3VDYA

B. subtilis ssbb/ssdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
101
Chain Sequence
HMFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYEVNVYVTEVLADTVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
molecule keywords Single-stranded DNA-binding protein ssbB
total genus 16
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3vdyA00
5LMNQ 4DV4Q 2E2HH 2CQOA 5C44G 2ZM6Q 4A4IA 4HJAA 1K83H 4GNXA 4A3FH 2QEXA 1NTGA 4UPAA 5DLQE 1SMXA 1LM0A 1EQQA 1HNZL 4GKKQ 4A3GG 2AWOA 4JBWA 4JG2A 1X3EA 1TWCH 2DUDA 4GS3A 4BY1H 3JAMc 4DV7L 1VQ8A 4JI2L 1CSPA 2HT1A 1UE1A 4A3BG 1UE6A 4A3JG 1KRTA 3PIPA 2JEAI 4BBSH 1KL9A 1BKBA 4KI0A 4JI1L 4AQYQ 1VQCA 4Y7NH 3GTOH 4LUVA 2UUBL 4YHHL 3I4OA 4JI8L 2JA7H 3GTLH 1C0AA 3CAMA 1XNRQ 4GLVB 4P74A 3GTPH 2QGQA 5IP7H 5LMNL 4OO1G 2WB1E 2MQHA 4DV6L 3CC4A 4O2DA 3GTKH 4LF6L 1G291 3PSIA 2VW9A 4QJFA 2CCZA 1MKHA 3BU2A 1EQRA 4IPCA 5IP9G 2BH8A 4IJHA 3U4ZA 2VY3A 1VQDA 1Y1WH 2UU9Q 1ASZA 4X66Q 4JBJA 4UY8C 4DR4Q 5IT9c 2JK8A 3KJOA 1D8LA 5LMUQ 1GD7A 5ELOA 1Q82C 2F4VQ 1HZAA 2K50A 2AKWB 2VQEQ 5M3FH 4R4TA 4L5QA 4A75A 4YHHQ 1PH9A 1OXSC 2VQFQ 4DV1L 4GNXB 4DR2L 4JI5L 1VQ5A 2JA7G 1YHQA 1XNRL 1TXYA 1CKNB 4NPSA 2D62A 3PIOA 4DAYB 5EAYA 1XNQL 1Q12A 4R4QA 4YWMA 1CUKA 3PO3G 3I4NG 2CFMA 4OWXB 1HZ9A 3K7UC 1YIJA 3K8AA 1OXUA 1Y1WG 3M85A 1BBUA 2PQAA 3CCEA 1IXRA 1S72A 4LWCA 4BA2I 3CF5A 5J3BA 3PUYA 2R7ZH 4KHPL 4DUYQ 1P8LA 1WFQA 5AJ3L 4X65Q 1X9NA 4IFDI 1U0LA 3K0XA 3EN2A 3I55A 1AH9A 3KF6A 2RHQB 3OTOQ 4L5TA 1IBKL 2IHEA 4PZ6A 2K5VA 5M5XH 2XGTA 4DR6Q 1PH5A 5BR8Q 2F3IA 2E5LQ 3HOZG 1AE3A 3I7FA 4HIMA 1PHJA 3HOUG 2BH2A 2K52A 1PH2A 4DAMA 4TVAB 4BBRG 1N36Q 1MJCA 1M1KC 1IBML 4K0KQ 2NVTH 4LF8L 4LFCQ 4JYAL 1WYDA 3UE0A 4DV1Q 2NZOA 4OXPA 3FKIH 2I0QA 1OTCA 2N49A 1PYBA 2JA6G 5E7NA 1KD1C 1XMOL 1I50H 1EFWA 3HOZH 2ATWA 1HNXQ 2R93G 1YI2A 4A3GH 4GN3B 3W5OA 4IPHA 3KJPA 4P71A 1X65A 1IL2A 2CKZB 2YV5A 4JI3Q 1PA6A 3S1QH 4A3JH 4JBKA 3RLNA 2DGYA 3F2CA 2Y0SG 3PGZA 1TWFH 4O0AA 4GOPA 4A3EH 2Y0SE 1YJ9A 4R4CA 2VNUD 3TREA 1JE5A 2K75A 5GAHC 4A3IH 1MJEA 3RZOH 3I2ZA 3I56A 2ZJQA 3TS2A 4MZ9A 1I5FA 4YCUA 4DV2L 3KF8B 4X6AH 3M4QA 2UUCQ 4X62L 1XMQQ 3HOVG 2PI2E 4B3SL 1A63A 1S40A 4JI3L 4A3CH 2GVBA 3KDFA 3Q8DA 5HY6A 4YWKA 2I5HA 1M90C 2UUAL 1VQJA 3L0OA 1OXXK 1WOCA 2ZM6L 2Z6KC 3CPWA 2QA4A 3T1YQ 4QL5A 1JJGA 4WJ3M 4JC0A 5IWAQ 5C4XH 3S16H 2HIXA 4JI0Q 3T1HL 4GN4B 1SR3A 4AYBE 4DV0Q 3RZDH 1HNWQ 5JJKA 3DM3A 2K14A 1FL0A 1YBYA 4AQYL 3TRZA 1PFSA 2NN6I 1PH8A 1IBMQ 5GQOA 4JI1Q 1O7IA 4GOPB 3PUVA 5C4JH 4HIKA 4IO9A 1HNXL 2ZTEA 4XIGS 2PI2A 4JI8Q 1G51A 4B3SQ 3HOVH 1C9OA 2KENA 4LF5L 2UXCL 1PH7A 4LF4Q 1OXTA 3D31A 4X64L 2F52A 3RN5A 3TEHB 2ZTCA 4EX5A 3AEVA 3GTQH 4LUZA 2B63H 2UXBL 3MEFA 1GM5A 5IWAL 1UWVA 4OONA 2ZJRA 2YU9H 3BJUA 3RR5A 4DV0L 4PG3A 4ALPA 1PH3A 2A8VA 2RF4A 4BXXH 1L1OC 1E22A 2JA9A 5LMUL 1Q1BA 2ID0A 4J15A 4RG1A 2E2JH 2KBNA 3E9HA 2F4VL 1QVGA 4A3IG 3NELA 4LFAL 2WFWA 4LF9L 1AE2A 4JI2Q 2FXQA 1VQOA 1UE5A 1TWHH 2EIFA 4LF4L 4GKJQ 5C0XG 3F2DA 4BBRH 2MNAA 3STBC 1CKOA 2B63G 3EBEA 4A3EG 1GVPA 2WAQE 1K73C 4BBSG 4JBMA 1YHAA 1I94L 4LNQA 3KLWA 1V9PA 1IZ6A 4C3IH 4DV3L 1PV4A 1VQLA 4JI0L 1SROA 1KC8C 1RIPA 4JI6L 4DR7Q 2VUMG 3M9BA 3RN2A 3HOYG 4IPDA 5IP7G 3ULPA 4DUZQ 2RHSB 3PO3H 4KHPQ 2RCNA 1KXLA 3ER0A 4IJLA 4X65L 3CCVA 3UE1A 1KQSA 1T9HA 1YNXA 4A3CG 5M3MH 2VL6A 1W3SA 5JJLA 4B3MQ 3NBHB 4C3HH 3MXNB 4DR5Q 2JE6I 2L15A 4JI7Q 1N9WA 1LTLA 3U4VA 5IE8A 4YY3L 2H5XA 2JEBI 1J5EL 1HR0Q 4NXML 4AYBG 3S2DH 2OQKA 4YCWA 2VQFL 4LFBQ 1VQ4A 2B29A 3KF6B 2VUMH 1A8VA 1XNQQ 4QQBX 2Z6KA 3CCJA 3CMEA 1XPOA 3HKZG 3J80i 3NEMA 4LF8Q 3UDGA 4KHZA 3S15H 4K0KL 3GD7A 1E1OA 1X6OA 1Q46A 2B3GA 2D0PA 4UP9A 4POFA 5FLMH 4LF9Q 3ULLA 2HHHL 1S3OA 4DPGA 1E7ZA 3F1ZA 4LF6Q 2IX0A 1VQGA 1NMGA 4GKJL 1NMFA 3L2PA 1XMOQ 1I6HH 3W1GA 2NVYH 5GAEC 5IYCG 4DUYL 3M4OH 1VQHA 2AWNA 1NE3A 3OYYA 3KFUA 5IYDG 3J7ZC 1VQ7A 3B6YA 4DV3Q 1B70B 4EQ5A 3S1MH 4DR7L 2A19A 1UEBA 1X56A 1CSQA 1Z47A 1I3QH 3ERSX 4A3LH 3CP0A 2KHIA 3AYHB 1QVFA 5FLXc 1Y1VH 3NENA 1VQKA 4OX9L 2JA8G 2OTJA 1VQFA 3M3YH 2KHJA 4P72A 3HOXH 1Q7YC 4QY7A 4PMWA 4NXNQ 2UUCL 3PO2G 1HJPA 4UP8A 3U50C 1K8GA 4TQUS 3CQZH 4YY3Q 1XMQL 1HR0W 4JI4Q 1SN8A 3TS0A 3U58A 2ZTDA 1N8RC 1FJGQ 4B3TL 1EOVA 2C35B 2MFIA 1P16A 4OWTB 2OQ0A 1E3PA 2CWAA 1E1TA 1V1QA 4C3JH 3T1YL 1N33L 1V43A 2Q2TA 3I4MG 4BY1G 4RMFA 1WCMG 4LFBL 2OTLA 3SGIA 4A3LG 2N8NA 5M3MG 2JA5G 1RL2A 3EIVA 4R4OA 2R92G 4B3RQ 2UU9L 3OTOL 2I5LX 5ELNA 3HOXG 1D7QA 1VQIA 2D0OA 4P75A 2EXDA 4PZ7A 1J6QA 1KIXA 1FVIA 1WI5A 4GKKL 2VS1A 1E24A 1WJJA 2CWPA 3JC66 1YZ6A 5IY0A 4JI4L 3PV0A 3H3VH 5C4XG 3RLFA 3STBD 4GNXC 4DR2Q 2WAQG 4B3TQ 5JEAJ 2JA6H 1JJCB 2KCMA 1NBWA 4LW1A 4IFDJ 1HH2P 4NB3A 4X64Q 3FHWA 2KCTA 3G48A 4A3FG 5C3EG 2UUBQ 5GADC 4POGA 2A1AA 4GN5A 2ASBA 2R92H 2BA0A 4B3RL 4XTCS 1Z9FA 1Y1VG 5M5WH 4APVA 1H95A 1VQEA 2K5NA 1L1OA 3VDYA 4JV5Q 1YEZA 1CKNA 3W1BA 5AJ3Q 2I5MX 1K9MC 3PF4A 1IBKQ 1KHIA 5C44H 1K8AC 1U5KA 3S2HH 1BBWA 4LF7Q 2K5HA 2VZAA 4R4IA 5GAGC 4IOCA 5IYBG 3HOWH 2VQEL 3E0EA 1N33Q 2ZJPA 3PUXA 3J81j 4DV7Q 1DGSA 3HKSA 2UXCQ 2PNHA 3H0GG 2BA1A 1K0RA 2PQAB 1Q86C 5K36G 1SE8A 1N36L 2WB1G 1G6PA 5C0XI 5JEAG 3ULJA 4JYAQ 3K7AH 1YVCA 1L0WA 2N3SA 3KYHC 3CC2A 1MIUA 2GVAA 1EYGA 4A3MH 1B8AA 3L7ZC 3CD6A 3J81i 2UUAQ 4B3ML 1Y14B 1YHBA 1ASYA 4LF7L 3I4MH 3GDEA 4DR1Q 1C7YA 2IY5B 1GO3E 4ME3A 1HR0L 2JQOA 3HOUH 3G71A 3G6EA 1XTDA 4AIMA 2GN5A 3GTGH 3ICEA 4X66L 1YITA 3G4SA 5FJ8G 4HJ9A 2NN6G 2N78A 3PF5A 2IX1A 1SRUA 5H1SE 4JI5Q 4GOPC 2HHHQ 3FKIG 1BVSA 3A5UA 1VQBA 1IYJB 3K80C 3PUZA 3I4NH 2JJQA 3CCUA 1XPUA 2R6GA 3HOYH 1X3FA 4JV5L 1TWAH 2R93H 1Q81C 2JA5H 4X62Q 4WJ4A 3CCQA 2YTYA 3S1RH 1VQPA 1QZGA 2HQLA 1HZCA 1YJNA 1L1OB 1X54A 2Q2HA 2LXJA 4DR5L 3J7A5 4QGUA 1YJWA 2Q2UA 4DV6Q 1R9TH 2UXDQ 2WP8J 4LFAQ 1J5EQ 4DNIA 4GLAC 1KRSA 3T1HQ 5JJIA 1NY4A 1HNWL 1W2BA 3K81C 2V1CC 3FP9A 3JAMi 2AMCB 5M5YH 2PMZE 3CCSA 1JJ2A 4DR4L 4DR6L 3A0JA 2Z0SA 1HZBA 5IYBH 3HOWG 4HJ8A 1UE7A 4MNOA 3OW2A 1JB7A 3ZJYC 5BR8L 1N34L 1VQMA 1I94Q 1PYSB 4JOIA 1PH4A 1N34Q 3F8TA 3H0GH 3PCOB 3RNUA 4LF5Q 4KLKA 1IBLL 4IFDG 3A74A 1QZHA 4GLXA 3CXCA 3CCMA 4DV5L 3HKZE 3D0FA 2ES2A 3BZCA 2E2IH 4Y52H 3CCRA 2ALYB 2OCEA 4DUZL 4A3KG 2YTVA 4A93G 1K3RA 2R7ZG 4LFCL 2K4KA 2LSSA 4AH6A 1CKMA 5IYCH 4IOAA 2LXKA 3UDFA 1EIFA 4HIDA 3CCLA 4BY7H 1NJIC 3H3VI 1N32L 5IYDH 4L5SA 1A0IA 1EUJA 3GO5A 4HIOA 3AFQA 3LGJA 1KAWA 3E9IA 3CMAA 3CC7A 1B7YB 4NXMQ 1OXVA 1VQ9A 5FLMG 1LYLA 3WWVA 3M7NA 4OX9Q 3J81c 2AHOB 2MO1A 2IHFA 4FDBA 4DR3L 3GTMH 1JT8A 3TQYA 4DV5Q 2JA8H 4DV4L 3IRBA 5FJ8H 2IT1A 3UDXA 1SLJA 2NVXH 4A93H 3GTJH 2E5LL 2R7FA 4DK3C 1X3GA 3S24A 1PH1A 1FJGL 4A3DH 3AFPA 1L2FA 3KDFB 1X55A 3S17H 1GKHA 2YTXA 1Q8KA 1XPRA 4JI6Q 3DLLA 5C0XJ 1EIYB 1JMCA 2UXDL 3CPFA 5C3EH 3S1NH 2NZHA 2UXBQ 3HFZB 4DKAC 2NVQH 4YCVA 4HJ7A 1XJVA 4JOIC 3KOJA 4LUOA 2XTIA 2E8GA 1EWIA 3M4PA 4P73A 5IP9H 3H15A 4DR3Q 4OWWB 2YYZA 4DK6C 1IBLQ 1Q1EA 3BZKA 3PO2H 4JI7L 1LUZA 1VCIA 4C2MH 2MO0A 4H02A 4BA1I 5M3FG 4A3DG 4UP7A 1FGUA 3CW2C 1VQNA 2OWOA 4BY7G 5GROA 3UDIA 4BXXG 1N32Q 3A5ZB 1QUQB 1WCMH 2R7DA 4R1JA 4NXNL 3AQQA 1VS0A 4YWLA 2Q2IA 1HNZQ 3S14H 1PVOA 1VQAA 1A62A 2HIVA 4L5RC 1QUQA 3RLOA 1QVCA 5HGQA 4IPGA 5LMNW 2EQSA 4HJ5A 4A3BH 4PZ8A 4QIWE 4DR1L 4A3KH 4MTNA 3F2BA 1PH6A 3PUWA 3J80c 4DV2Q 1VQ6A 1SFOH 1TWGH 4A3MG 4OO1I 4A76A 4JCVE
chains in the Genus database with same CATH superfamily
1Z6HA 5C44G 2ZM6Q 5IIFA 1GJXA 1HNZL 2L11A 4BY1H 5C3WA 5C5LA 4JI2L 1CSPA 3K58A 2HT1A 4A3BG 3IAYA 1LTID 2OXPA 4KI0A 4AQYQ 1U4LA 4CHTB 4IUUA 1U9RA 4FXGC 4P74A 1ZYRD 2MQHA 4DV6L 4O2DA 2QW7A 2VW9A 2AQ1B 4IPCA 2M2LA 2KEDA 1AN8A 2MP1A 4KV6A 3T16A 2UU9Q 1VQDA 4IQZA 2J7ZA 4DXFA 1LO5D 5J22A 1G8ZD 1TS3A 2K5QA 3HS0C 3KJOA 1GD7A 5ELOA 1HZAA 2K50A 1PH9A 5M3FH 1N34Q 4R4TA 2L1BA 4YHHQ 5C4XB 1VQ5A 2CW0C 2D2CC 3C2PA 1HXYD 4C3IG 4X3SA 5EAYA 4B08A 1XNQL 2EPBA 1U4PA 4OWXB 1WTXA 3K8AA 2WKCA 1IYUA 2D5DA 1S72A 2QDBA 4FVMA 2NN6H 4DF7A 3FKIB 1I4PA 5J3BA 2K5WA 3C1EA 1X9NA 1G6ZA 3KF6A 3OTOQ 4PZ6A 2E2IB 1PH5A 4XT1B 2E5LQ 1CA5A 2K52A 1BUVT 4PV1C 5DEHA 2L55A 2MHVA 4BBRG 1N36Q 1BCPF 4IZ8A 4KY5A 5FLXL 2BCOA 4LFCQ 2NZ1D 4OXPA 1F2YA 3NTIA 4OEMB 1ICWA 5E7NA 1XMOL 3TZDA 2R93G 1YI2A 1Z7TA 1T5EA 3GTOB 3KJPA 1IL2A 1PA6A 1TQOA 4JBKA 3G7LA 3SDZA 4ZYSA 2FINB 4C1NK 2DY7A 5JPMC 3PGZA 1TWFH 3BVZA 4O0AA 4GOPA 2HD3A 2Y0SE 4R4CA 2JA8B 4IURA 1RDPD 2K04A 5EKIA 3M4YA 3N6RA 3RZOH 1JOQA 1EEFD 2BDNA 3M4QA 4BWGB 1AZPA 2PI2E 1NCVA 5IGFA 4A3CH 5M5XB 3L0OA 1WOCA 3CPWA 3JAME 1SNQA 5IWAQ 1L0YB 2B8FA 4AYBE 1SR3A 4Q0FA 3RZDH 1YBYA 4ABNA 4JVZA 4ID6A 4LJZC 4GOPB 3PUVA 1K0SA 1NR4A 4IO9A 1G51A 4B3SQ 4LF4Q 1HUMA 4X64L 2NB0A 3RN5A 3KUPA 4EX5A 3AEVA 2RVLA 4BY1B 5C4ZA 2A6HC 2NWGA 3KLSX 3A8JE 2YU9H 3BJUA 3RR5A 1I4QA 2G5DA 5CYUA 3DUZA 2RF4A 3IKJA 5IT9L 2F0UA 2UUAL 2ID0A 2E2JH 1CQVA 1QVGA 2LKVA 2RDGA 1DZ1A 2RDFA 4EGVA 2F0NA 1UE5A 2EIFA 5EPLA 5C0XG 1UUPA 3F2DA 3STBC 4IN3A 3QIAA 1SYCA 1C48A 1LTTD 4X3TA 4A3EB 4JBMA 1YHAA 2AQ3B 3VYSA 4H0LC 4LNQA 3KK7A 1AFPA 1VQLA 1KC8C 1RIPA 1O78A 5DM63 2SEBD 1A2TA 3ULPA 3PO3H 1RD9D 1KXLA 4B9XA 4IJLA 4X65L 4K5VA 1T9HA 1YNXA 4XT3B 3HOWB 1W3SA 4OHJA 4C3HH 2ICEC 1YNJC 3S2DH 2H5XA 3AMUA 2VQFL 1PTOH 3R3OA 1PZID 4J6HA 4KHZA 1STYA 1E1OA 1MD2D 1F2MA 4UP9A 5FLMH 2ZXPA 1H9SB 1NMGA 4GKJL 3F2UA 3L2PA 1OO9B 1I6HH 1NUCA 2NVYH 3TDQA 2Q8RE 1XYIA 3KFUA 5IYDG 1VQ7A 2R3ZA 3B6YA 3TP5A 3S1MH 2I07B 1X56A 4ME5A 1S5BD 1PTOD 1Z47A 2F0DA 1I3QH 3ERSX 1H9KA 1B50A 3CP0A 1O7YA 2KHIA 1Y1VH 5E3FA 2B39A 4J1MA 1Q7YC 4RFBA 1LT5D 4PMWA 5KYLA 1K8GA 4TQUS 4HCSA 1SN8A 4I7ZC 3TS0A 3CRLC 5C6AA 2MFIA 2C35B 4PQXA 2CWAA 1V1QA 1V1PB 4C3JH 3I4MG 1TWFB 4ILWA 4RMFA 2OTLA 4A3LG 5JPNC 3NUCA 1ET9A 2IJ0A 1V8QA 5ELNA 1D7QA 2D0OA 2M00A 1J6QA 4R9WA 1FVIA 1WI5A 1E24A 1WJJA 2CWPA 4A3GB 1YZ6A 5CV6A 4GNXC 1IYVA 3D6WA 2JA6H 5C3XA 2PNRC 3G48A 4LAAA 4A3FG 2A1AA 5ELBA 3J81L 2WINB 4XTCS 1Y1VG 1H95A 2K5NA 3T13A 5I9PA 3ITPA 2PZWA 4JV5Q 2Q8IB 2JN4A 4CJ2C 3W1BA 3PF4A 2FJ2A 3DHQA 1EU3A 1GUGA 2KCCA 4R4IA 4IOCA 4HAEA 1N33Q 2L5TA 3H0GG 2BA1A 2PQAB 2BDOA 2FFKB 3D3RA 4UDUC 1EL0A 1ONLA 1SE8A 1SYEA 1G6PA 2X6LA 4JYAQ 3K7AH 1L0WA 2OEOA 2N3SA 2SNSA 3CC2A 1MIUA 3IFTA 3A55A 1NR2A 2RQXA 1JC7A 3I91A 1Y14B 1RHPA 1EQTA 1GO3E 4ME3A 5KEEA 3G71A 3G6EA 3I4MB 4AIMA 5BN5A 5IGGA 3WOEA 1YITA 4K5XA 3KLSA 4HJ9A 4L63B 4C3JB 4KKTA 4HSPA 3SE0A 2B2WA 3SVMA 3K80C 3S2HB 1HZCA 4HMJA 1HCZA 1STHA 4DR5L 2LXJA 1Y1WB 3OIPA 1EIGA 4DV6Q 1AP0A 1NSNS 2QF7A 1W2BA 2V1CC 2AMCB 5E1FA 5M5YH 3RMHA 5KYIA 4HJ8A 2PQEA 4XYOA 3HOVB 1Y1VB 1E2VA 4RAUC 2Z6BA 3HOUB 1QJOA 5IODA 4LF5Q 5A2QL 1ESRA 3ZYYX 3E5SA 2E2IH 4UHVA 4N8X1 4LFCL 3HRZC 2LSSA 5IYCH 1CKMA 5COYA 2LXKA 1SEBD 3OWEB 1PFNA 1HA6A 4C3JG 2K1BA 1KAWA 3NHHA 4NXMQ 1OXVA 1VQ9A 4GZYC 2O4XA 3OIQA 2JXMB 3M7NA 4A3BB 2MO1A 2IHFA 2A74C 4E6IA 4DR3L 5FJ8H 4XQJA 2IT1A 3RUZA 1SLJA 3TP7A 4A93H 3A8IE 3K7AB 3S24A 1PH1A 4KN4C 5CMDA 1S5DD 1FD7D 3KDFB 3BYTB 3S17H 1GKHA 4Z9CB 3VR5A 4JI6Q 5C0XJ 2UXDL 3CPFA 4WRDA 3HFZB 2NVQH 1XJVA 4JOIC 2F0KA 3KOJA 4P73A 3D8GA 2RCFA 3X3NA 1EQVA 3PQIA 4CGYB 1XTCD 2AQ2B 4M1UB 3K5NA 1GUOA 1LUZA 1X3PA 1VCIA 3VYUA 5IGCA 1KLGD 4C2MH 2MO0A 4BA1I 2IPKD 3L9AX 1UAPA 3S14B 1FGUA 5EJWA 4QF4A 4BBRB 1VQNA 4BY7B 5GROA 3AB9A 1DJRD 2LY7A 1N32Q 4HSVA 1WCMH 3AQQA 4OIKA 1KAAA 1VS0A 2Q2IA 1HNZQ 1PVOA 1VQAA 4I7AA 1LACA 1QUQA 2LFNA 3NSWA 3LWUA 3RLOA 5HGQA 4IPGA 5LMNW 1EWHA 5D14A 2EQSA 3PIP3 4QIWE 2GA4B 3E6ZX 4YIJA 4MTNA 3M4OB 5J39A 3QWNA 1F9SA 1SNMA 2B2WC 1HFGA 3GP7A 1JWUD 5CC4A 1SFOH 1SNOA 4J8QA 1X3QA 1M4VA 2E2HH 4HJAA 2B2YA 4GNXA 5IGBA 2F03A 4GKKQ 1NTGA 4UPAA 5I4DA 4A3GG 4JBWA 4JG2A 4XQNA 2XSCA 2A6HD 3KF8A 3J7YW 1UE6A 4A3JG 1DOMA 1D5XC 1KRTA 3PIPA 4JI1L 3GTOH 2EOTA 4YHHL 3HZXA 3I4OA 4TRDA 3GTLH 1TKWB 5KIXA 1C0AA 4NKLA 1XNRQ 4GLVB 3GTPH 4OO1G 5IP7H 1EY7A 1VF5C 2WB1E 3CC4A 1D1KA 1VF7A 4WJWA 4QJFA 2NVQB 4G7ZC 1MKHA 2RSNA 3BU2A 4KD4A 1LTRD 5IP9G 3H6MA 4X66Q 1M8AA 3D4DA 3HG9A 3P7JA 2XVSA 2JK8A 1D8LA 1B1ZA 3S9WA 2VQEQ 4K14A 4FXKC 4L5QA 1QOHA 5CV9A 3HP3A 4DR2L 3GTQB 5D3IB 4F7XA 1YHQA 1CKNB 5IOCA 3PIOA 3S17B 4YWMA 3PO3G 4WORA 1YIJA 1OXUA 1I4HA 2A73B 4RCNA 4KHPL 3SEBA 4IFDI 4NP5A 3I55A 4ZQ3A 1AH9A 4A93B 1STGA 3NWTA 3KLRA 4DR6Q 2XGTA 1Q3LA 4RGOS 2O5IC 5BR8Q 3HOZG 3I7FA 2JA7B 1HQRD 4ZUJA 2Z1CA 1PH2A 4QUFA 4MIUA 4DAMA 4TVAB 2CHBD 4DAYA 2NVTH 4JYAL 3PMFA 2NZOA 1PYWD 3K5LA 2N49A 3EVQA 2DY8A 1HTLD 3HOZH 2ATWA 2K28A 4DAPA 3NP8A 1I6VC 2YV5A 1STNA 1TY0A 3S1QH 1AZQA 1EEID 3BS1A 3M3YB 3F2CA 2Y0SG 4XXEA 2EJFC 1V1PA 3SXHA 1WCMB 2Z8LA 1JE5A 1D1IA 1MJEA 3H09A 4MZ9A 4DV2L 2UUCQ 4BBSB 3HOZB 1OXXK 2ZM6L 4WJ3M 2AUJD 3DMUA 2NUCA 3S16H 2HIXA 3SK8A 4JI0Q 3BDLA 3T1HL 1HNWQ 1TS2A 1FL0A 3DM1A 1IKLA 3CU7A 4ZLTF 4HIKA 1H9SA 2ZTEA 4XIGS 1K28A 2KENA 2UXCL 4KY7A 3R8BA 4PNYA 1OXTA 2K03A 3D31A 2F52A 3TEHB 2PZUA 1GM5A 4OONA 2ZJRA 4ALPA 2A8VA 1WTVA 1E22A 5LMUL 2F4VL 3E9HA 3NBHA 2RBMA 1QILA 1BCPB 2WFWA 4AYBB 3GTLB 2L12A 1SE3A 4LF4L 4GKJQ 3VR3A 2MNAA 5KGUA 3EBEA 4BBSG 1RF2D 3I70A 1WD1A 2F4IA 3KLWA 3S15B 1SROA 2VUMG 5KRUA 4A3DB 4KHPQ 1DONA 3UE1A 3H94A 3FMCA 1LLRD 3KBGA 1IKMA 3NBHB 3EJIA 4JI7Q 2MJ8A 3U9SA 1N9WA 1LTLA 5IE8A 4LMQD 1J5EL 3VR4A 1O7ZA 1TIID 2O2LD 4YCWA 4ZRZA 1I3QB 1RKNA 2VUMH 1PTOF 4QQBX 2A69D 4DFAA 1XPOA 3S15H 2B3GA 4POFA 3V05A 4LF9Q 4QIWB 3QB3A 2EZVA 1E7ZA 4LF6Q 2IX0A 1VQGA 3D4WA 3MEHA 1B3AA 4KKSA 4DUYL 2AWNA 4FF4A 1BCPD 2A6ED 1B70B 1CSQA 2J4XA 1S5CD 4EQOA 3AYHB 1ZXTA 4L8JA 2OTJA 2KHJA 5HGTA 2NYZD 4RKLA 4QY7A 4EVOA 3PO2G 2K7VA 4N8FA 1D6EC 3CQZH 1I4XA 4JI4Q 4IALA 1YNJD 1LT6D 2EY5A 1SYFA 5M9OA 1EOVA 1QWYA 4IUTA 2IL8A 4OWTB 1E3PA 4C1NI 5I6YA 1EY8A 5KNDA 1DD2A 3E0JA 4OELB 2IW3A 4K8JA 4KD3A 5M3MG 2JA5G 5E4XA 2UU9L 1VQIA 4PZ7A 2EXDA 4V0BA 3SK6A 1QE6A 4K2LA 3JC66 1PTOB 5IY0A 1BOSA 3PV0A 1I4GA 1YNNC 3RLFA 3STBD 1FYCA 3QG1A 4DR2Q 2WAQG 3VA7A 3MHBA 2KCMA 1HH2P 4NB3A 4X64Q 2KCTA 1E2WA 5C3EG 5GADC 3FRPB 4GN5A 2ASBA 4TSSA 4OIJA 1CQFA 4APVA 5EPKA 4FF3A 3TMEA 1MSHA 3I72A 1YEZA 3NPPA 2B2VA 1CKNA 2F0IA 1K9MC 1KHIA 5C44H 1K8AC 1U5KA 3VYRA 3S2HH 5EGTA 1BBWA 3URYA 5IYBG 2HCCA 1ENAA 3E0EA 2ZJPA 3J81j 1A3UA 3HKSA 3I3CA 1Q8IA 3EQLC 5EQ0A 1N36L 4A3MB 5CBAE 1TT2A 5JEAG 3ULJA 1YVCA 3KYHC 4HCEA 2TSSA 1Y8PB 1HQMC 1EYGA 1I50B 1NNXA 3L7ZC 4QB4A 3CD6A 2UUAQ 1SDFA 4LF7L 1C7YA 2IY5B 4PMBA 3BDCA 3SR1A 3HOUH 3T51B 3MXNA 3G4SA 1EFID 1D5MC 5FJ8G 2NN6G 2Y0SB 2IX1A 1SJED 3RZOB 2HHHQ 1SYBA 1IYJB 3PUZA 2WAQB 3HOYH 3CCUA 1XPUA 1X3FA 1TWAH 1CZGA 3R93A 1B2TA 1QZGA 1L1OB 4QGUA 1QCBD 2E2DC 4LFAQ 1J8IA 1XWEA 5JJIA 1NY4A 3EFXD 3K81C 1U4MA 3FP9A 4K5WA 2TMPA 2EY1A 2Z0SA 1ZEQX 3HOWG 3OW2A 1N34L 1CA6A 3MAQA 1I94Q 1IW7C 1EU4A 4IFDG 1QZHA 4GLXA 4DV5L 1TVXA 2EYFA 3D0FA 1KNEA 2ES2A 4DUZL 2ALYB 1K3RA 2E75C 1FNWA 1V1OA 1EIFA 1D5ZC 4BY7H 4CKCA 1N32L 2B8GA 4L5SA 1EUJA 2EYPA 2FMMA 2PMZB 3NE5B 2A6EC 3CMAA 1B7YB 2R93B 1TR5A 2AUKA 1SSOA 3WWVA 5ELDA 3J81c 2AHOB 4FDBA 3GTMH 1E2ZA 1HPCA 4RCOA 3TQYA 3IRBA 1LT3D 2NVXH 2F3WA 2XNAC 2HUGA 3AFPA 1X55A 1Q8KA 3QOJA 3PIO3 2A69C 5JJZA 4ZK9B 5C3EH 2NZHA 3BVMA 5JAVA 2UXBQ 1K3BC 3IFDA 5IP9H 2E8GA 3M4PA 3H15A 1K8OA 1EOTA 1ZYRC 4NDXA 4RKBA 2F0HA 5M3FG 1TWAB 4UP7A 2Z9HA 2F0MA 1S5ED 3CW2C 3V2TA 4KJOA 4BXXG 2ENBA 1IHZA 2FHTA 4K6DA 3OMCA 4ZUIA 1DXMA 3S14H 5CV7A 1QVCA 1WTQA 3SHLA 2XIWA 4A3KH 3FPPA 5DM73 5KNBA 2L9HA 1EY5A 3J80c 2R7ZB 2NBFA 1TWGH 3A8KE 3D6CA 4A76A 3I4NB 5LMNQ 5IGDA 2CQOA 4A3FH 4A4IA 4BS9A 3BZDB 2QEXA 5DLQE 1SMXA 2ZXRA 1EQQA 1MHWC 2AWOA 1X3EA 4GS3A 1A3TA 2KQ3A 1UE1A 4CJ1B 1R4QB 1W6KA 4BBSH 2JEAI 1BKBA 4NMZA 4G7HC 1EZ6A 4Y7NH 2EYJA 4LUVA 1JWSD 4JI8L 2B63B 3CAMA 5LMNL 3GTKH 1C4QA 3PSIA 3H0GB 1EQRA 2BH8A 4G7OC 1Y1WH 3C3LA 2VY3A 1ASZA 4UY8C 1WTPA 4DR4Q 5LMUQ 2F4VQ 1Q82C 2AKWB 4X3UA 3S16B 2VQFQ 4JI5L 1Y69U 4DN4M 1TXYA 3L3OC 4NPSA 4Q5VA 2D62A 3Q0AA 1XNRL 1O7LA 2C9OA 4R4QA 3FPUB 3I4NG 2CFMA 3K7UC 5FO8B 1Y1WG 1CHQD 3M85A 2BE5D 1BBUA 1LABA 4LWCA 1JWMD 2VUMB 3CF5A 3T53B 2F1MA 4DUYQ 1P8LA 1WFQA 1U0LA 1A15A 1ENFA 2RHQB 2XN9C 2NVXB 4L5TA 1WD0A 1IBKL 5M5XH 1PMRA 1IW7D 2F0SA 1B9MA 1AE3A 1HUNA 2BH2A 3OW7A 3RZDB 2DNEA 5BN3A 1MJCA 5IGEA 1M1KC 1D2BA 4U68A 3N52A 2KJXA 3UE0A 4OGQC 4DV1Q 5L37A 3J80L 3Q22A 2JA6G 2X69A 1KD1C 1EFWA 3OWFA 4A3GH 4GN3B 3W5OA 4IPHA 2CKZB 4JI3Q 4IUVA 3MXGA 1IL8A 4A3JH 2DGYA 5C0XH 4HN7A 1YJ9A 3AU7A 3DWQA 3BVGA 3W2DA 2K75A 5GAHC 4A3IH 2K5DA 3I56A 1O80A 2ZJQA 3TS2A 4X6AH 3DEOA 4EQNA 4X62L 3FEWX 3HOVG 3A7AB 4H7BA 2QILA 1A63A 2NTSA 1S40A 2FMCA 4JI3L 2GVBA 5HY6A 4YWKA 2I5HA 4JK1C 4QL5A 5FLXE 4JC0A 4KTAA 1DOKA 4GN4B 4DV0Q 3J81E 5JJKA 3DM3A 2K14A 4ZAIA 3P1HA 4JW0A 1PFSA 2NN6I 1PH8A 4ZCKA 5GQOA 2KECA 1PDQA 4DNTB 2XWBB 3MWYW 3ND9A 3HOVH 4JI8Q 2PI2A 1X32A 1C9OA 4LF5L 1SE2A 4RGMA 2CVRA 4XQQA 1JOOA 2ZTCA 1H9RA 4LUZA 3MEFA 1SE4A 1QNUA 1UWVA 4X3KA 4ULLA 4PG3A 1PH3A 5CV4A 1L1OC 2JA9A 4S3SA 5CV5A 3I4LA 4A3IG 5M5WB 2EYMA 3NELA 4XYQA 1AE2A 1SFOB 3E3XA 3O13A 4JI2Q 3Q6SA 4ZKCB 1TWHH 1ML0D 3EROA 4BBRH 1CKOA 4A3EG 2WAQE 1RTOA 1K73C 1E0BA 4K2KA 1I94L 3C1FA 1IZ6A 1PV4A 4JI0L 4DR7Q 1C8CA 3NBIA 3M9BA 3RN2A 3HOYG 4OL7A 4DUZQ 2RCNA 1BDOA 2F0QA 2WV6D 3CCVA 3CQZB 4CKEA 4A3CG 4QMGA 1RCVD 4B3MQ 3TN2A 1ET6A 2B2UA 3A7LA 3U4VA 4YY3L 2JEBI 2A68C 4NXML 4LFBQ 5C4JB 2OQKA 1RJTA 3DWPA 1ICFB 4OO1H 3P20A 3KF6B 3PO3B 2Z6KA 3CCJA 3HKZG 3J80i 3Q24A 1X6OA 1Q46A 1F2LA 4F87A 1GXDC 3ULLA 2HHHL 4DPGA 3T56B 3W1GA 5G3LD 5GAEC 5IYCG 3OYYA 1KDAA 4N9PA 4DV3Q 3FDTA 2A19A 1KTKA 3H3VC 2ZT9C 3NTKA 2LMCB 2EDGA 3NK9A 5FLXc 4DA2A 4OX9L 1VQFA 3M3YH 3SK4A 3LNNA 3HOXH 4UP8A 4YY3Q 2PPBC 2ZTDA 2XRQD 1FJGQ 2F0VA 4A3IB 4O42A 1P16A 4UAIA 1LTGD 3OPOA 1V43A 1JR0D 3DEPA 1LTBD 1SMYD 1WCMG 2Q2TA 1EIHA 2N8NA 2HQEA 4R4OA 3BYYB 2R92G 1EYCA 3OTOL 1U4RA 3GTGB 2V4DA 1KIXA 2YU9B 4N9TA 4GKKL 1ILQA 3T4AC 1PRTD 1PFBA 4LW1A 4IFDJ 2WACA 3FHWA 2L4NA 2K32A 3HKZB 2BA0A 2C5CA 4B3RL 2BOSA 3S1MB 5M5WH 1QNKA 1VQEA 5JVH3 1KDCA 1L1OA 2E74C 5J1ZA 3VDYA 4C3IB 5I6WA 2JYOA 2KCNA 1JB3A 4FF1A 2I5MX 4KJNA 1IBKQ 1DCZA 4ZKBB 4LF7Q 3J7AV 2VZAA 1LTAD 2VQEL 1F2ZA 2R61A 2PNHA 2PW5A 1K0RA 1WTWA 1SNCA 2B2TC 2WB1G 3NQTA 5C0XI 1ESFA 1GUNA 4L6TB 1SJHD 4I65A 4RHSA 3VR6A 1UNSA 1B8AA 1H9JA 4B3ML 1CK1A 3Q23A 2JA6B 1FNVA 1PRTF 5D65A 1ASYA 3GDEA 4CBVA 1Q90A 1VDZA 5M3FB 3GTGH 3ICEA 5I9OA 3VYTA 1CM9A 4H13C 3PF5A 3A54A 1SRUA 4JI5Q 4GOPC 3FKIG 1BVSA 1ENCA 1VQBA 2K6AA 1UEAB 5FO9B 2R6GA 2X6GA 4JV5L 1Q81C 4TKOB 4KK7A 4XDXA 3S1RH 2KEEA 2HQLA 1YJNA 1X54A 5DAUA 3J7A5 1PXUA 5CGKA 1YJWA 4O1NA 2UXDQ 1J5EQ 1ZKOA 4DNIA 1BO0A 3J80E 3T1HQ 3DXJC 2CH4W 4LK1C 3CCSA 1JJ2A 2RA4A 3M7GA 1UE7A 4MNOA 1DM0B 3MFYA 1JB7A 3ZJYC 1VQMA 2NVTB 4C2MB 1PYSB 4JOIA 1PH4A 3OSOA 1G2SA 3H0GH 3PCOB 3RNUA 4KLKA 5DNFA 3A74A 3CCMA 4FYDA 3BZCA 4Y52H 1VMPA 3MC0B 4IUQA 1MBYA 2EJGC 1PRTB 2YTVA 2R7ZG 2K4KA 1GUSA 4AH6A 1F9PA 4IOAA 3UDFA 3CCLA 3HOXB 3H3VI 1JQYD 4DXGA 1A0IA 3GO5A 3MXUA 3AFQA 3LGJA 1SBBB 3E9IA 5FLMG 1LYLA 2QDLA 2JA8H 1SXTA 5CR3A 4DV4L 2PO4A 3JAML 3MVVA 3GTJH 4FO2A 2DJFC 4DK3C 3ERQA 2KA7A 1FJGL 4CDDC 1L2FA 3ND8A 1XPRA 1EIYB 5M5YB 1JMCA 3S1NH 3I73A 1JORA 1Y8NB 2LS01 1JICA 4HJ7A 1DOLA 2KVMA 2XTIA 1EWIA 2A68D 1TWHB 2YYZA 4DK6C 3G6JB 1S4ZA 4JI7L 3GTKB 2SNMA 4HTHA 5I2YA 1BQQT 2A5HA 2VB2X 3S2DB 1GUWA 4HMIA 3I90A 5C3EB 4BY7G 1B3QA 4NXNL 2QKIC 1TU2B 2F0PA 1DYQA 2RDHA 3FVQA 4DR1L 3F2BA 1PH6A 1EY6A 1F77A 3PUWA 4DAVA 3MTSA 2MUYA 4A3MG 2I0QA 3PO2B 1GHKA 4JCVE 4DV4Q 2EJMA 2DNCA 2CH4A 1K83H 1SNDA 2WIIB 1LM0A 1LV9A 1TWCH 2DUDA 3TZUA 3JAMc 4DV7L 1EWCA 1VQ8A 4FF2A 3OMGA 4A3JB 4EQPA 4F88A 2SOBA 1KL9A 5FO7B 1VQCA 2UUBL 2F3VA 1HA5A 2JA7H 5LHY1 1VMCA 2QGQA 5A35A 4LF6L 1G291 2WKDA 2CCZA 5ISRA 3LWEA 3GTJB 4IJHA 1JCKB 1BXTA 3U4ZA 3NWSA 5JVG3 4JBJA 5ELCA 1F9QA 3HGBA 5IT9c 4G57A 1GUTA 1HRJA 4A75A 1OXSC 4RHRA 2IWHA 5FK9C 4RWSC 4DV1L 4GNXB 4MHEA 2JA7G 1ILPA 3QR8A 1KLUD 4DAYB 2PZTA 4G4KA 1Q12A 2J0TD 1WTRA 1CUKA 1HZ9A 2XRSD 4MTKA 3S1QB 3WDNA 3CCEA 2PQAA 1IXRA 1KDBA 4PMCA 1I4RA 3CRKC 4QUCA 4BA2I 4FP5D 3PUYA 3VA5A 4CDEC 2R7ZH 5AJ3L 4X65Q 5T1GA 3K0XA 3EN2A 3C46A 5BN4A 3KBXA 2IHEA 2K5VA 3V96A 3QJYA 2F3IA 4HIMA 1PHJA 3HOUG 2B2UC 1A2UA 4DK0A 1A6XA 1IBML 4K0KQ 4DGZA 4LF8L 1EYAA 1WYDA 2RSOA 3TBIB 1G2TA 3FKIH 1CI3M 5E4WC 1OTCA 3S1RB 1PYBA 4RGTA 1I50H 1HNXQ 2MGSA 2H1EA 4P71A 1X65A 4C3HG 2P5ZX 2Q8TA 3RLNA 1CT1D 3MZ5A 5EBDA 5T1IA 3TSSA 3LX0A 4A3EH 1RODA 5G3LF 5I2XA 2VNUD 3TREA 4DU9A 1R4PB 3I2ZA 1K8MA 3GV6A 1I5FA 1TWGB 3D4RA 3KF8B 4YCUA 1BNZA 1EY4A 1XMQQ 1HHVA 1EY0A 4B3SL 4IFDH 3KDFA 3Q8DA 1M90C 5C44B 4B9WA 1VQJA 2KOLA 2Z6KC 2QA4A 3T1YQ 1RTNA 1JJGA 5EKLA 5C4XH 1B53A 3H91A 3QOLA 4A3FB 3BG3A 2F0GA 4AQYL 3TRZA 1IBMQ 3P75A 1O7IA 4JI1Q 4IUPA 5C4JH 5LL6X 1HNXL 5CV8A 1KABA 2F0FA 1STBA 3K0YA 4Y7NB 1PH7A 2DN8A 3GTQH 2B63H 2UXBL 2L0CA 5IWAL 5IT9E 2F0WA 1KNAA 2B2YC 2B2VC 1Y8OB 4RH6A 5CORA 3QO2A 3HEJA 4DV0L 5ELFA 4BXXH 1NAPA 1Q1BA 4J15A 4RG1A 2KBNA 5NUCA 1EY9A 2ICIA 3ONAB 4JPBW 4LFAL 3X3MA 4LF9L 3R2IA 2FXQA 2M9VA 1VQOA 3MA2B 2B63G 1PRTC 1GVPA 2N88A 3K5MA 2QCPX 2SDFA 3VR2A 4C3IH 1V9PA 3U9OA 4DV3L 1CTMA 4JI6L 1B4OA 2EXZA 4IPDA 5IP7G 1CFMA 2RHSB 4KN7C 1SMYC 3ER0A 1KQSA 5M3MH 2NTTA 5ELEA 2VL6A 5JJLA 3MXNB 2JSOA 4RGNA 2JE6I 2L15A 4DR5Q 1HR0Q 4AYBG 2H4OA 3BDOA 1VQ4A 2B29A 4CDCC 3RD4A 1A8VA 1XNQQ 4K8IA 2E2HB 3CMEA 3J7AF 3OOCA 4LF8Q 3NEMA 3UDGA 4K0KL 1QG7A 3GD7A 2RKSA 1PTOC 2D0PA 5LL6S 1MI2A 1A3VA 3K57A 3A56A 2MPMA 1S3OA 2E2JB 2F0LA 3IL8A 1GHJA 3F1ZA 2HDLA 1NMFA 1AW7A 1XMOQ 4V190 1TS4A 5AFWA 4FXDA 3M4OH 1VQHA 1NE3A 5F2DA 3OHXC 3J7ZC 4DR7L 4EQ5A 1H9MA 1UEBA 5FOBB 2KHSA 2IX3A 2OF1A 4KMUC 2K01A 3NXWA 4A3LH 1QVFA 4U673 2JP1A 3NENA 1VQKA 2JA8G 4KHVA 4P72A 1T5XD 4DNRB 4NXNQ 2UUCL 1HJPA 3U50C 1XMQL 3MFGA 1HR0W 3DWAA 1HTPA 5JEAH 1BBXC 3U58A 1N8RC 4B3TL 3K5OA 1CHPD 4FNFA 2OQ0A 4H44C 1E1TA 3T1YL 1N33L 4LFBL 2EY6A 4BY1G 3SGIA 1MGSA 2JA5B 5M3MB 1EYDA 1RL2A 3EIVA 2D9UA 4R8IA 4B3RQ 1PLFA 3WOFA 2I5LX 3HOXG 1XXGA 4P75A 2VS1A 4R8NA 3H3VH 5D3DA 4JI4L 1WTHA 5C4XG 3NQIA 4KY6A 4B3TQ 5JEAJ 1JJCB 1NBWA 2EYLA 2OT2A 2UUBQ 4POGA 5KNCA 2R92H 1GOZA 1FNUA 1Z9FA 3UI2A 1XX8A 2F0JA 4CKBA 1FR3A 3GQBA 5AJ3Q 1J9OA 2G9DA 3EA6A 4MN3A 2K5HA 1MSGA 5GAGC 3HOWH 3CHBD 2VXWA 3PUXA 4DV7Q 1DGSA 2B2TA 3CKIB 2UXCQ 5FKAC 1Q86C 5K36G 2E76C 1PZJD 4KKUA 1PFMA 2GVAA 4WFN3 4A3MH 2O5JC 1QB5D 3J81i 1LT4D 4DK1A 1YHBA 3I4MH 4DR1Q 1HR0L 2I46A 2JQOA 1FGBD 1R9TB 5A2QE 1XTDA 2GN5A 2EE1A 2Z4IA 4X66L 5HURA 1I6HB 2K05A 2N78A 2Z4HA 5H1SE 3HOYB 1LTSD 1F9RA 3NTHA 5EKKA 1S5FD 1W6JA 3A5UA 3GTMB 3GTPB 3TP8A 3I4NH 2F0TA 2JJQA 2R93H 2G9HD 5CBEE 4NW2A 2JA5H 1YNND 5EBCA 5C5MA 4X62Q 2YTYA 3CCQA 4WJ4A 5K5PA 1VQPA 2Q2HA 4K6LA 2Q2UA 1SYGA 1SAPA 2DJGC 1R9TH 2WP8J 4GLAC 1KRSA 1HNWL 4C56C 1STEA 3JAMi 2PCFB 4DR4L 2PMZE 4DR6L 3A0JA 5IYBH 1HZBA 5TSSA 1WTOA 2XWJB 2KUMA 5BR8L 3GV3A 3MXPA 1L0XB 1JOKA 1EZ8A 3K6OA 2CQAA 3F8TA 4ODGA 3TP6A 1IBLL 3CXCA 3R2TA 4F8MA 4RA8A 5C4HA 3HKZE 3CCRA 2OCEA 4A3KG 4A93G 1CZWA 4HIDA 4IUNA 1NJIC 5IYDH 2BE5C 2EYOA 4HIOA 1G91A 1BCPC 3CC7A 1PZKD 4QCLA 1WVLA 2ZXOA 3W3AA 4OX9Q 2PW7A 1JT8A 4DV5Q 2PYKA 2CW0D 3UDXA 2R92B 2EY2A 2E5LL 2R7FA 2VB3X 1B44D 4CJ0B 4P2CB 1X3GA 2EVBA 4A3DH 1II3A 1TS5A 2QEJC 2YTXA 1K83B 2K33A 3DLLA 2HDMA 1TY2A 1TWCB 2N55A 2F0OA 4DKAC 4HEDA 4YCVA 1JE4A 4LUOA 4OWWB 4DR3Q 1B9NA 2F0EA 3K59A 1IBLQ 1Q1EA 3BZKA 3PO2H 1BF4A 5EPJA 2HCIA 2NVYB 4H02A 4A3DG 3S1NB 2OWOA 3UDIA 3SK5A 3A5ZB 1HFNA 1QUQB 2R7DA 4R1JA 1SNPA 1BR9A 4YWLA 4HR7B 1A62A 2HIVA 4L5RC 4HJ5A 4CDFC 4PZ8A 1AEXA 4A3BH 5K36H 4M8AA 1STAA 4DV2Q 1SYDA 3I8ZA 1VQ6A 5JOBA 4A3KB 4OO1I 2WB1B 2EYHA 4C3HB
chains in the Genus database with same CATH topology
5LMNQ 4DV4Q 2E2HH 2CQOA 5C44G 2ZM6Q 4A4IA 4HJAA 1K83H 4GNXA 4A3FH 2QEXA 1NTGA 4UPAA 5DLQE 1SMXA 1LM0A 1EQQA 1HNZL 4GKKQ 4A3GG 2AWOA 4JBWA 4JG2A 1X3EA 1TWCH 2DUDA 4GS3A 4BY1H 3JAMc 4DV7L 1VQ8A 4JI2L 1CSPA 2HT1A 1UE1A 4A3BG 1UE6A 4A3JG 1KRTA 3PIPA 2JEAI 4BBSH 1KL9A 1BKBA 4KI0A 4JI1L 4AQYQ 1VQCA 4Y7NH 3GTOH 4LUVA 2UUBL 4YHHL 3I4OA 4JI8L 2JA7H 3GTLH 1C0AA 3CAMA 1XNRQ 4GLVB 4P74A 3GTPH 2QGQA 5IP7H 5LMNL 4OO1G 2WB1E 2MQHA 4DV6L 3CC4A 4O2DA 3GTKH 4LF6L 1G291 3PSIA 2VW9A 4QJFA 2CCZA 1MKHA 3BU2A 1EQRA 4IPCA 5IP9G 2BH8A 4IJHA 3U4ZA 2VY3A 1VQDA 1Y1WH 2UU9Q 1ASZA 4X66Q 4JBJA 4UY8C 4DR4Q 5IT9c 2JK8A 3KJOA 1D8LA 5LMUQ 1GD7A 5ELOA 1Q82C 2F4VQ 1HZAA 2K50A 2AKWB 2VQEQ 5M3FH 4R4TA 4L5QA 4A75A 4YHHQ 1PH9A 1OXSC 2VQFQ 4DV1L 4GNXB 4DR2L 4JI5L 1VQ5A 2JA7G 1YHQA 1XNRL 1TXYA 1CKNB 4NPSA 2D62A 3PIOA 4DAYB 5EAYA 1XNQL 1Q12A 4R4QA 4YWMA 1CUKA 3PO3G 3I4NG 2CFMA 4OWXB 1HZ9A 3K7UC 1YIJA 3K8AA 1OXUA 1Y1WG 3M85A 1BBUA 2PQAA 3CCEA 1IXRA 1S72A 4LWCA 4BA2I 3CF5A 5J3BA 3PUYA 2R7ZH 4KHPL 4DUYQ 1P8LA 1WFQA 5AJ3L 4X65Q 1X9NA 4IFDI 1U0LA 3K0XA 3EN2A 3I55A 1AH9A 3KF6A 2RHQB 3OTOQ 4L5TA 1IBKL 2IHEA 4PZ6A 2K5VA 5M5XH 2XGTA 4DR6Q 1PH5A 5BR8Q 2F3IA 2E5LQ 3HOZG 1AE3A 3I7FA 4HIMA 1PHJA 3HOUG 2BH2A 2K52A 1PH2A 4DAMA 4TVAB 4BBRG 1N36Q 1MJCA 1M1KC 1IBML 4K0KQ 2NVTH 4LF8L 4LFCQ 4JYAL 1WYDA 3UE0A 4DV1Q 2NZOA 4OXPA 3FKIH 2I0QA 1OTCA 2N49A 1PYBA 2JA6G 5E7NA 1KD1C 1XMOL 1I50H 1EFWA 3HOZH 2ATWA 1HNXQ 2R93G 1YI2A 4A3GH 4GN3B 3W5OA 4IPHA 3KJPA 4P71A 1X65A 1IL2A 2CKZB 2YV5A 4JI3Q 1PA6A 3S1QH 4A3JH 4JBKA 3RLNA 2DGYA 3F2CA 2Y0SG 3PGZA 1TWFH 4O0AA 4GOPA 4A3EH 2Y0SE 1YJ9A 4R4CA 2VNUD 3TREA 1JE5A 2K75A 5GAHC 4A3IH 1MJEA 3RZOH 3I2ZA 3I56A 2ZJQA 3TS2A 4MZ9A 1I5FA 4YCUA 4DV2L 3KF8B 4X6AH 3M4QA 2UUCQ 4X62L 1XMQQ 3HOVG 2PI2E 4B3SL 1A63A 1S40A 4JI3L 4A3CH 2GVBA 3KDFA 3Q8DA 5HY6A 4YWKA 2I5HA 1M90C 2UUAL 1VQJA 3L0OA 1OXXK 1WOCA 2ZM6L 2Z6KC 3CPWA 2QA4A 3T1YQ 4QL5A 1JJGA 4WJ3M 4JC0A 5IWAQ 5C4XH 3S16H 2HIXA 4JI0Q 3T1HL 4GN4B 1SR3A 4AYBE 4DV0Q 3RZDH 1HNWQ 5JJKA 3DM3A 2K14A 1FL0A 1YBYA 4AQYL 3TRZA 1PFSA 2NN6I 1PH8A 1IBMQ 5GQOA 4JI1Q 1O7IA 4GOPB 3PUVA 5C4JH 4HIKA 4IO9A 1HNXL 2ZTEA 4XIGS 2PI2A 4JI8Q 1G51A 4B3SQ 3HOVH 1C9OA 2KENA 4LF5L 2UXCL 1PH7A 4LF4Q 1OXTA 3D31A 4X64L 2F52A 3RN5A 3TEHB 2ZTCA 4EX5A 3AEVA 3GTQH 4LUZA 2B63H 2UXBL 3MEFA 1GM5A 5IWAL 1UWVA 4OONA 2ZJRA 2YU9H 3BJUA 3RR5A 4DV0L 4PG3A 4ALPA 1PH3A 2A8VA 2RF4A 4BXXH 1L1OC 1E22A 2JA9A 5LMUL 1Q1BA 2ID0A 4J15A 4RG1A 2E2JH 2KBNA 3E9HA 2F4VL 1QVGA 4A3IG 3NELA 4LFAL 2WFWA 4LF9L 1AE2A 4JI2Q 2FXQA 1VQOA 1UE5A 1TWHH 2EIFA 4LF4L 4GKJQ 5C0XG 3F2DA 4BBRH 2MNAA 3STBC 1CKOA 2B63G 3EBEA 4A3EG 1GVPA 2WAQE 1K73C 4BBSG 4JBMA 1YHAA 1I94L 4LNQA 3KLWA 1V9PA 1IZ6A 4C3IH 4DV3L 1PV4A 1VQLA 4JI0L 1SROA 1KC8C 1RIPA 4JI6L 4DR7Q 2VUMG 3M9BA 3RN2A 3HOYG 4IPDA 5IP7G 3ULPA 4DUZQ 2RHSB 3PO3H 4KHPQ 2RCNA 1KXLA 3ER0A 4IJLA 4X65L 3CCVA 3UE1A 1KQSA 1T9HA 1YNXA 4A3CG 5M3MH 2VL6A 1W3SA 5JJLA 4B3MQ 3NBHB 4C3HH 3MXNB 4DR5Q 2JE6I 2L15A 4JI7Q 1N9WA 1LTLA 3U4VA 5IE8A 4YY3L 2H5XA 2JEBI 1J5EL 1HR0Q 4NXML 4AYBG 3S2DH 2OQKA 4YCWA 2VQFL 4LFBQ 1VQ4A 2B29A 3KF6B 2VUMH 1A8VA 1XNQQ 4QQBX 2Z6KA 3CCJA 3CMEA 1XPOA 3HKZG 3J80i 3NEMA 4LF8Q 3UDGA 4KHZA 3S15H 4K0KL 3GD7A 1E1OA 1X6OA 1Q46A 2B3GA 2D0PA 4UP9A 4POFA 5FLMH 4LF9Q 3ULLA 2HHHL 1S3OA 4DPGA 1E7ZA 3F1ZA 4LF6Q 2IX0A 1VQGA 1NMGA 4GKJL 1NMFA 3L2PA 1XMOQ 1I6HH 3W1GA 2NVYH 5GAEC 5IYCG 4DUYL 3M4OH 1VQHA 2AWNA 1NE3A 3OYYA 3KFUA 5IYDG 3J7ZC 1VQ7A 3B6YA 4DV3Q 1B70B 4EQ5A 3S1MH 4DR7L 2A19A 1UEBA 1X56A 1CSQA 1Z47A 1I3QH 3ERSX 4A3LH 3CP0A 2KHIA 3AYHB 1QVFA 5FLXc 1Y1VH 3NENA 1VQKA 4OX9L 2JA8G 2OTJA 1VQFA 3M3YH 2KHJA 4P72A 3HOXH 1Q7YC 4QY7A 4PMWA 4NXNQ 2UUCL 3PO2G 1HJPA 4UP8A 3U50C 1K8GA 4TQUS 3CQZH 4YY3Q 1XMQL 1HR0W 4JI4Q 1SN8A 3TS0A 3U58A 2ZTDA 1N8RC 1FJGQ 4B3TL 1EOVA 2C35B 2MFIA 1P16A 4OWTB 2OQ0A 1E3PA 2CWAA 1E1TA 1V1QA 4C3JH 3T1YL 1N33L 1V43A 2Q2TA 3I4MG 4BY1G 4RMFA 1WCMG 4LFBL 2OTLA 3SGIA 4A3LG 2N8NA 5M3MG 2JA5G 1RL2A 3EIVA 4R4OA 2R92G 4B3RQ 2UU9L 3OTOL 2I5LX 5ELNA 3HOXG 1D7QA 1VQIA 2D0OA 4P75A 2EXDA 4PZ7A 1J6QA 1KIXA 1FVIA 1WI5A 4GKKL 2VS1A 1E24A 1WJJA 2CWPA 3JC66 1YZ6A 5IY0A 4JI4L 3PV0A 3H3VH 5C4XG 3RLFA 3STBD 4GNXC 4DR2Q 2WAQG 4B3TQ 5JEAJ 2JA6H 1JJCB 2KCMA 1NBWA 4LW1A 4IFDJ 1HH2P 4NB3A 4X64Q 3FHWA 2KCTA 3G48A 4A3FG 5C3EG 2UUBQ 5GADC 4POGA 2A1AA 4GN5A 2ASBA 2R92H 2BA0A 4B3RL 4XTCS 1Z9FA 1Y1VG 5M5WH 4APVA 1H95A 1VQEA 2K5NA 1L1OA 3VDYA 4JV5Q 1YEZA 1CKNA 3W1BA 5AJ3Q 2I5MX 1K9MC 3PF4A 1IBKQ 1KHIA 5C44H 1K8AC 1U5KA 3S2HH 1BBWA 4LF7Q 2K5HA 2VZAA 4R4IA 5GAGC 4IOCA 5IYBG 3HOWH 2VQEL 3E0EA 1N33Q 2ZJPA 3PUXA 3J81j 4DV7Q 1DGSA 3HKSA 2UXCQ 2PNHA 3H0GG 2BA1A 1K0RA 2PQAB 1Q86C 5K36G 1SE8A 1N36L 2WB1G 1G6PA 5C0XI 5JEAG 3ULJA 4JYAQ 3K7AH 1YVCA 1L0WA 2N3SA 3KYHC 3CC2A 1MIUA 2GVAA 1EYGA 4A3MH 1B8AA 3L7ZC 3CD6A 3J81i 2UUAQ 4B3ML 1Y14B 1YHBA 1ASYA 4LF7L 3I4MH 3GDEA 4DR1Q 1C7YA 2IY5B 1GO3E 4ME3A 1HR0L 2JQOA 3HOUH 3G71A 3G6EA 1XTDA 4AIMA 2GN5A 3GTGH 3ICEA 4X66L 1YITA 3G4SA 5FJ8G 4HJ9A 2NN6G 2N78A 3PF5A 2IX1A 1SRUA 5H1SE 4JI5Q 4GOPC 2HHHQ 3FKIG 1BVSA 3A5UA 1VQBA 1IYJB 3K80C 3PUZA 3I4NH 2JJQA 3CCUA 1XPUA 2R6GA 3HOYH 1X3FA 4JV5L 1TWAH 2R93H 1Q81C 2JA5H 4X62Q 4WJ4A 3CCQA 2YTYA 3S1RH 1VQPA 1QZGA 2HQLA 1HZCA 1YJNA 1L1OB 1X54A 2Q2HA 2LXJA 4DR5L 3J7A5 4QGUA 1YJWA 2Q2UA 4DV6Q 1R9TH 2UXDQ 2WP8J 4LFAQ 1J5EQ 4DNIA 4GLAC 1KRSA 3T1HQ 5JJIA 1NY4A 1HNWL 1W2BA 3K81C 2V1CC 3FP9A 3JAMi 2AMCB 5M5YH 2PMZE 3CCSA 1JJ2A 4DR4L 4DR6L 3A0JA 2Z0SA 1HZBA 5IYBH 3HOWG 4HJ8A 1UE7A 4MNOA 3OW2A 1JB7A 3ZJYC 5BR8L 1N34L 1VQMA 1I94Q 1PYSB 4JOIA 1PH4A 1N34Q 3F8TA 3H0GH 3PCOB 3RNUA 4LF5Q 4KLKA 1IBLL 4IFDG 3A74A 1QZHA 4GLXA 3CXCA 3CCMA 4DV5L 3HKZE 3D0FA 2ES2A 3BZCA 2E2IH 4Y52H 3CCRA 2ALYB 2OCEA 4DUZL 4A3KG 2YTVA 4A93G 1K3RA 2R7ZG 4LFCL 2K4KA 2LSSA 4AH6A 1CKMA 5IYCH 4IOAA 2LXKA 3UDFA 1EIFA 4HIDA 3CCLA 4BY7H 1NJIC 3H3VI 1N32L 5IYDH 4L5SA 1A0IA 1EUJA 3GO5A 4HIOA 3AFQA 3LGJA 1KAWA 3E9IA 3CMAA 3CC7A 1B7YB 4NXMQ 1OXVA 1VQ9A 5FLMG 1LYLA 3WWVA 3M7NA 4OX9Q 3J81c 2AHOB 2MO1A 2IHFA 4FDBA 4DR3L 3GTMH 1JT8A 3TQYA 4DV5Q 2JA8H 4DV4L 3IRBA 5FJ8H 2IT1A 3UDXA 1SLJA 2NVXH 4A93H 3GTJH 2E5LL 2R7FA 4DK3C 1X3GA 3S24A 1PH1A 1FJGL 4A3DH 3AFPA 1L2FA 3KDFB 1X55A 3S17H 1GKHA 2YTXA 1Q8KA 1XPRA 4JI6Q 3DLLA 5C0XJ 1EIYB 1JMCA 2UXDL 3CPFA 5C3EH 3S1NH 2NZHA 2UXBQ 3HFZB 4DKAC 2NVQH 4YCVA 4HJ7A 1XJVA 4JOIC 3KOJA 4LUOA 2XTIA 2E8GA 1EWIA 3M4PA 4P73A 5IP9H 3H15A 4DR3Q 4OWWB 2YYZA 4DK6C 1IBLQ 1Q1EA 3BZKA 3PO2H 4JI7L 1LUZA 1VCIA 4C2MH 2MO0A 4H02A 4BA1I 5M3FG 4A3DG 4UP7A 1FGUA 3CW2C 1VQNA 2OWOA 4BY7G 5GROA 3UDIA 4BXXG 1N32Q 3A5ZB 1QUQB 1WCMH 2R7DA 4R1JA 4NXNL 3AQQA 1VS0A 4YWLA 2Q2IA 1HNZQ 3S14H 1PVOA 1VQAA 1A62A 2HIVA 4L5RC 1QUQA 3RLOA 1QVCA 5HGQA 4IPGA 5LMNW 2EQSA 4HJ5A 4A3BH 4PZ8A 4QIWE 4DR1L 4A3KH 4MTNA 3F2BA 1PH6A 3PUWA 3J80c 4DV2Q 1VQ6A 1SFOH 1TWGH 4A3MG 4OO1I 4A76A 4JCVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN Q;  4DV4 Q;  2E2H H;  2CQO A;  5C44 G;  2ZM6 Q;  4A4I A;  4HJA A;  1K83 H;  4GNX A;  4A3F H;  2QEX A;  1NTG A;  4UPA A;  5DLQ E;  1SMX A;  1LM0 A;  1EQQ A;  1HNZ L;  4GKK Q;  4A3G G;  2AWO A;  4JBW A;  4JG2 A;  1X3E A;  1TWC H;  2DUD A;  4GS3 A;  4BY1 H;  3JAM c;  4DV7 L;  1VQ8 A;  4JI2 L;  1CSP A;  2HT1 A;  1UE1 A;  4A3B G;  1UE6 A;  4A3J G;  1KRT A;  3PIP A;  2JEA I;  4BBS H;  1KL9 A;  1BKB A;  4KI0 A;  4JI1 L;  4AQY Q;  1VQC A;  4Y7N H;  3GTO H;  4LUV A;  2UUB L;  4YHH L;  3I4O A;  4JI8 L;  2JA7 H;  3GTL H;  1C0A A;  3CAM A;  1XNR Q;  4GLV B;  4P74 A;  3GTP H;  2QGQ A;  5IP7 H;  5LMN L;  4OO1 G;  2WB1 E;  2MQH A;  4DV6 L;  3CC4 A;  4O2D A;  3GTK H;  4LF6 L;  1G29 1;  3PSI A;  2VW9 A;  4QJF A;  2CCZ A;  1MKH A;  3BU2 A;  1EQR A;  4IPC A;  5IP9 G;  2BH8 A;  4IJH A;  3U4Z A;  2VY3 A;  1VQD A;  1Y1W H;  2UU9 Q;  1ASZ A;  4X66 Q;  4JBJ A;  4UY8 C;  4DR4 Q;  5IT9 c;  2JK8 A;  3KJO A;  1D8L A;  5LMU Q;  1GD7 A;  5ELO A;  1Q82 C;  2F4V Q;  1HZA A;  2K50 A;  2AKW B;  2VQE Q;  5M3F H;  4R4T A;  4L5Q A;  4A75 A;  4YHH Q;  1PH9 A;  1OXS C;  2VQF Q;  4DV1 L;  4GNX B;  4DR2 L;  4JI5 L;  1VQ5 A;  2JA7 G;  1YHQ A;  1XNR L;  1TXY A;  1CKN B;  4NPS A;  2D62 A;  3PIO A;  4DAY B;  5EAY A;  1XNQ L;  1Q12 A;  4R4Q A;  4YWM A;  1CUK A;  3PO3 G;  3I4N G;  2CFM A;  4OWX B;  1HZ9 A;  3K7U C;  1YIJ A;  3K8A A;  1OXU A;  1Y1W G;  3M85 A;  1BBU A;  2PQA A;  3CCE A;  1IXR A;  1S72 A;  4LWC A;  4BA2 I;  3CF5 A;  5J3B A;  3PUY A;  2R7Z H;  4KHP L;  4DUY Q;  1P8L A;  1WFQ A;  5AJ3 L;  4X65 Q;  1X9N A;  4IFD I;  1U0L A;  3K0X A;  3EN2 A;  3I55 A;  1AH9 A;  3KF6 A;  2RHQ B;  3OTO Q;  4L5T A;  1IBK L;  2IHE A;  4PZ6 A;  2K5V A;  5M5X H;  2XGT A;  4DR6 Q;  1PH5 A;  5BR8 Q;  2F3I A;  2E5L Q;  3HOZ G;  1AE3 A;  3I7F A;  4HIM A;  1PHJ A;  3HOU G;  2BH2 A;  2K52 A;  1PH2 A;  4DAM A;  4TVA B;  4BBR G;  1N36 Q;  1MJC A;  1M1K C;  1IBM L;  4K0K Q;  2NVT H;  4LF8 L;  4LFC Q;  4JYA L;  1WYD A;  3UE0 A;  4DV1 Q;  2NZO A;  4OXP A;  3FKI H;  2I0Q A;  1OTC A;  2N49 A;  1PYB A;  2JA6 G;  5E7N A;  1KD1 C;  1XMO L;  1I50 H;  1EFW A;  3HOZ H;  2ATW A;  1HNX Q;  2R93 G;  1YI2 A;  4A3G H;  4GN3 B;  3W5O A;  4IPH A;  3KJP A;  4P71 A;  1X65 A;  1IL2 A;  2CKZ B;  2YV5 A;  4JI3 Q;  1PA6 A;  3S1Q H;  4A3J H;  4JBK A;  3RLN A;  2DGY A;  3F2C A;  2Y0S G;  3PGZ A;  1TWF H;  4O0A A;  4GOP A;  4A3E H;  2Y0S E;  1YJ9 A;  4R4C A;  2VNU D;  3TRE A;  1JE5 A;  2K75 A;  5GAH C;  4A3I H;  1MJE A;  3RZO H;  3I2Z A;  3I56 A;  2ZJQ A;  3TS2 A;  4MZ9 A;  1I5F A;  4YCU A;  4DV2 L;  3KF8 B;  4X6A H;  3M4Q A;  2UUC Q;  4X62 L;  1XMQ Q;  3HOV G;  2PI2 E;  4B3S L;  1A63 A;  1S40 A;  4JI3 L;  4A3C H;  2GVB A;  3KDF A;  3Q8D A;  5HY6 A;  4YWK A;  2I5H A;  1M90 C;  2UUA L;  1VQJ A;  3L0O A;  1OXX K;  1WOC A;  2ZM6 L;  2Z6K C;  3CPW A;  2QA4 A;  3T1Y Q;  4QL5 A;  1JJG A;  4WJ3 M;  4JC0 A;  5IWA Q;  5C4X H;  3S16 H;  2HIX A;  4JI0 Q;  3T1H L;  4GN4 B;  1SR3 A;  4AYB E;  4DV0 Q;  3RZD H;  1HNW Q;  5JJK A;  3DM3 A;  2K14 A;  1FL0 A;  1YBY A;  4AQY L;  3TRZ A;  1PFS A;  2NN6 I;  1PH8 A;  1IBM Q;  5GQO A;  4JI1 Q;  1O7I A;  4GOP B;  3PUV A;  5C4J H;  4HIK A;  4IO9 A;  1HNX L;  2ZTE A;  4XIG S;  2PI2 A;  4JI8 Q;  1G51 A;  4B3S Q;  3HOV H;  1C9O A;  2KEN A;  4LF5 L;  2UXC L;  1PH7 A;  4LF4 Q;  1OXT A;  3D31 A;  4X64 L;  2F52 A;  3RN5 A;  3TEH B;  2ZTC A;  4EX5 A;  3AEV A;  3GTQ H;  4LUZ A;  2B63 H;  2UXB L;  3MEF A;  1GM5 A;  5IWA L;  1UWV A;  4OON A;  2ZJR A;  2YU9 H;  3BJU A;  3RR5 A;  4DV0 L;  4PG3 A;  4ALP A;  1PH3 A;  2A8V A;  2RF4 A;  4BXX H;  1L1O C;  1E22 A;  2JA9 A;  5LMU L;  1Q1B A;  2ID0 A;  4J15 A;  4RG1 A;  2E2J H;  2KBN A;  3E9H A;  2F4V L;  1QVG A;  4A3I G;  3NEL A;  4LFA L;  2WFW A;  4LF9 L;  1AE2 A;  4JI2 Q;  2FXQ A;  1VQO A;  1UE5 A;  1TWH H;  2EIF A;  4LF4 L;  4GKJ Q;  5C0X G;  3F2D A;  4BBR H;  2MNA A;  3STB C;  1CKO A;  2B63 G;  3EBE A;  4A3E G;  1GVP A;  2WAQ E;  1K73 C;  4BBS G;  4JBM A;  1YHA A;  1I94 L;  4LNQ A;  3KLW A;  1V9P A;  1IZ6 A;  4C3I H;  4DV3 L;  1PV4 A;  1VQL A;  4JI0 L;  1SRO A;  1KC8 C;  1RIP A;  4JI6 L;  4DR7 Q;  2VUM G;  3M9B A;  3RN2 A;  3HOY G;  4IPD A;  5IP7 G;  3ULP A;  4DUZ Q;  2RHS B;  3PO3 H;  4KHP Q;  2RCN A;  1KXL A;  3ER0 A;  4IJL A;  4X65 L;  3CCV A;  3UE1 A;  1KQS A;  1T9H A;  1YNX A;  4A3C G;  5M3M H;  2VL6 A;  1W3S A;  5JJL A;  4B3M Q;  3NBH B;  4C3H H;  3MXN B;  4DR5 Q;  2JE6 I;  2L15 A;  4JI7 Q;  1N9W A;  1LTL A;  3U4V A;  5IE8 A;  4YY3 L;  2H5X A;  2JEB I;  1J5E L;  1HR0 Q;  4NXM L;  4AYB G;  3S2D H;  2OQK A;  4YCW A;  2VQF L;  4LFB Q;  1VQ4 A;  2B29 A;  3KF6 B;  2VUM H;  1A8V A;  1XNQ Q;  4QQB X;  2Z6K A;  3CCJ A;  3CME A;  1XPO A;  3HKZ G;  3J80 i;  3NEM A;  4LF8 Q;  3UDG A;  4KHZ A;  3S15 H;  4K0K L;  3GD7 A;  1E1O A;  1X6O A;  1Q46 A;  2B3G A;  2D0P A;  4UP9 A;  4POF A;  5FLM H;  4LF9 Q;  3ULL A;  2HHH L;  1S3O A;  4DPG A;  1E7Z A;  3F1Z A;  4LF6 Q;  2IX0 A;  1VQG A;  1NMG A;  4GKJ L;  1NMF A;  3L2P A;  1XMO Q;  1I6H H;  3W1G A;  2NVY H;  5GAE C;  5IYC G;  4DUY L;  3M4O H;  1VQH A;  2AWN A;  1NE3 A;  3OYY A;  3KFU A;  5IYD G;  3J7Z C;  1VQ7 A;  3B6Y A;  4DV3 Q;  1B70 B;  4EQ5 A;  3S1M H;  4DR7 L;  2A19 A;  1UEB A;  1X56 A;  1CSQ A;  1Z47 A;  1I3Q H;  3ERS X;  4A3L H;  3CP0 A;  2KHI A;  3AYH B;  1QVF A;  5FLX c;  1Y1V H;  3NEN A;  1VQK A;  4OX9 L;  2JA8 G;  2OTJ A;  1VQF A;  3M3Y H;  2KHJ A;  4P72 A;  3HOX H;  1Q7Y C;  4QY7 A;  4PMW A;  4NXN Q;  2UUC L;  3PO2 G;  1HJP A;  4UP8 A;  3U50 C;  1K8G A;  4TQU S;  3CQZ H;  4YY3 Q;  1XMQ L;  1HR0 W;  4JI4 Q;  1SN8 A;  3TS0 A;  3U58 A;  2ZTD A;  1N8R C;  1FJG Q;  4B3T L;  1EOV A;  2C35 B;  2MFI A;  1P16 A;  4OWT B;  2OQ0 A;  1E3P A;  2CWA A;  1E1T A;  1V1Q A;  4C3J H;  3T1Y L;  1N33 L;  1V43 A;  2Q2T A;  3I4M G;  4BY1 G;  4RMF A;  1WCM G;  4LFB L;  2OTL A;  3SGI A;  4A3L G;  2N8N A;  5M3M G;  2JA5 G;  1RL2 A;  3EIV A;  4R4O A;  2R92 G;  4B3R Q;  2UU9 L;  3OTO L;  2I5L X;  5ELN A;  3HOX G;  1D7Q A;  1VQI A;  2D0O A;  4P75 A;  2EXD A;  4PZ7 A;  1J6Q A;  1KIX A;  1FVI A;  1WI5 A;  4GKK L;  2VS1 A;  1E24 A;  1WJJ A;  2CWP A;  3JC6 6;  1YZ6 A;  5IY0 A;  4JI4 L;  3PV0 A;  3H3V H;  5C4X G;  3RLF A;  3STB D;  4GNX C;  4DR2 Q;  2WAQ G;  4B3T Q;  5JEA J;  2JA6 H;  1JJC B;  2KCM A;  1NBW A;  4LW1 A;  4IFD J;  1HH2 P;  4NB3 A;  4X64 Q;  3FHW A;  2KCT A;  3G48 A;  4A3F G;  5C3E G;  2UUB Q;  5GAD C;  4POG A;  2A1A A;  4GN5 A;  2ASB A;  2R92 H;  2BA0 A;  4B3R L;  4XTC S;  1Z9F A;  1Y1V G;  5M5W H;  4APV A;  1H95 A;  1VQE A;  2K5N A;  1L1O A;  3VDY A;  4JV5 Q;  1YEZ A;  1CKN A;  3W1B A;  5AJ3 Q;  2I5M X;  1K9M C;  3PF4 A;  1IBK Q;  1KHI A;  5C44 H;  1K8A C;  1U5K A;  3S2H H;  1BBW A;  4LF7 Q;  2K5H A;  2VZA A;  4R4I A;  5GAG C;  4IOC A;  5IYB G;  3HOW H;  2VQE L;  3E0E A;  1N33 Q;  2ZJP A;  3PUX A;  3J81 j;  4DV7 Q;  1DGS A;  3HKS A;  2UXC Q;  2PNH A;  3H0G G;  2BA1 A;  1K0R A;  2PQA B;  1Q86 C;  5K36 G;  1SE8 A;  1N36 L;  2WB1 G;  1G6P A;  5C0X I;  5JEA G;  3ULJ A;  4JYA Q;  3K7A H;  1YVC A;  1L0W A;  2N3S A;  3KYH C;  3CC2 A;  1MIU A;  2GVA A;  1EYG A;  4A3M H;  1B8A A;  3L7Z C;  3CD6 A;  3J81 i;  2UUA Q;  4B3M L;  1Y14 B;  1YHB A;  1ASY A;  4LF7 L;  3I4M H;  3GDE A;  4DR1 Q;  1C7Y A;  2IY5 B;  1GO3 E;  4ME3 A;  1HR0 L;  2JQO A;  3HOU H;  3G71 A;  3G6E A;  1XTD A;  4AIM A;  2GN5 A;  3GTG H;  3ICE A;  4X66 L;  1YIT A;  3G4S A;  5FJ8 G;  4HJ9 A;  2NN6 G;  2N78 A;  3PF5 A;  2IX1 A;  1SRU A;  5H1S E;  4JI5 Q;  4GOP C;  2HHH Q;  3FKI G;  1BVS A;  3A5U A;  1VQB A;  1IYJ B;  3K80 C;  3PUZ A;  3I4N H;  2JJQ A;  3CCU A;  1XPU A;  2R6G A;  3HOY H;  1X3F A;  4JV5 L;  1TWA H;  2R93 H;  1Q81 C;  2JA5 H;  4X62 Q;  4WJ4 A;  3CCQ A;  2YTY A;  3S1R H;  1VQP A;  1QZG A;  2HQL A;  1HZC A;  1YJN A;  1L1O B;  1X54 A;  2Q2H A;  2LXJ A;  4DR5 L;  3J7A 5;  4QGU A;  1YJW A;  2Q2U A;  4DV6 Q;  1R9T H;  2UXD Q;  2WP8 J;  4LFA Q;  1J5E Q;  4DNI A;  4GLA C;  1KRS A;  3T1H Q;  5JJI A;  1NY4 A;  1HNW L;  1W2B A;  3K81 C;  2V1C C;  3FP9 A;  3JAM i;  2AMC B;  5M5Y H;  2PMZ E;  3CCS A;  1JJ2 A;  4DR4 L;  4DR6 L;  3A0J A;  2Z0S A;  1HZB A;  5IYB H;  3HOW G;  4HJ8 A;  1UE7 A;  4MNO A;  3OW2 A;  1JB7 A;  3ZJY C;  5BR8 L;  1N34 L;  1VQM A;  1I94 Q;  1PYS B;  4JOI A;  1PH4 A;  1N34 Q;  3F8T A;  3H0G H;  3PCO B;  3RNU A;  4LF5 Q;  4KLK A;  1IBL L;  4IFD G;  3A74 A;  1QZH A;  4GLX A;  3CXC A;  3CCM A;  4DV5 L;  3HKZ E;  3D0F A;  2ES2 A;  3BZC A;  2E2I H;  4Y52 H;  3CCR A;  2ALY B;  2OCE A;  4DUZ L;  4A3K G;  2YTV A;  4A93 G;  1K3R A;  2R7Z G;  4LFC L;  2K4K A;  2LSS A;  4AH6 A;  1CKM A;  5IYC H;  4IOA A;  2LXK A;  3UDF A;  1EIF A;  4HID A;  3CCL A;  4BY7 H;  1NJI C;  3H3V I;  1N32 L;  5IYD H;  4L5S A;  1A0I A;  1EUJ A;  3GO5 A;  4HIO A;  3AFQ A;  3LGJ A;  1KAW A;  3E9I A;  3CMA A;  3CC7 A;  1B7Y B;  4NXM Q;  1OXV A;  1VQ9 A;  5FLM G;  1LYL A;  3WWV A;  3M7N A;  4OX9 Q;  3J81 c;  2AHO B;  2MO1 A;  2IHF A;  4FDB A;  4DR3 L;  3GTM H;  1JT8 A;  3TQY A;  4DV5 Q;  2JA8 H;  4DV4 L;  3IRB A;  5FJ8 H;  2IT1 A;  3UDX A;  1SLJ A;  2NVX H;  4A93 H;  3GTJ H;  2E5L L;  2R7F A;  4DK3 C;  1X3G A;  3S24 A;  1PH1 A;  1FJG L;  4A3D H;  3AFP A;  1L2F A;  3KDF B;  1X55 A;  3S17 H;  1GKH A;  2YTX A;  1Q8K A;  1XPR A;  4JI6 Q;  3DLL A;  5C0X J;  1EIY B;  1JMC A;  2UXD L;  3CPF A;  5C3E H;  3S1N H;  2NZH A;  2UXB Q;  3HFZ B;  4DKA C;  2NVQ H;  4YCV A;  4HJ7 A;  1XJV A;  4JOI C;  3KOJ A;  4LUO A;  2XTI A;  2E8G A;  1EWI A;  3M4P A;  4P73 A;  5IP9 H;  3H15 A;  4DR3 Q;  4OWW B;  2YYZ A;  4DK6 C;  1IBL Q;  1Q1E A;  3BZK A;  3PO2 H;  4JI7 L;  1LUZ A;  1VCI A;  4C2M H;  2MO0 A;  4H02 A;  4BA1 I;  5M3F G;  4A3D G;  4UP7 A;  1FGU A;  3CW2 C;  1VQN A;  2OWO A;  4BY7 G;  5GRO A;  3UDI A;  4BXX G;  1N32 Q;  3A5Z B;  1QUQ B;  1WCM H;  2R7D A;  4R1J A;  4NXN L;  3AQQ A;  1VS0 A;  4YWL A;  2Q2I A;  1HNZ Q;  3S14 H;  1PVO A;  1VQA A;  1A62 A;  2HIV A;  4L5R C;  1QUQ A;  3RLO A;  1QVC A;  5HGQ A;  4IPG A;  5LMN W;  2EQS A;  4HJ5 A;  4A3B H;  4PZ8 A;  4QIW E;  4DR1 L;  4A3K H;  4MTN A;  3F2B A;  1PH6 A;  3PUW A;  3J80 c;  4DV2 Q;  1VQ6 A;  1SFO H;  1TWG H;  4A3M G;  4OO1 I;  4A76 A;  4JCV E; 
#chains in the Genus database with same CATH topology
 1Z6H A;  5C44 G;  2ZM6 Q;  5IIF A;  1GJX A;  1HNZ L;  2L11 A;  4BY1 H;  5C3W A;  5C5L A;  4JI2 L;  1CSP A;  3K58 A;  2HT1 A;  4A3B G;  3IAY A;  1LTI D;  2OXP A;  4KI0 A;  4AQY Q;  1U4L A;  4CHT B;  4IUU A;  1U9R A;  4FXG C;  4P74 A;  1ZYR D;  2MQH A;  4DV6 L;  4O2D A;  2QW7 A;  2VW9 A;  2AQ1 B;  4IPC A;  2M2L A;  2KED A;  1AN8 A;  2MP1 A;  4KV6 A;  3T16 A;  2UU9 Q;  1VQD A;  4IQZ A;  2J7Z A;  4DXF A;  1LO5 D;  5J22 A;  1G8Z D;  1TS3 A;  2K5Q A;  3HS0 C;  3KJO A;  1GD7 A;  5ELO A;  1HZA A;  2K50 A;  1PH9 A;  5M3F H;  1N34 Q;  4R4T A;  2L1B A;  4YHH Q;  5C4X B;  1VQ5 A;  2CW0 C;  2D2C C;  3C2P A;  1HXY D;  4C3I G;  4X3S A;  5EAY A;  4B08 A;  1XNQ L;  2EPB A;  1U4P A;  4OWX B;  1WTX A;  3K8A A;  2WKC A;  1IYU A;  2D5D A;  1S72 A;  2QDB A;  4FVM A;  2NN6 H;  4DF7 A;  3FKI B;  1I4P A;  5J3B A;  2K5W A;  3C1E A;  1X9N A;  1G6Z A;  3KF6 A;  3OTO Q;  4PZ6 A;  2E2I B;  1PH5 A;  4XT1 B;  2E5L Q;  1CA5 A;  2K52 A;  1BUV T;  4PV1 C;  5DEH A;  2L55 A;  2MHV A;  4BBR G;  1N36 Q;  1BCP F;  4IZ8 A;  4KY5 A;  5FLX L;  2BCO A;  4LFC Q;  2NZ1 D;  4OXP A;  1F2Y A;  3NTI A;  4OEM B;  1ICW A;  5E7N A;  1XMO L;  3TZD A;  2R93 G;  1YI2 A;  1Z7T A;  1T5E A;  3GTO B;  3KJP A;  1IL2 A;  1PA6 A;  1TQO A;  4JBK A;  3G7L A;  3SDZ A;  4ZYS A;  2FIN B;  4C1N K;  2DY7 A;  5JPM C;  3PGZ A;  1TWF H;  3BVZ A;  4O0A A;  4GOP A;  2HD3 A;  2Y0S E;  4R4C A;  2JA8 B;  4IUR A;  1RDP D;  2K04 A;  5EKI A;  3M4Y A;  3N6R A;  3RZO H;  1JOQ A;  1EEF D;  2BDN A;  3M4Q A;  4BWG B;  1AZP A;  2PI2 E;  1NCV A;  5IGF A;  4A3C H;  5M5X B;  3L0O A;  1WOC A;  3CPW A;  3JAM E;  1SNQ A;  5IWA Q;  1L0Y B;  2B8F A;  4AYB E;  1SR3 A;  4Q0F A;  3RZD H;  1YBY A;  4ABN A;  4JVZ A;  4ID6 A;  4LJZ C;  4GOP B;  3PUV A;  1K0S A;  1NR4 A;  4IO9 A;  1G51 A;  4B3S Q;  4LF4 Q;  1HUM A;  4X64 L;  2NB0 A;  3RN5 A;  3KUP A;  4EX5 A;  3AEV A;  2RVL A;  4BY1 B;  5C4Z A;  2A6H C;  2NWG A;  3KLS X;  3A8J E;  2YU9 H;  3BJU A;  3RR5 A;  1I4Q A;  2G5D A;  5CYU A;  3DUZ A;  2RF4 A;  3IKJ A;  5IT9 L;  2F0U A;  2UUA L;  2ID0 A;  2E2J H;  1CQV A;  1QVG A;  2LKV A;  2RDG A;  1DZ1 A;  2RDF A;  4EGV A;  2F0N A;  1UE5 A;  2EIF A;  5EPL A;  5C0X G;  1UUP A;  3F2D A;  3STB C;  4IN3 A;  3QIA A;  1SYC A;  1C48 A;  1LTT D;  4X3T A;  4A3E B;  4JBM A;  1YHA A;  2AQ3 B;  3VYS A;  4H0L C;  4LNQ A;  3KK7 A;  1AFP A;  1VQL A;  1KC8 C;  1RIP A;  1O78 A;  5DM6 3;  2SEB D;  1A2T A;  3ULP A;  3PO3 H;  1RD9 D;  1KXL A;  4B9X A;  4IJL A;  4X65 L;  4K5V A;  1T9H A;  1YNX A;  4XT3 B;  3HOW B;  1W3S A;  4OHJ A;  4C3H H;  2ICE C;  1YNJ C;  3S2D H;  2H5X A;  3AMU A;  2VQF L;  1PTO H;  3R3O A;  1PZI D;  4J6H A;  4KHZ A;  1STY A;  1E1O A;  1MD2 D;  1F2M A;  4UP9 A;  5FLM H;  2ZXP A;  1H9S B;  1NMG A;  4GKJ L;  3F2U A;  3L2P A;  1OO9 B;  1I6H H;  1NUC A;  2NVY H;  3TDQ A;  2Q8R E;  1XYI A;  3KFU A;  5IYD G;  1VQ7 A;  2R3Z A;  3B6Y A;  3TP5 A;  3S1M H;  2I07 B;  1X56 A;  4ME5 A;  1S5B D;  1PTO D;  1Z47 A;  2F0D A;  1I3Q H;  3ERS X;  1H9K A;  1B50 A;  3CP0 A;  1O7Y A;  2KHI A;  1Y1V H;  5E3F A;  2B39 A;  4J1M A;  1Q7Y C;  4RFB A;  1LT5 D;  4PMW A;  5KYL A;  1K8G A;  4TQU S;  4HCS A;  1SN8 A;  4I7Z C;  3TS0 A;  3CRL C;  5C6A A;  2MFI A;  2C35 B;  4PQX A;  2CWA A;  1V1Q A;  1V1P B;  4C3J H;  3I4M G;  1TWF B;  4ILW A;  4RMF A;  2OTL A;  4A3L G;  5JPN C;  3NUC A;  1ET9 A;  2IJ0 A;  1V8Q A;  5ELN A;  1D7Q A;  2D0O A;  2M00 A;  1J6Q A;  4R9W A;  1FVI A;  1WI5 A;  1E24 A;  1WJJ A;  2CWP A;  4A3G B;  1YZ6 A;  5CV6 A;  4GNX C;  1IYV A;  3D6W A;  2JA6 H;  5C3X A;  2PNR C;  3G48 A;  4LAA A;  4A3F G;  2A1A A;  5ELB A;  3J81 L;  2WIN B;  4XTC S;  1Y1V G;  1H95 A;  2K5N A;  3T13 A;  5I9P A;  3ITP A;  2PZW A;  4JV5 Q;  2Q8I B;  2JN4 A;  4CJ2 C;  3W1B A;  3PF4 A;  2FJ2 A;  3DHQ A;  1EU3 A;  1GUG A;  2KCC A;  4R4I A;  4IOC A;  4HAE A;  1N33 Q;  2L5T A;  3H0G G;  2BA1 A;  2PQA B;  2BDO A;  2FFK B;  3D3R A;  4UDU C;  1EL0 A;  1ONL A;  1SE8 A;  1SYE A;  1G6P A;  2X6L A;  4JYA Q;  3K7A H;  1L0W A;  2OEO A;  2N3S A;  2SNS A;  3CC2 A;  1MIU A;  3IFT A;  3A55 A;  1NR2 A;  2RQX A;  1JC7 A;  3I91 A;  1Y14 B;  1RHP A;  1EQT A;  1GO3 E;  4ME3 A;  5KEE A;  3G71 A;  3G6E A;  3I4M B;  4AIM A;  5BN5 A;  5IGG A;  3WOE A;  1YIT A;  4K5X A;  3KLS A;  4HJ9 A;  4L63 B;  4C3J B;  4KKT A;  4HSP A;  3SE0 A;  2B2W A;  3SVM A;  3K80 C;  3S2H B;  1HZC A;  4HMJ A;  1HCZ A;  1STH A;  4DR5 L;  2LXJ A;  1Y1W B;  3OIP A;  1EIG A;  4DV6 Q;  1AP0 A;  1NSN S;  2QF7 A;  1W2B A;  2V1C C;  2AMC B;  5E1F A;  5M5Y H;  3RMH A;  5KYI A;  4HJ8 A;  2PQE A;  4XYO A;  3HOV B;  1Y1V B;  1E2V A;  4RAU C;  2Z6B A;  3HOU B;  1QJO A;  5IOD A;  4LF5 Q;  5A2Q L;  1ESR A;  3ZYY X;  3E5S A;  2E2I H;  4UHV A;  4N8X 1;  4LFC L;  3HRZ C;  2LSS A;  5IYC H;  1CKM A;  5COY A;  2LXK A;  1SEB D;  3OWE B;  1PFN A;  1HA6 A;  4C3J G;  2K1B A;  1KAW A;  3NHH A;  4NXM Q;  1OXV A;  1VQ9 A;  4GZY C;  2O4X A;  3OIQ A;  2JXM B;  3M7N A;  4A3B B;  2MO1 A;  2IHF A;  2A74 C;  4E6I A;  4DR3 L;  5FJ8 H;  4XQJ A;  2IT1 A;  3RUZ A;  1SLJ A;  3TP7 A;  4A93 H;  3A8I E;  3K7A B;  3S24 A;  1PH1 A;  4KN4 C;  5CMD A;  1S5D D;  1FD7 D;  3KDF B;  3BYT B;  3S17 H;  1GKH A;  4Z9C B;  3VR5 A;  4JI6 Q;  5C0X J;  2UXD L;  3CPF A;  4WRD A;  3HFZ B;  2NVQ H;  1XJV A;  4JOI C;  2F0K A;  3KOJ A;  4P73 A;  3D8G A;  2RCF A;  3X3N A;  1EQV A;  3PQI A;  4CGY B;  1XTC D;  2AQ2 B;  4M1U B;  3K5N A;  1GUO A;  1LUZ A;  1X3P A;  1VCI A;  3VYU A;  5IGC A;  1KLG D;  4C2M H;  2MO0 A;  4BA1 I;  2IPK D;  3L9A X;  1UAP A;  3S14 B;  1FGU A;  5EJW A;  4QF4 A;  4BBR B;  1VQN A;  4BY7 B;  5GRO A;  3AB9 A;  1DJR D;  2LY7 A;  1N32 Q;  4HSV A;  1WCM H;  3AQQ A;  4OIK A;  1KAA A;  1VS0 A;  2Q2I A;  1HNZ Q;  1PVO A;  1VQA A;  4I7A A;  1LAC A;  1QUQ A;  2LFN A;  3NSW A;  3LWU A;  3RLO A;  5HGQ A;  4IPG A;  5LMN W;  1EWH A;  5D14 A;  2EQS A;  3PIP 3;  4QIW E;  2GA4 B;  3E6Z X;  4YIJ A;  4MTN A;  3M4O B;  5J39 A;  3QWN A;  1F9S A;  1SNM A;  2B2W C;  1HFG A;  3GP7 A;  1JWU D;  5CC4 A;  1SFO H;  1SNO A;  4J8Q A;  1X3Q A;  1M4V A;  2E2H H;  4HJA A;  2B2Y A;  4GNX A;  5IGB A;  2F03 A;  4GKK Q;  1NTG A;  4UPA A;  5I4D A;  4A3G G;  4JBW A;  4JG2 A;  4XQN A;  2XSC A;  2A6H D;  3KF8 A;  3J7Y W;  1UE6 A;  4A3J G;  1DOM A;  1D5X C;  1KRT A;  3PIP A;  4JI1 L;  3GTO H;  2EOT A;  4YHH L;  3HZX A;  3I4O A;  4TRD A;  3GTL H;  1TKW B;  5KIX A;  1C0A A;  4NKL A;  1XNR Q;  4GLV B;  3GTP H;  4OO1 G;  5IP7 H;  1EY7 A;  1VF5 C;  2WB1 E;  3CC4 A;  1D1K A;  1VF7 A;  4WJW A;  4QJF A;  2NVQ B;  4G7Z C;  1MKH A;  2RSN A;  3BU2 A;  4KD4 A;  1LTR D;  5IP9 G;  3H6M A;  4X66 Q;  1M8A A;  3D4D A;  3HG9 A;  3P7J A;  2XVS A;  2JK8 A;  1D8L A;  1B1Z A;  3S9W A;  2VQE Q;  4K14 A;  4FXK C;  4L5Q A;  1QOH A;  5CV9 A;  3HP3 A;  4DR2 L;  3GTQ B;  5D3I B;  4F7X A;  1YHQ A;  1CKN B;  5IOC A;  3PIO A;  3S17 B;  4YWM A;  3PO3 G;  4WOR A;  1YIJ A;  1OXU A;  1I4H A;  2A73 B;  4RCN A;  4KHP L;  3SEB A;  4IFD I;  4NP5 A;  3I55 A;  4ZQ3 A;  1AH9 A;  4A93 B;  1STG A;  3NWT A;  3KLR A;  4DR6 Q;  2XGT A;  1Q3L A;  4RGO S;  2O5I C;  5BR8 Q;  3HOZ G;  3I7F A;  2JA7 B;  1HQR D;  4ZUJ A;  2Z1C A;  1PH2 A;  4QUF A;  4MIU A;  4DAM A;  4TVA B;  2CHB D;  4DAY A;  2NVT H;  4JYA L;  3PMF A;  2NZO A;  1PYW D;  3K5L A;  2N49 A;  3EVQ A;  2DY8 A;  1HTL D;  3HOZ H;  2ATW A;  2K28 A;  4DAP A;  3NP8 A;  1I6V C;  2YV5 A;  1STN A;  1TY0 A;  3S1Q H;  1AZQ A;  1EEI D;  3BS1 A;  3M3Y B;  3F2C A;  2Y0S G;  4XXE A;  2EJF C;  1V1P A;  3SXH A;  1WCM B;  2Z8L A;  1JE5 A;  1D1I A;  1MJE A;  3H09 A;  4MZ9 A;  4DV2 L;  2UUC Q;  4BBS B;  3HOZ B;  1OXX K;  2ZM6 L;  4WJ3 M;  2AUJ D;  3DMU A;  2NUC A;  3S16 H;  2HIX A;  3SK8 A;  4JI0 Q;  3BDL A;  3T1H L;  1HNW Q;  1TS2 A;  1FL0 A;  3DM1 A;  1IKL A;  3CU7 A;  4ZLT F;  4HIK A;  1H9S A;  2ZTE A;  4XIG S;  1K28 A;  2KEN A;  2UXC L;  4KY7 A;  3R8B A;  4PNY A;  1OXT A;  2K03 A;  3D31 A;  2F52 A;  3TEH B;  2PZU A;  1GM5 A;  4OON A;  2ZJR A;  4ALP A;  2A8V A;  1WTV A;  1E22 A;  5LMU L;  2F4V L;  3E9H A;  3NBH A;  2RBM A;  1QIL A;  1BCP B;  2WFW A;  4AYB B;  3GTL B;  2L12 A;  1SE3 A;  4LF4 L;  4GKJ Q;  3VR3 A;  2MNA A;  5KGU A;  3EBE A;  4BBS G;  1RF2 D;  3I70 A;  1WD1 A;  2F4I A;  3KLW A;  3S15 B;  1SRO A;  2VUM G;  5KRU A;  4A3D B;  4KHP Q;  1DON A;  3UE1 A;  3H94 A;  3FMC A;  1LLR D;  3KBG A;  1IKM A;  3NBH B;  3EJI A;  4JI7 Q;  2MJ8 A;  3U9S A;  1N9W A;  1LTL A;  5IE8 A;  4LMQ D;  1J5E L;  3VR4 A;  1O7Z A;  1TII D;  2O2L D;  4YCW A;  4ZRZ A;  1I3Q B;  1RKN A;  2VUM H;  1PTO F;  4QQB X;  2A69 D;  4DFA A;  1XPO A;  3S15 H;  2B3G A;  4POF A;  3V05 A;  4LF9 Q;  4QIW B;  3QB3 A;  2EZV A;  1E7Z A;  4LF6 Q;  2IX0 A;  1VQG A;  3D4W A;  3MEH A;  1B3A A;  4KKS A;  4DUY L;  2AWN A;  4FF4 A;  1BCP D;  2A6E D;  1B70 B;  1CSQ A;  2J4X A;  1S5C D;  4EQO A;  3AYH B;  1ZXT A;  4L8J A;  2OTJ A;  2KHJ A;  5HGT A;  2NYZ D;  4RKL A;  4QY7 A;  4EVO A;  3PO2 G;  2K7V A;  4N8F A;  1D6E C;  3CQZ H;  1I4X A;  4JI4 Q;  4IAL A;  1YNJ D;  1LT6 D;  2EY5 A;  1SYF A;  5M9O A;  1EOV A;  1QWY A;  4IUT A;  2IL8 A;  4OWT B;  1E3P A;  4C1N I;  5I6Y A;  1EY8 A;  5KND A;  1DD2 A;  3E0J A;  4OEL B;  2IW3 A;  4K8J A;  4KD3 A;  5M3M G;  2JA5 G;  5E4X A;  2UU9 L;  1VQI A;  4PZ7 A;  2EXD A;  4V0B A;  3SK6 A;  1QE6 A;  4K2L A;  3JC6 6;  1PTO B;  5IY0 A;  1BOS A;  3PV0 A;  1I4G A;  1YNN C;  3RLF A;  3STB D;  1FYC A;  3QG1 A;  4DR2 Q;  2WAQ G;  3VA7 A;  3MHB A;  2KCM A;  1HH2 P;  4NB3 A;  4X64 Q;  2KCT A;  1E2W A;  5C3E G;  5GAD C;  3FRP B;  4GN5 A;  2ASB A;  4TSS A;  4OIJ A;  1CQF A;  4APV A;  5EPK A;  4FF3 A;  3TME A;  1MSH A;  3I72 A;  1YEZ A;  3NPP A;  2B2V A;  1CKN A;  2F0I A;  1K9M C;  1KHI A;  5C44 H;  1K8A C;  1U5K A;  3VYR A;  3S2H H;  5EGT A;  1BBW A;  3URY A;  5IYB G;  2HCC A;  1ENA A;  3E0E A;  2ZJP A;  3J81 j;  1A3U A;  3HKS A;  3I3C A;  1Q8I A;  3EQL C;  5EQ0 A;  1N36 L;  4A3M B;  5CBA E;  1TT2 A;  5JEA G;  3ULJ A;  1YVC A;  3KYH C;  4HCE A;  2TSS A;  1Y8P B;  1HQM C;  1EYG A;  1I50 B;  1NNX A;  3L7Z C;  4QB4 A;  3CD6 A;  2UUA Q;  1SDF A;  4LF7 L;  1C7Y A;  2IY5 B;  4PMB A;  3BDC A;  3SR1 A;  3HOU H;  3T51 B;  3MXN A;  3G4S A;  1EFI D;  1D5M C;  5FJ8 G;  2NN6 G;  2Y0S B;  2IX1 A;  1SJE D;  3RZO B;  2HHH Q;  1SYB A;  1IYJ B;  3PUZ A;  2WAQ B;  3HOY H;  3CCU A;  1XPU A;  1X3F A;  1TWA H;  1CZG A;  3R93 A;  1B2T A;  1QZG A;  1L1O B;  4QGU A;  1QCB D;  2E2D C;  4LFA Q;  1J8I A;  1XWE A;  5JJI A;  1NY4 A;  3EFX D;  3K81 C;  1U4M A;  3FP9 A;  4K5W A;  2TMP A;  2EY1 A;  2Z0S A;  1ZEQ X;  3HOW G;  3OW2 A;  1N34 L;  1CA6 A;  3MAQ A;  1I94 Q;  1IW7 C;  1EU4 A;  4IFD G;  1QZH A;  4GLX A;  4DV5 L;  1TVX A;  2EYF A;  3D0F A;  1KNE A;  2ES2 A;  4DUZ L;  2ALY B;  1K3R A;  2E75 C;  1FNW A;  1V1O A;  1EIF A;  1D5Z C;  4BY7 H;  4CKC A;  1N32 L;  2B8G A;  4L5S A;  1EUJ A;  2EYP A;  2FMM A;  2PMZ B;  3NE5 B;  2A6E C;  3CMA A;  1B7Y B;  2R93 B;  1TR5 A;  2AUK A;  1SSO A;  3WWV A;  5ELD A;  3J81 c;  2AHO B;  4FDB A;  3GTM H;  1E2Z A;  1HPC A;  4RCO A;  3TQY A;  3IRB A;  1LT3 D;  2NVX H;  2F3W A;  2XNA C;  2HUG A;  3AFP A;  1X55 A;  1Q8K A;  3QOJ A;  3PIO 3;  2A69 C;  5JJZ A;  4ZK9 B;  5C3E H;  2NZH A;  3BVM A;  5JAV A;  2UXB Q;  1K3B C;  3IFD A;  5IP9 H;  2E8G A;  3M4P A;  3H15 A;  1K8O A;  1EOT A;  1ZYR C;  4NDX A;  4RKB A;  2F0H A;  5M3F G;  1TWA B;  4UP7 A;  2Z9H A;  2F0M A;  1S5E D;  3CW2 C;  3V2T A;  4KJO A;  4BXX G;  2ENB A;  1IHZ A;  2FHT A;  4K6D A;  3OMC A;  4ZUI A;  1DXM A;  3S14 H;  5CV7 A;  1QVC A;  1WTQ A;  3SHL A;  2XIW A;  4A3K H;  3FPP A;  5DM7 3;  5KNB A;  2L9H A;  1EY5 A;  3J80 c;  2R7Z B;  2NBF A;  1TWG H;  3A8K E;  3D6C A;  4A76 A;  3I4N B;  5LMN Q;  5IGD A;  2CQO A;  4A3F H;  4A4I A;  4BS9 A;  3BZD B;  2QEX A;  5DLQ E;  1SMX A;  2ZXR A;  1EQQ A;  1MHW C;  2AWO A;  1X3E A;  4GS3 A;  1A3T A;  2KQ3 A;  1UE1 A;  4CJ1 B;  1R4Q B;  1W6K A;  4BBS H;  2JEA I;  1BKB A;  4NMZ A;  4G7H C;  1EZ6 A;  4Y7N H;  2EYJ A;  4LUV A;  1JWS D;  4JI8 L;  2B63 B;  3CAM A;  5LMN L;  3GTK H;  1C4Q A;  3PSI A;  3H0G B;  1EQR A;  2BH8 A;  4G7O C;  1Y1W H;  3C3L A;  2VY3 A;  1ASZ A;  4UY8 C;  1WTP A;  4DR4 Q;  5LMU Q;  2F4V Q;  1Q82 C;  2AKW B;  4X3U A;  3S16 B;  2VQF Q;  4JI5 L;  1Y69 U;  4DN4 M;  1TXY A;  3L3O C;  4NPS A;  4Q5V A;  2D62 A;  3Q0A A;  1XNR L;  1O7L A;  2C9O A;  4R4Q A;  3FPU B;  3I4N G;  2CFM A;  3K7U C;  5FO8 B;  1Y1W G;  1CHQ D;  3M85 A;  2BE5 D;  1BBU A;  1LAB A;  4LWC A;  1JWM D;  2VUM B;  3CF5 A;  3T53 B;  2F1M A;  4DUY Q;  1P8L A;  1WFQ A;  1U0L A;  1A15 A;  1ENF A;  2RHQ B;  2XN9 C;  2NVX B;  4L5T A;  1WD0 A;  1IBK L;  5M5X H;  1PMR A;  1IW7 D;  2F0S A;  1B9M A;  1AE3 A;  1HUN A;  2BH2 A;  3OW7 A;  3RZD B;  2DNE A;  5BN3 A;  1MJC A;  5IGE A;  1M1K C;  1D2B A;  4U68 A;  3N52 A;  2KJX A;  3UE0 A;  4OGQ C;  4DV1 Q;  5L37 A;  3J80 L;  3Q22 A;  2JA6 G;  2X69 A;  1KD1 C;  1EFW A;  3OWF A;  4A3G H;  4GN3 B;  3W5O A;  4IPH A;  2CKZ B;  4JI3 Q;  4IUV A;  3MXG A;  1IL8 A;  4A3J H;  2DGY A;  5C0X H;  4HN7 A;  1YJ9 A;  3AU7 A;  3DWQ A;  3BVG A;  3W2D A;  2K75 A;  5GAH C;  4A3I H;  2K5D A;  3I56 A;  1O80 A;  2ZJQ A;  3TS2 A;  4X6A H;  3DEO A;  4EQN A;  4X62 L;  3FEW X;  3HOV G;  3A7A B;  4H7B A;  2QIL A;  1A63 A;  2NTS A;  1S40 A;  2FMC A;  4JI3 L;  2GVB A;  5HY6 A;  4YWK A;  2I5H A;  4JK1 C;  4QL5 A;  5FLX E;  4JC0 A;  4KTA A;  1DOK A;  4GN4 B;  4DV0 Q;  3J81 E;  5JJK A;  3DM3 A;  2K14 A;  4ZAI A;  3P1H A;  4JW0 A;  1PFS A;  2NN6 I;  1PH8 A;  4ZCK A;  5GQO A;  2KEC A;  1PDQ A;  4DNT B;  2XWB B;  3MWY W;  3ND9 A;  3HOV H;  4JI8 Q;  2PI2 A;  1X32 A;  1C9O A;  4LF5 L;  1SE2 A;  4RGM A;  2CVR A;  4XQQ A;  1JOO A;  2ZTC A;  1H9R A;  4LUZ A;  3MEF A;  1SE4 A;  1QNU A;  1UWV A;  4X3K A;  4ULL A;  4PG3 A;  1PH3 A;  5CV4 A;  1L1O C;  2JA9 A;  4S3S A;  5CV5 A;  3I4L A;  4A3I G;  5M5W B;  2EYM A;  3NEL A;  4XYQ A;  1AE2 A;  1SFO B;  3E3X A;  3O13 A;  4JI2 Q;  3Q6S A;  4ZKC B;  1TWH H;  1ML0 D;  3ERO A;  4BBR H;  1CKO A;  4A3E G;  2WAQ E;  1RTO A;  1K73 C;  1E0B A;  4K2K A;  1I94 L;  3C1F A;  1IZ6 A;  1PV4 A;  4JI0 L;  4DR7 Q;  1C8C A;  3NBI A;  3M9B A;  3RN2 A;  3HOY G;  4OL7 A;  4DUZ Q;  2RCN A;  1BDO A;  2F0Q A;  2WV6 D;  3CCV A;  3CQZ B;  4CKE A;  4A3C G;  4QMG A;  1RCV D;  4B3M Q;  3TN2 A;  1ET6 A;  2B2U A;  3A7L A;  3U4V A;  4YY3 L;  2JEB I;  2A68 C;  4NXM L;  4LFB Q;  5C4J B;  2OQK A;  1RJT A;  3DWP A;  1ICF B;  4OO1 H;  3P20 A;  3KF6 B;  3PO3 B;  2Z6K A;  3CCJ A;  3HKZ G;  3J80 i;  3Q24 A;  1X6O A;  1Q46 A;  1F2L A;  4F87 A;  1GXD C;  3ULL A;  2HHH L;  4DPG A;  3T56 B;  3W1G A;  5G3L D;  5GAE C;  5IYC G;  3OYY A;  1KDA A;  4N9P A;  4DV3 Q;  3FDT A;  2A19 A;  1KTK A;  3H3V C;  2ZT9 C;  3NTK A;  2LMC B;  2EDG A;  3NK9 A;  5FLX c;  4DA2 A;  4OX9 L;  1VQF A;  3M3Y H;  3SK4 A;  3LNN A;  3HOX H;  4UP8 A;  4YY3 Q;  2PPB C;  2ZTD A;  2XRQ D;  1FJG Q;  2F0V A;  4A3I B;  4O42 A;  1P16 A;  4UAI A;  1LTG D;  3OPO A;  1V43 A;  1JR0 D;  3DEP A;  1LTB D;  1SMY D;  1WCM G;  2Q2T A;  1EIH A;  2N8N A;  2HQE A;  4R4O A;  3BYY B;  2R92 G;  1EYC A;  3OTO L;  1U4R A;  3GTG B;  2V4D A;  1KIX A;  2YU9 B;  4N9T A;  4GKK L;  1ILQ A;  3T4A C;  1PRT D;  1PFB A;  4LW1 A;  4IFD J;  2WAC A;  3FHW A;  2L4N A;  2K32 A;  3HKZ B;  2BA0 A;  2C5C A;  4B3R L;  2BOS A;  3S1M B;  5M5W H;  1QNK A;  1VQE A;  5JVH 3;  1KDC A;  1L1O A;  2E74 C;  5J1Z A;  3VDY A;  4C3I B;  5I6W A;  2JYO A;  2KCN A;  1JB3 A;  4FF1 A;  2I5M X;  4KJN A;  1IBK Q;  1DCZ A;  4ZKB B;  4LF7 Q;  3J7A V;  2VZA A;  1LTA D;  2VQE L;  1F2Z A;  2R61 A;  2PNH A;  2PW5 A;  1K0R A;  1WTW A;  1SNC A;  2B2T C;  2WB1 G;  3NQT A;  5C0X I;  1ESF A;  1GUN A;  4L6T B;  1SJH D;  4I65 A;  4RHS A;  3VR6 A;  1UNS A;  1B8A A;  1H9J A;  4B3M L;  1CK1 A;  3Q23 A;  2JA6 B;  1FNV A;  1PRT F;  5D65 A;  1ASY A;  3GDE A;  4CBV A;  1Q90 A;  1VDZ A;  5M3F B;  3GTG H;  3ICE A;  5I9O A;  3VYT A;  1CM9 A;  4H13 C;  3PF5 A;  3A54 A;  1SRU A;  4JI5 Q;  4GOP C;  3FKI G;  1BVS A;  1ENC A;  1VQB A;  2K6A A;  1UEA B;  5FO9 B;  2R6G A;  2X6G A;  4JV5 L;  1Q81 C;  4TKO B;  4KK7 A;  4XDX A;  3S1R H;  2KEE A;  2HQL A;  1YJN A;  1X54 A;  5DAU A;  3J7A 5;  1PXU A;  5CGK A;  1YJW A;  4O1N A;  2UXD Q;  1J5E Q;  1ZKO A;  4DNI A;  1BO0 A;  3J80 E;  3T1H Q;  3DXJ C;  2CH4 W;  4LK1 C;  3CCS A;  1JJ2 A;  2RA4 A;  3M7G A;  1UE7 A;  4MNO A;  1DM0 B;  3MFY A;  1JB7 A;  3ZJY C;  1VQM A;  2NVT B;  4C2M B;  1PYS B;  4JOI A;  1PH4 A;  3OSO A;  1G2S A;  3H0G H;  3PCO B;  3RNU A;  4KLK A;  5DNF A;  3A74 A;  3CCM A;  4FYD A;  3BZC A;  4Y52 H;  1VMP A;  3MC0 B;  4IUQ A;  1MBY A;  2EJG C;  1PRT B;  2YTV A;  2R7Z G;  2K4K A;  1GUS A;  4AH6 A;  1F9P A;  4IOA A;  3UDF A;  3CCL A;  3HOX B;  3H3V I;  1JQY D;  4DXG A;  1A0I A;  3GO5 A;  3MXU A;  3AFQ A;  3LGJ A;  1SBB B;  3E9I A;  5FLM G;  1LYL A;  2QDL A;  2JA8 H;  1SXT A;  5CR3 A;  4DV4 L;  2PO4 A;  3JAM L;  3MVV A;  3GTJ H;  4FO2 A;  2DJF C;  4DK3 C;  3ERQ A;  2KA7 A;  1FJG L;  4CDD C;  1L2F A;  3ND8 A;  1XPR A;  1EIY B;  5M5Y B;  1JMC A;  3S1N H;  3I73 A;  1JOR A;  1Y8N B;  2LS0 1;  1JIC A;  4HJ7 A;  1DOL A;  2KVM A;  2XTI A;  1EWI A;  2A68 D;  1TWH B;  2YYZ A;  4DK6 C;  3G6J B;  1S4Z A;  4JI7 L;  3GTK B;  2SNM A;  4HTH A;  5I2Y A;  1BQQ T;  2A5H A;  2VB2 X;  3S2D B;  1GUW A;  4HMI A;  3I90 A;  5C3E B;  4BY7 G;  1B3Q A;  4NXN L;  2QKI C;  1TU2 B;  2F0P A;  1DYQ A;  2RDH A;  3FVQ A;  4DR1 L;  3F2B A;  1PH6 A;  1EY6 A;  1F77 A;  3PUW A;  4DAV A;  3MTS A;  2MUY A;  4A3M G;  2I0Q A;  3PO2 B;  1GHK A;  4JCV E;  4DV4 Q;  2EJM A;  2DNC A;  2CH4 A;  1K83 H;  1SND A;  2WII B;  1LM0 A;  1LV9 A;  1TWC H;  2DUD A;  3TZU A;  3JAM c;  4DV7 L;  1EWC A;  1VQ8 A;  4FF2 A;  3OMG A;  4A3J B;  4EQP A;  4F88 A;  2SOB A;  1KL9 A;  5FO7 B;  1VQC A;  2UUB L;  2F3V A;  1HA5 A;  2JA7 H;  5LHY 1;  1VMC A;  2QGQ A;  5A35 A;  4LF6 L;  1G29 1;  2WKD A;  2CCZ A;  5ISR A;  3LWE A;  3GTJ B;  4IJH A;  1JCK B;  1BXT A;  3U4Z A;  3NWS A;  5JVG 3;  4JBJ A;  5ELC A;  1F9Q A;  3HGB A;  5IT9 c;  4G57 A;  1GUT A;  1HRJ A;  4A75 A;  1OXS C;  4RHR A;  2IWH A;  5FK9 C;  4RWS C;  4DV1 L;  4GNX B;  4MHE A;  2JA7 G;  1ILP A;  3QR8 A;  1KLU D;  4DAY B;  2PZT A;  4G4K A;  1Q12 A;  2J0T D;  1WTR A;  1CUK A;  1HZ9 A;  2XRS D;  4MTK A;  3S1Q B;  3WDN A;  3CCE A;  2PQA A;  1IXR A;  1KDB A;  4PMC A;  1I4R A;  3CRK C;  4QUC A;  4BA2 I;  4FP5 D;  3PUY A;  3VA5 A;  4CDE C;  2R7Z H;  5AJ3 L;  4X65 Q;  5T1G A;  3K0X A;  3EN2 A;  3C46 A;  5BN4 A;  3KBX A;  2IHE A;  2K5V A;  3V96 A;  3QJY A;  2F3I A;  4HIM A;  1PHJ A;  3HOU G;  2B2U C;  1A2U A;  4DK0 A;  1A6X A;  1IBM L;  4K0K Q;  4DGZ A;  4LF8 L;  1EYA A;  1WYD A;  2RSO A;  3TBI B;  1G2T A;  3FKI H;  1CI3 M;  5E4W C;  1OTC A;  3S1R B;  1PYB A;  4RGT A;  1I50 H;  1HNX Q;  2MGS A;  2H1E A;  4P71 A;  1X65 A;  4C3H G;  2P5Z X;  2Q8T A;  3RLN A;  1CT1 D;  3MZ5 A;  5EBD A;  5T1I A;  3TSS A;  3LX0 A;  4A3E H;  1ROD A;  5G3L F;  5I2X A;  2VNU D;  3TRE A;  4DU9 A;  1R4P B;  3I2Z A;  1K8M A;  3GV6 A;  1I5F A;  1TWG B;  3D4R A;  3KF8 B;  4YCU A;  1BNZ A;  1EY4 A;  1XMQ Q;  1HHV A;  1EY0 A;  4B3S L;  4IFD H;  3KDF A;  3Q8D A;  1M90 C;  5C44 B;  4B9W A;  1VQJ A;  2KOL A;  2Z6K C;  2QA4 A;  3T1Y Q;  1RTN A;  1JJG A;  5EKL A;  5C4X H;  1B53 A;  3H91 A;  3QOL A;  4A3F B;  3BG3 A;  2F0G A;  4AQY L;  3TRZ A;  1IBM Q;  3P75 A;  1O7I A;  4JI1 Q;  4IUP A;  5C4J H;  5LL6 X;  1HNX L;  5CV8 A;  1KAB A;  2F0F A;  1STB A;  3K0Y A;  4Y7N B;  1PH7 A;  2DN8 A;  3GTQ H;  2B63 H;  2UXB L;  2L0C A;  5IWA L;  5IT9 E;  2F0W A;  1KNA A;  2B2Y C;  2B2V C;  1Y8O B;  4RH6 A;  5COR A;  3QO2 A;  3HEJ A;  4DV0 L;  5ELF A;  4BXX H;  1NAP A;  1Q1B A;  4J15 A;  4RG1 A;  2KBN A;  5NUC A;  1EY9 A;  2ICI A;  3ONA B;  4JPB W;  4LFA L;  3X3M A;  4LF9 L;  3R2I A;  2FXQ A;  2M9V A;  1VQO A;  3MA2 B;  2B63 G;  1PRT C;  1GVP A;  2N88 A;  3K5M A;  2QCP X;  2SDF A;  3VR2 A;  4C3I H;  1V9P A;  3U9O A;  4DV3 L;  1CTM A;  4JI6 L;  1B4O A;  2EXZ A;  4IPD A;  5IP7 G;  1CFM A;  2RHS B;  4KN7 C;  1SMY C;  3ER0 A;  1KQS A;  5M3M H;  2NTT A;  5ELE A;  2VL6 A;  5JJL A;  3MXN B;  2JSO A;  4RGN A;  2JE6 I;  2L15 A;  4DR5 Q;  1HR0 Q;  4AYB G;  2H4O A;  3BDO A;  1VQ4 A;  2B29 A;  4CDC C;  3RD4 A;  1A8V A;  1XNQ Q;  4K8I A;  2E2H B;  3CME A;  3J7A F;  3OOC A;  4LF8 Q;  3NEM A;  3UDG A;  4K0K L;  1QG7 A;  3GD7 A;  2RKS A;  1PTO C;  2D0P A;  5LL6 S;  1MI2 A;  1A3V A;  3K57 A;  3A56 A;  2MPM A;  1S3O A;  2E2J B;  2F0L A;  3IL8 A;  1GHJ A;  3F1Z A;  2HDL A;  1NMF A;  1AW7 A;  1XMO Q;  4V19 0;  1TS4 A;  5AFW A;  4FXD A;  3M4O H;  1VQH A;  1NE3 A;  5F2D A;  3OHX C;  3J7Z C;  4DR7 L;  4EQ5 A;  1H9M A;  1UEB A;  5FOB B;  2KHS A;  2IX3 A;  2OF1 A;  4KMU C;  2K01 A;  3NXW A;  4A3L H;  1QVF A;  4U67 3;  2JP1 A;  3NEN A;  1VQK A;  2JA8 G;  4KHV A;  4P72 A;  1T5X D;  4DNR B;  4NXN Q;  2UUC L;  1HJP A;  3U50 C;  1XMQ L;  3MFG A;  1HR0 W;  3DWA A;  1HTP A;  5JEA H;  1BBX C;  3U58 A;  1N8R C;  4B3T L;  3K5O A;  1CHP D;  4FNF A;  2OQ0 A;  4H44 C;  1E1T A;  3T1Y L;  1N33 L;  4LFB L;  2EY6 A;  4BY1 G;  3SGI A;  1MGS A;  2JA5 B;  5M3M B;  1EYD A;  1RL2 A;  3EIV A;  2D9U A;  4R8I A;  4B3R Q;  1PLF A;  3WOF A;  2I5L X;  3HOX G;  1XXG A;  4P75 A;  2VS1 A;  4R8N A;  3H3V H;  5D3D A;  4JI4 L;  1WTH A;  5C4X G;  3NQI A;  4KY6 A;  4B3T Q;  5JEA J;  1JJC B;  1NBW A;  2EYL A;  2OT2 A;  2UUB Q;  4POG A;  5KNC A;  2R92 H;  1GOZ A;  1FNU A;  1Z9F A;  3UI2 A;  1XX8 A;  2F0J A;  4CKB A;  1FR3 A;  3GQB A;  5AJ3 Q;  1J9O A;  2G9D A;  3EA6 A;  4MN3 A;  2K5H A;  1MSG A;  5GAG C;  3HOW H;  3CHB D;  2VXW A;  3PUX A;  4DV7 Q;  1DGS A;  2B2T A;  3CKI B;  2UXC Q;  5FKA C;  1Q86 C;  5K36 G;  2E76 C;  1PZJ D;  4KKU A;  1PFM A;  2GVA A;  4WFN 3;  4A3M H;  2O5J C;  1QB5 D;  3J81 i;  1LT4 D;  4DK1 A;  1YHB A;  3I4M H;  4DR1 Q;  1HR0 L;  2I46 A;  2JQO A;  1FGB D;  1R9T B;  5A2Q E;  1XTD A;  2GN5 A;  2EE1 A;  2Z4I A;  4X66 L;  5HUR A;  1I6H B;  2K05 A;  2N78 A;  2Z4H A;  5H1S E;  3HOY B;  1LTS D;  1F9R A;  3NTH A;  5EKK A;  1S5F D;  1W6J A;  3A5U A;  3GTM B;  3GTP B;  3TP8 A;  3I4N H;  2F0T A;  2JJQ A;  2R93 H;  2G9H D;  5CBE E;  4NW2 A;  2JA5 H;  1YNN D;  5EBC A;  5C5M A;  4X62 Q;  2YTY A;  3CCQ A;  4WJ4 A;  5K5P A;  1VQP A;  2Q2H A;  4K6L A;  2Q2U A;  1SYG A;  1SAP A;  2DJG C;  1R9T H;  2WP8 J;  4GLA C;  1KRS A;  1HNW L;  4C56 C;  1STE A;  3JAM i;  2PCF B;  4DR4 L;  2PMZ E;  4DR6 L;  3A0J A;  5IYB H;  1HZB A;  5TSS A;  1WTO A;  2XWJ B;  2KUM A;  5BR8 L;  3GV3 A;  3MXP A;  1L0X B;  1JOK A;  1EZ8 A;  3K6O A;  2CQA A;  3F8T A;  4ODG A;  3TP6 A;  1IBL L;  3CXC A;  3R2T A;  4F8M A;  4RA8 A;  5C4H A;  3HKZ E;  3CCR A;  2OCE A;  4A3K G;  4A93 G;  1CZW A;  4HID A;  4IUN A;  1NJI C;  5IYD H;  2BE5 C;  2EYO A;  4HIO A;  1G91 A;  1BCP C;  3CC7 A;  1PZK D;  4QCL A;  1WVL A;  2ZXO A;  3W3A A;  4OX9 Q;  2PW7 A;  1JT8 A;  4DV5 Q;  2PYK A;  2CW0 D;  3UDX A;  2R92 B;  2EY2 A;  2E5L L;  2R7F A;  2VB3 X;  1B44 D;  4CJ0 B;  4P2C B;  1X3G A;  2EVB A;  4A3D H;  1II3 A;  1TS5 A;  2QEJ C;  2YTX A;  1K83 B;  2K33 A;  3DLL A;  2HDM A;  1TY2 A;  1TWC B;  2N55 A;  2F0O A;  4DKA C;  4HED A;  4YCV A;  1JE4 A;  4LUO A;  4OWW B;  4DR3 Q;  1B9N A;  2F0E A;  3K59 A;  1IBL Q;  1Q1E A;  3BZK A;  3PO2 H;  1BF4 A;  5EPJ A;  2HCI A;  2NVY B;  4H02 A;  4A3D G;  3S1N B;  2OWO A;  3UDI A;  3SK5 A;  3A5Z B;  1HFN A;  1QUQ B;  2R7D A;  4R1J A;  1SNP A;  1BR9 A;  4YWL A;  4HR7 B;  1A62 A;  2HIV A;  4L5R C;  4HJ5 A;  4CDF C;  4PZ8 A;  1AEX A;  4A3B H;  5K36 H;  4M8A A;  1STA A;  4DV2 Q;  1SYD A;  3I8Z A;  1VQ6 A;  5JOB A;  4A3K B;  4OO1 I;  2WB1 B;  2EYH A;  4C3H B; 
#chains in the Genus database with same CATH homology
 5LMN Q;  4DV4 Q;  2E2H H;  2CQO A;  5C44 G;  2ZM6 Q;  4A4I A;  4HJA A;  1K83 H;  4GNX A;  4A3F H;  2QEX A;  1NTG A;  4UPA A;  5DLQ E;  1SMX A;  1LM0 A;  1EQQ A;  1HNZ L;  4GKK Q;  4A3G G;  2AWO A;  4JBW A;  4JG2 A;  1X3E A;  1TWC H;  2DUD A;  4GS3 A;  4BY1 H;  3JAM c;  4DV7 L;  1VQ8 A;  4JI2 L;  1CSP A;  2HT1 A;  1UE1 A;  4A3B G;  1UE6 A;  4A3J G;  1KRT A;  3PIP A;  2JEA I;  4BBS H;  1KL9 A;  1BKB A;  4KI0 A;  4JI1 L;  4AQY Q;  1VQC A;  4Y7N H;  3GTO H;  4LUV A;  2UUB L;  4YHH L;  3I4O A;  4JI8 L;  2JA7 H;  3GTL H;  1C0A A;  3CAM A;  1XNR Q;  4GLV B;  4P74 A;  3GTP H;  2QGQ A;  5IP7 H;  5LMN L;  4OO1 G;  2WB1 E;  2MQH A;  4DV6 L;  3CC4 A;  4O2D A;  3GTK H;  4LF6 L;  1G29 1;  3PSI A;  2VW9 A;  4QJF A;  2CCZ A;  1MKH A;  3BU2 A;  1EQR A;  4IPC A;  5IP9 G;  2BH8 A;  4IJH A;  3U4Z A;  2VY3 A;  1VQD A;  1Y1W H;  2UU9 Q;  1ASZ A;  4X66 Q;  4JBJ A;  4UY8 C;  4DR4 Q;  5IT9 c;  2JK8 A;  3KJO A;  1D8L A;  5LMU Q;  1GD7 A;  5ELO A;  1Q82 C;  2F4V Q;  1HZA A;  2K50 A;  2AKW B;  2VQE Q;  5M3F H;  4R4T A;  4L5Q A;  4A75 A;  4YHH Q;  1PH9 A;  1OXS C;  2VQF Q;  4DV1 L;  4GNX B;  4DR2 L;  4JI5 L;  1VQ5 A;  2JA7 G;  1YHQ A;  1XNR L;  1TXY A;  1CKN B;  4NPS A;  2D62 A;  3PIO A;  4DAY B;  5EAY A;  1XNQ L;  1Q12 A;  4R4Q A;  4YWM A;  1CUK A;  3PO3 G;  3I4N G;  2CFM A;  4OWX B;  1HZ9 A;  3K7U C;  1YIJ A;  3K8A A;  1OXU A;  1Y1W G;  3M85 A;  1BBU A;  2PQA A;  3CCE A;  1IXR A;  1S72 A;  4LWC A;  4BA2 I;  3CF5 A;  5J3B A;  3PUY A;  2R7Z H;  4KHP L;  4DUY Q;  1P8L A;  1WFQ A;  5AJ3 L;  4X65 Q;  1X9N A;  4IFD I;  1U0L A;  3K0X A;  3EN2 A;  3I55 A;  1AH9 A;  3KF6 A;  2RHQ B;  3OTO Q;  4L5T A;  1IBK L;  2IHE A;  4PZ6 A;  2K5V A;  5M5X H;  2XGT A;  4DR6 Q;  1PH5 A;  5BR8 Q;  2F3I A;  2E5L Q;  3HOZ G;  1AE3 A;  3I7F A;  4HIM A;  1PHJ A;  3HOU G;  2BH2 A;  2K52 A;  1PH2 A;  4DAM A;  4TVA B;  4BBR G;  1N36 Q;  1MJC A;  1M1K C;  1IBM L;  4K0K Q;  2NVT H;  4LF8 L;  4LFC Q;  4JYA L;  1WYD A;  3UE0 A;  4DV1 Q;  2NZO A;  4OXP A;  3FKI H;  2I0Q A;  1OTC A;  2N49 A;  1PYB A;  2JA6 G;  5E7N A;  1KD1 C;  1XMO L;  1I50 H;  1EFW A;  3HOZ H;  2ATW A;  1HNX Q;  2R93 G;  1YI2 A;  4A3G H;  4GN3 B;  3W5O A;  4IPH A;  3KJP A;  4P71 A;  1X65 A;  1IL2 A;  2CKZ B;  2YV5 A;  4JI3 Q;  1PA6 A;  3S1Q H;  4A3J H;  4JBK A;  3RLN A;  2DGY A;  3F2C A;  2Y0S G;  3PGZ A;  1TWF H;  4O0A A;  4GOP A;  4A3E H;  2Y0S E;  1YJ9 A;  4R4C A;  2VNU D;  3TRE A;  1JE5 A;  2K75 A;  5GAH C;  4A3I H;  1MJE A;  3RZO H;  3I2Z A;  3I56 A;  2ZJQ A;  3TS2 A;  4MZ9 A;  1I5F A;  4YCU A;  4DV2 L;  3KF8 B;  4X6A H;  3M4Q A;  2UUC Q;  4X62 L;  1XMQ Q;  3HOV G;  2PI2 E;  4B3S L;  1A63 A;  1S40 A;  4JI3 L;  4A3C H;  2GVB A;  3KDF A;  3Q8D A;  5HY6 A;  4YWK A;  2I5H A;  1M90 C;  2UUA L;  1VQJ A;  3L0O A;  1OXX K;  1WOC A;  2ZM6 L;  2Z6K C;  3CPW A;  2QA4 A;  3T1Y Q;  4QL5 A;  1JJG A;  4WJ3 M;  4JC0 A;  5IWA Q;  5C4X H;  3S16 H;  2HIX A;  4JI0 Q;  3T1H L;  4GN4 B;  1SR3 A;  4AYB E;  4DV0 Q;  3RZD H;  1HNW Q;  5JJK A;  3DM3 A;  2K14 A;  1FL0 A;  1YBY A;  4AQY L;  3TRZ A;  1PFS A;  2NN6 I;  1PH8 A;  1IBM Q;  5GQO A;  4JI1 Q;  1O7I A;  4GOP B;  3PUV A;  5C4J H;  4HIK A;  4IO9 A;  1HNX L;  2ZTE A;  4XIG S;  2PI2 A;  4JI8 Q;  1G51 A;  4B3S Q;  3HOV H;  1C9O A;  2KEN A;  4LF5 L;  2UXC L;  1PH7 A;  4LF4 Q;  1OXT A;  3D31 A;  4X64 L;  2F52 A;  3RN5 A;  3TEH B;  2ZTC A;  4EX5 A;  3AEV A;  3GTQ H;  4LUZ A;  2B63 H;  2UXB L;  3MEF A;  1GM5 A;  5IWA L;  1UWV A;  4OON A;  2ZJR A;  2YU9 H;  3BJU A;  3RR5 A;  4DV0 L;  4PG3 A;  4ALP A;  1PH3 A;  2A8V A;  2RF4 A;  4BXX H;  1L1O C;  1E22 A;  2JA9 A;  5LMU L;  1Q1B A;  2ID0 A;  4J15 A;  4RG1 A;  2E2J H;  2KBN A;  3E9H A;  2F4V L;  1QVG A;  4A3I G;  3NEL A;  4LFA L;  2WFW A;  4LF9 L;  1AE2 A;  4JI2 Q;  2FXQ A;  1VQO A;  1UE5 A;  1TWH H;  2EIF A;  4LF4 L;  4GKJ Q;  5C0X G;  3F2D A;  4BBR H;  2MNA A;  3STB C;  1CKO A;  2B63 G;  3EBE A;  4A3E G;  1GVP A;  2WAQ E;  1K73 C;  4BBS G;  4JBM A;  1YHA A;  1I94 L;  4LNQ A;  3KLW A;  1V9P A;  1IZ6 A;  4C3I H;  4DV3 L;  1PV4 A;  1VQL A;  4JI0 L;  1SRO A;  1KC8 C;  1RIP A;  4JI6 L;  4DR7 Q;  2VUM G;  3M9B A;  3RN2 A;  3HOY G;  4IPD A;  5IP7 G;  3ULP A;  4DUZ Q;  2RHS B;  3PO3 H;  4KHP Q;  2RCN A;  1KXL A;  3ER0 A;  4IJL A;  4X65 L;  3CCV A;  3UE1 A;  1KQS A;  1T9H A;  1YNX A;  4A3C G;  5M3M H;  2VL6 A;  1W3S A;  5JJL A;  4B3M Q;  3NBH B;  4C3H H;  3MXN B;  4DR5 Q;  2JE6 I;  2L15 A;  4JI7 Q;  1N9W A;  1LTL A;  3U4V A;  5IE8 A;  4YY3 L;  2H5X A;  2JEB I;  1J5E L;  1HR0 Q;  4NXM L;  4AYB G;  3S2D H;  2OQK A;  4YCW A;  2VQF L;  4LFB Q;  1VQ4 A;  2B29 A;  3KF6 B;  2VUM H;  1A8V A;  1XNQ Q;  4QQB X;  2Z6K A;  3CCJ A;  3CME A;  1XPO A;  3HKZ G;  3J80 i;  3NEM A;  4LF8 Q;  3UDG A;  4KHZ A;  3S15 H;  4K0K L;  3GD7 A;  1E1O A;  1X6O A;  1Q46 A;  2B3G A;  2D0P A;  4UP9 A;  4POF A;  5FLM H;  4LF9 Q;  3ULL A;  2HHH L;  1S3O A;  4DPG A;  1E7Z A;  3F1Z A;  4LF6 Q;  2IX0 A;  1VQG A;  1NMG A;  4GKJ L;  1NMF A;  3L2P A;  1XMO Q;  1I6H H;  3W1G A;  2NVY H;  5GAE C;  5IYC G;  4DUY L;  3M4O H;  1VQH A;  2AWN A;  1NE3 A;  3OYY A;  3KFU A;  5IYD G;  3J7Z C;  1VQ7 A;  3B6Y A;  4DV3 Q;  1B70 B;  4EQ5 A;  3S1M H;  4DR7 L;  2A19 A;  1UEB A;  1X56 A;  1CSQ A;  1Z47 A;  1I3Q H;  3ERS X;  4A3L H;  3CP0 A;  2KHI A;  3AYH B;  1QVF A;  5FLX c;  1Y1V H;  3NEN A;  1VQK A;  4OX9 L;  2JA8 G;  2OTJ A;  1VQF A;  3M3Y H;  2KHJ A;  4P72 A;  3HOX H;  1Q7Y C;  4QY7 A;  4PMW A;  4NXN Q;  2UUC L;  3PO2 G;  1HJP A;  4UP8 A;  3U50 C;  1K8G A;  4TQU S;  3CQZ H;  4YY3 Q;  1XMQ L;  1HR0 W;  4JI4 Q;  1SN8 A;  3TS0 A;  3U58 A;  2ZTD A;  1N8R C;  1FJG Q;  4B3T L;  1EOV A;  2C35 B;  2MFI A;  1P16 A;  4OWT B;  2OQ0 A;  1E3P A;  2CWA A;  1E1T A;  1V1Q A;  4C3J H;  3T1Y L;  1N33 L;  1V43 A;  2Q2T A;  3I4M G;  4BY1 G;  4RMF A;  1WCM G;  4LFB L;  2OTL A;  3SGI A;  4A3L G;  2N8N A;  5M3M G;  2JA5 G;  1RL2 A;  3EIV A;  4R4O A;  2R92 G;  4B3R Q;  2UU9 L;  3OTO L;  2I5L X;  5ELN A;  3HOX G;  1D7Q A;  1VQI A;  2D0O A;  4P75 A;  2EXD A;  4PZ7 A;  1J6Q A;  1KIX A;  1FVI A;  1WI5 A;  4GKK L;  2VS1 A;  1E24 A;  1WJJ A;  2CWP A;  3JC6 6;  1YZ6 A;  5IY0 A;  4JI4 L;  3PV0 A;  3H3V H;  5C4X G;  3RLF A;  3STB D;  4GNX C;  4DR2 Q;  2WAQ G;  4B3T Q;  5JEA J;  2JA6 H;  1JJC B;  2KCM A;  1NBW A;  4LW1 A;  4IFD J;  1HH2 P;  4NB3 A;  4X64 Q;  3FHW A;  2KCT A;  3G48 A;  4A3F G;  5C3E G;  2UUB Q;  5GAD C;  4POG A;  2A1A A;  4GN5 A;  2ASB A;  2R92 H;  2BA0 A;  4B3R L;  4XTC S;  1Z9F A;  1Y1V G;  5M5W H;  4APV A;  1H95 A;  1VQE A;  2K5N A;  1L1O A;  3VDY A;  4JV5 Q;  1YEZ A;  1CKN A;  3W1B A;  5AJ3 Q;  2I5M X;  1K9M C;  3PF4 A;  1IBK Q;  1KHI A;  5C44 H;  1K8A C;  1U5K A;  3S2H H;  1BBW A;  4LF7 Q;  2K5H A;  2VZA A;  4R4I A;  5GAG C;  4IOC A;  5IYB G;  3HOW H;  2VQE L;  3E0E A;  1N33 Q;  2ZJP A;  3PUX A;  3J81 j;  4DV7 Q;  1DGS A;  3HKS A;  2UXC Q;  2PNH A;  3H0G G;  2BA1 A;  1K0R A;  2PQA B;  1Q86 C;  5K36 G;  1SE8 A;  1N36 L;  2WB1 G;  1G6P A;  5C0X I;  5JEA G;  3ULJ A;  4JYA Q;  3K7A H;  1YVC A;  1L0W A;  2N3S A;  3KYH C;  3CC2 A;  1MIU A;  2GVA A;  1EYG A;  4A3M H;  1B8A A;  3L7Z C;  3CD6 A;  3J81 i;  2UUA Q;  4B3M L;  1Y14 B;  1YHB A;  1ASY A;  4LF7 L;  3I4M H;  3GDE A;  4DR1 Q;  1C7Y A;  2IY5 B;  1GO3 E;  4ME3 A;  1HR0 L;  2JQO A;  3HOU H;  3G71 A;  3G6E A;  1XTD A;  4AIM A;  2GN5 A;  3GTG H;  3ICE A;  4X66 L;  1YIT A;  3G4S A;  5FJ8 G;  4HJ9 A;  2NN6 G;  2N78 A;  3PF5 A;  2IX1 A;  1SRU A;  5H1S E;  4JI5 Q;  4GOP C;  2HHH Q;  3FKI G;  1BVS A;  3A5U A;  1VQB A;  1IYJ B;  3K80 C;  3PUZ A;  3I4N H;  2JJQ A;  3CCU A;  1XPU A;  2R6G A;  3HOY H;  1X3F A;  4JV5 L;  1TWA H;  2R93 H;  1Q81 C;  2JA5 H;  4X62 Q;  4WJ4 A;  3CCQ A;  2YTY A;  3S1R H;  1VQP A;  1QZG A;  2HQL A;  1HZC A;  1YJN A;  1L1O B;  1X54 A;  2Q2H A;  2LXJ A;  4DR5 L;  3J7A 5;  4QGU A;  1YJW A;  2Q2U A;  4DV6 Q;  1R9T H;  2UXD Q;  2WP8 J;  4LFA Q;  1J5E Q;  4DNI A;  4GLA C;  1KRS A;  3T1H Q;  5JJI A;  1NY4 A;  1HNW L;  1W2B A;  3K81 C;  2V1C C;  3FP9 A;  3JAM i;  2AMC B;  5M5Y H;  2PMZ E;  3CCS A;  1JJ2 A;  4DR4 L;  4DR6 L;  3A0J A;  2Z0S A;  1HZB A;  5IYB H;  3HOW G;  4HJ8 A;  1UE7 A;  4MNO A;  3OW2 A;  1JB7 A;  3ZJY C;  5BR8 L;  1N34 L;  1VQM A;  1I94 Q;  1PYS B;  4JOI A;  1PH4 A;  1N34 Q;  3F8T A;  3H0G H;  3PCO B;  3RNU A;  4LF5 Q;  4KLK A;  1IBL L;  4IFD G;  3A74 A;  1QZH A;  4GLX A;  3CXC A;  3CCM A;  4DV5 L;  3HKZ E;  3D0F A;  2ES2 A;  3BZC A;  2E2I H;  4Y52 H;  3CCR A;  2ALY B;  2OCE A;  4DUZ L;  4A3K G;  2YTV A;  4A93 G;  1K3R A;  2R7Z G;  4LFC L;  2K4K A;  2LSS A;  4AH6 A;  1CKM A;  5IYC H;  4IOA A;  2LXK A;  3UDF A;  1EIF A;  4HID A;  3CCL A;  4BY7 H;  1NJI C;  3H3V I;  1N32 L;  5IYD H;  4L5S A;  1A0I A;  1EUJ A;  3GO5 A;  4HIO A;  3AFQ A;  3LGJ A;  1KAW A;  3E9I A;  3CMA A;  3CC7 A;  1B7Y B;  4NXM Q;  1OXV A;  1VQ9 A;  5FLM G;  1LYL A;  3WWV A;  3M7N A;  4OX9 Q;  3J81 c;  2AHO B;  2MO1 A;  2IHF A;  4FDB A;  4DR3 L;  3GTM H;  1JT8 A;  3TQY A;  4DV5 Q;  2JA8 H;  4DV4 L;  3IRB A;  5FJ8 H;  2IT1 A;  3UDX A;  1SLJ A;  2NVX H;  4A93 H;  3GTJ H;  2E5L L;  2R7F A;  4DK3 C;  1X3G A;  3S24 A;  1PH1 A;  1FJG L;  4A3D H;  3AFP A;  1L2F A;  3KDF B;  1X55 A;  3S17 H;  1GKH A;  2YTX A;  1Q8K A;  1XPR A;  4JI6 Q;  3DLL A;  5C0X J;  1EIY B;  1JMC A;  2UXD L;  3CPF A;  5C3E H;  3S1N H;  2NZH A;  2UXB Q;  3HFZ B;  4DKA C;  2NVQ H;  4YCV A;  4HJ7 A;  1XJV A;  4JOI C;  3KOJ A;  4LUO A;  2XTI A;  2E8G A;  1EWI A;  3M4P A;  4P73 A;  5IP9 H;  3H15 A;  4DR3 Q;  4OWW B;  2YYZ A;  4DK6 C;  1IBL Q;  1Q1E A;  3BZK A;  3PO2 H;  4JI7 L;  1LUZ A;  1VCI A;  4C2M H;  2MO0 A;  4H02 A;  4BA1 I;  5M3F G;  4A3D G;  4UP7 A;  1FGU A;  3CW2 C;  1VQN A;  2OWO A;  4BY7 G;  5GRO A;  3UDI A;  4BXX G;  1N32 Q;  3A5Z B;  1QUQ B;  1WCM H;  2R7D A;  4R1J A;  4NXN L;  3AQQ A;  1VS0 A;  4YWL A;  2Q2I A;  1HNZ Q;  3S14 H;  1PVO A;  1VQA A;  1A62 A;  2HIV A;  4L5R C;  1QUQ A;  3RLO A;  1QVC A;  5HGQ A;  4IPG A;  5LMN W;  2EQS A;  4HJ5 A;  4A3B H;  4PZ8 A;  4QIW E;  4DR1 L;  4A3K H;  4MTN A;  3F2B A;  1PH6 A;  3PUW A;  3J80 c;  4DV2 Q;  1VQ6 A;  1SFO H;  1TWG H;  4A3M G;  4OO1 I;  4A76 A;  4JCV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...