C;  2R92 G;  1E1T A;  3KF8 B;  1N32 Q;  1GVP A;  2CWP A;  4DV7 Q;  1IBM L;  3HOV G;  2BA1 A;  4DR3 L;  2E5L Q;  2UXC L;  4X62 L;  4IPG A;  1VQA A;  3T1Y L;  1VQ9 A;  2JA7 G;  3RLO A;  1YIJ A;  2D0P A;  4B3T Q;  2ZTC A;  5IP7 G;  1LTL A;  3G71 A;  1KD1 C;  4DR6 Q;  2C35 B;  1N8R C;  5M3F H;  4IPD A;  2H5X A;  4A3E G;  1C9O A;  4BY1 H;  1UEB A;  3S2D H;  4A3C G;  1TWG H;  2OCE A;  3K7U C;  4JI8 L;  4DV4 L;  2D62 A;  4YY3 L;  4GOP A;  4B3S Q;  3GTL H;  2K4K A;  4DV6 L;  1I94 Q;  1E3P A;  1YNX A;  1PYS B;  2VS1 A;  3NEL A;  4JI1 Q;  1M90 C;  1QZH A;  4POG A;  4A3K G;  2NN6 I;  4DK3 C;  4HJ8 A;  3T1H Q;  4JI3 L;  1OXV A;  3RZO H;  1Q82 C;  4B3R L;  4AQY L;  1VQE A;  1VQI A;  1L1O C;  4IFD I;  2R7Z H;  1XNQ Q;  4QGU A;  4JI4 L;  4DAY B;  2WB1 E;  1CSQ A;  1CKO A;  1NMF A;  1X56 A;  2NN6 G;  3KJP A;  3CC7 A;  1B8A A;  3KLW A;  1YHQ A;  2QA4 A;  5M5Y H;  4DR4 L;  3F2C A;  4GKK Q;  2B63 H;  1EQR A;  4IFD G;  1XPU A;  4IPC A;  4OX9 L;  3HKZ E;  3CF5 A;  4KI0 A;  4P71 A;  4NXN L;  2R7Z G;  3HOY H;  2R93 H;  1N9W A;  2Y0S E;  1PHJ A;  4YHH Q;  3A5Z B;  1HZ9 A;  1B7Y B;  1X54 A;  5C3E G;  1Q81 C;  1OTC A;  3MXN B;  1CKN A;  4GKJ Q;  2OTJ A;  1J6Q A;  1SE8 A;  2LSS A;  2IY5 B;  1KL9 A;  1XMQ L;  1KRS A;  4QIW E;  4YWM A;  3TRZ A;  4AIM A;  4ALP A;  2AHO B;  2NZO A;  4GLA C;  3HOY G;  1PYB A;  2YTV A;  4PZ6 A;  4LF5 Q;  4KLK A;  3M4P A;  4P74 A;  2Q2U A;  3FKI H;  1TWH H;  2Q2H A;  4HIM A;  1RIP A;  1DGS A;  4DNI A;  1XNR L;  2L15 A;  2VY3 A;  4JI7 Q;  3RNU A;  3CCS A;  1XMO L;  1YIT A;  2F4V L;  2WB1 G;  1IBK Q;  4A3J G;  1L0W A;  2B29 A;  1NE3 A;  2N78 A;  2ZM6 L;  4DV0 L;  3FHW A;  1S72 A;  1FJG L;  4H02 A;  2A19 A;  4OXP A;  3FKI G;  3UE1 A;  1HNZ Q;  4A3M H;  4QY7 A;  1RL2 A;  1V43 A;  4DV2 L;  4DUZ L;  1K73 C;  3HKZ G;  2YU9 H;  2E8G A;  2F3I A;  3CAM A;  2Y0S G;  1EIF A;  2PQA A;  4DKA C;  2ALY B;  2MQH A;  5GAG C;  3M3Y H;  3G4S A;  4X6A H;  4DR3 Q;  2UXC Q;  4A3M G;  1OXX K;  1K9M C;  1S3O A;  1QZG A;  1YHB A;  4X64 L;  2ATW A;  3UDI A;  2UUB L;  3UDG A;  3HOW G;  4IPH A;  5BR8 L;  4GN4 B;  3AFQ A;  3ULL A;  5IE8 A;  5FJ8 H;  2CFM A;  2KHI A;  3J7A 5;  1AE3 A;  1NBW A;  4LF8 Q;  3GTM H;  1SRO A;  3AYH B;  4DR2 L;  1ASZ A;  2UU9 Q;  1VQP A;  3OTO L;  3GTQ H;  2OWO A;  2JQO A;  1OXS C;  3KDF A;  1L1O A;  3K8A A;  4YY3 Q;  1KRT A;  4DV1 Q;  1Q86 C;  4P75 A;  3E9H A;  3G48 A;  3KOJ A;  2I5L X;  1JJ2 A;  4DV6 Q;  4OON A;  3RLN A;  3CCR A;  2BA0 A;  2K5N A;  3PUW A;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...