3VDYA

B. subtilis ssbb/ssdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
101
Chain Sequence
HMFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYEVNVYVTEVLADTVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
molecule keywords Single-stranded DNA-binding protein ssbB
total genus 16
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3vdyA00
2MFIA 4BBSH 5M5WH 1HH2P 1HZAA 1A63A 1Q86C 1YEZA 4LF8L 3NEMA 2VNUD 1EQQA 2JEAI 4MZ9A 4LFBL 3ER0A 3K80C 5C3EG 3HOWG 1I94L 3M3YH 4P71A 4JI6L 2GVBA 2F4VQ 1U0LA 4DR4Q 1PH6A 3PGZA 3WWVA 4DV1L 4DUYQ 3G6EA 5GAHC 1KQSA 2KCTA 2WB1E 4JI4L 4IO9A 4L5RC 1K8GA 3FHWA 4BA2I 1E1TA 3EIVA 4HIKA 3W1GA 4H02A 1D8LA 2ASBA 1VQBA 1YHBA 5LMUL 1AE2A 1YJWA 2UXBQ 1X9NA 1QUQA 3L2PA 4APVA 2L15A 3RZOH 5C3EH 1HJPA 2E5LL 1XTDA 3KYHC 4X66Q 4RG1A 1N36Q 2AKWB 1JJ2A 4YWMA 3A0JA 3I4NH 5HGQA 1VQ8A 1N36L 1JB7A 4X64L 3K8AA 4DR5Q 2R7ZG 4XIGS 4DV2Q 2PNHA 1VQ7A 3PF4A 3U58A 3BZKA 1QZHA 4DUZQ 4IFDJ 3K81C 3CQZH 4GNXC 4JI2L 4UP9A 1YHAA 3TQYA 4B3RQ 3UDIA 3W1BA 3HOVG 3CPWA 4A93H 5IP9G 1WCMG 4DV4Q 1PYSB 3RR5A 3MXNB 4AIMA 1VQLA 2Q2UA 4OX9Q 4JI5L 3GO5A 1Y1WH 2LSSA 1Z47A 1X6OA 3F2DA 4YY3L 3UDGA 4K0KL 2IX0A 1YJNA 3HKSA 4OO1I 2K5VA 2I5HA 3I4OA 2NVQH 1HZCA 1YJ9A 2PI2E 4TVAB 3PUWA 2N8NA 4IPCA 1Z9FA 2CWPA 3G71A 1PV4A 1LYLA 2RCNA 1WJJA 1PH8A 3EN2A 3GTJH 3S16H 3T1HL 2AWOA 5AJ3Q 3J80i 1PH4A 1V1QA 4A3EG 4JI0Q 3I4MH 2I5MX 4L5SA 1HNWQ 4A3BG 2BA0A 4DV0Q 2VZAA 1GVPA 2JK8A 4A3EH 5IP9H 4DR7L 1EOVA 2K14A 1J5EL 3A74A 3S24A 3L0OA 1VQHA 2QA4A 3S1RH 1XMQQ 2F52A 4DV0L 3PF5A 2JE6I 4OWTB 4BBRH 4B3SQ 2B63G 3UE0A 3CMEA 4YHHQ 1IL2A 4IFDG 1QVCA 2LXJA 1OXVA 5AJ3L 3CXCA 4A3MG 1PH9A 2UUBQ 2CCZA 2Q2IA 3KLWA 2WAQE 5JJKA 1E24A 1XMQL 5GROA 5IP7G 3PUZA 1NBWA 1TWCH 2K5NA 5H1SE 4A93G 3HOVH 3CD6A 4MTNA 3T1YQ 5IP7H 2PQAA 1N33L 1PVOA 2QEXA 1VQCA 3HOWH 4A3BH 4P74A 2BH8A 4R4QA 2KHJA 4R4OA 1U5KA 1HNWL 4GLVB 2YTYA 1EWIA 5IWAQ 2K4KA 3TEHB 2R7DA 1VQNA 5IT9c 3GTQH 2E2HH 2OTJA 1HNXL 4LF5Q 4LF9Q 2ZJPA 4BBSG 2OCEA 2RHSB 5C0XG 3MEFA 1N32Q 1K83H 1OXSC 1I50H 3RLOA 1UWVA 4HIDA 4JI7L 4DNIA 1BBWA 4GOPC 5M5YH 4AYBE 1VQIA 1HNXQ 4LF5L 3RLNA 4OX9L 4DR6Q 2XTIA 1MJCA 1YI2A 4A3LH 2N3SA 2NN6I 5C44G 3H15A 2HHHL 3M4QA 4JI3Q 5C4XH 4C2MH 1EFWA 2JA7H 2R7FA 2XGTA 1QVGA 4A3CG 3K0XA 2KENA 3T1YL 4A3MH 5M3FH 5M5XH 1GKHA 4GNXA 1SROA 2ZTCA 3JAMc 4A76A 5C4XG 5IYDH 1G6PA 2R6GA 3D0FA 4YCWA 4IPGA 5IY0A 3U4ZA 1Q81C 1Q46A 4A3GH 2R93G 2UXDQ 3CC2A 2OWOA 2JA5H 1K3RA 3W5OA 3J81c 4DV7Q 3AYHB 4YCVA 3M85A 4A4IA 4BXXG 1B70B 4BY1G 1PH5A 3HOYH 3K7UC 1E1OA 4R4CA 3ULJA 4HIOA 1C9OA 1NY4A 1SR3A 1YZ6A 1VQ6A 1K73C 2B63H 1KAWA 2MQHA 2IX1A 1I94Q 3PO3H 1V9PA 4JI1L 1KRTA 1CSQA 1VS0A 2AHOB 4DR1L 2Q2HA 4IFDI 1J6QA 1TWAH 2JQOA 4B3TL 2VUMH 4HJ8A 1VQ9A 4BY7G 1EIYB 4GKJL 1JJCB 4YHHL 1NTGA 4LF6L 4JI8L 2I0QA 1A8VA 2CWAA 2UU9Q 3GTMH 4HJ7A 1S40A 2R93H 1Y1VG 3CF5A 1VQMA 3ULLA 4L5TA 1J5EQ 1UE6A 1KXLA 3G48A 1IBML 1NMGA 3HOXH 4TQUS 2K75A 1OXTA 2VY3A 3RZDH 4LUZA 2YYZA 1SLJA 4PZ6A 5JJLA 3KJPA 3EBEA 3PUXA 1OTCA 1E7ZA 3CP0A 4P75A 3RN5A 1Y14B 4LNQA 3S17H 4JI1Q 1CUKA 4GLAC 1S3OA 2YTXA 4DV3L 2CQOA 4DV2L 2E2JH 2VS1A 1OXUA 3HOUG 1R9TH 4UP8A 3CMAA 4A3DG 1KHIA 2LXKA 4YY3Q 5GADC 1B8AA 5LMNQ 1JJGA 1K9MC 4LF6Q 4JBWA 5JEAJ 1JMCA 2IY5B 2N49A 4Y7NH 3U50C 3RN2A 3PO3G 3VDYA 2OQ0A 1XPOA 1FJGL 2NZOA 4B3TQ 3KJOA 2D62A 1Q1EA 4GKKQ 2JA9A 3LGJA 2RF4A 4QY7A 4B3MQ 3AFQA 4HJAA 1IZ6A 3I56A 2IT1A 4X64Q 1HR0L 4AQYL 2UUAQ 1Y1VH 3PSIA 4KHZA 1JT8A 4DR3L 4DAMA 1AE3A 1VQDA 1I3QH 3GTPH 1TXYA 4DUYL 3PIOA 3J7A5 4OWWB 4KLKA 4AQYQ 3ERSX 4DK6C 1XNQQ 3CCQA 2E5LQ 4JOIA 4JI7Q 4JI6Q 3S14H 3ICEA 4NPSA 1YVCA 5LMUQ 4PZ7A 3S15H 1PH1A 5IWAL 1FJGQ 5JEAG 4A3FH 3HKZE 1L1OB 1UE1A 3RLFA 1TWFH 2DUDA 1EIFA 4EQ5A 4J15A 3TREA 1HZBA 3HOUH 2CKZB 1PHJA 1ASZA 2JA5G 1XNRL 3M7NA 2K50A 1C0AA 1HNZL 1UE5A 4QIWE 4WJ4A 5C4JH 1XPUA 3SGIA 2UXCL 1GO3E 4GOPB 2NVXH 3CCSA 1SMXA 2B29A 4A3JG 2HIVA 4GKJQ 1G291 2Z0SA 5K36G 3E9IA 4DV5L 1NJIC 1M1KC 1E22A 2VUMG 5HY6A 3J7ZC 1RL2A 4DR1Q 1P8LA 1TWHH 1KC8C 2GN5A 3PO2G 2NVTH 3M4OH 3CC7A 4DR7Q 2ZJQA 1IYJB 4JYAL 3PV0A 1IXRA 5FJ8H 4ME3A 1B7YB 2I5LX 4DV5Q 3B6YA 4JI8Q 2MNAA 4BY1H 2MO1A 4DV7L 1XPRA 2FXQA 2K52A 3BJUA 3HKZG 1VCIA 2VW9A 4KHPQ 4NB3A 1L0WA 1UEBA 5FLMG 1OXXK 5IYBH 3FKIH 4RMFA 1DGSA 4O2DA 4YWLA 1PA6A 1VQAA 4IPDA 4JYAQ 1VQ5A 3I4MG 4DR5L 1C7YA 1YBYA 2A19A 1W2BA 2R7ZH 4GNXB 2MO0A 5FLXc 3CCJA 1PFSA 5EAYA 3PO2H 3OYYA 3T1HQ 3BZCA 1I5FA 2JJQA 1LM0A 4X65L 1PH3A 2YTVA 4LF7Q 4JV5L 1WOCA 1WI5A 4DPGA 4GN5A 4YCUA 1Q7YC 2UXCQ 4DV6Q 3KF6B 3M4PA 3D31A 2A1AA 1UE7A 3J81i 1XMOQ 4A3IG 2HIXA 1CKNA 2CFMA 5IYBG 3I7FA 5GAEC 4DK3C 2VQFL 4GLXA 1N34L 2NZHA 2YU9H 1EQRA 2QGQA 1RIPA 4LFAL 4IOAA 3KOJA 1H95A 4QJFA 5IYDG 4Y52H 4JG2A 1QUQB 1PYBA 2AWNA 3H0GH 3OTOL 4HJ9A 4A3KH 5FJ8G 4JI2Q 3CCRA 2ZTEA 3PCOB 4A3DH 4DV1Q 4K0KQ 4DKAC 3CCVA 4DUZL 4GN4B 1GD7A 3PUYA 4R1JA 1VQOA 2Z6KA 3PIPA 4PZ8A 3CPFA 2OTLA 2EIFA 1WFQA 1S72A 1MKHA 4LF9L 1X3EA 2Y0SG 2WAQG 4JI4Q 4POGA 4OONA 5M3MH 4LFBQ 2ZTDA 3GD7A 4JBKA 1P16A 2Q2TA 4LF4L 1X54A 3KDFA 1LUZA 4LUVA 1N34Q 3J80c 4BY7H 2JA8H 2F3IA 3U4VA 2VL6A 2YV5A 4DR4L 1XMOL 1N33Q 1E3PA 1PH7A 2JA6G 4A3GG 1TWGH 4R4IA 4OO1G 3CAMA 2ES2A 1MIUA 1BBUA 4YWKA 2AMCB 4BA1I 2JA8G 3I4NG 4OWXB 1SE8A 1X3FA 4C3IH 2A8VA 3HOYG 3M9BA 2KCMA 1EYGA 3UDXA 3I2ZA 2WP8J 1T9HA 3STBD 4X62L 3S2HH 5BR8Q 3F2CA 2ZM6L 2H5XA 3K7AH 4A3IH 1FVIA 3NELA 4UPAA 3S1NH 3E0EA 2PQAB 4R4TA 1KD1C 3CCEA 3PUVA 1Q8KA 5ELNA 3UDFA 4OXPA 3JAMi 4JOIC 1A0IA 4L5QA 5GAGC 4DV3Q 3AFPA 4NXMQ 3E9HA 4FDBA 4IPHA 4LWCA 4JI5Q 4NXNQ 2JEBI 5JJIA 2Y0SE 4JV5Q 3CCMA 4DV4L 1FL0A 2JA7G 4WJ3M 3GTLH 3TS2A 2K5HA 4LUOA 3CCLA 3GDEA 1I6HH 3TS0A 3GTOH 1N32L 4JC0A 2RHQB 2VQEQ 4DR2L 3AEVA 1VQPA 1Q82C 5M3MG 4GS3A 4C3HH 1X55A 4A3FG 4UP7A 2VQEL 3KDFB 5FLMH 4A3CH 1L2FA 2E8GA 1MJEA 2ZM6Q 3DM3A 1XNRQ 3S1MH 2UU9L 4QQBX 1XJVA 4JI0L 1NE3A 2ID0A 1N9WA 4IJLA 2JA6H 4LW1A 2D0OA 3CCUA 4IOCA 2UXDL 1CSPA 2C35B 3G4SA 2D0PA 4NXNL 4AYBG 4KI0A 2EQSA 1A62A 2E2IH 1QVFA 3JC66 2HQLA 1K8AC 1KL9A 5C44H 2OQKA 4C3JH 1ASYA 3F8TA 3CW2C 4EX5A 2UUCL 4JI3L 4PG3A 4POFA 3A5ZB 3HFZB 5BR8L 3OTOQ 1HR0W 3ULPA 2BH2A 4PMWA 2EXDA 3H3VI 1Q1BA 1VQ4A 1YIJA 1VQGA 4XTCS 1IBLL 4B3RL 2GVAA 1GM5A 4DR3Q 1EUJA 4X66L 5E7NA 5C0XJ 4LFCL 2VQFQ 3KF6A 2Z6KC 5DLQE 3HOXG 3UE1A 2R92G 1G51A 4HIMA 1CKOA 1WCMH 2UXBL 4GN3B 4LFCQ 4QL5A 1HNZQ 1XNQL 2KHIA 2N78A 1L1OA 4B3ML 4A3LG 1D7QA 1NMFA 1K0RA 1BKBA 4BXXH 1X65A 4LF4Q 3Q8DA 4DAYB 4X65Q 1N8RC 1KRSA 3I55A 4AH6A 4LF7L 3DLLA 3FKIG 1IBLQ 5M3FG 4LF8Q 2HHHQ 2B3GA 3STBC 1M90C 2HT1A 4LFAQ 4QGUA 5ELOA 5IYCG 4BBRG 2UUCQ 1V43A 1SFOH 1HR0Q 1VQJA 3F1ZA 5LMNL 3IRBA 5J3BA 2UUAL 3H3VH 3TRZA 4DR6L 5GQOA 3A5UA 1L1OC 5IYCH 1WYDA 2F4VL 1LTLA 2NVYH 3BU2A 4A3KG 1BVSA 3KF8B 1Q12A 4P72A 4O0AA 5IE8A 4DR2Q 3RNUA 1SN8A 3OW2A 4JBMA 1YITA 1JE5A 1Y1WG 4UY8C 1FGUA 3GTGH 3S1QH 3ZJYC 4B3SL 1SRUA 3J81j 1AH9A 1X3GA 2DGYA 3L7ZC 4MNOA 3F2BA 1VQFA 1CKMA 3FP9A 4JCVE 4A3JH 1QZGA 3HOZG 1W3SA 4HJ5A 4DV6L 2WFWA 2ZJRA 4A75A 1PH2A 4NXML 2PI2A 3GTKH 2V1CC 1YHQA 1IBKQ 2NN6G 2ATWA 2IHEA 5LMNW 1VQKA 4GKKL 2PMZE 3H0GG 3HOZH 4X6AH 2ALYB 2BA1A 1KIXA 4ALPA 2WB1G 2R92H 3S2DH 1YNXA 1CKNB 1O7IA 2UUBL 4KHPL 2IHFA 4P73A 4X62Q 4JBJA 5C0XI 1VQEA 1X56A 3AQQA 3KFUA 3NBHB 3NENA 1IBMQ 3CC4A 1HZ9A 4IJHA 4GOPA 1IBKL 2KBNA
chains in the Genus database with same CATH superfamily
4CHTB 4RGNA 3S2HB 2MFIA 4DK0A 2KECA 1I4RA 2NTSA 1TWHB 1WTHA 2RKSA 1EQQA 3LWUA 3SK5A 3ER0A 5C3EG 3Q23A 2D9UA 5EBDA 1SNQA 1U0LA 4DR4Q 3HGBA 2L55A 2BE5D 3BG3A 4JI4L 4IO9A 1K8GA 1F2LA 3FHWA 3EIVA 4RCOA 2CHBD 2EYHA 1YJWA 2UXBQ 2CH4A 1QUQA 1ZYRD 2E2IB 4ZCKA 3W2DA 1N36Q 2Z4IA 5FO9B 1DD2A 1JB7A 1Y8OB 2G5DA 2Z8LA 3K8AA 4XIGS 4QUFA 5I2YA 2EVBA 2PNHA 4UDUC 1B1ZA 4JI2L 2HDLA 1YHAA 4HR7B 2XWBB 5IOCA 3UDIA 2JN4A 3HOVG 4X3UA 1PZID 1GHKA 3RR5A 2XNAC 2EYPA 3A7AB 5C4HA 4HTHA 4JI5L 1D6EC 3GQBA 3F2DA 1X6OA 3UDGA 3J7AF 5CYUA 5ELBA 1YJNA 2QF7A 2I5HA 4OIJA 1B4OA 4IZ8A 1NAPA 1Z6HA 1HZCA 1YJ9A 2PI2E 2ICEC 3K0YA 5E4WC 2AWOA 1HNWQ 3OPOA 2JK8A 5KEEA 2WINB 4A3EH 5IP9H 2K14A 1SJED 5CV5A 3S24A 3L0OA 1STNA 1JC7A 5BN3A 2JE6I 2EE1A 1BCPC 2PYKA 2B63G 3UE0A 1N32Q 1QVCA 5AJ3L 2EYMA 5JJKA 3S2DB 1QE6A 3PUZA 1Y8PB 1BR9A 1B9MA 3HOUB 3HOVH 1PVOA 1VQCA 4A3BH 2BH8A 4R4OA 1HNWL 4HMIA 2EJFC 2B2YC 4GLVB 3G6JB 2K4KA 3TEHB 5IT9c 3GTQH 2R61A 2NTTA 3MEFA 1O7YA 1OXSC 5K36H 1UWVA 4KK7A 4DNIA 2NUCA 1RJTA 3DEPA 2E74C 1GUNA 4G7OC 3M3YB 2Z9HA 3RZOB 4G7ZC 4PNYA 4XYQA 3H15A 4JI3Q 1EFWA 4C2MH 3Q0AA 2NVXB 1QVGA 5FK9C 2KENA 3T1YL 2EOTA 1HFGA 1AFPA 2F1MA 3LNNA 2ZTCA 1ET6A 2K33A 1G6PA 1K3BC 4YCWA 3D0FA 3S1NB 5IY0A 2UXDQ 3BVZA 1FNWA 1SE3A 3D8GA 1WCMB 3J81c 1QNUA 3AYHB 4DXFA 1CA5A 4YCVA 1PH5A 3K7UC 1I6VC 1NY4A 1K73C 3BVGA 3A8IE 4JI1L 2I07B 1KRTA 1VS0A 4IFDI 2RDHA 1J6QA 1JWUD 4FXKC 2VUMH 1YNJC 1VQ9A 3MFGA 2CQAA 4GKJL 3OMCA 3M4OB 3CQZB 3CRLC 2F0WA 2KA7A 2I0QA 2CWAA 2F0IA 2AQ3B 4OIKA 1VQMA 1DOMA 1VMPA 3TDQA 2ENBA 3G48A 1FYCA 3TZDA 3HOXH 5COYA 2VY3A 4ME5A 1H9KA 1XYIA 1E7ZA 4LK1C 3S16B 4JI1Q 4DV3L 2CQOA 3NBIA 1H9SA 3WOFA 1KHIA 4YY3Q 5CV9A 1EZ8A 3D4WA 2WIIB 4LF6Q 3FEWX 3RN2A 3QB3A 3J7AV 1X3QA 1XPOA 4QMGA 5ELDA 1K0SA 3LGJA 1PRTB 3DUZA 1R4PB 1LTRD 3AFQA 4QY7A 4HJAA 1V1OA 2UUAQ 1PTOF 3PSIA 1D5XC 1JWMD 2NVTB 1I3QH 1DM0B 1QJOA 4KLKA 5I6YA 4DK6C 5T1IA 3CCQA 5EPKA 5AFWA 3S15H 1CM9A 2F0QA 3TP7A 1TWFH 2MHVA 3TREA 4IQZA 4S3SA 2N55A 1STYA 2K50A 1HNZL 4CDCC 3SGIA 1VF5C 2MP1A 3J80L 4DA2A 2HIVA 3NWTA 3E9IA 1PYWD 2IPKD 2L5TA 3NK9A 1F9RA 1CQFA 4DR7Q 2BOSA 3CC7A 4DF7A 3C2PA 1IYJB 1G2SA 2I5LX 4DV5Q 1KTKA 2F0GA 4BY1H 4NKLA 1XPRA 2FXQA 4OGQC 3HP3A 1BO0A 4FF2A 4C3JB 1L0WA 1LLRD 5JOBA 2FJ2A 2QDBA 4RMFA 3U9SA 1WTOA 4A3FB 3GTJB 3E5SA 2A19A 3I8ZA 5J22A 3T1HQ 1I5FA 2JJQA 4JV5L 1TQOA 1WOCA 4CKEA 4IUQA 4L63B 1G6ZA 1LTTD 4YCUA 3U9OA 1CI3M 1EWHA 2HIXA 3TP5A 1CKNA 2CFMA 2Z6BA 3V2TA 5EQ0A 4DK3C 2QGQA 1RIPA 1EZ6A 2X69A 3KOJA 3VR6A 1H95A 3I90A 4PMBA 4Y52H 3MXPA 1V1PA 3H0GH 1EYAA 3OTOL 5C4ZA 4DAPA 2F0DA 3LWEA 4K0KQ 4DV1Q 1AZQA 4R1JA 1O80A 1VQOA 2EIFA 3BYTB 3MFYA 4POGA 3TZUA 4X3KA 1A6XA 4JBKA 3GD7A 1LABA 1I50B 1LUZA 2F3IA 2VL6A 2A68C 2L9HA 4A3GG 1TWGH 5D14A 1IKMA 1I3QB 1MIUA 3ITPA 2F03A 1CFMA 1SE8A 4PQXA 2A8VA 2KCMA 2BDNA 1TY2A 3TN2A 4UAIA 2ZM6L 2VUMB 4UPAA 3S1NH 1C4QA 1SNMA 2PQAB 1KD1C 1Q8KA 4OXPA 4L5QA 1A0IA 3AFPA 2JEBI 4DV4L 4N9PA 4CJ1B 3FRPB 4LUOA 5JVG3 3GDEA 2A5HA 2B8FA 3HEJA 4ODGA 3RUZA 1QWYA 3SE0A 1N32L 2RHQB 2IJ0A 1AZPA 2ZXRA 2VQEQ 5KNCA 2OF1A 1STBA 2EJGC 4K5XA 2VQEL 4KJNA 3KDFB 1L2FA 2ZM6Q 1XNRQ 2UU9L 4QQBX 1XJVA 1CHPD 1NE3A 3D6CA 4ZUJA 1YNJD 1SJHD 2G9DA 2E2IH 1PTOD 1S5ED 5G3LF 2HQLA 3PIP3 3QG1A 1FGBD 1KL9A 3SEBA 1JOQA 3DWAA 3OHXC 5BR8L 1K28A 4ZK9B 2WV6D 1HR0W 1LTBD 4KTAA 1EY8A 5EPLA 1YIJA 2XWJB 4XTCS 1EY0A 3K59A 2K5QA 1EUJA 2L0CA 5DLQE 3HOXG 1CKOA 4GN3B 4LFCQ 4A3LG 1TKWB 1NMFA 3Q6SA 1K0RA 1BKBA 4BXXH 2Y0SB 2WAQB 1N8RC 4I7ZC 4AH6A 2HT1A 2B3GA 3STBC 1M90C 4K6DA 3S15B 5ELOA 2UUCQ 1V43A 1SFOH 2UUAL 1VQJA 3F1ZA 5KNBA 5J3BA 3D4DA 4A3GB 1L1OC 2PNRC 1LT6D 1UUPA 4IUTA 1JORA 2JA8B 1VDZA 2E76C 3P75A 4RGTA 1AP0A 5JPMC 5DNFA 1TS4A 4DR2Q 1Y1WG 3GTGH 3HOYB 3ZJYC 3J81j 1WTRA 2B8GA 3L7ZC 4MNOA 5CMDA 1QG7A 4JCVE 4A3JH 1PMRA 2QKIC 4DV6L 3NXWA 1DONA 1XX8A 3H0GG 3TMEA 1DZ1A 1MHWC 5FOBB 3S2DH 4OELB 1YNXA 2UUBL 2A73B 4CDDC 3AMUA 4WORA 2A6HC 1IBMQ 3MC0B 4IJHA 2KBNA 3Q22A 4BBSH 3DXJC 1Q86C 2LFNA 1YEZA 4UHVA 4MZ9A 4AYBB 3HOWG 4KV6A 2IX3A 5IIFA 4P71A 3GTPB 1FNUA 1PZKD 2GVBA 3A8KE 2F4VQ 1PH6A 1GUWA 1F9PA 2K1BA 3WWVA 4FF3A 4GZYC 3A7LA 1KABA 1HFNA 5GAHC 3EQLC 2K5WA 3W1GA 2K05A 2ASBA 1VQBA 2HDMA 1SE4A 1AE2A 1RODA 4CDEC 3OWEB 4K5VA 3RZOH 5C3EH 1HJPA 1XTDA 3KYHC 1S5BD 4X66Q 3FPUB 3T51B 3I4NH 2BCOA 4K8IA 4BBRB 2X6LA 1U4PA 2EXZA 1KLGD 2R7ZG 3T4AC 1LT3D 2PW7A 2EY2A 3CQZH 4UP9A 2R93B 3TQYA 1H9MA 4QF4A 4A93H 5KIXA 4DV4Q 4OX9Q 1GUTA 2BDOA 3NBHA 5I9PA 2K5VA 2B2WC 3N6RA 3I72A 4TVAB 2KQ3A 1PV4A 3G71A 2RCNA 1U9RA 5ELFA 3S16H 5AJ3Q 4RHRA 1LT4D 1V1QA 3I4MH 2I5MX 2LKVA 4L5SA 2BA0A 3PIO3 2VZAA 4XQQA 3T13A 3S1QB 4WJWA 2KHSA 4R8NA 1VQHA 5DAUA 4DV0L 1HRJA 3PF5A 4OWTB 4B3SQ 1HQRD 4C3HB 3QWNA 3GTKB 1B2TA 1PH9A 4C56C 3SK8A 2Q2IA 1E24A 1XMQL 1KLUD 5GROA 1NBWA 1WVLA 5H1SE 4A93G 3O13A 2CVRA 2ZT9C 3CD6A 5IP7H 4A3DB 4R4QA 4FF4A 2IWHA 1TS5A 3DEOA 2YTYA 1EWIA 5IWAQ 3G7LA 1VQNA 2E2HH 4LF9Q 5C6AA 1LTGD 4B9XA 1K83H 3RLOA 4B9WA 4JI7L 1BBWA 4GOPC 1FR3A 3I73A 1VQIA 5T1GA 3W3AA 5CGKA 2XTIA 3GV3A 1YI2A 3QJYA 1O78A 1X32A 2SOBA 2F3VA 2XGTA 2ICIA 3K0XA 2I46A 5M3FH 5KYLA 3WOEA 1KNEA 3JAMc 4A76A 5C4XG 1Y69U 2R6GA 1Q81C 1PFBA 4A3GH 1YNND 1Q46A 1B3QA 3CC2A 2JA5H 1K3RA 4XQJA 1D5MC 2K5DA 3M85A 3VR3A 1B70B 4BXXG 3HOYH 1E1OA 2B2WA 1LO5D 4R4CA 3ULJA 1C9OA 1YZ6A 1F9SA 3A54A 1I94Q 3PO3H 4DR1L 1TWAH 3VA7A 4BY7G 4K6LA 3LX0A 2Q8RE 4DNRB 1EIYB 1M4VA 2AQ1B 1R9TB 5LL6S 4JI8L 3MVVA 1AEXA 1H9JA 5G3LD 4HJ7A 1STAA 3CF5A 1UE6A 1KXLA 1JOKA 3P7JA 2EY6A 3NTKA 1Y8NB 1RTOA 4TQUS 2HD3A 1OXTA 5IODA 1SLJA 4KY6A 5JJLA 3EBEA 4KY7A 1RF2D 1JCKB 1JQYD 4LNQA 1CUKA 4GLAC 2YTXA 3CMAA 1J9OA 3D3RA 4A3DG 3MZ5A 1EEFD 2LXKA 1K9MC 4N9TA 4JBWA 5JEAJ 1JMCA 2JXMB 3PO3G 2OQ0A 3KJOA 3CHBD 4XXEA 3OW7A 4GKKQ 1F2MA 1A2TA 1ICFB 2JA9A 2RSOA 1S5DD 3I56A 4A3IB 2IT1A 2RQXA 4X64Q 4DGZA 3I3CA 1HR0L 4L6TB 3GTMB 3PQIA 4DR3L 4DAMA 2D5DA 4K2LA 1TXYA 3PIOA 3J7A5 1HPCA 4BS9A 5CBEE 3P20A 5CV8A 2M2LA 3ICEA 4FVMA 5LMUQ 1MGSA 4C1NI 1FJGQ 1U4MA 1PLFA 1L1OB 3RLFA 2DUDA 4EQ5A 1ZXTA 2NN6H 4FNFA 1NR2A 2H4OA 1BQQT 4I7AA 5JEAH 2CKZB 1C0AA 4B08A 4J6HA 4IURA 1XPUA 3I4NB 2J0TD 1SMXA 3BDCA 2B29A 1XTCD 4GKJQ 3KUPA 1BNZA 2Z0SA 1M1KC 1P8LA 1TWHH 1A2UA 2GN5A 1Y1VB 3M4OH 4QIWB 2F0TA 3MXUA 5FJ8H 4ME3A 1B7YB 2ZXPA 1RTNA 4N8X1 2SEBD 2K52A 1VCIA 4X3TA 3L3OC 4KHPQ 4NB3A 3P1HA 5ELCA 1UEBA 1OXXK 5C5MA 5CV4A 1DGSA 1EY4A 4O2DA 3VYRA 4YWLA 1VQAA 4IPDA 3ONAB 1VQ5A 3I4MG 4I65A 3CKIB 1C7YA 2R7ZH 3SVMA 3X3NA 1LTSD 2F0OA 1PH3A 4HEDA 1Q7YC 4ZYSA 4DV6Q 3D31A 3H94A 1UE7A 5I9OA 4A3IG 3I7FA 1N34L 4IOAA 1EQRA 1II3A 4ZKBB 4NMZA 5IYDG 2F0HA 4JG2A 2B2VA 4A3KH 4EQOA 4CJ2C 1AW7A 1D5ZC 2ZTEA 3BZDB 2R92B 4DKAC 4DUZL 4HMJA 1GD7A 3FPPA 3PIPA 4NDXA 3CPFA 1WFQA 1HUMA 4OONA 4R9WA 4LFBQ 2ZTDA 3VYSA 1P16A 1QOHA 1TS2A 3FVQA 5C3XA 3J80c 2JA8H 3U4VA 1XMOL 1N33Q 1F2YA 1BCPD 2AMCB 4MTKA 4RGOS 3R8BA 3L9AX 3M9BA 1EYGA 5CORA 4X62L 2WP8J 3STBD 4A3JB 5BR8Q 4LMQD 3KLRA 3F2CA 3NELA 3I91A 5EKLA 5LL6X 3QOLA 3CCEA 3H6MA 5ELNA 3UDFA 1KDCA 3JAMi 5GAGC 3S17H 4NXNQ 3E9HA 4IPHA 4LWCA 4JI5Q 2Y0SE 1ENFA 3TS2A 2K5HA 3GTOH 1WTQA 1VQPA 1Q82C 1BF4A 4GS3A 1X55A 4UP7A 1HTLD 2E8GA 4IJLA 3S17B 4LW1A 3CCUA 4U673 2C35B 1SYBA 2D0PA 2B2TA 4AYBG 1HTPA 2EQSA 3JC66 3HOWB 1Q8IA 1Z7TA 3GTOB 2OQKA 1ASYA 3F8TA 5J39A 4JI3L 3HFZB 1DXMA 3OTOQ 1NSNS 1PRTC 1GOZA 4ULLA 1IBLL 1VQGA 4B3RL 2E75C 1GM5A 4DR3Q 2D2CC 5IGBA 5E7NA 5EKIA 4DXGA 5IGFA 4EQPA 2DN8A 1G51A 1MSHA 1LV9A 1U4LA 2KHIA 1L1OA 1D7QA 5FLXL 1SMYC 3RMHA 3DLLA 4LF8Q 4LFAQ 5FO8B 4QGUA 2LS01 3KBGA 4E6IA 5LMNL 1SNOA 4MN3A 1I4HA 1V1PB 4KD4A 5IYCH 1Q3LA 2NVYH 3BU2A 3NE5B 3KF8A 1Q12A 4P72A 3RNUA 1SN8A 2B2UA 2QDLA 1HCZA 4B3SL 1X3GA 2R3ZA 2DGYA 2OXPA 3VR4A 3NUCA 1CKMA 4HJ5A 2WFWA 3GTKH 1IBKQ 1EU3A 2NN6G 5I4DA 1SNCA 5C3WA 5LMNW 4GKKL 3C46A 2PMZE 3TBIB 4ALPA 1KDBA 3HZXA 2VXWA 2BE5C 1O7IA 2MPMA 4X62Q 4JBJA 4XQNA 1SYDA 4XYOA 3AQQA 3NBHB 3CC4A 1HZ9A 2RDFA 1I6HB 4GOPA 4CBVA 5C5LA 3T53B 1IW7D 5M5WH 1HH2P 1HZAA 3QR8A 2B2TC 2JEAI 1EY9A 1V8QA 4LFBL 1EYCA 5LHY1 3M3YH 4A93B 2J4XA 1HA5A 4ZUIA 3PGZA 2K7VA 1WTVA 1A3TA 3V05A 5A2QE 1KQSA 4KD3A 1SYGA 1F9QA 3DWQA 5EJWA 5C0XH 4L5RC 4BA2I 2X6GA 5M5WB 5IT9L 4H02A 4IUVA 5JVH3 2PW5A 1YHBA 1LTID 2DJFC 1X9NA 4EGVA 1SXTA 3L2PA 1ET9A 3VYTA 2E5LL 3MXGA 2M00A 4RG1A 3VR2A 4TKOB 2AKWB 3A0JA 5M3FB 2EDGA 3S14B 4FXGC 2PZTA 3AU7A 1N36L 1VQ8A 3TP8A 3D6WA 2VB2X 4H0LC 1VQ7A 3PF4A 3U58A 1TWFB 1CHQD 2B2UC 3BZKA 4DUZQ 2PPBC 4IFDJ 3K81C 4HCSA 2B2YA 4ZLTF 4GNXC 1D1KA 1ESRA 3M4YA 2F0JA 2TMPA 3W1BA 1S5FD 3CPWA 2JYOA 1WCMG 2AUKA 4H13C 5M9OA 3MXNB 2Q2UA 1J8IA 2ZXOA 4BY1B 3GO5A 1I4PA 1Y1WH 4YY3L 3KLSX 3HKSA 2F4IA 4JVZA 3I4OA 1Z9FA 2CWPA 1E2ZA 1LYLA 1W6JA 1WJJA 2C9OA 1PH8A 4BY7B 3GTJH 2WB1B 3T1HL 1PH4A 3J80i 4A3EG 4JI0Q 5M5YB 2F0VA 4A3BG 2F0KA 1GVPA 4MHEA 1C8CA 4DR7L 1PTOH 1J5EL 5CV6A 4V0BA 2QA4A 3S1RH 4BBRH 5E1FA 4IFDG 5ELEA 3CXCA 2UUBQ 2YU9B 4DFAA 5IP7G 5D3IB 2K5NA 2O4XA 5IGCA 5TSSA 2Z4HA 3GTGB 1ENCA 3T1YQ 1N33L 3HOWH 1O7ZA 2KHJA 2O5JC 1VF7A 3CRKC 3PO3B 2J7ZA 2OTJA 2R7DA 1SE2A 2NVQB 2RA4A 4WRDA 2ZJPA 4BBSG 5KNDA 2OCEA 2RHSB 2JP1A 1I50H 4HIDA 2OT2A 2HUGA 3ND8A 4AYBE 4DR6Q 4CJ0B 3AB9A 2N3SA 2NN6I 2HHHL 3M4QA 1BCPF 2R7FA 3UI2A 4A3CG 3J81E 5FKAC 4A3MH 2G9HD 2QCPX 2EY5A 3GP7A 4GNXA 1SROA 1K8OA 3R2TA 3K5MA 2R93G 2E2JB 3W5OA 4DV7Q 1PFNA 5HURA 5ISRA 2N88A 4A4IA 4BY1G 4HIOA 1SR3A 3A8JE 1VQ6A 5HGTA 5D3DA 2PZWA 1KAWA 2MQHA 3RZDB 2B63H 2IX1A 4F8MA 2KOLA 4OEMB 2Q2HA 3NQIA 2E2HB 2K28A 3K7AB 4HJ8A 1E0BA 3SHLA 1KAAA 1JJCB 4YHHL 1CT1D 4LF6L 1TR5A 3GTMH 1A8VA 2UU9Q 1JB3A 3VR5A 4L5TA 2AUJD 1RKNA 5EKKA 4XDXA 3IFTA 3RZDH 4LUZA 2B63B 2YYZA 3NHHA 2EYJA 3PUXA 2XRQD 1SYEA 4OL7A 1E2WA 1Y14B 2XVSA 4DV2L 4K14A 1UNSA 2VS1A 2EYFA 4NP5A 5EBCA 3IL8A 1TWCB 5LMNQ 1B8AA 1JJGA 4Y7NH 1RHPA 3U50C 5C4JB 4RFBA 4OHJA 2NZOA 3WDNA 2RF4A 1TY0A 1CZGA 2KCCA 4AQYL 4KN7C 1D1IA 1Y1VH 1XXGA 1VQDA 1KDAA 2KEEA 4ZRZA 2E2DC 4OWWB 2EJMA 4AQYQ 3ERSX 1XNQQ 1QILA 4JI7Q 3S14H 5C4XB 2A74C 4PZ7A 3EFXD 1PH1A 5IWAL 3OIPA 5JEAG 2EPBA 1UE1A 3SXHA 2F0PA 1EIFA 1HA6A 1ASZA 1A3UA 2JA5G 1XNRL 2JA6B 3M7NA 5FLXE 1WTPA 4QIWE 2XSCA 2K01A 4FXDA 1VMCA 3I4LA 2NVXH 2K04A 3CCSA 4QB4A 4A3JG 3MAQA 1G291 4DV5L 2VUMG 5HY6A 4XT1B 1RL2A 3J7ZC 3VA5A 1RD9D 3PO2G 1FNVA 5IT9E 1SNPA 2ZJQA 1IXRA 3OWFA 5CV7A 2JA7B 2F0NA 4ZKCB 2KCNA 3BJUA 1I4QA 3HKZG 4QUCA 2VW9A 3S1RB 5FLMG 3IFDA 1JICA 1I4GA 5DEHA 3NWSA 4JYAQ 4IN3A 2XN9C 1YBYA 1W2BA 3R2IA 3J7YW 2IL8A 3OYYA 1LM0A 3OSOA 1UEAB 1O7LA 1WI5A 1SSOA 2UXCQ 1TS3A 4F7XA 3KF6B 1BDOA 2Q8IB 3IKJA 4HCEA 2VQFL 2UXBL 2YU9H 4K0KL 2NZHA 4QJFA 4KKUA 2RCFA 1PYBA 2AWNA 4U68A 1TVXA 2SNSA 5FJ8G 3PCOB 3MA2B 2Z1CA 3D4RA 5BN5A 4F87A 4GN4B 3J81L 2GA4B 2Z6KA 5A2QL 1S72A 1MKHA 2CW0C 2AQ2B 2WAQG 2Y0SG 3FKIB 2Q2TA 1X54A 3C1EA 3KDFA 4LUVA 3OOCA 3BDLA 4EVOA 1ENAA 2YV5A 4Z9CB 4CKBA 2JA6G 1E3PA 1PH7A 4OO1G 4R4IA 4ABNA 4YWKA 3I4NG 4BA1I 2EYLA 3DHQA 4C3IH 1Q90A 3I2ZA 2FHTA 1T9HA 3JAME 3SDZA 1EY5A 4K2KA 4CKCA 4A3IH 3K7AH 1BBXC 1FVIA 3E0EA 4R4TA 3BDOA 1PTOC 5DM73 3PUVA 4JOIC 2WACA 4DV3Q 1ONLA 4K5WA 5I6WA 5JJIA 1EU4A 1FL0A 1JOOA 3GTLH 3CCLA 4JC0A 4DR2L 3AEVA 4C3HH 4FP5D 4A3CH 1NR4A 1WD0A 1SDFA 2ID0A 1N9WA 2D0OA 2UXDL 5NUCA 3G4SA 4FO2A 3I70A 1FD7D 1QVFA 2K6AA 3ND9A 1K8AC 2M9VA 3CW2C 2UUCL 3RD4A 1WTXA 1IYUA 1ZYRC 4RA8A 2BH2A 4PMWA 3H3VI 4MIUA 1U4RA 4X66L 5CC4A 1STEA 5C0XJ 4LFCL 2VQFQ 2Z6KC 2R92G 3UE1A 1C48A 2QILA 2QEJC 3NTIA 1HNZQ 1XNQL 2N78A 2NZ1D 3K5LA 1A15A 3TSSA 4LF4Q 1ILQA 3Q8DA 4K8JA 4DAYB 4X65Q 4LF7L 3VYUA 3I55A 1G91A 1IBLQ 5M3FG 2A6EC 2V4DA 2A6ED 1T5XD 4LAAA 4BBRG 1TWAB 1G2TA 3QOJA 3TRZA 1QNKA 3A5UA 2R7ZB 2RBMA 1A3VA 4KKSA 1EFID 1LTLA 2KVMA 4A3KG 3FMCA 4JBMA 4O0AA 5IE8A 1QB5D 3OW2A 1YITA 3HOVB 3S1QH 2C5CA 1AH9A 1IYVA 1VQFA 3NSWA 4JK1C 1W3SA 1PH2A 4NXML 2V1CC 2ATWA 2IHEA 1VQKA 2RDGA 2A69D 3HOZH 2HQEA 5A35A 1SNDA 4OO1H 4HAEA 2WB1G 2R92H 4IUNA 4Q5VA 4A3EB 2HCIA 4M1UB 2PZUA 4P73A 4KJOA 5C0XI 1X56A 3NENA 2OWOA 3OIQA 1IBKL 5M3MB 1L0XB 3TP6A 1WTWA 1MSGA 3GTQB 3EJIA 1A63A 4DU9A 1PRTD 5CBAE 4LF8L 3NEMA 2VNUD 1HXYD 4V190 1S5CD 4G4KA 3K80C 1B53A 1TIID 3EROA 1I94L 2F0MA 4JI6L 2K03A 1CTMA 1K8MA 1PDQA 4DV1L 5EGTA 4DUYQ 5M5XB 3G6EA 2KCTA 2DNEA 2WB1E 4EQNA 5L37A 4IUUA 1E1TA 4HIKA 2F0FA 3Q24A 1D8LA 5LMUL 2VB3X 2SNMA 4APVA 3K57A 4RKLA 2L15A 2CW0D 1G8ZD 4ILWA 4ZQ3A 1NUCA 3E0JA 3QO2A 3R93A 1JWSD 3E3XA 3NTHA 1JJ2A 5C44B 4YWMA 2LY7A 5HGQA 2A68D 1IKLA 4KMUC 4X64L 1GUGA 2JSOA 4RAUC 4DR5Q 4DV2Q 5JAVA 5I2XA 3IAYA 1QZHA 2CH4W 1E2VA 4B3RQ 5E4XA 5IP9G 4M8AA 3ERQA 1PYSB 4AIMA 1DYQA 1VQLA 2LSSA 1Z47A 2IX0A 4FYDA 1EL0A 4OO1I 1ICWA 2NVQH 1D2BA 1STGA 3HG9A 3PUWA 1EEID 2N8NA 4IPCA 1JE4A 3EN2A 4RWSC 1NNXA 1NCVA 4X3SA 4KKTA 4DV0Q 2EZVA 4CDFC 1EOVA 4QCLA 3A74A 1CQVA 1XMQQ 2F52A 1PRTF 3CMEA 3MEHA 4YHHQ 1IL2A 2LXJA 1OXVA 1ZEQX 5E3FA 4ZAIA 4A3MG 2XIWA 2CCZA 5KGUA 3A56A 3KLWA 2WAQE 1I6HH 2QW7A 2EY1A 1TWCH 1ESFA 4MTNA 2PQAA 1TT2A 3GTLB 2QEXA 4P74A 5IGGA 5DM63 1U5KA 4IUPA 2FFKB 1GHJA 2PMZB 1HNXL 4LF5Q 3JAML 1CA6A 4H7BA 5IGDA 5C0XG 1B50A 2SDFA 3K5NA 3KLSA 5M5YH 1HNXQ 4LF5L 4OX9L 1DOLA 1I4XA 3RLNA 1F2ZA 1MJCA 5F2DA 4A3LH 5C44G 1GUSA 3K5OA 5JPNC 1SBBB 5C4XH 2JA7H 3EVQA 4C3IG 5BN4A 5M5XH 4IFDH 1GKHA 4N8FA 5IYDH 1SFOB 2PQEA 4IPGA 4HSVA 3U4ZA 3N52A 3A55A 3S9WA 1XWEA 4IALA 1CK1A 3EA6A 5KRUA 4JW0A 3QIAA 1V9PA 1DOKA 1CSQA 2RSNA 2AHOB 3BS1A 4JPBW 2JQOA 4B3TL 3T16A 1NTGA 4HSPA 3H91A 1S40A 4RCNA 1Y1VG 3PO2B 2R93H 3ULLA 1J5EQ 2DY8A 4J1MA 1IBML 3K6OA 1NMGA 4NW2A 2NWGA 4DN4M 3NPPA 2K75A 1PTOB 4C2MB 3KBXA 4C3HG 4PZ6A 3X3MA 4A3MB 3KJPA 1OTCA 4O1NA 3BVMA 2EYOA 4DAVA 3CP0A 1DJRD 1F77A 1TU2B 4P75A 3RN5A 3S1MB 1S3OA 2E2JH 1OXUA 1KNAA 1BXTA 4G7HC 4UP8A 1R9TH 2O2LD 3HOUG 1SMYD 2L4NA 2PO4A 3I4MB 2H1EA 3K58A 5GADC 2RVLA 2Q8TA 2KJXA 2N49A 2IY5B 3VDYA 1EY6A 1FJGL 4B3TQ 2D62A 4KN4C 1Q1EA 4BBSB 1ZKOA 4B3MQ 1IZ6A 2WKCA 4R8IA 2FINB 4KHZA 1JT8A 1AE3A 3H09A 4TRDA 3M7GA 3GTPH 4DUYL 4RKBA 3DWPA 1AN8A 4C3IB 2E5LQ 4JOIA 4O42A 4PV1C 4JI6Q 1PXUA 1QCBD 3E6ZX 1YVCA 4NPSA 5J1ZA 2L12A 2PCFB 2NB0A 4A3FH 3HKZE 4RHSA 1ML0D 4J15A 1HZBA 3HOUH 2NVYB 2F0LA 2WKDA 1GUOA 1PHJA 1UE5A 4WJ4A 5JJZA 5C4JH 4Y7NB 2UXCL 1GO3E 2B39A 4GOPB 4LJZC 2B2VC 2P5ZX 3V96A 5K36G 1NJIC 1E22A 4DR1Q 1LT5D 1KC8C 2NVTH 3MWYW 4JYAL 3PV0A 1RCVD 3B6YA 4JI8Q 2MNAA 2MO1A 4DV7L 1JR0D 2LMCB 3OMGA 1STHA 1SYFA 5KYIA 5IYBH 3FKIH 3SK4A 1PFMA 1PA6A 2MGSA 5FO7B 4F88A 4J8QA 1W6KA 4DR5L 3DMUA 4GNXB 1PZJD 2MO0A 5FLXc 3CCJA 1PFSA 5EAYA 3PO2H 3FDTA 3BZCA 4C1NK 4X65L 4LF7Q 2YTVA 1EOTA 3R3OA 1H9RA 4KHVA 1EYDA 4DPGA 4KY5A 4GN5A 3NQTA 4DAYA 3M4PA 1B9NA 2KEDA 2NYZD 2A1AA 1XMOQ 3J81i 1GXDC 1MD2D 5IYBG 4GLXA 5GAEC 4XT3B 1WD1A 4CGYB 4LFAL 2HCCA 1H9SB 1GJXA 1QUQB 4YIJA 4HJ9A 1B3AA 3MHBA 4JI2Q 3CCRA 4A3DH 3HOXB 1SYCA 3CCVA 2F0UA 1EIHA 1BOSA 1MI2A 3PUYA 2OTLA 4PZ8A 1IHZA 4H44C 1DCZA 3F2UA 4LF9L 1X3EA 4JI4Q 5M3MH 4LF4L 1EWCA 1K83B 4TSSA 5D65A 4Q0FA 2DJGC 3PMFA 1N34Q 4BY7H 4DNTB 5IGEA 4DR4L 2JA5B 2MUYA 4ID6A 1R4QB 3CAMA 4RGMA 4RH6A 2ES2A 2FMMA 4A3KB 1BBUA 2JA8G 2K32A 4OWXB 2O5IC 1X3FA 3DM1A 2DY7A 2L11A 1Y1WB 3HOYG 4L8JA 5EPJA 3UDXA 3S2HH 1T5EA 1SEBD 1OO9B 2H5XA 3HOZB 3MXNA 1MBYA 2XRSD 3H0GB 3C3LA 4NXMQ 4FDBA 2L1BA 4JV5Q 3CCMA 3HS0C 2JA7G 4WJ3M 1LTAD 1YNNC 1HQMC 3HKZB 3HRZC 4G57A 3TS0A 4C3JG 1EQTA 1HUNA 3ZYYX 1HHVA 1LACA 5M3MG 2F0SA 4A3FG 5FLMH 2A69C 1MJEA 1ILPA 3DM3A 3S1MH 4JI0L 1IL8A 2JA6H 4IOCA 3CU7A 1CSPA 4NXNL 4KI0A 1A62A 5C3EB 2A6HD 1X3PA 1BUVT 5C44H 4C3JH 1EY7A 4EX5A 4PG3A 4POFA 3A5ZB 1L0YB 2TSSA 3H3VC 4BWGB 3ULPA 2EXDA 3NP8A 1Q1BA 1VQ4A 2GVAA 4WFN3 3KF6A 1B44D 1UAPA 4HIMA 1WCMH 2DNCA 4QL5A 4B3ML 1S4ZA 1SAPA 2F3WA 2IW3A 1X65A 1KRSA 3T56B 2NBFA 3FKIG 2HHHQ 3KK7A 5IYCG 3J80E 2MJ8A 1HR0Q 3H3VH 3IRBA 4DR6L 5GQOA 4HN7A 1WYDA 2F4VL 1BCPB 1BVSA 3KF8B 3MTSA 1IW7C 1TWGB 2KUMA 5CR3A 4UY8C 1JE5A 1FGUA 1SRUA 2FMCA 3F2BA 4P2CB 4DK1A 3FP9A 1QZGA 3HOZG 4A75A 2ZJRA 1EQVA 3GV6A 2PI2A 1YHQA 1RDPD 1CZWA 3C1FA 1M8AA 2OEOA 4PMCA 2ALYB 2BA1A 4X6AH 1KIXA 3BYYB 5K5PA 1CKNB 3SK6A 4KHPL 1EIGA 2IHFA 4A3BB 1VQEA 3SR1A 3KFUA 2F0EA 4FF1A 3URYA
chains in the Genus database with same CATH topology
2MFIA 4BBSH 5M5WH 1HH2P 1HZAA 1A63A 1Q86C 1YEZA 4LF8L 3NEMA 2VNUD 1EQQA 2JEAI 4MZ9A 4LFBL 3ER0A 3K80C 5C3EG 3HOWG 1I94L 3M3YH 4P71A 4JI6L 2GVBA 2F4VQ 1U0LA 4DR4Q 1PH6A 3PGZA 3WWVA 4DV1L 4DUYQ 3G6EA 5GAHC 1KQSA 2KCTA 2WB1E 4JI4L 4IO9A 4L5RC 1K8GA 3FHWA 4BA2I 1E1TA 3EIVA 4HIKA 3W1GA 4H02A 1D8LA 2ASBA 1VQBA 1YHBA 5LMUL 1AE2A 1YJWA 2UXBQ 1X9NA 1QUQA 3L2PA 4APVA 2L15A 3RZOH 5C3EH 1HJPA 2E5LL 1XTDA 3KYHC 4X66Q 4RG1A 1N36Q 2AKWB 1JJ2A 4YWMA 3A0JA 3I4NH 5HGQA 1VQ8A 1N36L 1JB7A 4X64L 3K8AA 4DR5Q 2R7ZG 4XIGS 4DV2Q 2PNHA 1VQ7A 3PF4A 3U58A 3BZKA 1QZHA 4DUZQ 4IFDJ 3K81C 3CQZH 4GNXC 4JI2L 4UP9A 1YHAA 3TQYA 4B3RQ 3UDIA 3W1BA 3HOVG 3CPWA 4A93H 5IP9G 1WCMG 4DV4Q 1PYSB 3RR5A 3MXNB 4AIMA 1VQLA 2Q2UA 4OX9Q 4JI5L 3GO5A 1Y1WH 2LSSA 1Z47A 1X6OA 3F2DA 4YY3L 3UDGA 4K0KL 2IX0A 1YJNA 3HKSA 4OO1I 2K5VA 2I5HA 3I4OA 2NVQH 1HZCA 1YJ9A 2PI2E 4TVAB 3PUWA 2N8NA 4IPCA 1Z9FA 2CWPA 3G71A 1PV4A 1LYLA 2RCNA 1WJJA 1PH8A 3EN2A 3GTJH 3S16H 3T1HL 2AWOA 5AJ3Q 3J80i 1PH4A 1V1QA 4A3EG 4JI0Q 3I4MH 2I5MX 4L5SA 1HNWQ 4A3BG 2BA0A 4DV0Q 2VZAA 1GVPA 2JK8A 4A3EH 5IP9H 4DR7L 1EOVA 2K14A 1J5EL 3A74A 3S24A 3L0OA 1VQHA 2QA4A 3S1RH 1XMQQ 2F52A 4DV0L 3PF5A 2JE6I 4OWTB 4BBRH 4B3SQ 2B63G 3UE0A 3CMEA 4YHHQ 1IL2A 4IFDG 1QVCA 2LXJA 1OXVA 5AJ3L 3CXCA 4A3MG 1PH9A 2UUBQ 2CCZA 2Q2IA 3KLWA 2WAQE 5JJKA 1E24A 1XMQL 5GROA 5IP7G 3PUZA 1NBWA 1TWCH 2K5NA 5H1SE 4A93G 3HOVH 3CD6A 4MTNA 3T1YQ 5IP7H 2PQAA 1N33L 1PVOA 2QEXA 1VQCA 3HOWH 4A3BH 4P74A 2BH8A 4R4QA 2KHJA 4R4OA 1U5KA 1HNWL 4GLVB 2YTYA 1EWIA 5IWAQ 2K4KA 3TEHB 2R7DA 1VQNA 5IT9c 3GTQH 2E2HH 2OTJA 1HNXL 4LF5Q 4LF9Q 2ZJPA 4BBSG 2OCEA 2RHSB 5C0XG 3MEFA 1N32Q 1K83H 1OXSC 1I50H 3RLOA 1UWVA 4HIDA 4JI7L 4DNIA 1BBWA 4GOPC 5M5YH 4AYBE 1VQIA 1HNXQ 4LF5L 3RLNA 4OX9L 4DR6Q 2XTIA 1MJCA 1YI2A 4A3LH 2N3SA 2NN6I 5C44G 3H15A 2HHHL 3M4QA 4JI3Q 5C4XH 4C2MH 1EFWA 2JA7H 2R7FA 2XGTA 1QVGA 4A3CG 3K0XA 2KENA 3T1YL 4A3MH 5M3FH 5M5XH 1GKHA 4GNXA 1SROA 2ZTCA 3JAMc 4A76A 5C4XG 5IYDH 1G6PA 2R6GA 3D0FA 4YCWA 4IPGA 5IY0A 3U4ZA 1Q81C 1Q46A 4A3GH 2R93G 2UXDQ 3CC2A 2OWOA 2JA5H 1K3RA 3W5OA 3J81c 4DV7Q 3AYHB 4YCVA 3M85A 4A4IA 4BXXG 1B70B 4BY1G 1PH5A 3HOYH 3K7UC 1E1OA 4R4CA 3ULJA 4HIOA 1C9OA 1NY4A 1SR3A 1YZ6A 1VQ6A 1K73C 2B63H 1KAWA 2MQHA 2IX1A 1I94Q 3PO3H 1V9PA 4JI1L 1KRTA 1CSQA 1VS0A 2AHOB 4DR1L 2Q2HA 4IFDI 1J6QA 1TWAH 2JQOA 4B3TL 2VUMH 4HJ8A 1VQ9A 4BY7G 1EIYB 4GKJL 1JJCB 4YHHL 1NTGA 4LF6L 4JI8L 2I0QA 1A8VA 2CWAA 2UU9Q 3GTMH 4HJ7A 1S40A 2R93H 1Y1VG 3CF5A 1VQMA 3ULLA 4L5TA 1J5EQ 1UE6A 1KXLA 3G48A 1IBML 1NMGA 3HOXH 4TQUS 2K75A 1OXTA 2VY3A 3RZDH 4LUZA 2YYZA 1SLJA 4PZ6A 5JJLA 3KJPA 3EBEA 3PUXA 1OTCA 1E7ZA 3CP0A 4P75A 3RN5A 1Y14B 4LNQA 3S17H 4JI1Q 1CUKA 4GLAC 1S3OA 2YTXA 4DV3L 2CQOA 4DV2L 2E2JH 2VS1A 1OXUA 3HOUG 1R9TH 4UP8A 3CMAA 4A3DG 1KHIA 2LXKA 4YY3Q 5GADC 1B8AA 5LMNQ 1JJGA 1K9MC 4LF6Q 4JBWA 5JEAJ 1JMCA 2IY5B 2N49A 4Y7NH 3U50C 3RN2A 3PO3G 3VDYA 2OQ0A 1XPOA 1FJGL 2NZOA 4B3TQ 3KJOA 2D62A 1Q1EA 4GKKQ 2JA9A 3LGJA 2RF4A 4QY7A 4B3MQ 3AFQA 4HJAA 1IZ6A 3I56A 2IT1A 4X64Q 1HR0L 4AQYL 2UUAQ 1Y1VH 3PSIA 4KHZA 1JT8A 4DR3L 4DAMA 1AE3A 1VQDA 1I3QH 3GTPH 1TXYA 4DUYL 3PIOA 3J7A5 4OWWB 4KLKA 4AQYQ 3ERSX 4DK6C 1XNQQ 3CCQA 2E5LQ 4JOIA 4JI7Q 4JI6Q 3S14H 3ICEA 4NPSA 1YVCA 5LMUQ 4PZ7A 3S15H 1PH1A 5IWAL 1FJGQ 5JEAG 4A3FH 3HKZE 1L1OB 1UE1A 3RLFA 1TWFH 2DUDA 1EIFA 4EQ5A 4J15A 3TREA 1HZBA 3HOUH 2CKZB 1PHJA 1ASZA 2JA5G 1XNRL 3M7NA 2K50A 1C0AA 1HNZL 1UE5A 4QIWE 4WJ4A 5C4JH 1XPUA 3SGIA 2UXCL 1GO3E 4GOPB 2NVXH 3CCSA 1SMXA 2B29A 4A3JG 2HIVA 4GKJQ 1G291 2Z0SA 5K36G 3E9IA 4DV5L 1NJIC 1M1KC 1E22A 2VUMG 5HY6A 3J7ZC 1RL2A 4DR1Q 1P8LA 1TWHH 1KC8C 2GN5A 3PO2G 2NVTH 3M4OH 3CC7A 4DR7Q 2ZJQA 1IYJB 4JYAL 3PV0A 1IXRA 5FJ8H 4ME3A 1B7YB 2I5LX 4DV5Q 3B6YA 4JI8Q 2MNAA 4BY1H 2MO1A 4DV7L 1XPRA 2FXQA 2K52A 3BJUA 3HKZG 1VCIA 2VW9A 4KHPQ 4NB3A 1L0WA 1UEBA 5FLMG 1OXXK 5IYBH 3FKIH 4RMFA 1DGSA 4O2DA 4YWLA 1PA6A 1VQAA 4IPDA 4JYAQ 1VQ5A 3I4MG 4DR5L 1C7YA 1YBYA 2A19A 1W2BA 2R7ZH 4GNXB 2MO0A 5FLXc 3CCJA 1PFSA 5EAYA 3PO2H 3OYYA 3T1HQ 3BZCA 1I5FA 2JJQA 1LM0A 4X65L 1PH3A 2YTVA 4LF7Q 4JV5L 1WOCA 1WI5A 4DPGA 4GN5A 4YCUA 1Q7YC 2UXCQ 4DV6Q 3KF6B 3M4PA 3D31A 2A1AA 1UE7A 3J81i 1XMOQ 4A3IG 2HIXA 1CKNA 2CFMA 5IYBG 3I7FA 5GAEC 4DK3C 2VQFL 4GLXA 1N34L 2NZHA 2YU9H 1EQRA 2QGQA 1RIPA 4LFAL 4IOAA 3KOJA 1H95A 4QJFA 5IYDG 4Y52H 4JG2A 1QUQB 1PYBA 2AWNA 3H0GH 3OTOL 4HJ9A 4A3KH 5FJ8G 4JI2Q 3CCRA 2ZTEA 3PCOB 4A3DH 4DV1Q 4K0KQ 4DKAC 3CCVA 4DUZL 4GN4B 1GD7A 3PUYA 4R1JA 1VQOA 2Z6KA 3PIPA 4PZ8A 3CPFA 2OTLA 2EIFA 1WFQA 1S72A 1MKHA 4LF9L 1X3EA 2Y0SG 2WAQG 4JI4Q 4POGA 4OONA 5M3MH 4LFBQ 2ZTDA 3GD7A 4JBKA 1P16A 2Q2TA 4LF4L 1X54A 3KDFA 1LUZA 4LUVA 1N34Q 3J80c 4BY7H 2JA8H 2F3IA 3U4VA 2VL6A 2YV5A 4DR4L 1XMOL 1N33Q 1E3PA 1PH7A 2JA6G 4A3GG 1TWGH 4R4IA 4OO1G 3CAMA 2ES2A 1MIUA 1BBUA 4YWKA 2AMCB 4BA1I 2JA8G 3I4NG 4OWXB 1SE8A 1X3FA 4C3IH 2A8VA 3HOYG 3M9BA 2KCMA 1EYGA 3UDXA 3I2ZA 2WP8J 1T9HA 3STBD 4X62L 3S2HH 5BR8Q 3F2CA 2ZM6L 2H5XA 3K7AH 4A3IH 1FVIA 3NELA 4UPAA 3S1NH 3E0EA 2PQAB 4R4TA 1KD1C 3CCEA 3PUVA 1Q8KA 5ELNA 3UDFA 4OXPA 3JAMi 4JOIC 1A0IA 4L5QA 5GAGC 4DV3Q 3AFPA 4NXMQ 3E9HA 4FDBA 4IPHA 4LWCA 4JI5Q 4NXNQ 2JEBI 5JJIA 2Y0SE 4JV5Q 3CCMA 4DV4L 1FL0A 2JA7G 4WJ3M 3GTLH 3TS2A 2K5HA 4LUOA 3CCLA 3GDEA 1I6HH 3TS0A 3GTOH 1N32L 4JC0A 2RHQB 2VQEQ 4DR2L 3AEVA 1VQPA 1Q82C 5M3MG 4GS3A 4C3HH 1X55A 4A3FG 4UP7A 2VQEL 3KDFB 5FLMH 4A3CH 1L2FA 2E8GA 1MJEA 2ZM6Q 3DM3A 1XNRQ 3S1MH 2UU9L 4QQBX 1XJVA 4JI0L 1NE3A 2ID0A 1N9WA 4IJLA 2JA6H 4LW1A 2D0OA 3CCUA 4IOCA 2UXDL 1CSPA 2C35B 3G4SA 2D0PA 4NXNL 4AYBG 4KI0A 2EQSA 1A62A 2E2IH 1QVFA 3JC66 2HQLA 1K8AC 1KL9A 5C44H 2OQKA 4C3JH 1ASYA 3F8TA 3CW2C 4EX5A 2UUCL 4JI3L 4PG3A 4POFA 3A5ZB 3HFZB 5BR8L 3OTOQ 1HR0W 3ULPA 2BH2A 4PMWA 2EXDA 3H3VI 1Q1BA 1VQ4A 1YIJA 1VQGA 4XTCS 1IBLL 4B3RL 2GVAA 1GM5A 4DR3Q 1EUJA 4X66L 5E7NA 5C0XJ 4LFCL 2VQFQ 3KF6A 2Z6KC 5DLQE 3HOXG 3UE1A 2R92G 1G51A 4HIMA 1CKOA 1WCMH 2UXBL 4GN3B 4LFCQ 4QL5A 1HNZQ 1XNQL 2KHIA 2N78A 1L1OA 4B3ML 4A3LG 1D7QA 1NMFA 1K0RA 1BKBA 4BXXH 1X65A 4LF4Q 3Q8DA 4DAYB 4X65Q 1N8RC 1KRSA 3I55A 4AH6A 4LF7L 3DLLA 3FKIG 1IBLQ 5M3FG 4LF8Q 2HHHQ 2B3GA 3STBC 1M90C 2HT1A 4LFAQ 4QGUA 5ELOA 5IYCG 4BBRG 2UUCQ 1V43A 1SFOH 1HR0Q 1VQJA 3F1ZA 5LMNL 3IRBA 5J3BA 2UUAL 3H3VH 3TRZA 4DR6L 5GQOA 3A5UA 1L1OC 5IYCH 1WYDA 2F4VL 1LTLA 2NVYH 3BU2A 4A3KG 1BVSA 3KF8B 1Q12A 4P72A 4O0AA 5IE8A 4DR2Q 3RNUA 1SN8A 3OW2A 4JBMA 1YITA 1JE5A 1Y1WG 4UY8C 1FGUA 3GTGH 3S1QH 3ZJYC 4B3SL 1SRUA 3J81j 1AH9A 1X3GA 2DGYA 3L7ZC 4MNOA 3F2BA 1VQFA 1CKMA 3FP9A 4JCVE 4A3JH 1QZGA 3HOZG 1W3SA 4HJ5A 4DV6L 2WFWA 2ZJRA 4A75A 1PH2A 4NXML 2PI2A 3GTKH 2V1CC 1YHQA 1IBKQ 2NN6G 2ATWA 2IHEA 5LMNW 1VQKA 4GKKL 2PMZE 3H0GG 3HOZH 4X6AH 2ALYB 2BA1A 1KIXA 4ALPA 2WB1G 2R92H 3S2DH 1YNXA 1CKNB 1O7IA 2UUBL 4KHPL 2IHFA 4P73A 4X62Q 4JBJA 5C0XI 1VQEA 1X56A 3AQQA 3KFUA 3NBHB 3NENA 1IBMQ 3CC4A 1HZ9A 4IJHA 4GOPA 1IBKL 2KBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFI A;  4BBS H;  5M5W H;  1HH2 P;  1HZA A;  1A63 A;  1Q86 C;  1YEZ A;  4LF8 L;  3NEM A;  2VNU D;  1EQQ A;  2JEA I;  4MZ9 A;  4LFB L;  3ER0 A;  3K80 C;  5C3E G;  3HOW G;  1I94 L;  3M3Y H;  4P71 A;  4JI6 L;  2GVB A;  2F4V Q;  1U0L A;  4DR4 Q;  1PH6 A;  3PGZ A;  3WWV A;  4DV1 L;  4DUY Q;  3G6E A;  5GAH C;  1KQS A;  2KCT A;  2WB1 E;  4JI4 L;  4IO9 A;  4L5R C;  1K8G A;  3FHW A;  4BA2 I;  1E1T A;  3EIV A;  4HIK A;  3W1G A;  4H02 A;  1D8L A;  2ASB A;  1VQB A;  1YHB A;  5LMU L;  1AE2 A;  1YJW A;  2UXB Q;  1X9N A;  1QUQ A;  3L2P A;  4APV A;  2L15 A;  3RZO H;  5C3E H;  1HJP A;  2E5L L;  1XTD A;  3KYH C;  4X66 Q;  4RG1 A;  1N36 Q;  2AKW B;  1JJ2 A;  4YWM A;  3A0J A;  3I4N H;  5HGQ A;  1VQ8 A;  1N36 L;  1JB7 A;  4X64 L;  3K8A A;  4DR5 Q;  2R7Z G;  4XIG S;  4DV2 Q;  2PNH A;  1VQ7 A;  3PF4 A;  3U58 A;  3BZK A;  1QZH A;  4DUZ Q;  4IFD J;  3K81 C;  3CQZ H;  4GNX C;  4JI2 L;  4UP9 A;  1YHA A;  3TQY A;  4B3R Q;  3UDI A;  3W1B A;  3HOV G;  3CPW A;  4A93 H;  5IP9 G;  1WCM G;  4DV4 Q;  1PYS B;  3RR5 A;  3MXN B;  4AIM A;  1VQL A;  2Q2U A;  4OX9 Q;  4JI5 L;  3GO5 A;  1Y1W H;  2LSS A;  1Z47 A;  1X6O A;  3F2D A;  4YY3 L;  3UDG A;  4K0K L;  2IX0 A;  1YJN A;  3HKS A;  4OO1 I;  2K5V A;  2I5H A;  3I4O A;  2NVQ H;  1HZC A;  1YJ9 A;  2PI2 E;  4TVA B;  3PUW A;  2N8N A;  4IPC A;  1Z9F A;  2CWP A;  3G71 A;  1PV4 A;  1LYL A;  2RCN A;  1WJJ A;  1PH8 A;  3EN2 A;  3GTJ H;  3S16 H;  3T1H L;  2AWO A;  5AJ3 Q;  3J80 i;  1PH4 A;  1V1Q A;  4A3E G;  4JI0 Q;  3I4M H;  2I5M X;  4L5S A;  1HNW Q;  4A3B G;  2BA0 A;  4DV0 Q;  2VZA A;  1GVP A;  2JK8 A;  4A3E H;  5IP9 H;  4DR7 L;  1EOV A;  2K14 A;  1J5E L;  3A74 A;  3S24 A;  3L0O A;  1VQH A;  2QA4 A;  3S1R H;  1XMQ Q;  2F52 A;  4DV0 L;  3PF5 A;  2JE6 I;  4OWT B;  4BBR H;  4B3S Q;  2B63 G;  3UE0 A;  3CME A;  4YHH Q;  1IL2 A;  4IFD G;  1QVC A;  2LXJ A;  1OXV A;  5AJ3 L;  3CXC A;  4A3M G;  1PH9 A;  2UUB Q;  2CCZ A;  2Q2I A;  3KLW A;  2WAQ E;  5JJK A;  1E24 A;  1XMQ L;  5GRO A;  5IP7 G;  3PUZ A;  1NBW A;  1TWC H;  2K5N A;  5H1S E;  4A93 G;  3HOV H;  3CD6 A;  4MTN A;  3T1Y Q;  5IP7 H;  2PQA A;  1N33 L;  1PVO A;  2QEX A;  1VQC A;  3HOW H;  4A3B H;  4P74 A;  2BH8 A;  4R4Q A;  2KHJ A;  4R4O A;  1U5K A;  1HNW L;  4GLV B;  2YTY A;  1EWI A;  5IWA Q;  2K4K A;  3TEH B;  2R7D A;  1VQN A;  5IT9 c;  3GTQ H;  2E2H H;  2OTJ A;  1HNX L;  4LF5 Q;  4LF9 Q;  2ZJP A;  4BBS G;  2OCE A;  2RHS B;  5C0X G;  3MEF A;  1N32 Q;  1K83 H;  1OXS C;  1I50 H;  3RLO A;  1UWV A;  4HID A;  4JI7 L;  4DNI A;  1BBW A;  4GOP C;  5M5Y H;  4AYB E;  1VQI A;  1HNX Q;  4LF5 L;  3RLN A;  4OX9 L;  4DR6 Q;  2XTI A;  1MJC A;  1YI2 A;  4A3L H;  2N3S A;  2NN6 I;  5C44 G;  3H15 A;  2HHH L;  3M4Q A;  4JI3 Q;  5C4X H;  4C2M H;  1EFW A;  2JA7 H;  2R7F A;  2XGT A;  1QVG A;  4A3C G;  3K0X A;  2KEN A;  3T1Y L;  4A3M H;  5M3F H;  5M5X H;  1GKH A;  4GNX A;  1SRO A;  2ZTC A;  3JAM c;  4A76 A;  5C4X G;  5IYD H;  1G6P A;  2R6G A;  3D0F A;  4YCW A;  4IPG A;  5IY0 A;  3U4Z A;  1Q81 C;  1Q46 A;  4A3G H;  2R93 G;  2UXD Q;  3CC2 A;  2OWO A;  2JA5 H;  1K3R A;  3W5O A;  3J81 c;  4DV7 Q;  3AYH B;  4YCV A;  3M85 A;  4A4I A;  4BXX G;  1B70 B;  4BY1 G;  1PH5 A;  3HOY H;  3K7U C;  1E1O A;  4R4C A;  3ULJ A;  4HIO A;  1C9O A;  1NY4 A;  1SR3 A;  1YZ6 A;  1VQ6 A;  1K73 C;  2B63 H;  1KAW A;  2MQH A;  2IX1 A;  1I94 Q;  3PO3 H;  1V9P A;  4JI1 L;  1KRT A;  1CSQ A;  1VS0 A;  2AHO B;  4DR1 L;  2Q2H A;  4IFD I;  1J6Q A;  1TWA H;  2JQO A;  4B3T L;  2VUM H;  4HJ8 A;  1VQ9 A;  4BY7 G;  1EIY B;  4GKJ L;  1JJC B;  4YHH L;  1NTG A;  4LF6 L;  4JI8 L;  2I0Q A;  1A8V A;  2CWA A;  2UU9 Q;  3GTM H;  4HJ7 A;  1S40 A;  2R93 H;  1Y1V G;  3CF5 A;  1VQM A;  3ULL A;  4L5T A;  1J5E Q;  1UE6 A;  1KXL A;  3G48 A;  1IBM L;  1NMG A;  3HOX H;  4TQU S;  2K75 A;  1OXT A;  2VY3 A;  3RZD H;  4LUZ A;  2YYZ A;  1SLJ A;  4PZ6 A;  5JJL A;  3KJP A;  3EBE A;  3PUX A;  1OTC A;  1E7Z A;  3CP0 A;  4P75 A;  3RN5 A;  1Y14 B;  4LNQ A;  3S17 H;  4JI1 Q;  1CUK A;  4GLA C;  1S3O A;  2YTX A;  4DV3 L;  2CQO A;  4DV2 L;  2E2J H;  2VS1 A;  1OXU A;  3HOU G;  1R9T H;  4UP8 A;  3CMA A;  4A3D G;  1KHI A;  2LXK A;  4YY3 Q;  5GAD C;  1B8A A;  5LMN Q;  1JJG A;  1K9M C;  4LF6 Q;  4JBW A;  5JEA J;  1JMC A;  2IY5 B;  2N49 A;  4Y7N H;  3U50 C;  3RN2 A;  3PO3 G;  3VDY A;  2OQ0 A;  1XPO A;  1FJG L;  2NZO A;  4B3T Q;  3KJO A;  2D62 A;  1Q1E A;  4GKK Q;  2JA9 A;  3LGJ A;  2RF4 A;  4QY7 A;  4B3M Q;  3AFQ A;  4HJA A;  1IZ6 A;  3I56 A;  2IT1 A;  4X64 Q;  1HR0 L;  4AQY L;  2UUA Q;  1Y1V H;  3PSI A;  4KHZ A;  1JT8 A;  4DR3 L;  4DAM A;  1AE3 A;  1VQD A;  1I3Q H;  3GTP H;  1TXY A;  4DUY L;  3PIO A;  3J7A 5;  4OWW B;  4KLK A;  4AQY Q;  3ERS X;  4DK6 C;  1XNQ Q;  3CCQ A;  2E5L Q;  4JOI A;  4JI7 Q;  4JI6 Q;  3S14 H;  3ICE A;  4NPS A;  1YVC A;  5LMU Q;  4PZ7 A;  3S15 H;  1PH1 A;  5IWA L;  1FJG Q;  5JEA G;  4A3F H;  3HKZ E;  1L1O B;  1UE1 A;  3RLF A;  1TWF H;  2DUD A;  1EIF A;  4EQ5 A;  4J15 A;  3TRE A;  1HZB A;  3HOU H;  2CKZ B;  1PHJ A;  1ASZ A;  2JA5 G;  1XNR L;  3M7N A;  2K50 A;  1C0A A;  1HNZ L;  1UE5 A;  4QIW E;  4WJ4 A;  5C4J H;  1XPU A;  3SGI A;  2UXC L;  1GO3 E;  4GOP B;  2NVX H;  3CCS A;  1SMX A;  2B29 A;  4A3J G;  2HIV A;  4GKJ Q;  1G29 1;  2Z0S A;  5K36 G;  3E9I A;  4DV5 L;  1NJI C;  1M1K C;  1E22 A;  2VUM G;  5HY6 A;  3J7Z C;  1RL2 A;  4DR1 Q;  1P8L A;  1TWH H;  1KC8 C;  2GN5 A;  3PO2 G;  2NVT H;  3M4O H;  3CC7 A;  4DR7 Q;  2ZJQ A;  1IYJ B;  4JYA L;  3PV0 A;  1IXR A;  5FJ8 H;  4ME3 A;  1B7Y B;  2I5L X;  4DV5 Q;  3B6Y A;  4JI8 Q;  2MNA A;  4BY1 H;  2MO1 A;  4DV7 L;  1XPR A;  2FXQ A;  2K52 A;  3BJU A;  3HKZ G;  1VCI A;  2VW9 A;  4KHP Q;  4NB3 A;  1L0W A;  1UEB A;  5FLM G;  1OXX K;  5IYB H;  3FKI H;  4RMF A;  1DGS A;  4O2D A;  4YWL A;  1PA6 A;  1VQA A;  4IPD A;  4JYA Q;  1VQ5 A;  3I4M G;  4DR5 L;  1C7Y A;  1YBY A;  2A19 A;  1W2B A;  2R7Z H;  4GNX B;  2MO0 A;  5FLX c;  3CCJ A;  1PFS A;  5EAY A;  3PO2 H;  3OYY A;  3T1H Q;  3BZC A;  1I5F A;  2JJQ A;  1LM0 A;  4X65 L;  1PH3 A;  2YTV A;  4LF7 Q;  4JV5 L;  1WOC A;  1WI5 A;  4DPG A;  4GN5 A;  4YCU A;  1Q7Y C;  2UXC Q;  4DV6 Q;  3KF6 B;  3M4P A;  3D31 A;  2A1A A;  1UE7 A;  3J81 i;  1XMO Q;  4A3I G;  2HIX A;  1CKN A;  2CFM A;  5IYB G;  3I7F A;  5GAE C;  4DK3 C;  2VQF L;  4GLX A;  1N34 L;  2NZH A;  2YU9 H;  1EQR A;  2QGQ A;  1RIP A;  4LFA L;  4IOA A;  3KOJ A;  1H95 A;  4QJF A;  5IYD G;  4Y52 H;  4JG2 A;  1QUQ B;  1PYB A;  2AWN A;  3H0G H;  3OTO L;  4HJ9 A;  4A3K H;  5FJ8 G;  4JI2 Q;  3CCR A;  2ZTE A;  3PCO B;  4A3D H;  4DV1 Q;  4K0K Q;  4DKA C;  3CCV A;  4DUZ L;  4GN4 B;  1GD7 A;  3PUY A;  4R1J A;  1VQO A;  2Z6K A;  3PIP A;  4PZ8 A;  3CPF A;  2OTL A;  2EIF A;  1WFQ A;  1S72 A;  1MKH A;  4LF9 L;  1X3E A;  2Y0S G;  2WAQ G;  4JI4 Q;  4POG A;  4OON A;  5M3M H;  4LFB Q;  2ZTD A;  3GD7 A;  4JBK A;  1P16 A;  2Q2T A;  4LF4 L;  1X54 A;  3KDF A;  1LUZ A;  4LUV A;  1N34 Q;  3J80 c;  4BY7 H;  2JA8 H;  2F3I A;  3U4V A;  2VL6 A;  2YV5 A;  4DR4 L;  1XMO L;  1N33 Q;  1E3P A;  1PH7 A;  2JA6 G;  4A3G G;  1TWG H;  4R4I A;  4OO1 G;  3CAM A;  2ES2 A;  1MIU A;  1BBU A;  4YWK A;  2AMC B;  4BA1 I;  2JA8 G;  3I4N G;  4OWX B;  1SE8 A;  1X3F A;  4C3I H;  2A8V A;  3HOY G;  3M9B A;  2KCM A;  1EYG A;  3UDX A;  3I2Z A;  2WP8 J;  1T9H A;  3STB D;  4X62 L;  3S2H H;  5BR8 Q;  3F2C A;  2ZM6 L;  2H5X A;  3K7A H;  4A3I H;  1FVI A;  3NEL A;  4UPA A;  3S1N H;  3E0E A;  2PQA B;  4R4T A;  1KD1 C;  3CCE A;  3PUV A;  1Q8K A;  5ELN A;  3UDF A;  4OXP A;  3JAM i;  4JOI C;  1A0I A;  4L5Q A;  5GAG C;  4DV3 Q;  3AFP A;  4NXM Q;  3E9H A;  4FDB A;  4IPH A;  4LWC A;  4JI5 Q;  4NXN Q;  2JEB I;  5JJI A;  2Y0S E;  4JV5 Q;  3CCM A;  4DV4 L;  1FL0 A;  2JA7 G;  4WJ3 M;  3GTL H;  3TS2 A;  2K5H A;  4LUO A;  3CCL A;  3GDE A;  1I6H H;  3TS0 A;  3GTO H;  1N32 L;  4JC0 A;  2RHQ B;  2VQE Q;  4DR2 L;  3AEV A;  1VQP A;  1Q82 C;  5M3M G;  4GS3 A;  4C3H H;  1X55 A;  4A3F G;  4UP7 A;  2VQE L;  3KDF B;  5FLM H;  4A3C H;  1L2F A;  2E8G A;  1MJE A;  2ZM6 Q;  3DM3 A;  1XNR Q;  3S1M H;  2UU9 L;  4QQB X;  1XJV A;  4JI0 L;  1NE3 A;  2ID0 A;  1N9W A;  4IJL A;  2JA6 H;  4LW1 A;  2D0O A;  3CCU A;  4IOC A;  2UXD L;  1CSP A;  2C35 B;  3G4S A;  2D0P A;  4NXN L;  4AYB G;  4KI0 A;  2EQS A;  1A62 A;  2E2I H;  1QVF A;  3JC6 6;  2HQL A;  1K8A C;  1KL9 A;  5C44 H;  2OQK A;  4C3J H;  1ASY A;  3F8T A;  3CW2 C;  4EX5 A;  2UUC L;  4JI3 L;  4PG3 A;  4POF A;  3A5Z B;  3HFZ B;  5BR8 L;  3OTO Q;  1HR0 W;  3ULP A;  2BH2 A;  4PMW A;  2EXD A;  3H3V I;  1Q1B A;  1VQ4 A;  1YIJ A;  1VQG A;  4XTC S;  1IBL L;  4B3R L;  2GVA A;  1GM5 A;  4DR3 Q;  1EUJ A;  4X66 L;  5E7N A;  5C0X J;  4LFC L;  2VQF Q;  3KF6 A;  2Z6K C;  5DLQ E;  3HOX G;  3UE1 A;  2R92 G;  1G51 A;  4HIM A;  1CKO A;  1WCM H;  2UXB L;  4GN3 B;  4LFC Q;  4QL5 A;  1HNZ Q;  1XNQ L;  2KHI A;  2N78 A;  1L1O A;  4B3M L;  4A3L G;  1D7Q A;  1NMF A;  1K0R A;  1BKB A;  4BXX H;  1X65 A;  4LF4 Q;  3Q8D A;  4DAY B;  4X65 Q;  1N8R C;  1KRS A;  3I55 A;  4AH6 A;  4LF7 L;  3DLL A;  3FKI G;  1IBL Q;  5M3F G;  4LF8 Q;  2HHH Q;  2B3G A;  3STB C;  1M90 C;  2HT1 A;  4LFA Q;  4QGU A;  5ELO A;  5IYC G;  4BBR G;  2UUC Q;  1V43 A;  1SFO H;  1HR0 Q;  1VQJ A;  3F1Z A;  5LMN L;  3IRB A;  5J3B A;  2UUA L;  3H3V H;  3TRZ A;  4DR6 L;  5GQO A;  3A5U A;  1L1O C;  5IYC H;  1WYD A;  2F4V L;  1LTL A;  2NVY H;  3BU2 A;  4A3K G;  1BVS A;  3KF8 B;  1Q12 A;  4P72 A;  4O0A A;  5IE8 A;  4DR2 Q;  3RNU A;  1SN8 A;  3OW2 A;  4JBM A;  1YIT A;  1JE5 A;  1Y1W G;  4UY8 C;  1FGU A;  3GTG H;  3S1Q H;  3ZJY C;  4B3S L;  1SRU A;  3J81 j;  1AH9 A;  1X3G A;  2DGY A;  3L7Z C;  4MNO A;  3F2B A;  1VQF A;  1CKM A;  3FP9 A;  4JCV E;  4A3J H;  1QZG A;  3HOZ G;  1W3S A;  4HJ5 A;  4DV6 L;  2WFW A;  2ZJR A;  4A75 A;  1PH2 A;  4NXM L;  2PI2 A;  3GTK H;  2V1C C;  1YHQ A;  1IBK Q;  2NN6 G;  2ATW A;  2IHE A;  5LMN W;  1VQK A;  4GKK L;  2PMZ E;  3H0G G;  3HOZ H;  4X6A H;  2ALY B;  2BA1 A;  1KIX A;  4ALP A;  2WB1 G;  2R92 H;  3S2D H;  1YNX A;  1CKN B;  1O7I A;  2UUB L;  4KHP L;  2IHF A;  4P73 A;  4X62 Q;  4JBJ A;  5C0X I;  1VQE A;  1X56 A;  3AQQ A;  3KFU A;  3NBH B;  3NEN A;  1IBM Q;  3CC4 A;  1HZ9 A;  4IJH A;  4GOP A;  1IBK L;  2KBN A; 
#chains in the Genus database with same CATH topology
 4CHT B;  4RGN A;  3S2H B;  2MFI A;  4DK0 A;  2KEC A;  1I4R A;  2NTS A;  1TWH B;  1WTH A;  2RKS A;  1EQQ A;  3LWU A;  3SK5 A;  3ER0 A;  5C3E G;  3Q23 A;  2D9U A;  5EBD A;  1SNQ A;  1U0L A;  4DR4 Q;  3HGB A;  2L55 A;  2BE5 D;  3BG3 A;  4JI4 L;  4IO9 A;  1K8G A;  1F2L A;  3FHW A;  3EIV A;  4RCO A;  2CHB D;  2EYH A;  1YJW A;  2UXB Q;  2CH4 A;  1QUQ A;  1ZYR D;  2E2I B;  4ZCK A;  3W2D A;  1N36 Q;  2Z4I A;  5FO9 B;  1DD2 A;  1JB7 A;  1Y8O B;  2G5D A;  2Z8L A;  3K8A A;  4XIG S;  4QUF A;  5I2Y A;  2EVB A;  2PNH A;  4UDU C;  1B1Z A;  4JI2 L;  2HDL A;  1YHA A;  4HR7 B;  2XWB B;  5IOC A;  3UDI A;  2JN4 A;  3HOV G;  4X3U A;  1PZI D;  1GHK A;  3RR5 A;  2XNA C;  2EYP A;  3A7A B;  5C4H A;  4HTH A;  4JI5 L;  1D6E C;  3GQB A;  3F2D A;  1X6O A;  3UDG A;  3J7A F;  5CYU A;  5ELB A;  1YJN A;  2QF7 A;  2I5H A;  4OIJ A;  1B4O A;  4IZ8 A;  1NAP A;  1Z6H A;  1HZC A;  1YJ9 A;  2PI2 E;  2ICE C;  3K0Y A;  5E4W C;  2AWO A;  1HNW Q;  3OPO A;  2JK8 A;  5KEE A;  2WIN B;  4A3E H;  5IP9 H;  2K14 A;  1SJE D;  5CV5 A;  3S24 A;  3L0O A;  1STN A;  1JC7 A;  5BN3 A;  2JE6 I;  2EE1 A;  1BCP C;  2PYK A;  2B63 G;  3UE0 A;  1N32 Q;  1QVC A;  5AJ3 L;  2EYM A;  5JJK A;  3S2D B;  1QE6 A;  3PUZ A;  1Y8P B;  1BR9 A;  1B9M A;  3HOU B;  3HOV H;  1PVO A;  1VQC A;  4A3B H;  2BH8 A;  4R4O A;  1HNW L;  4HMI A;  2EJF C;  2B2Y C;  4GLV B;  3G6J B;  2K4K A;  3TEH B;  5IT9 c;  3GTQ H;  2R61 A;  2NTT A;  3MEF A;  1O7Y A;  1OXS C;  5K36 H;  1UWV A;  4KK7 A;  4DNI A;  2NUC A;  1RJT A;  3DEP A;  2E74 C;  1GUN A;  4G7O C;  3M3Y B;  2Z9H A;  3RZO B;  4G7Z C;  4PNY A;  4XYQ A;  3H15 A;  4JI3 Q;  1EFW A;  4C2M H;  3Q0A A;  2NVX B;  1QVG A;  5FK9 C;  2KEN A;  3T1Y L;  2EOT A;  1HFG A;  1AFP A;  2F1M A;  3LNN A;  2ZTC A;  1ET6 A;  2K33 A;  1G6P A;  1K3B C;  4YCW A;  3D0F A;  3S1N B;  5IY0 A;  2UXD Q;  3BVZ A;  1FNW A;  1SE3 A;  3D8G A;  1WCM B;  3J81 c;  1QNU A;  3AYH B;  4DXF A;  1CA5 A;  4YCV A;  1PH5 A;  3K7U C;  1I6V C;  1NY4 A;  1K73 C;  3BVG A;  3A8I E;  4JI1 L;  2I07 B;  1KRT A;  1VS0 A;  4IFD I;  2RDH A;  1J6Q A;  1JWU D;  4FXK C;  2VUM H;  1YNJ C;  1VQ9 A;  3MFG A;  2CQA A;  4GKJ L;  3OMC A;  3M4O B;  3CQZ B;  3CRL C;  2F0W A;  2KA7 A;  2I0Q A;  2CWA A;  2F0I A;  2AQ3 B;  4OIK A;  1VQM A;  1DOM A;  1VMP A;  3TDQ A;  2ENB A;  3G48 A;  1FYC A;  3TZD A;  3HOX H;  5COY A;  2VY3 A;  4ME5 A;  1H9K A;  1XYI A;  1E7Z A;  4LK1 C;  3S16 B;  4JI1 Q;  4DV3 L;  2CQO A;  3NBI A;  1H9S A;  3WOF A;  1KHI A;  4YY3 Q;  5CV9 A;  1EZ8 A;  3D4W A;  2WII B;  4LF6 Q;  3FEW X;  3RN2 A;  3QB3 A;  3J7A V;  1X3Q A;  1XPO A;  4QMG A;  5ELD A;  1K0S A;  3LGJ A;  1PRT B;  3DUZ A;  1R4P B;  1LTR D;  3AFQ A;  4QY7 A;  4HJA A;  1V1O A;  2UUA Q;  1PTO F;  3PSI A;  1D5X C;  1JWM D;  2NVT B;  1I3Q H;  1DM0 B;  1QJO A;  4KLK A;  5I6Y A;  4DK6 C;  5T1I A;  3CCQ A;  5EPK A;  5AFW A;  3S15 H;  1CM9 A;  2F0Q A;  3TP7 A;  1TWF H;  2MHV A;  3TRE A;  4IQZ A;  4S3S A;  2N55 A;  1STY A;  2K50 A;  1HNZ L;  4CDC C;  3SGI A;  1VF5 C;  2MP1 A;  3J80 L;  4DA2 A;  2HIV A;  3NWT A;  3E9I A;  1PYW D;  2IPK D;  2L5T A;  3NK9 A;  1F9R A;  1CQF A;  4DR7 Q;  2BOS A;  3CC7 A;  4DF7 A;  3C2P A;  1IYJ B;  1G2S A;  2I5L X;  4DV5 Q;  1KTK A;  2F0G A;  4BY1 H;  4NKL A;  1XPR A;  2FXQ A;  4OGQ C;  3HP3 A;  1BO0 A;  4FF2 A;  4C3J B;  1L0W A;  1LLR D;  5JOB A;  2FJ2 A;  2QDB A;  4RMF A;  3U9S A;  1WTO A;  4A3F B;  3GTJ B;  3E5S A;  2A19 A;  3I8Z A;  5J22 A;  3T1H Q;  1I5F A;  2JJQ A;  4JV5 L;  1TQO A;  1WOC A;  4CKE A;  4IUQ A;  4L63 B;  1G6Z A;  1LTT D;  4YCU A;  3U9O A;  1CI3 M;  1EWH A;  2HIX A;  3TP5 A;  1CKN A;  2CFM A;  2Z6B A;  3V2T A;  5EQ0 A;  4DK3 C;  2QGQ A;  1RIP A;  1EZ6 A;  2X69 A;  3KOJ A;  3VR6 A;  1H95 A;  3I90 A;  4PMB A;  4Y52 H;  3MXP A;  1V1P A;  3H0G H;  1EYA A;  3OTO L;  5C4Z A;  4DAP A;  2F0D A;  3LWE A;  4K0K Q;  4DV1 Q;  1AZQ A;  4R1J A;  1O80 A;  1VQO A;  2EIF A;  3BYT B;  3MFY A;  4POG A;  3TZU A;  4X3K A;  1A6X A;  4JBK A;  3GD7 A;  1LAB A;  1I50 B;  1LUZ A;  2F3I A;  2VL6 A;  2A68 C;  2L9H A;  4A3G G;  1TWG H;  5D14 A;  1IKM A;  1I3Q B;  1MIU A;  3ITP A;  2F03 A;  1CFM A;  1SE8 A;  4PQX A;  2A8V A;  2KCM A;  2BDN A;  1TY2 A;  3TN2 A;  4UAI A;  2ZM6 L;  2VUM B;  4UPA A;  3S1N H;  1C4Q A;  1SNM A;  2PQA B;  1KD1 C;  1Q8K A;  4OXP A;  4L5Q A;  1A0I A;  3AFP A;  2JEB I;  4DV4 L;  4N9P A;  4CJ1 B;  3FRP B;  4LUO A;  5JVG 3;  3GDE A;  2A5H A;  2B8F A;  3HEJ A;  4ODG A;  3RUZ A;  1QWY A;  3SE0 A;  1N32 L;  2RHQ B;  2IJ0 A;  1AZP A;  2ZXR A;  2VQE Q;  5KNC A;  2OF1 A;  1STB A;  2EJG C;  4K5X A;  2VQE L;  4KJN A;  3KDF B;  1L2F A;  2ZM6 Q;  1XNR Q;  2UU9 L;  4QQB X;  1XJV A;  1CHP D;  1NE3 A;  3D6C A;  4ZUJ A;  1YNJ D;  1SJH D;  2G9D A;  2E2I H;  1PTO D;  1S5E D;  5G3L F;  2HQL A;  3PIP 3;  3QG1 A;  1FGB D;  1KL9 A;  3SEB A;  1JOQ A;  3DWA A;  3OHX C;  5BR8 L;  1K28 A;  4ZK9 B;  2WV6 D;  1HR0 W;  1LTB D;  4KTA A;  1EY8 A;  5EPL A;  1YIJ A;  2XWJ B;  4XTC S;  1EY0 A;  3K59 A;  2K5Q A;  1EUJ A;  2L0C A;  5DLQ E;  3HOX G;  1CKO A;  4GN3 B;  4LFC Q;  4A3L G;  1TKW B;  1NMF A;  3Q6S A;  1K0R A;  1BKB A;  4BXX H;  2Y0S B;  2WAQ B;  1N8R C;  4I7Z C;  4AH6 A;  2HT1 A;  2B3G A;  3STB C;  1M90 C;  4K6D A;  3S15 B;  5ELO A;  2UUC Q;  1V43 A;  1SFO H;  2UUA L;  1VQJ A;  3F1Z A;  5KNB A;  5J3B A;  3D4D A;  4A3G B;  1L1O C;  2PNR C;  1LT6 D;  1UUP A;  4IUT A;  1JOR A;  2JA8 B;  1VDZ A;  2E76 C;  3P75 A;  4RGT A;  1AP0 A;  5JPM C;  5DNF A;  1TS4 A;  4DR2 Q;  1Y1W G;  3GTG H;  3HOY B;  3ZJY C;  3J81 j;  1WTR A;  2B8G A;  3L7Z C;  4MNO A;  5CMD A;  1QG7 A;  4JCV E;  4A3J H;  1PMR A;  2QKI C;  4DV6 L;  3NXW A;  1DON A;  1XX8 A;  3H0G G;  3TME A;  1DZ1 A;  1MHW C;  5FOB B;  3S2D H;  4OEL B;  1YNX A;  2UUB L;  2A73 B;  4CDD C;  3AMU A;  4WOR A;  2A6H C;  1IBM Q;  3MC0 B;  4IJH A;  2KBN A;  3Q22 A;  4BBS H;  3DXJ C;  1Q86 C;  2LFN A;  1YEZ A;  4UHV A;  4MZ9 A;  4AYB B;  3HOW G;  4KV6 A;  2IX3 A;  5IIF A;  4P71 A;  3GTP B;  1FNU A;  1PZK D;  2GVB A;  3A8K E;  2F4V Q;  1PH6 A;  1GUW A;  1F9P A;  2K1B A;  3WWV A;  4FF3 A;  4GZY C;  3A7L A;  1KAB A;  1HFN A;  5GAH C;  3EQL C;  2K5W A;  3W1G A;  2K05 A;  2ASB A;  1VQB A;  2HDM A;  1SE4 A;  1AE2 A;  1ROD A;  4CDE C;  3OWE B;  4K5V A;  3RZO H;  5C3E H;  1HJP A;  1XTD A;  3KYH C;  1S5B D;  4X66 Q;  3FPU B;  3T51 B;  3I4N H;  2BCO A;  4K8I A;  4BBR B;  2X6L A;  1U4P A;  2EXZ A;  1KLG D;  2R7Z G;  3T4A C;  1LT3 D;  2PW7 A;  2EY2 A;  3CQZ H;  4UP9 A;  2R93 B;  3TQY A;  1H9M A;  4QF4 A;  4A93 H;  5KIX A;  4DV4 Q;  4OX9 Q;  1GUT A;  2BDO A;  3NBH A;  5I9P A;  2K5V A;  2B2W C;  3N6R A;  3I72 A;  4TVA B;  2KQ3 A;  1PV4 A;  3G71 A;  2RCN A;  1U9R A;  5ELF A;  3S16 H;  5AJ3 Q;  4RHR A;  1LT4 D;  1V1Q A;  3I4M H;  2I5M X;  2LKV A;  4L5S A;  2BA0 A;  3PIO 3;  2VZA A;  4XQQ A;  3T13 A;  3S1Q B;  4WJW A;  2KHS A;  4R8N A;  1VQH A;  5DAU A;  4DV0 L;  1HRJ A;  3PF5 A;  4OWT B;  4B3S Q;  1HQR D;  4C3H B;  3QWN A;  3GTK B;  1B2T A;  1PH9 A;  4C56 C;  3SK8 A;  2Q2I A;  1E24 A;  1XMQ L;  1KLU D;  5GRO A;  1NBW A;  1WVL A;  5H1S E;  4A93 G;  3O13 A;  2CVR A;  2ZT9 C;  3CD6 A;  5IP7 H;  4A3D B;  4R4Q A;  4FF4 A;  2IWH A;  1TS5 A;  3DEO A;  2YTY A;  1EWI A;  5IWA Q;  3G7L A;  1VQN A;  2E2H H;  4LF9 Q;  5C6A A;  1LTG D;  4B9X A;  1K83 H;  3RLO A;  4B9W A;  4JI7 L;  1BBW A;  4GOP C;  1FR3 A;  3I73 A;  1VQI A;  5T1G A;  3W3A A;  5CGK A;  2XTI A;  3GV3 A;  1YI2 A;  3QJY A;  1O78 A;  1X32 A;  2SOB A;  2F3V A;  2XGT A;  2ICI A;  3K0X A;  2I46 A;  5M3F H;  5KYL A;  3WOE A;  1KNE A;  3JAM c;  4A76 A;  5C4X G;  1Y69 U;  2R6G A;  1Q81 C;  1PFB A;  4A3G H;  1YNN D;  1Q46 A;  1B3Q A;  3CC2 A;  2JA5 H;  1K3R A;  4XQJ A;  1D5M C;  2K5D A;  3M85 A;  3VR3 A;  1B70 B;  4BXX G;  3HOY H;  1E1O A;  2B2W A;  1LO5 D;  4R4C A;  3ULJ A;  1C9O A;  1YZ6 A;  1F9S A;  3A54 A;  1I94 Q;  3PO3 H;  4DR1 L;  1TWA H;  3VA7 A;  4BY7 G;  4K6L A;  3LX0 A;  2Q8R E;  4DNR B;  1EIY B;  1M4V A;  2AQ1 B;  1R9T B;  5LL6 S;  4JI8 L;  3MVV A;  1AEX A;  1H9J A;  5G3L D;  4HJ7 A;  1STA A;  3CF5 A;  1UE6 A;  1KXL A;  1JOK A;  3P7J A;  2EY6 A;  3NTK A;  1Y8N B;  1RTO A;  4TQU S;  2HD3 A;  1OXT A;  5IOD A;  1SLJ A;  4KY6 A;  5JJL A;  3EBE A;  4KY7 A;  1RF2 D;  1JCK B;  1JQY D;  4LNQ A;  1CUK A;  4GLA C;  2YTX A;  3CMA A;  1J9O A;  3D3R A;  4A3D G;  3MZ5 A;  1EEF D;  2LXK A;  1K9M C;  4N9T A;  4JBW A;  5JEA J;  1JMC A;  2JXM B;  3PO3 G;  2OQ0 A;  3KJO A;  3CHB D;  4XXE A;  3OW7 A;  4GKK Q;  1F2M A;  1A2T A;  1ICF B;  2JA9 A;  2RSO A;  1S5D D;  3I56 A;  4A3I B;  2IT1 A;  2RQX A;  4X64 Q;  4DGZ A;  3I3C A;  1HR0 L;  4L6T B;  3GTM B;  3PQI A;  4DR3 L;  4DAM A;  2D5D A;  4K2L A;  1TXY A;  3PIO A;  3J7A 5;  1HPC A;  4BS9 A;  5CBE E;  3P20 A;  5CV8 A;  2M2L A;  3ICE A;  4FVM A;  5LMU Q;  1MGS A;  4C1N I;  1FJG Q;  1U4M A;  1PLF A;  1L1O B;  3RLF A;  2DUD A;  4EQ5 A;  1ZXT A;  2NN6 H;  4FNF A;  1NR2 A;  2H4O A;  1BQQ T;  4I7A A;  5JEA H;  2CKZ B;  1C0A A;  4B08 A;  4J6H A;  4IUR A;  1XPU A;  3I4N B;  2J0T D;  1SMX A;  3BDC A;  2B29 A;  1XTC D;  4GKJ Q;  3KUP A;  1BNZ A;  2Z0S A;  1M1K C;  1P8L A;  1TWH H;  1A2U A;  2GN5 A;  1Y1V B;  3M4O H;  4QIW B;  2F0T A;  3MXU A;  5FJ8 H;  4ME3 A;  1B7Y B;  2ZXP A;  1RTN A;  4N8X 1;  2SEB D;  2K52 A;  1VCI A;  4X3T A;  3L3O C;  4KHP Q;  4NB3 A;  3P1H A;  5ELC A;  1UEB A;  1OXX K;  5C5M A;  5CV4 A;  1DGS A;  1EY4 A;  4O2D A;  3VYR A;  4YWL A;  1VQA A;  4IPD A;  3ONA B;  1VQ5 A;  3I4M G;  4I65 A;  3CKI B;  1C7Y A;  2R7Z H;  3SVM A;  3X3N A;  1LTS D;  2F0O A;  1PH3 A;  4HED A;  1Q7Y C;  4ZYS A;  4DV6 Q;  3D31 A;  3H94 A;  1UE7 A;  5I9O A;  4A3I G;  3I7F A;  1N34 L;  4IOA A;  1EQR A;  1II3 A;  4ZKB B;  4NMZ A;  5IYD G;  2F0H A;  4JG2 A;  2B2V A;  4A3K H;  4EQO A;  4CJ2 C;  1AW7 A;  1D5Z C;  2ZTE A;  3BZD B;  2R92 B;  4DKA C;  4DUZ L;  4HMJ A;  1GD7 A;  3FPP A;  3PIP A;  4NDX A;  3CPF A;  1WFQ A;  1HUM A;  4OON A;  4R9W A;  4LFB Q;  2ZTD A;  3VYS A;  1P16 A;  1QOH A;  1TS2 A;  3FVQ A;  5C3X A;  3J80 c;  2JA8 H;  3U4V A;  1XMO L;  1N33 Q;  1F2Y A;  1BCP D;  2AMC B;  4MTK A;  4RGO S;  3R8B A;  3L9A X;  3M9B A;  1EYG A;  5COR A;  4X62 L;  2WP8 J;  3STB D;  4A3J B;  5BR8 Q;  4LMQ D;  3KLR A;  3F2C A;  3NEL A;  3I91 A;  5EKL A;  5LL6 X;  3QOL A;  3CCE A;  3H6M A;  5ELN A;  3UDF A;  1KDC A;  3JAM i;  5GAG C;  3S17 H;  4NXN Q;  3E9H A;  4IPH A;  4LWC A;  4JI5 Q;  2Y0S E;  1ENF A;  3TS2 A;  2K5H A;  3GTO H;  1WTQ A;  1VQP A;  1Q82 C;  1BF4 A;  4GS3 A;  1X55 A;  4UP7 A;  1HTL D;  2E8G A;  4IJL A;  3S17 B;  4LW1 A;  3CCU A;  4U67 3;  2C35 B;  1SYB A;  2D0P A;  2B2T A;  4AYB G;  1HTP A;  2EQS A;  3JC6 6;  3HOW B;  1Q8I A;  1Z7T A;  3GTO B;  2OQK A;  1ASY A;  3F8T A;  5J39 A;  4JI3 L;  3HFZ B;  1DXM A;  3OTO Q;  1NSN S;  1PRT C;  1GOZ A;  4ULL A;  1IBL L;  1VQG A;  4B3R L;  2E75 C;  1GM5 A;  4DR3 Q;  2D2C C;  5IGB A;  5E7N A;  5EKI A;  4DXG A;  5IGF A;  4EQP A;  2DN8 A;  1G51 A;  1MSH A;  1LV9 A;  1U4L A;  2KHI A;  1L1O A;  1D7Q A;  5FLX L;  1SMY C;  3RMH A;  3DLL A;  4LF8 Q;  4LFA Q;  5FO8 B;  4QGU A;  2LS0 1;  3KBG A;  4E6I A;  5LMN L;  1SNO A;  4MN3 A;  1I4H A;  1V1P B;  4KD4 A;  5IYC H;  1Q3L A;  2NVY H;  3BU2 A;  3NE5 B;  3KF8 A;  1Q12 A;  4P72 A;  3RNU A;  1SN8 A;  2B2U A;  2QDL A;  1HCZ A;  4B3S L;  1X3G A;  2R3Z A;  2DGY A;  2OXP A;  3VR4 A;  3NUC A;  1CKM A;  4HJ5 A;  2WFW A;  3GTK H;  1IBK Q;  1EU3 A;  2NN6 G;  5I4D A;  1SNC A;  5C3W A;  5LMN W;  4GKK L;  3C46 A;  2PMZ E;  3TBI B;  4ALP A;  1KDB A;  3HZX A;  2VXW A;  2BE5 C;  1O7I A;  2MPM A;  4X62 Q;  4JBJ A;  4XQN A;  1SYD A;  4XYO A;  3AQQ A;  3NBH B;  3CC4 A;  1HZ9 A;  2RDF A;  1I6H B;  4GOP A;  4CBV A;  5C5L A;  3T53 B;  1IW7 D;  5M5W H;  1HH2 P;  1HZA A;  3QR8 A;  2B2T C;  2JEA I;  1EY9 A;  1V8Q A;  4LFB L;  1EYC A;  5LHY 1;  3M3Y H;  4A93 B;  2J4X A;  1HA5 A;  4ZUI A;  3PGZ A;  2K7V A;  1WTV A;  1A3T A;  3V05 A;  5A2Q E;  1KQS A;  4KD3 A;  1SYG A;  1F9Q A;  3DWQ A;  5EJW A;  5C0X H;  4L5R C;  4BA2 I;  2X6G A;  5M5W B;  5IT9 L;  4H02 A;  4IUV A;  5JVH 3;  2PW5 A;  1YHB A;  1LTI D;  2DJF C;  1X9N A;  4EGV A;  1SXT A;  3L2P A;  1ET9 A;  3VYT A;  2E5L L;  3MXG A;  2M00 A;  4RG1 A;  3VR2 A;  4TKO B;  2AKW B;  3A0J A;  5M3F B;  2EDG A;  3S14 B;  4FXG C;  2PZT A;  3AU7 A;  1N36 L;  1VQ8 A;  3TP8 A;  3D6W A;  2VB2 X;  4H0L C;  1VQ7 A;  3PF4 A;  3U58 A;  1TWF B;  1CHQ D;  2B2U C;  3BZK A;  4DUZ Q;  2PPB C;  4IFD J;  3K81 C;  4HCS A;  2B2Y A;  4ZLT F;  4GNX C;  1D1K A;  1ESR A;  3M4Y A;  2F0J A;  2TMP A;  3W1B A;  1S5F D;  3CPW A;  2JYO A;  1WCM G;  2AUK A;  4H13 C;  5M9O A;  3MXN B;  2Q2U A;  1J8I A;  2ZXO A;  4BY1 B;  3GO5 A;  1I4P A;  1Y1W H;  4YY3 L;  3KLS X;  3HKS A;  2F4I A;  4JVZ A;  3I4O A;  1Z9F A;  2CWP A;  1E2Z A;  1LYL A;  1W6J A;  1WJJ A;  2C9O A;  1PH8 A;  4BY7 B;  3GTJ H;  2WB1 B;  3T1H L;  1PH4 A;  3J80 i;  4A3E G;  4JI0 Q;  5M5Y B;  2F0V A;  4A3B G;  2F0K A;  1GVP A;  4MHE A;  1C8C A;  4DR7 L;  1PTO H;  1J5E L;  5CV6 A;  4V0B A;  2QA4 A;  3S1R H;  4BBR H;  5E1F A;  4IFD G;  5ELE A;  3CXC A;  2UUB Q;  2YU9 B;  4DFA A;  5IP7 G;  5D3I B;  2K5N A;  2O4X A;  5IGC A;  5TSS A;  2Z4H A;  3GTG B;  1ENC A;  3T1Y Q;  1N33 L;  3HOW H;  1O7Z A;  2KHJ A;  2O5J C;  1VF7 A;  3CRK C;  3PO3 B;  2J7Z A;  2OTJ A;  2R7D A;  1SE2 A;  2NVQ B;  2RA4 A;  4WRD A;  2ZJP A;  4BBS G;  5KND A;  2OCE A;  2RHS B;  2JP1 A;  1I50 H;  4HID A;  2OT2 A;  2HUG A;  3ND8 A;  4AYB E;  4DR6 Q;  4CJ0 B;  3AB9 A;  2N3S A;  2NN6 I;  2HHH L;  3M4Q A;  1BCP F;  2R7F A;  3UI2 A;  4A3C G;  3J81 E;  5FKA C;  4A3M H;  2G9H D;  2QCP X;  2EY5 A;  3GP7 A;  4GNX A;  1SRO A;  1K8O A;  3R2T A;  3K5M A;  2R93 G;  2E2J B;  3W5O A;  4DV7 Q;  1PFN A;  5HUR A;  5ISR A;  2N88 A;  4A4I A;  4BY1 G;  4HIO A;  1SR3 A;  3A8J E;  1VQ6 A;  5HGT A;  5D3D A;  2PZW A;  1KAW A;  2MQH A;  3RZD B;  2B63 H;  2IX1 A;  4F8M A;  2KOL A;  4OEM B;  2Q2H A;  3NQI A;  2E2H B;  2K28 A;  3K7A B;  4HJ8 A;  1E0B A;  3SHL A;  1KAA A;  1JJC B;  4YHH L;  1CT1 D;  4LF6 L;  1TR5 A;  3GTM H;  1A8V A;  2UU9 Q;  1JB3 A;  3VR5 A;  4L5T A;  2AUJ D;  1RKN A;  5EKK A;  4XDX A;  3IFT A;  3RZD H;  4LUZ A;  2B63 B;  2YYZ A;  3NHH A;  2EYJ A;  3PUX A;  2XRQ D;  1SYE A;  4OL7 A;  1E2W A;  1Y14 B;  2XVS A;  4DV2 L;  4K14 A;  1UNS A;  2VS1 A;  2EYF A;  4NP5 A;  5EBC A;  3IL8 A;  1TWC B;  5LMN Q;  1B8A A;  1JJG A;  4Y7N H;  1RHP A;  3U50 C;  5C4J B;  4RFB A;  4OHJ A;  2NZO A;  3WDN A;  2RF4 A;  1TY0 A;  1CZG A;  2KCC A;  4AQY L;  4KN7 C;  1D1I A;  1Y1V H;  1XXG A;  1VQD A;  1KDA A;  2KEE A;  4ZRZ A;  2E2D C;  4OWW B;  2EJM A;  4AQY Q;  3ERS X;  1XNQ Q;  1QIL A;  4JI7 Q;  3S14 H;  5C4X B;  2A74 C;  4PZ7 A;  3EFX D;  1PH1 A;  5IWA L;  3OIP A;  5JEA G;  2EPB A;  1UE1 A;  3SXH A;  2F0P A;  1EIF A;  1HA6 A;  1ASZ A;  1A3U A;  2JA5 G;  1XNR L;  2JA6 B;  3M7N A;  5FLX E;  1WTP A;  4QIW E;  2XSC A;  2K01 A;  4FXD A;  1VMC A;  3I4L A;  2NVX H;  2K04 A;  3CCS A;  4QB4 A;  4A3J G;  3MAQ A;  1G29 1;  4DV5 L;  2VUM G;  5HY6 A;  4XT1 B;  1RL2 A;  3J7Z C;  3VA5 A;  1RD9 D;  3PO2 G;  1FNV A;  5IT9 E;  1SNP A;  2ZJQ A;  1IXR A;  3OWF A;  5CV7 A;  2JA7 B;  2F0N A;  4ZKC B;  2KCN A;  3BJU A;  1I4Q A;  3HKZ G;  4QUC A;  2VW9 A;  3S1R B;  5FLM G;  3IFD A;  1JIC A;  1I4G A;  5DEH A;  3NWS A;  4JYA Q;  4IN3 A;  2XN9 C;  1YBY A;  1W2B A;  3R2I A;  3J7Y W;  2IL8 A;  3OYY A;  1LM0 A;  3OSO A;  1UEA B;  1O7L A;  1WI5 A;  1SSO A;  2UXC Q;  1TS3 A;  4F7X A;  3KF6 B;  1BDO A;  2Q8I B;  3IKJ A;  4HCE A;  2VQF L;  2UXB L;  2YU9 H;  4K0K L;  2NZH A;  4QJF A;  4KKU A;  2RCF A;  1PYB A;  2AWN A;  4U68 A;  1TVX A;  2SNS A;  5FJ8 G;  3PCO B;  3MA2 B;  2Z1C A;  3D4R A;  5BN5 A;  4F87 A;  4GN4 B;  3J81 L;  2GA4 B;  2Z6K A;  5A2Q L;  1S72 A;  1MKH A;  2CW0 C;  2AQ2 B;  2WAQ G;  2Y0S G;  3FKI B;  2Q2T A;  1X54 A;  3C1E A;  3KDF A;  4LUV A;  3OOC A;  3BDL A;  4EVO A;  1ENA A;  2YV5 A;  4Z9C B;  4CKB A;  2JA6 G;  1E3P A;  1PH7 A;  4OO1 G;  4R4I A;  4ABN A;  4YWK A;  3I4N G;  4BA1 I;  2EYL A;  3DHQ A;  4C3I H;  1Q90 A;  3I2Z A;  2FHT A;  1T9H A;  3JAM E;  3SDZ A;  1EY5 A;  4K2K A;  4CKC A;  4A3I H;  3K7A H;  1BBX C;  1FVI A;  3E0E A;  4R4T A;  3BDO A;  1PTO C;  5DM7 3;  3PUV A;  4JOI C;  2WAC A;  4DV3 Q;  1ONL A;  4K5W A;  5I6W A;  5JJI A;  1EU4 A;  1FL0 A;  1JOO A;  3GTL H;  3CCL A;  4JC0 A;  4DR2 L;  3AEV A;  4C3H H;  4FP5 D;  4A3C H;  1NR4 A;  1WD0 A;  1SDF A;  2ID0 A;  1N9W A;  2D0O A;  2UXD L;  5NUC A;  3G4S A;  4FO2 A;  3I70 A;  1FD7 D;  1QVF A;  2K6A A;  3ND9 A;  1K8A C;  2M9V A;  3CW2 C;  2UUC L;  3RD4 A;  1WTX A;  1IYU A;  1ZYR C;  4RA8 A;  2BH2 A;  4PMW A;  3H3V I;  4MIU A;  1U4R A;  4X66 L;  5CC4 A;  1STE A;  5C0X J;  4LFC L;  2VQF Q;  2Z6K C;  2R92 G;  3UE1 A;  1C48 A;  2QIL A;  2QEJ C;  3NTI A;  1HNZ Q;  1XNQ L;  2N78 A;  2NZ1 D;  3K5L A;  1A15 A;  3TSS A;  4LF4 Q;  1ILQ A;  3Q8D A;  4K8J A;  4DAY B;  4X65 Q;  4LF7 L;  3VYU A;  3I55 A;  1G91 A;  1IBL Q;  5M3F G;  2A6E C;  2V4D A;  2A6E D;  1T5X D;  4LAA A;  4BBR G;  1TWA B;  1G2T A;  3QOJ A;  3TRZ A;  1QNK A;  3A5U A;  2R7Z B;  2RBM A;  1A3V A;  4KKS A;  1EFI D;  1LTL A;  2KVM A;  4A3K G;  3FMC A;  4JBM A;  4O0A A;  5IE8 A;  1QB5 D;  3OW2 A;  1YIT A;  3HOV B;  3S1Q H;  2C5C A;  1AH9 A;  1IYV A;  1VQF A;  3NSW A;  4JK1 C;  1W3S A;  1PH2 A;  4NXM L;  2V1C C;  2ATW A;  2IHE A;  1VQK A;  2RDG A;  2A69 D;  3HOZ H;  2HQE A;  5A35 A;  1SND A;  4OO1 H;  4HAE A;  2WB1 G;  2R92 H;  4IUN A;  4Q5V A;  4A3E B;  2HCI A;  4M1U B;  2PZU A;  4P73 A;  4KJO A;  5C0X I;  1X56 A;  3NEN A;  2OWO A;  3OIQ A;  1IBK L;  5M3M B;  1L0X B;  3TP6 A;  1WTW A;  1MSG A;  3GTQ B;  3EJI A;  1A63 A;  4DU9 A;  1PRT D;  5CBA E;  4LF8 L;  3NEM A;  2VNU D;  1HXY D;  4V19 0;  1S5C D;  4G4K A;  3K80 C;  1B53 A;  1TII D;  3ERO A;  1I94 L;  2F0M A;  4JI6 L;  2K03 A;  1CTM A;  1K8M A;  1PDQ A;  4DV1 L;  5EGT A;  4DUY Q;  5M5X B;  3G6E A;  2KCT A;  2DNE A;  2WB1 E;  4EQN A;  5L37 A;  4IUU A;  1E1T A;  4HIK A;  2F0F A;  3Q24 A;  1D8L A;  5LMU L;  2VB3 X;  2SNM A;  4APV A;  3K57 A;  4RKL A;  2L15 A;  2CW0 D;  1G8Z D;  4ILW A;  4ZQ3 A;  1NUC A;  3E0J A;  3QO2 A;  3R93 A;  1JWS D;  3E3X A;  3NTH A;  1JJ2 A;  5C44 B;  4YWM A;  2LY7 A;  5HGQ A;  2A68 D;  1IKL A;  4KMU C;  4X64 L;  1GUG A;  2JSO A;  4RAU C;  4DR5 Q;  4DV2 Q;  5JAV A;  5I2X A;  3IAY A;  1QZH A;  2CH4 W;  1E2V A;  4B3R Q;  5E4X A;  5IP9 G;  4M8A A;  3ERQ A;  1PYS B;  4AIM A;  1DYQ A;  1VQL A;  2LSS A;  1Z47 A;  2IX0 A;  4FYD A;  1EL0 A;  4OO1 I;  1ICW A;  2NVQ H;  1D2B A;  1STG A;  3HG9 A;  3PUW A;  1EEI D;  2N8N A;  4IPC A;  1JE4 A;  3EN2 A;  4RWS C;  1NNX A;  1NCV A;  4X3S A;  4KKT A;  4DV0 Q;  2EZV A;  4CDF C;  1EOV A;  4QCL A;  3A74 A;  1CQV A;  1XMQ Q;  2F52 A;  1PRT F;  3CME A;  3MEH A;  4YHH Q;  1IL2 A;  2LXJ A;  1OXV A;  1ZEQ X;  5E3F A;  4ZAI A;  4A3M G;  2XIW A;  2CCZ A;  5KGU A;  3A56 A;  3KLW A;  2WAQ E;  1I6H H;  2QW7 A;  2EY1 A;  1TWC H;  1ESF A;  4MTN A;  2PQA A;  1TT2 A;  3GTL B;  2QEX A;  4P74 A;  5IGG A;  5DM6 3;  1U5K A;  4IUP A;  2FFK B;  1GHJ A;  2PMZ B;  1HNX L;  4LF5 Q;  3JAM L;  1CA6 A;  4H7B A;  5IGD A;  5C0X G;  1B50 A;  2SDF A;  3K5N A;  3KLS A;  5M5Y H;  1HNX Q;  4LF5 L;  4OX9 L;  1DOL A;  1I4X A;  3RLN A;  1F2Z A;  1MJC A;  5F2D A;  4A3L H;  5C44 G;  1GUS A;  3K5O A;  5JPN C;  1SBB B;  5C4X H;  2JA7 H;  3EVQ A;  4C3I G;  5BN4 A;  5M5X H;  4IFD H;  1GKH A;  4N8F A;  5IYD H;  1SFO B;  2PQE A;  4IPG A;  4HSV A;  3U4Z A;  3N52 A;  3A55 A;  3S9W A;  1XWE A;  4IAL A;  1CK1 A;  3EA6 A;  5KRU A;  4JW0 A;  3QIA A;  1V9P A;  1DOK A;  1CSQ A;  2RSN A;  2AHO B;  3BS1 A;  4JPB W;  2JQO A;  4B3T L;  3T16 A;  1NTG A;  4HSP A;  3H91 A;  1S40 A;  4RCN A;  1Y1V G;  3PO2 B;  2R93 H;  3ULL A;  1J5E Q;  2DY8 A;  4J1M A;  1IBM L;  3K6O A;  1NMG A;  4NW2 A;  2NWG A;  4DN4 M;  3NPP A;  2K75 A;  1PTO B;  4C2M B;  3KBX A;  4C3H G;  4PZ6 A;  3X3M A;  4A3M B;  3KJP A;  1OTC A;  4O1N A;  3BVM A;  2EYO A;  4DAV A;  3CP0 A;  1DJR D;  1F77 A;  1TU2 B;  4P75 A;  3RN5 A;  3S1M B;  1S3O A;  2E2J H;  1OXU A;  1KNA A;  1BXT A;  4G7H C;  4UP8 A;  1R9T H;  2O2L D;  3HOU G;  1SMY D;  2L4N A;  2PO4 A;  3I4M B;  2H1E A;  3K58 A;  5GAD C;  2RVL A;  2Q8T A;  2KJX A;  2N49 A;  2IY5 B;  3VDY A;  1EY6 A;  1FJG L;  4B3T Q;  2D62 A;  4KN4 C;  1Q1E A;  4BBS B;  1ZKO A;  4B3M Q;  1IZ6 A;  2WKC A;  4R8I A;  2FIN B;  4KHZ A;  1JT8 A;  1AE3 A;  3H09 A;  4TRD A;  3M7G A;  3GTP H;  4DUY L;  4RKB A;  3DWP A;  1AN8 A;  4C3I B;  2E5L Q;  4JOI A;  4O42 A;  4PV1 C;  4JI6 Q;  1PXU A;  1QCB D;  3E6Z X;  1YVC A;  4NPS A;  5J1Z A;  2L12 A;  2PCF B;  2NB0 A;  4A3F H;  3HKZ E;  4RHS A;  1ML0 D;  4J15 A;  1HZB A;  3HOU H;  2NVY B;  2F0L A;  2WKD A;  1GUO A;  1PHJ A;  1UE5 A;  4WJ4 A;  5JJZ A;  5C4J H;  4Y7N B;  2UXC L;  1GO3 E;  2B39 A;  4GOP B;  4LJZ C;  2B2V C;  2P5Z X;  3V96 A;  5K36 G;  1NJI C;  1E22 A;  4DR1 Q;  1LT5 D;  1KC8 C;  2NVT H;  3MWY W;  4JYA L;  3PV0 A;  1RCV D;  3B6Y A;  4JI8 Q;  2MNA A;  2MO1 A;  4DV7 L;  1JR0 D;  2LMC B;  3OMG A;  1STH A;  1SYF A;  5KYI A;  5IYB H;  3FKI H;  3SK4 A;  1PFM A;  1PA6 A;  2MGS A;  5FO7 B;  4F88 A;  4J8Q A;  1W6K A;  4DR5 L;  3DMU A;  4GNX B;  1PZJ D;  2MO0 A;  5FLX c;  3CCJ A;  1PFS A;  5EAY A;  3PO2 H;  3FDT A;  3BZC A;  4C1N K;  4X65 L;  4LF7 Q;  2YTV A;  1EOT A;  3R3O A;  1H9R A;  4KHV A;  1EYD A;  4DPG A;  4KY5 A;  4GN5 A;  3NQT A;  4DAY A;  3M4P A;  1B9N A;  2KED A;  2NYZ D;  2A1A A;  1XMO Q;  3J81 i;  1GXD C;  1MD2 D;  5IYB G;  4GLX A;  5GAE C;  4XT3 B;  1WD1 A;  4CGY B;  4LFA L;  2HCC A;  1H9S B;  1GJX A;  1QUQ B;  4YIJ A;  4HJ9 A;  1B3A A;  3MHB A;  4JI2 Q;  3CCR A;  4A3D H;  3HOX B;  1SYC A;  3CCV A;  2F0U A;  1EIH A;  1BOS A;  1MI2 A;  3PUY A;  2OTL A;  4PZ8 A;  1IHZ A;  4H44 C;  1DCZ A;  3F2U A;  4LF9 L;  1X3E A;  4JI4 Q;  5M3M H;  4LF4 L;  1EWC A;  1K83 B;  4TSS A;  5D65 A;  4Q0F A;  2DJG C;  3PMF A;  1N34 Q;  4BY7 H;  4DNT B;  5IGE A;  4DR4 L;  2JA5 B;  2MUY A;  4ID6 A;  1R4Q B;  3CAM A;  4RGM A;  4RH6 A;  2ES2 A;  2FMM A;  4A3K B;  1BBU A;  2JA8 G;  2K32 A;  4OWX B;  2O5I C;  1X3F A;  3DM1 A;  2DY7 A;  2L11 A;  1Y1W B;  3HOY G;  4L8J A;  5EPJ A;  3UDX A;  3S2H H;  1T5E A;  1SEB D;  1OO9 B;  2H5X A;  3HOZ B;  3MXN A;  1MBY A;  2XRS D;  3H0G B;  3C3L A;  4NXM Q;  4FDB A;  2L1B A;  4JV5 Q;  3CCM A;  3HS0 C;  2JA7 G;  4WJ3 M;  1LTA D;  1YNN C;  1HQM C;  3HKZ B;  3HRZ C;  4G57 A;  3TS0 A;  4C3J G;  1EQT A;  1HUN A;  3ZYY X;  1HHV A;  1LAC A;  5M3M G;  2F0S A;  4A3F G;  5FLM H;  2A69 C;  1MJE A;  1ILP A;  3DM3 A;  3S1M H;  4JI0 L;  1IL8 A;  2JA6 H;  4IOC A;  3CU7 A;  1CSP A;  4NXN L;  4KI0 A;  1A62 A;  5C3E B;  2A6H D;  1X3P A;  1BUV T;  5C44 H;  4C3J H;  1EY7 A;  4EX5 A;  4PG3 A;  4POF A;  3A5Z B;  1L0Y B;  2TSS A;  3H3V C;  4BWG B;  3ULP A;  2EXD A;  3NP8 A;  1Q1B A;  1VQ4 A;  2GVA A;  4WFN 3;  3KF6 A;  1B44 D;  1UAP A;  4HIM A;  1WCM H;  2DNC A;  4QL5 A;  4B3M L;  1S4Z A;  1SAP A;  2F3W A;  2IW3 A;  1X65 A;  1KRS A;  3T56 B;  2NBF A;  3FKI G;  2HHH Q;  3KK7 A;  5IYC G;  3J80 E;  2MJ8 A;  1HR0 Q;  3H3V H;  3IRB A;  4DR6 L;  5GQO A;  4HN7 A;  1WYD A;  2F4V L;  1BCP B;  1BVS A;  3KF8 B;  3MTS A;  1IW7 C;  1TWG B;  2KUM A;  5CR3 A;  4UY8 C;  1JE5 A;  1FGU A;  1SRU A;  2FMC A;  3F2B A;  4P2C B;  4DK1 A;  3FP9 A;  1QZG A;  3HOZ G;  4A75 A;  2ZJR A;  1EQV A;  3GV6 A;  2PI2 A;  1YHQ A;  1RDP D;  1CZW A;  3C1F A;  1M8A A;  2OEO A;  4PMC A;  2ALY B;  2BA1 A;  4X6A H;  1KIX A;  3BYY B;  5K5P A;  1CKN B;  3SK6 A;  4KHP L;  1EIG A;  2IHF A;  4A3B B;  1VQE A;  3SR1 A;  3KFU A;  2F0E A;  4FF1 A;  3URY A; 
#chains in the Genus database with same CATH homology
 2MFI A;  4BBS H;  5M5W H;  1HH2 P;  1HZA A;  1A63 A;  1Q86 C;  1YEZ A;  4LF8 L;  3NEM A;  2VNU D;  1EQQ A;  2JEA I;  4MZ9 A;  4LFB L;  3ER0 A;  3K80 C;  5C3E G;  3HOW G;  1I94 L;  3M3Y H;  4P71 A;  4JI6 L;  2GVB A;  2F4V Q;  1U0L A;  4DR4 Q;  1PH6 A;  3PGZ A;  3WWV A;  4DV1 L;  4DUY Q;  3G6E A;  5GAH C;  1KQS A;  2KCT A;  2WB1 E;  4JI4 L;  4IO9 A;  4L5R C;  1K8G A;  3FHW A;  4BA2 I;  1E1T A;  3EIV A;  4HIK A;  3W1G A;  4H02 A;  1D8L A;  2ASB A;  1VQB A;  1YHB A;  5LMU L;  1AE2 A;  1YJW A;  2UXB Q;  1X9N A;  1QUQ A;  3L2P A;  4APV A;  2L15 A;  3RZO H;  5C3E H;  1HJP A;  2E5L L;  1XTD A;  3KYH C;  4X66 Q;  4RG1 A;  1N36 Q;  2AKW B;  1JJ2 A;  4YWM A;  3A0J A;  3I4N H;  5HGQ A;  1VQ8 A;  1N36 L;  1JB7 A;  4X64 L;  3K8A A;  4DR5 Q;  2R7Z G;  4XIG S;  4DV2 Q;  2PNH A;  1VQ7 A;  3PF4 A;  3U58 A;  3BZK A;  1QZH A;  4DUZ Q;  4IFD J;  3K81 C;  3CQZ H;  4GNX C;  4JI2 L;  4UP9 A;  1YHA A;  3TQY A;  4B3R Q;  3UDI A;  3W1B A;  3HOV G;  3CPW A;  4A93 H;  5IP9 G;  1WCM G;  4DV4 Q;  1PYS B;  3RR5 A;  3MXN B;  4AIM A;  1VQL A;  2Q2U A;  4OX9 Q;  4JI5 L;  3GO5 A;  1Y1W H;  2LSS A;  1Z47 A;  1X6O A;  3F2D A;  4YY3 L;  3UDG A;  4K0K L;  2IX0 A;  1YJN A;  3HKS A;  4OO1 I;  2K5V A;  2I5H A;  3I4O A;  2NVQ H;  1HZC A;  1YJ9 A;  2PI2 E;  4TVA B;  3PUW A;  2N8N A;  4IPC A;  1Z9F A;  2CWP A;  3G71 A;  1PV4 A;  1LYL A;  2RCN A;  1WJJ A;  1PH8 A;  3EN2 A;  3GTJ H;  3S16 H;  3T1H L;  2AWO A;  5AJ3 Q;  3J80 i;  1PH4 A;  1V1Q A;  4A3E G;  4JI0 Q;  3I4M H;  2I5M X;  4L5S A;  1HNW Q;  4A3B G;  2BA0 A;  4DV0 Q;  2VZA A;  1GVP A;  2JK8 A;  4A3E H;  5IP9 H;  4DR7 L;  1EOV A;  2K14 A;  1J5E L;  3A74 A;  3S24 A;  3L0O A;  1VQH A;  2QA4 A;  3S1R H;  1XMQ Q;  2F52 A;  4DV0 L;  3PF5 A;  2JE6 I;  4OWT B;  4BBR H;  4B3S Q;  2B63 G;  3UE0 A;  3CME A;  4YHH Q;  1IL2 A;  4IFD G;  1QVC A;  2LXJ A;  1OXV A;  5AJ3 L;  3CXC A;  4A3M G;  1PH9 A;  2UUB Q;  2CCZ A;  2Q2I A;  3KLW A;  2WAQ E;  5JJK A;  1E24 A;  1XMQ L;  5GRO A;  5IP7 G;  3PUZ A;  1NBW A;  1TWC H;  2K5N A;  5H1S E;  4A93 G;  3HOV H;  3CD6 A;  4MTN A;  3T1Y Q;  5IP7 H;  2PQA A;  1N33 L;  1PVO A;  2QEX A;  1VQC A;  3HOW H;  4A3B H;  4P74 A;  2BH8 A;  4R4Q A;  2KHJ A;  4R4O A;  1U5K A;  1HNW L;  4GLV B;  2YTY A;  1EWI A;  5IWA Q;  2K4K A;  3TEH B;  2R7D A;  1VQN A;  5IT9 c;  3GTQ H;  2E2H H;  2OTJ A;  1HNX L;  4LF5 Q;  4LF9 Q;  2ZJP A;  4BBS G;  2OCE A;  2RHS B;  5C0X G;  3MEF A;  1N32 Q;  1K83 H;  1OXS C;  1I50 H;  3RLO A;  1UWV A;  4HID A;  4JI7 L;  4DNI A;  1BBW A;  4GOP C;  5M5Y H;  4AYB E;  1VQI A;  1HNX Q;  4LF5 L;  3RLN A;  4OX9 L;  4DR6 Q;  2XTI A;  1MJC A;  1YI2 A;  4A3L H;  2N3S A;  2NN6 I;  5C44 G;  3H15 A;  2HHH L;  3M4Q A;  4JI3 Q;  5C4X H;  4C2M H;  1EFW A;  2JA7 H;  2R7F A;  2XGT A;  1QVG A;  4A3C G;  3K0X A;  2KEN A;  3T1Y L;  4A3M H;  5M3F H;  5M5X H;  1GKH A;  4GNX A;  1SRO A;  2ZTC A;  3JAM c;  4A76 A;  5C4X G;  5IYD H;  1G6P A;  2R6G A;  3D0F A;  4YCW A;  4IPG A;  5IY0 A;  3U4Z A;  1Q81 C;  1Q46 A;  4A3G H;  2R93 G;  2UXD Q;  3CC2 A;  2OWO A;  2JA5 H;  1K3R A;  3W5O A;  3J81 c;  4DV7 Q;  3AYH B;  4YCV A;  3M85 A;  4A4I A;  4BXX G;  1B70 B;  4BY1 G;  1PH5 A;  3HOY H;  3K7U C;  1E1O A;  4R4C A;  3ULJ A;  4HIO A;  1C9O A;  1NY4 A;  1SR3 A;  1YZ6 A;  1VQ6 A;  1K73 C;  2B63 H;  1KAW A;  2MQH A;  2IX1 A;  1I94 Q;  3PO3 H;  1V9P A;  4JI1 L;  1KRT A;  1CSQ A;  1VS0 A;  2AHO B;  4DR1 L;  2Q2H A;  4IFD I;  1J6Q A;  1TWA H;  2JQO A;  4B3T L;  2VUM H;  4HJ8 A;  1VQ9 A;  4BY7 G;  1EIY B;  4GKJ L;  1JJC B;  4YHH L;  1NTG A;  4LF6 L;  4JI8 L;  2I0Q A;  1A8V A;  2CWA A;  2UU9 Q;  3GTM H;  4HJ7 A;  1S40 A;  2R93 H;  1Y1V G;  3CF5 A;  1VQM A;  3ULL A;  4L5T A;  1J5E Q;  1UE6 A;  1KXL A;  3G48 A;  1IBM L;  1NMG A;  3HOX H;  4TQU S;  2K75 A;  1OXT A;  2VY3 A;  3RZD H;  4LUZ A;  2YYZ A;  1SLJ A;  4PZ6 A;  5JJL A;  3KJP A;  3EBE A;  3PUX A;  1OTC A;  1E7Z A;  3CP0 A;  4P75 A;  3RN5 A;  1Y14 B;  4LNQ A;  3S17 H;  4JI1 Q;  1CUK A;  4GLA C;  1S3O A;  2YTX A;  4DV3 L;  2CQO A;  4DV2 L;  2E2J H;  2VS1 A;  1OXU A;  3HOU G;  1R9T H;  4UP8 A;  3CMA A;  4A3D G;  1KHI A;  2LXK A;  4YY3 Q;  5GAD C;  1B8A A;  5LMN Q;  1JJG A;  1K9M C;  4LF6 Q;  4JBW A;  5JEA J;  1JMC A;  2IY5 B;  2N49 A;  4Y7N H;  3U50 C;  3RN2 A;  3PO3 G;  3VDY A;  2OQ0 A;  1XPO A;  1FJG L;  2NZO A;  4B3T Q;  3KJO A;  2D62 A;  1Q1E A;  4GKK Q;  2JA9 A;  3LGJ A;  2RF4 A;  4QY7 A;  4B3M Q;  3AFQ A;  4HJA A;  1IZ6 A;  3I56 A;  2IT1 A;  4X64 Q;  1HR0 L;  4AQY L;  2UUA Q;  1Y1V H;  3PSI A;  4KHZ A;  1JT8 A;  4DR3 L;  4DAM A;  1AE3 A;  1VQD A;  1I3Q H;  3GTP H;  1TXY A;  4DUY L;  3PIO A;  3J7A 5;  4OWW B;  4KLK A;  4AQY Q;  3ERS X;  4DK6 C;  1XNQ Q;  3CCQ A;  2E5L Q;  4JOI A;  4JI7 Q;  4JI6 Q;  3S14 H;  3ICE A;  4NPS A;  1YVC A;  5LMU Q;  4PZ7 A;  3S15 H;  1PH1 A;  5IWA L;  1FJG Q;  5JEA G;  4A3F H;  3HKZ E;  1L1O B;  1UE1 A;  3RLF A;  1TWF H;  2DUD A;  1EIF A;  4EQ5 A;  4J15 A;  3TRE A;  1HZB A;  3HOU H;  2CKZ B;  1PHJ A;  1ASZ A;  2JA5 G;  1XNR L;  3M7N A;  2K50 A;  1C0A A;  1HNZ L;  1UE5 A;  4QIW E;  4WJ4 A;  5C4J H;  1XPU A;  3SGI A;  2UXC L;  1GO3 E;  4GOP B;  2NVX H;  3CCS A;  1SMX A;  2B29 A;  4A3J G;  2HIV A;  4GKJ Q;  1G29 1;  2Z0S A;  5K36 G;  3E9I A;  4DV5 L;  1NJI C;  1M1K C;  1E22 A;  2VUM G;  5HY6 A;  3J7Z C;  1RL2 A;  4DR1 Q;  1P8L A;  1TWH H;  1KC8 C;  2GN5 A;  3PO2 G;  2NVT H;  3M4O H;  3CC7 A;  4DR7 Q;  2ZJQ A;  1IYJ B;  4JYA L;  3PV0 A;  1IXR A;  5FJ8 H;  4ME3 A;  1B7Y B;  2I5L X;  4DV5 Q;  3B6Y A;  4JI8 Q;  2MNA A;  4BY1 H;  2MO1 A;  4DV7 L;  1XPR A;  2FXQ A;  2K52 A;  3BJU A;  3HKZ G;  1VCI A;  2VW9 A;  4KHP Q;  4NB3 A;  1L0W A;  1UEB A;  5FLM G;  1OXX K;  5IYB H;  3FKI H;  4RMF A;  1DGS A;  4O2D A;  4YWL A;  1PA6 A;  1VQA A;  4IPD A;  4JYA Q;  1VQ5 A;  3I4M G;  4DR5 L;  1C7Y A;  1YBY A;  2A19 A;  1W2B A;  2R7Z H;  4GNX B;  2MO0 A;  5FLX c;  3CCJ A;  1PFS A;  5EAY A;  3PO2 H;  3OYY A;  3T1H Q;  3BZC A;  1I5F A;  2JJQ A;  1LM0 A;  4X65 L;  1PH3 A;  2YTV A;  4LF7 Q;  4JV5 L;  1WOC A;  1WI5 A;  4DPG A;  4GN5 A;  4YCU A;  1Q7Y C;  2UXC Q;  4DV6 Q;  3KF6 B;  3M4P A;  3D31 A;  2A1A A;  1UE7 A;  3J81 i;  1XMO Q;  4A3I G;  2HIX A;  1CKN A;  2CFM A;  5IYB G;  3I7F A;  5GAE C;  4DK3 C;  2VQF L;  4GLX A;  1N34 L;  2NZH A;  2YU9 H;  1EQR A;  2QGQ A;  1RIP A;  4LFA L;  4IOA A;  3KOJ A;  1H95 A;  4QJF A;  5IYD G;  4Y52 H;  4JG2 A;  1QUQ B;  1PYB A;  2AWN A;  3H0G H;  3OTO L;  4HJ9 A;  4A3K H;  5FJ8 G;  4JI2 Q;  3CCR A;  2ZTE A;  3PCO B;  4A3D H;  4DV1 Q;  4K0K Q;  4DKA C;  3CCV A;  4DUZ L;  4GN4 B;  1GD7 A;  3PUY A;  4R1J A;  1VQO A;  2Z6K A;  3PIP A;  4PZ8 A;  3CPF A;  2OTL A;  2EIF A;  1WFQ A;  1S72 A;  1MKH A;  4LF9 L;  1X3E A;  2Y0S G;  2WAQ G;  4JI4 Q;  4POG A;  4OON A;  5M3M H;  4LFB Q;  2ZTD A;  3GD7 A;  4JBK A;  1P16 A;  2Q2T A;  4LF4 L;  1X54 A;  3KDF A;  1LUZ A;  4LUV A;  1N34 Q;  3J80 c;  4BY7 H;  2JA8 H;  2F3I A;  3U4V A;  2VL6 A;  2YV5 A;  4DR4 L;  1XMO L;  1N33 Q;  1E3P A;  1PH7 A;  2JA6 G;  4A3G G;  1TWG H;  4R4I A;  4OO1 G;  3CAM A;  2ES2 A;  1MIU A;  1BBU A;  4YWK A;  2AMC B;  4BA1 I;  2JA8 G;  3I4N G;  4OWX B;  1SE8 A;  1X3F A;  4C3I H;  2A8V A;  3HOY G;  3M9B A;  2KCM A;  1EYG A;  3UDX A;  3I2Z A;  2WP8 J;  1T9H A;  3STB D;  4X62 L;  3S2H H;  5BR8 Q;  3F2C A;  2ZM6 L;  2H5X A;  3K7A H;  4A3I H;  1FVI A;  3NEL A;  4UPA A;  3S1N H;  3E0E A;  2PQA B;  4R4T A;  1KD1 C;  3CCE A;  3PUV A;  1Q8K A;  5ELN A;  3UDF A;  4OXP A;  3JAM i;  4JOI C;  1A0I A;  4L5Q A;  5GAG C;  4DV3 Q;  3AFP A;  4NXM Q;  3E9H A;  4FDB A;  4IPH A;  4LWC A;  4JI5 Q;  4NXN Q;  2JEB I;  5JJI A;  2Y0S E;  4JV5 Q;  3CCM A;  4DV4 L;  1FL0 A;  2JA7 G;  4WJ3 M;  3GTL H;  3TS2 A;  2K5H A;  4LUO A;  3CCL A;  3GDE A;  1I6H H;  3TS0 A;  3GTO H;  1N32 L;  4JC0 A;  2RHQ B;  2VQE Q;  4DR2 L;  3AEV A;  1VQP A;  1Q82 C;  5M3M G;  4GS3 A;  4C3H H;  1X55 A;  4A3F G;  4UP7 A;  2VQE L;  3KDF B;  5FLM H;  4A3C H;  1L2F A;  2E8G A;  1MJE A;  2ZM6 Q;  3DM3 A;  1XNR Q;  3S1M H;  2UU9 L;  4QQB X;  1XJV A;  4JI0 L;  1NE3 A;  2ID0 A;  1N9W A;  4IJL A;  2JA6 H;  4LW1 A;  2D0O A;  3CCU A;  4IOC A;  2UXD L;  1CSP A;  2C35 B;  3G4S A;  2D0P A;  4NXN L;  4AYB G;  4KI0 A;  2EQS A;  1A62 A;  2E2I H;  1QVF A;  3JC6 6;  2HQL A;  1K8A C;  1KL9 A;  5C44 H;  2OQK A;  4C3J H;  1ASY A;  3F8T A;  3CW2 C;  4EX5 A;  2UUC L;  4JI3 L;  4PG3 A;  4POF A;  3A5Z B;  3HFZ B;  5BR8 L;  3OTO Q;  1HR0 W;  3ULP A;  2BH2 A;  4PMW A;  2EXD A;  3H3V I;  1Q1B A;  1VQ4 A;  1YIJ A;  1VQG A;  4XTC S;  1IBL L;  4B3R L;  2GVA A;  1GM5 A;  4DR3 Q;  1EUJ A;  4X66 L;  5E7N A;  5C0X J;  4LFC L;  2VQF Q;  3KF6 A;  2Z6K C;  5DLQ E;  3HOX G;  3UE1 A;  2R92 G;  1G51 A;  4HIM A;  1CKO A;  1WCM H;  2UXB L;  4GN3 B;  4LFC Q;  4QL5 A;  1HNZ Q;  1XNQ L;  2KHI A;  2N78 A;  1L1O A;  4B3M L;  4A3L G;  1D7Q A;  1NMF A;  1K0R A;  1BKB A;  4BXX H;  1X65 A;  4LF4 Q;  3Q8D A;  4DAY B;  4X65 Q;  1N8R C;  1KRS A;  3I55 A;  4AH6 A;  4LF7 L;  3DLL A;  3FKI G;  1IBL Q;  5M3F G;  4LF8 Q;  2HHH Q;  2B3G A;  3STB C;  1M90 C;  2HT1 A;  4LFA Q;  4QGU A;  5ELO A;  5IYC G;  4BBR G;  2UUC Q;  1V43 A;  1SFO H;  1HR0 Q;  1VQJ A;  3F1Z A;  5LMN L;  3IRB A;  5J3B A;  2UUA L;  3H3V H;  3TRZ A;  4DR6 L;  5GQO A;  3A5U A;  1L1O C;  5IYC H;  1WYD A;  2F4V L;  1LTL A;  2NVY H;  3BU2 A;  4A3K G;  1BVS A;  3KF8 B;  1Q12 A;  4P72 A;  4O0A A;  5IE8 A;  4DR2 Q;  3RNU A;  1SN8 A;  3OW2 A;  4JBM A;  1YIT A;  1JE5 A;  1Y1W G;  4UY8 C;  1FGU A;  3GTG H;  3S1Q H;  3ZJY C;  4B3S L;  1SRU A;  3J81 j;  1AH9 A;  1X3G A;  2DGY A;  3L7Z C;  4MNO A;  3F2B A;  1VQF A;  1CKM A;  3FP9 A;  4JCV E;  4A3J H;  1QZG A;  3HOZ G;  1W3S A;  4HJ5 A;  4DV6 L;  2WFW A;  2ZJR A;  4A75 A;  1PH2 A;  4NXM L;  2PI2 A;  3GTK H;  2V1C C;  1YHQ A;  1IBK Q;  2NN6 G;  2ATW A;  2IHE A;  5LMN W;  1VQK A;  4GKK L;  2PMZ E;  3H0G G;  3HOZ H;  4X6A H;  2ALY B;  2BA1 A;  1KIX A;  4ALP A;  2WB1 G;  2R92 H;  3S2D H;  1YNX A;  1CKN B;  1O7I A;  2UUB L;  4KHP L;  2IHF A;  4P73 A;  4X62 Q;  4JBJ A;  5C0X I;  1VQE A;  1X56 A;  3AQQ A;  3KFU A;  3NBH B;  3NEN A;  1IBM Q;  3CC4 A;  1HZ9 A;  4IJH A;  4GOP A;  1IBK L;  2KBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...