3VDYA

B. subtilis ssbb/ssdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
101
Chain Sequence
HMFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYEVNVYVTEVLADTVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein ssbB
publication title Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
total genus 16
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3vdyA00
4R4OA 1I6HH 2QGQA 2K50A 1WJJA 1LM0A 2D0PA 4EQ5A 2E5LQ 2B63G 2F4VQ 1N36L 4HJ5A 3S1NH 4DV7Q 3U4VA 3RZDH 1SRUA 4JOIA 1IZ6A 2I5HA 2VL6A 3A5UA 1KHIA 4C3JH 1Q7YC 4DR6L 4A3DH 3S1MH 3CCSA 4BBSH 5HGQA 1OTCA 2JEAI 5C3EG 1PYSB 4OWTB 4A3CH 1AH9A 4POFA 1X55A 2ZTEA 3VDYA 2KCTA 2N49A 4P75A 3B6YA 4DR7L 1B7YB 4DV1Q 4GNXA 4JI6L 2CWAA 1GM5A 3NEMA 4DV5Q 2A1AA 3JC66 2ES2A 2UUAQ 1XNRL 1HNWL 1PH9A 2UXBL 3H3VH 4DR7Q 3MEFA 2AWOA 1KRTA 1E24A 5E7NA 4JI5Q 3PUVA 1GKHA 1K0RA 5IYBG 3CMEA 5M3FH 1X56A 3KLWA 3PUYA 1PH3A 4LFBL 3CMAA 2AMCB 3FKIG 1Y1WG 2CCZA 1VQDA 1PH2A 2XTIA 1Z9FA 1SFOH 3KOJA 4BA1I 1G6PA 2F52A 1H95A 4AQYL 2BA1A 1JJCB 4DUYQ 4KHZA 1BBUA 4A3LH 2IHEA 4HJ8A 4LF8Q 3L7ZC 2JA5G 2NVTH 4DV0L 4BBSG 1QVGA 1A8VA 2VQEL 4HJAA 1C9OA 3HOYH 4JBMA 4X66L 1R9TH 4A3CG 3ICEA 2R93H 3TQYA 3U4ZA 1VQKA 3A5ZB 2ZJPA 4YWMA 4AH6A 1YIJA 4O2DA 1XMOQ 4L5QA 3FHWA 4DUZL 1OXSC 2ZJRA 1HR0W 2HHHQ 2ZM6Q 1IXRA 1G291 4WJ3M 1DGSA 4HJ9A 2MO0A 3M4QA 4GN4B 4DV2Q 2K5NA 4TQUS 4YY3Q 3OTOL 2QA4A 1YHBA 2WB1G 2I0QA 1KXLA 4QY7A 1J6QA 3CQZH 1RIPA 1TWAH 3K7AH 3UE1A 2R92H 4LWCA 4ME3A 3HOXH 4PMWA 1VQBA 1I94L 3H3VI 3STBD 4H02A 2CWPA 3RLFA 1YHQA 2Z6KA 4GOPC 4LFAL 1KAWA 2N78A 1M90C 1I94Q 4OO1G 4JI3L 2VQFQ 5BR8Q 3GTJH 4A93H 3U58A 2UXDQ 4YCUA 1VS0A 1L1OB 2VZAA 1V1QA 3HOVG 4JV5Q 4Y52H 3NBHB 4JI3Q 4DKAC 2R7DA 4IOCA 4JCVE 4LF6L 4HIOA 2CFMA 4JI8Q 1JE5A 4LF9L 4A3FG 3HOYG 3RN2A 3RLOA 1EUJA 3HOUH 5FLMG 4A3GH 4X62L 3RNUA 4HIDA 4UP8A 2YYZA 5GROA 1YNXA 5DLQE 4JI4Q 1K3RA 1CKMA 1EOVA 4AYBG 5M3MG 4L5RC 4X62Q 3RZOH 1QUQA 5C4XH 2Q2IA 3I56A 4DR2L 4B3RL 4IOAA 4YHHL 1QVCA 3EBEA 4JBWA 4LF7L 4MTNA 4LFCL 2JA8H 3S15H 4B3RQ 2K5VA 3AYHB 3PF5A 1XPRA 1MJEA 1UE5A 1VQAA 2EXDA 4JI0L 4PG3A 4EX5A 1VQ6A 4YCVA 4X65Q 2YV5A 2KHIA 4JI0Q 4NXNQ 4A3EG 1VQ5A 1E1OA 2WP8J 4DR3L 4GLXA 1FJGL 2WAQE 4IJHA 2Q2UA 3ULLA 2OTLA 4BXXH 1N32L 3W1GA 2N3SA 2EQSA 2ATWA 4DR3Q 1VQGA 3EN2A 3DM3A 2K14A 1JJ2A 2ID0A 3KDFA 5AJ3L 4LNQA 1TWCH 5K36G 4IPDA 2GN5A 1VQHA 4UY8C 1XPUA 4K0KQ 4A3JG 2R7ZH 5IWAL 5FLXc 4JI7L 1CSQA 3TEHB 5AJ3Q 3UE0A 5C44G 4DK3C 3KF6A 3G71A 1HNXL 3GTPH 1HR0L 1WCMH 3K7UC 2NZHA 2IT1A 3NENA 4A3BH 4AIMA 5LMUL 3PO2G 1HZAA 1VQIA 3ZJYC 2E8GA 2PQAB 1X65A 5LMNW 1VQFA 1Q86C 5GAGC 3E0EA 3Q8DA 4LF5Q 4JI1L 3F2BA 4A3MH 1EIFA 2CQOA 1IBKQ 3CD6A 1IBKL 2ZTDA 3K80C 1BVSA 3I4OA 4L5TA 2A19A 1IL2A 3I2ZA 2OWOA 5IYDH 3HKZG 1YITA 1N36Q 4P73A 4PZ8A 2VNUD 3D31A 4DR1L 4DV4L 1PH6A 4BXXG 3I4NG 4JOIC 1IBLL 4DR6Q 3CAMA 3ULJA 3KJOA 1I3QH 5ELOA 4DV4Q 5IT9c 1FL0A 1VQ9A 3CC7A 2JE6I 3S1RH 4FDBA 1HJPA 1VQPA 2BH2A 1M1KC 1A63A 3JAMi 1XMQL 4NXML 1N34L 4A4IA 1NBWA 4GNXC 1S40A 2HQLA 1B8AA 2UU9L 4JI6Q 1XNRQ 3AFQA 1HNWQ 2OTJA 2UXBQ 4JBKA 2JA6G 3AFPA 3I4MG 4BY1H 3K0XA 1W3SA 4OONA 2JA7G 2D62A 3CCQA 3S16H 1Y1WH 1E7ZA 1IBML 2ZTCA 1QZHA 1UWVA 5IP7H 1A0IA 1VQCA 3BZCA 3H15A 4LFBQ 2UUCL 3HOWH 3PIPA 2RHQB 4A3MG 3J81c 2MO1A 5ELNA 2UUCQ 2BA0A 1VQ7A 4GKJL 3LGJA 3GO5A 1QVFA 2RCNA 4A3DG 4AQYQ 4KHPL 1YZ6A 2NVQH 4P74A 2HIXA 3UDXA 5GQOA 3S24A 1YI2A 1KL9A 3M3YH 2ASBA 4DV0Q 2VQEQ 1JJGA 4X64L 4X66Q 3TS0A 4HIKA 2K52A 5M5WH 3G48A 3UDIA 1MJCA 1PH1A 1X3GA 3CF5A 4YWLA 1KQSA 3GTLH 1X3EA 2WB1E 4JG2A 3H0GH 4DUZQ 5LMNL 1LYLA 1TXYA 5IY0A 5M3FG 4R4TA 3GTGH 2JEBI 3BZKA 3MXNB 3PO3H 4GKKL 3OTOQ 5LMNQ 1PH5A 4BY7H 2I5MX 4LUVA 3OYYA 4JC0A 3U50C 5FJ8H 4C3IH 5C4JH 4R4IA 3BJUA 5GAHC 1J5EL 1JT8A 1N9WA 2GVBA 3F2CA 1L1OA 4RMFA 4P72A 5JEAG 5IP7G 1ASZA 2ZJQA 1N33L 3J80i 2NZOA 2NVYH 1UE6A 1HZ9A 4R4CA 4LUZA 4LFAQ 4YCWA 4A75A 2Z6KC 1C0AA 4JI2L 1YJNA 1VCIA 4A3LG 2VY3A 3DLLA 3NELA 2DGYA 4LUOA 5JEAJ 2R93G 3RLNA 3S2DH 3T1YL 3CC4A 4LF6Q 4GKKQ 1PA6A 4AYBE 4LF9Q 2YTYA 3BU2A 4GLAC 3IRBA 2C35B 1SROA 1P16A 1WFQA 4GS3A 4LF4L 4DR4L 1CKOA 3PUZA 1A62A 4GOPB 5JJLA 5IYCH 3HOZH 1I50H 1YVCA 3TS2A 1SMXA 2D0OA 2PNHA 2HT1A 1S3OA 1HZCA 2Z0SA 5J3BA 4DR2Q 2OQ0A 1K9MC 3M4PA 4YHHQ 3CCUA 3T1HL 1KIXA 3M7NA 4LF7Q 4LFCQ 3GTKH 1X9NA 2R92G 2F3IA 2VS1A 3HOXG 1K73C 3GTQH 4IPGA 3T1HQ 3F2DA 2LSSA 2KENA 4Y7NH 4BBRH 4DR5L 1WI5A 1VQNA 1GVPA 4IFDI 3PCOB 5IP9H 1E1TA 1RL2A 3CPWA 3CCLA 4A3IH 1FJGQ 4JYAL 4A93G 3I7FA 3M9BA 4GN3B 3TRZA 1N32Q 4R4QA 3HFZB 2Y0SG 2YTXA 2K4KA 5M5XH 3S1QH 4C2MH 2QEXA 4J15A 1K8GA 2KBNA 1UEBA 2B63H 3HOUG 3J81j 4A3GG 3K8AA 2PQAA 5IWAQ 4JI7Q 3PUXA 1QZGA 4MNOA 4BA2I 1HNXQ 1HR0Q 4QIWE 4DV3L 1HNZL 4B3ML 5C4XG 3RR5A 4LW1A 1L0WA 5LMUQ 5IYCG 1VQ8A 1Q12A 2PI2A 4IPHA 1E22A 2IX1A 1AE2A 3KFUA 2MQHA 2JA8G 4P71A 4QGUA 2E2IH 4OWXB 4B3SL 2I5LX 4X6AH 3HKZE 2UUBL 4OX9L 4JI1Q 1WOCA 2MNAA 5JJKA 1XNQL 1IYJB 3CW2C 3ERSX 1D7QA 4ALPA 4B3TL 2OQKA 4KI0A 3PF4A 5IYBH 1Q1BA 1YBYA 3G4SA 4DR1Q 4IJLA 3L2PA 1IBLQ 3KYHC 1V43A 1YJWA 4O0AA 2E5LL 1PFSA 1EQQA 3FKIH 2F4VL 1EWIA 3GTMH 2R7ZG 4WJ4A 4GLVB 5JJIA 1CKNB 3ULPA 1XPOA 1Q81C 3EIVA 5EAYA 1WCMG 1Z47A 2IX0A 4POGA 2RHSB 1UE7A 2YTVA 1XMQQ 4NXMQ 3S14H 1N34Q 4A3BG 1AE3A 2UU9Q 3PV0A 3CCJA 1K83H 3CCVA 2JA5H 3CXCA 1VQMA 3PUWA 3KF8B 5C0XG 2BH8A 2V1CC 2YU9H 4XTCS 1NTGA 3W5OA 2KCMA 4MZ9A 1C7YA 3M4OH 1BKBA 4DV1L 4HIMA 3S2HH 3E9IA 3UDGA 4R1JA 3PGZA 4DV5L 2UUAL 1IBMQ 2GVAA 3F1ZA 2Q2TA 4JI5L 5C0XI 4PZ6A 1SLJA 2JK8A 5C0XJ 1VQLA 4GNXB 4GKJQ 2JQOA 2UXCL 1LUZA 2LXKA 2Q2HA 3STBC 4QJFA 3CCEA 4KHPQ 3GD7A 1T9HA 3WWVA 3G6EA 1B70B 3CCRA 1FVIA 1VQOA 2UXCQ 3W1BA 1O7IA 2JJQA 1MKHA 1ASYA 4X64Q 4DPGA 1YHAA 1XJVA 4DUYL 3AEVA 1W2BA 1NMGA 1EFWA 2DUDA 4LF8L 3A74A 4UPAA 3UDFA 3HOVH 2LXJA 4BY1G 3J7ZC 1CSPA 1G51A 1JMCA 3ER0A 4HJ7A 1CUKA 1NE3A 1Y14B 1BBWA 4A3FH 3D0FA 1YJ9A 1I5FA 4TVAB 4APVA 4OXPA 1N8RC 5FLMH 1WYDA 3A0JA 1XMOL 5GAEC 2IY5B 4L5SA 2R6GA 3HOWG 1KD1C 3JAMc 1Q1EA 3PSIA 2VUMH 1J5EQ 2HHHL 2ZM6L 3AQQA 5M3MH 1L1OC 1UE1A 1OXVA 4DV2L 1N33Q 4YY3L 4RG1A 3S17H 1Y1VH 2VW9A 1HZBA 2FXQA 4JI2Q 1PHJA 4IFDG 2AKWB 4A3KH 2RF4A 4GOPA 1K8AC 4C3HH 1PH8A 4GN5A 1Q8KA 4A3EH 2NN6G 3T1YQ 1EYGA 2VQFL 2UXDL 5BR8L 2JA9A 4NPSA 4A76A 1JB7A 3OW2A 4DR4Q 4JV5L 4DNIA 2NVXH 4LF4Q 2PI2E 1NMFA 2L15A 2K5HA 3H0GG 3L0OA 5H1SE 2AWNA 3KJPA 2EIFA 4IFDJ 3CCMA 1Q82C 2E2HH 4JI8L 3CP0A 5M5YH 3PO3G 1EQRA 2NN6I 4XIGS 4JBJA 4BY7G 2AHOB 3FP9A 4DK6C 4IO9A 4A3JH 1L2FA 2E2JH 5FJ8G 1V9PA 5C44H 4QL5A 4JI4L 1KRSA 4OO1I 1OXTA 1GD7A 1X6OA 3E9HA 1U0LA 2VUMG 2ALYB 4DAMA 3PO2H 2Y0SE 1LTLA 3I55A 3GTOH 1SE8A 4UP9A 4DR5Q 1OXXK 1EIYB 1Y1VG 4YWKA 1SR3A 2IHFA 4JYAQ 1TWGH 4DV6L 3HKSA 2XGTA 4X65L 4QQBX 1PH7A 1MIUA 1Q46A 1NY4A 1QUQB 2OCEA 2WFWA 3CPFA 4NB3A 4NXNL 4A3KG 2B3GA 4DV6Q 1NJIC 1VQJA 1PVOA 1E3PA 3CC2A 2PMZE 2KHJA 2HIVA 1U5KA 3GDEA 3J80c 1GO3E 3TREA 4IPCA 1SN8A 3PIOA 3M85A 1OXUA 5C3EH 3I4NH 2R7FA 4B3MQ 1HNZQ 4DV3Q 5GADC 2K75A 3HOZG 2WAQG 1PH4A 5IYDG 3J7A5 4K0KL 2A8VA 3RN5A 4UP7A 2B29A 1S72A 1HH2P 1P8LA 4PZ7A 5HY6A 4B3SQ 2CKZB 3J81i 1TWFH 3KDFB 2UUBQ 4OX9Q 3F8TA 4BBRG 1YEZA 1XNQQ 2JA6H 3I4MH 4KLKA 1PV4A 4OWWB 5IP9G 2MFIA 4B3TQ 2JA7H 1X54A 3SGIA 3K81C 1CKNA 1TWHH 3KF6B 5IE8A 4A3IG 1VQ4A 4LF5L 1PYBA 1VQEA 2H5XA 1KC8C 1XTDA 1D8LA 4DAYB 1X3FA 2N8NA 4DV7L 1FGUA
chains in the Genus database with same CATH superfamily
2F0HA 3EROA 2EXZA 4UAIA 5E1FA 2B63G 4HJ5A 1LABA 3W3AA 4DV7Q 3GP7A 4JOIA 1IZ6A 3KLSA 4JW0A 1Q7YC 3S1MH 3SK8A 5KRUA 2G5DA 4QF4A 3D4DA 1PYSB 2Q8TA 2A74C 4A3CH 5ELDA 1ENAA 1IHZA 1ICWA 2N49A 4P75A 3B6YA 4GNXA 2CWAA 4DV5Q 1WTQA 1D2BA 2UXBL 2N88A 4DR7Q 4CBVA 4A3JB 3I72A 5E7NA 4JI5Q 2AQ1B 5M3FH 1X56A 2X6LA 1QG7A 1RJTA 4R8IA 2BE5D 1ZYRC 1SE3A 4HAEA 1K28A 2XTIA 1SFOH 3K0YA 2F52A 1H95A 1D1IA 4PQXA 2E75C 4AQYL 1JJCB 1BBUA 3CU7A 1W6KA 4ZQ3A 4BBSG 3RMHA 1A8VA 3HOYH 2N55A 4NP5A 1YNJD 3I4NB 2ZJPA 1XTCD 2RBMA 2D2CC 4HMJA 1LTGD 4WJ3M 1G291 4G7HC 4X3KA 3C3LA 4TQUS 4YY3Q 3OTOL 2A6HC 2MUYA 4FXKC 2I0QA 1B50A 2CVRA 4EQNA 3CQZH 1RIPA 3I4MB 1YNND 3K7AH 2DY7A 1HA6A 4LWCA 1I4XA 4LMQD 2JA7B 2FJ2A 1GUOA 5FLXE 4LFAL 1ICFB 1KAWA 3HZXA 4DK1A 4OO1G 4JI3L 2VQFQ 4OL7A 2UXDQ 4UDUC 5J1ZA 1L1OB 4A3MB 4B9XA 2QKIC 4DKAC 4HIOA 2AUJD 3S1MB 4HMIA 5FLMG 2O5IC 4MTKA 1SYBA 1YNXA 1CKMA 1STBA 4X62Q 2WKCA 4L63B 1QUQA 3I56A 5EPKA 1UNSA 2EYHA 4JBWA 1ESRA 1BCPC 4RGNA 3PF5A 1S5FD 4JI0L 2I07B 5NUCA 1VQ6A 4EX5A 3BG3A 2TMPA 5M3FB 1I6VC 3FRPB 1R4QB 1VQ5A 2K01A 3S16B 3P20A 4GLXA 1WTRA 3QOLA 1J9OA 2B2TC 2OTLA 4IUQA 4V190 2NWGA 2N3SA 3A8JE 1SFOB 3EN2A 3DM3A 1ESFA 2ID0A 2PW7A 1EOTA 1K8OA 5K36G 4IPDA 2GN5A 3EA6A 1XPUA 4K0KQ 5J39A 5EQ0A 4CGYB 3SEBA 5FLXc 4JI7L 3TEHB 5AJ3Q 3MXUA 2F0TA 1HNXL 2FINB 3X3MA 2XRQD 4DAYA 3PO2G 3J81E 1TS5A 1SNPA 3AB9A 2WIIB 5LMNW 1Q86C 5GAGC 5C4ZA 3E0EA 2CQOA 3K80C 4RWSC 4QCLA 2WINB 1IL2A 3CQZB 3HKZG 5CMDA 3K7AB 2PNRC 4JOIC 1KABA 4HCEA 4KKUA 1JCKB 3CAMA 4DV4Q 1VQ9A 5I4DA 2JE6I 1HJPA 1NR2A 5IGCA 1H9JA 1N34L 4GNXC 1ML0D 2HQLA 1B8AA 2UU9L 2UXBQ 1TY0A 4OONA 3KLSX 1EFID 3HP3A 1E7ZA 2PMZB 1QZHA 1UUPA 1WTWA 4KY5A 1VQCA 3BZCA 1A6XA 3HOWH 1MBYA 4B08A 2RHQB 5IGFA 3J81c 5CV9A 5ELNA 1EWCA 1VQ7A 3H91A 5DAUA 4K8IA 3HEJA 4C3JG 4A3DG 4AQYQ 4KHPL 2HDLA 2NVQH 4G4KA 4F7XA 3UDXA 5GQOA 4EQPA 1V8QA 1SNCA 2NN6H 4KN7C 1MJCA 1L0YB 1PH1A 3VR2A 2OEOA 2WB1E 4C2MB 5LMNL 2D5DA 3MXNB 1IYUA 3PO3H 4GKKL 3OTOQ 3HRZC 3D6WA 1RCVD 1JICA 4LUVA 3U50C 5FO9B 5FJ8H 5C4JH 3DEOA 5EBCA 2ZJQA 2HCCA 1N33L 4LFAQ 1RD9D 4K5VA 1YJNA 2KVMA 2L1BA 4EVOA 2VY3A 3DLLA 3QR8A 4ZRZA 5JEAJ 5A2QE 2O4XA 5FK9C 3ITPA 1K0SA 5COYA 2XWJB 4ZUJA 4GLAC 4J6HA 1P16A 3MEHA 4V0BA 5FKAC 4GOPB 5IYCH 1YVCA 2D0OA 2PNHA 2HT1A 5J3BA 1VDZA 2JSOA 3CCUA 1DM0B 3M7NA 3T56B 1HXYD 1F2ZA 2PZWA 3S14B 3HOXG 1K73C 1STGA 4IPGA 3HG9A 2DN8A 4BBRH 1EIGA 2IX3A 1E1TA 3CPWA 3HOWB 4A3IH 4A93G 2MGSA 3M9BA 1PRTB 1H9RA 2NTSA 1H9SA 4KN4C 2KBNA 3TDQA 3TP7A 1UEBA 2B63H 4A3GG 2NVQB 3TP5A 2PQAA 4JI7Q 3PUXA 3NQIA 1QZGA 1HNXQ 4QIWE 4TSSA 4FP5D 2RA4A 3RR5A 4LW1A 3SDZA 3O13A 2IX1A 3KFUA 2E2IH 4B3SL 4OX9L 1Y8NB 2L55A 1WOCA 3PO3B 4ZCKA 4KD3A 1LTRD 5C4JB 4ALPA 2OQKA 3PF4A 1Q1BA 4XT1B 1HTPA 1U4MA 3E0JA 1V43A 1PFSA 1EWIA 2R7ZG 1V1PB 1EWHA 1Q81C 3EIVA 1PTOH 5EAYA 4POGA 1XWEA 1TY2A 2RHSB 2F0SA 1N34Q 2UU9Q 2PZUA 1VQMA 4NKLA 4FXGC 2BH8A 4TRDA 2YU9H 4XTCS 3G7LA 1SE2A 1HUMA 4DV1L 4O42A 3E9IA 1Y8PB 2UUAL 3F1ZA 2HCIA 1II3A 1QNUA 5M5YB 4PZ6A 5JPMC 1LT6D 5C0XJ 2F0MA 4EGVA 2JQOA 3STBC 1LLRD 4KHPQ 3CCEA 4BBRB 3I73A 2UXCQ 3G6EA 1B70B 1JC7A 3MZ5A 3ZYYX 1WTVA 5JOBA 4A3IB 3C1FA 1S5CD 4DPGA 1UAPA 1Z7TA 2O2LD 5ELEA 1XJVA 4RH6A 1NMGA 2K28A 5AFWA 2ZXOA 4DNTB 4OO1H 1WTPA 4LF8L 4X3TA 2B63B 1SSOA 2K1BA 2F03A 1PFNA 2WACA 1JMCA 4ULLA 1YJ9A 4GKKQ 5FLMH 1WYDA 3C2PA 2M9VA 2B8GA 2ZM6L 2KCCA 1N33Q 3S17H 3J80E 1MSHA 4FF2A 3J7YW 1HZBA 1PHJA 4L8JA 1C8CA 2J0TD 1PH8A 3SK4A 1Q8KA 1SAPA 2Z8LA 2JA9A 4JV5L 4IFDI 2PI2E 3L0OA 2K5HA 3H3VC 3K5LA 1EY0A 4N9TA 1FGBD 1Q82C 1PTOB 2M00A 4DU9A 3U9OA 5K36H 4BY7G 4DK6C 1L2FA 5IIFA 4BBSB 4OO1I 1OXTA 5JJZA 2YU9B 1H9KA 2HD3A 4OGQC 1U0LA 2VUMG 4DAMA 3PO2H 1FNUA 4OIKA 1K8MA 3BYTB 1EIYB 2VXWA 1Y1VG 1SR3A 2RSOA 1TWGH 5A2QL 4PMBA 1MIUA 1Q46A 2K05A 3A8IE 4NW2A 4NXNL 4A3KG 4EQOA 2HIVA 1U5KA 2B2UA 2IJ0A 3J80c 4LAAA 3Q22A 5JVG3 3M85A 2EYMA 1HCZA 2K03A 1DCZA 3RN5A 4L6TB 4UP7A 1EEFD 4C1NK 1HH2P 4B3SQ 4QUCA 1W6JA 4OX9Q 3F8TA 4OHJA 4I65A 1EIHA 1PV4A 5IP9G 2MFIA 3KF6B 5IE8A 1VQ4A 1ZXTA 4LF5L 1VQEA 3UI2A 5D14A 3DXJC 1BCPF 1Y1WH 4X6AH 4DV7L 1EZ8A 4H13C 3BS1A 2QGQA 1JB3A 2K50A 3SK5A 4J1MA 3S1NH 3KF8A 3NP8A 4HN7A 2A69D 2QDLA 4C3JH 4A3DH 4I7ZC 5C3EG 5EKIA 1LACA 3T13A 1VMPA 3ERQA 5FO7B 4DR7L 1B7YB 4DV1Q 4JI6L 2OXPA 3NEMA 2UUAQ 3JC66 1BBXC 3MEFA 2SOBA 1E24A 2PYKA 2Z6BA 3PUVA 3CMEA 2EY2A 4OEMB 3A56A 2EPBA 4LFBL 3PO2B 4KTAA 5C4XB 2WKDA 1I4RA 1QOHA 1CA6A 1SMYC 1B3AA 1TWGB 2NBFA 1RHPA 4JK1C 5CV6A 2BA1A 4IURA 1GUSA 4HJ8A 4LF8Q 3HKZB 1QB5D 2VQEL 1QVGA 1C9OA 4JBMA 1R9TH 3TQYA 3U4ZA 4YWMA 4AH6A 1ONLA 1E0BA 1STEA 4L5QA 3IL8A 4E6IA 3DWPA 2NB0A 4DUZL 2ZM6Q 1I4QA 4GN4B 2K5NA 2QA4A 1ILQA 2WB1G 4QY7A 1QCBD 2SEBD 1WCMB 3D6CA 5E3FA 1TWAH 4DF7A 3HOXH 4PMWA 1VQBA 4H02A 2CWPA 3RLFA 1YHQA 2CH4A 2Z6KA 1I94Q 4JPBW 5HGTA 3DMUA 4A93H 3U58A 1VS0A 4Y52H 1EY4A 1V1QA 4JV5Q 1A3UA 1JWUD 1NUCA 3NBHB 5JVH3 3S1NB 1VF7A 2KQ3A 2R7DA 2X6GA 2KCNA 2XN9C 4JCVE 4LF6L 3C46A 2CFMA 1JE5A 1FYCA 4C3JB 3OW7A 3RN2A 4LF9L 4A3DB 1EUJA 1S5ED 4YIJA 4A3GH 1J8IA 4X62L 1EYDA 5GROA 4F8MA 3VYRA 5KEEA 3S1RB 4IUVA 4DNRB 5BN5A 5DM63 2OT2A 1QVCA 4LF7L 4MTNA 4LFCL 3S15H 4B3RQ 1VQAA 2EXDA 2A68D 5D3IB 1BF4A 1SYFA 4MIUA 2KHIA 4NXNQ 1XXGA 1E1OA 2HDMA 1N32L 4IJHA 4BXXH 3ULLA 2B2UC 3U9SA 1CI3M 1VQGA 3KDFA 1B44D 2F0VA 5AJ3L 1TWCH 4IUNA 1SYEA 2R3ZA 2R7ZH 2ZT9C 4FVMA 2L0CA 4N8FA 3UE0A 4DK3C 5C44G 3G71A 3NENA 1R9TB 4AIMA 2F0OA 3R2TA 2F0KA 3TZDA 2BCOA 4DA2A 4XQNA 1X65A 3EJIA 5M5WB 1QNKA 1EY9A 2F0QA 3Q8DA 4LF5Q 4JI1L 4A3MH 3IKJA 2CH4W 2ZTDA 4L5TA 1BVSA 1V1OA 2A19A 3I2ZA 2OWOA 1TWAB 4P73A 3OIPA 4G7ZC 2H4OA 3HOXB 4DR1L 4DV4L 2H1EA 2IL8A 2I46A 2Q8IB 4DAPA 1GUWA 3ULJA 1I3QH 1BO0A 5ELOA 3CC7A 3TSSA 4A93B 5I2YA 3L9AX 2BH2A 1A63A 3JAMi 2B8FA 1ZKOA 4HSPA 4JI6Q 4K2KA 4A4IA 1CA5A 3VA7A 3AFQA 2OTJA 3OIQA 2JA6G 3K0XA 4A3GB 1CTMA 1LT4D 3S16H 1D5MC 1UWVA 3H15A 4LFBQ 3L3OC 4Q5VA 5CORA 2K5WA 1SNQA 3S15B 2UUCQ 4GKJL 1CZWA 3NSWA 1QVFA 2RCNA 2JXMB 1YZ6A 1SNDA 4RHSA 4P74A 2HIXA 4OIJA 3P1HA 1YI2A 2VQEQ 5KYLA 3M7GA 3MFYA 3UDIA 1TWCB 4YWLA 1B9MA 3SHLA 5I6WA 2PPBC 4IUPA 2R7ZB 1AZQA 4WORA 4DUZQ 1SDFA 3N6RA 1LYLA 3TP6A 3PIO3 1SXTA 2K5QA 1X3QA 5D3DA 3GTGH 5IGGA 1PZID 1PH5A 4BY7H 3VYUA 1E2ZA 3BJUA 1BOSA 5GAHC 1J5EL 3F2CA 1L1OA 4RMFA 5JEAG 5IP7G 1CM9A 5CBAE 1EZ6A 1ZYRD 2NVYH 4R4CA 4LUZA 2Z6KC 2RDFA 4JI2L 3QO2A 1Q8IA 4WFN3 4LUOA 2R93G 3BDCA 1IYVA 3T1YL 4LF6Q 2F0NA 5KGUA 4AYBE 4LF9Q 3BU2A 1STYA 3BDOA 4RGTA 1I3QB 1HHVA 2F0DA 1D5ZC 1NNXA 5CC4A 5JJLA 1I50H 3BZDB 2EY6A 2Z0SA 1K9MC 2PCFB 3M4PA 5I2XA 1CHQD 1SBBB 4M1UB 4LF7Q 1G2SA 4LFCQ 3GTQH 2A6HD 4ZKBB 3T1HQ 2JN4A 2EOTA 3P75A 4DR5L 1GVPA 5IP9H 1MGSA 1B3QA 4RA8A 2NUCA 3CCLA 1N32Q 4GN3B 3TRZA 3HFZB 2YTXA 1Q90A 2F0WA 2K4KA 3DWAA 4IALA 3S1QH 4C2MH 1IW7D 1CT1D 3MC0B 3V05A 1B53A 4XYQA 3J81j 2K7VA 2EJFC 3WOEA 3PIP3 4DV3L 3K5NA 5C4XG 4K5XA 1L0WA 2EZVA 1A3VA 3NWSA 2B2WA 1DD2A 4XXEA 4S3SA 1JORA 3HOVB 4JI1Q 2MNAA 2HQEA 3GTGB 1XNQL 1BCPD 3ERSX 1D7QA 4BY7B 4B3TL 3NPPA 4DR1Q 3Q24A 2VUMB 4CJ1B 1ET6A 2NVYB 5KNDA 1LO5D 2E5LL 2F4VL 3GTMH 1EQQA 4JVZA 2EYPA 1Y1VB 4ILWA 3ULPA 4RCOA 1WCMG 1SNOA 1UE7A 2F1MA 2YTVA 3S14H 2CW0C 4MN3A 4A3KB 3CCJA 3CCVA 4C3HB 3CXCA 5C0XG 1NTGA 3W5OA 5C5MA 4MZ9A 1B1ZA 5IGDA 3S2HH 3E5SA 3PGZA 3IAYA 1I50B 2GVAA 3CRLC 3I4LA 2A6ED 3ND8A 5ISRA 4NDXA 5BN3A 1SLJA 2F0PA 4N9PA 1FD7D 5D65A 3GTQB 4GKJQ 2D9UA 3URYA 2UXCL 1KLUD 3QB3A 4QJFA 3M4YA 2NZ1D 1FVIA 1I4PA 4IUUA 5I9OA 1O7IA 2B2YA 2JJQA 4G57A 1YHAA 2EJMA 2GA4B 4DUYL 3AEVA 1RDPD 5EJWA 2XIWA 3S1QB 1EFWA 1CHPD 4RGMA 4UPAA 3UDFA 4BY1G 3ER0A 1CUKA 5LL6S 2B2VA 3D0FA 4OXPA 3A0JA 1XMOL 2VB3X 5C3EB 4L5SA 4FYDA 1IL8A 1J5EQ 2HHHL 1DZ1A 1L1OC 1HQMC 2VW9A 1EEID 1WTXA 4JI2Q 5IGBA 3NXWA 2AKWB 4MHEA 1JE4A 3NHHA 1NSNS 1HQRD 2EYOA 1T5XD 2G9HD 4GOPA 4PV1C 3T1YQ 1PXUA 2Z9HA 1EYGA 1SYGA 5T1GA 3EFXD 5BR8L 1JB7A 5C6AA 3GTMB 4DNIA 2NVXH 3KJPA 1NMFA 1SJHD 3H0GG 4N8X1 5H1SE 4KKSA 4IFDJ 2E2HH 1S5BD 4JI8L 3CP0A 2CHBD 5M5YH 1JOQA 4J8QA 2NN6I 4JBJA 2E2JH 4XT3B 2EYJA 1V9PA 5C44H 4JI4L 1X6OA 3S2HB 2Y0SE 1LTLA 4UP9A 4DR5Q 5JAVA 3FPPA 2IHFA 3W2DA 3HKSA 4X65L 2OCEA 2WFWA 3CPFA 2B3GA 4DV6Q 1U4PA 2E74C 1E3PA 2EY5A 2WB1B 1PVOA 4ID6A 3TREA 4PNYA 3PIOA 3H09A 2KECA 4C1NI 4DV3Q 5GADC 4DXFA 3HOZG 1C4QA 5IYDG 2L12A 3J7A5 2B2WC 2B29A 1S72A 3J7AF 1WD0A 1WTOA 3D4RA 1I4GA 3J81i 1A3TA 1TS4A 1XNQQ 2JA6H 4OWWB 4B3TQ 3SGIA 1C48A 1TWHH 1V1PA 2JYOA 1STNA 1XTDA 1D8LA 5E4WC 1HFNA 3NTIA 1FGUA 4C56C 1I6HH 1LM0A 2E5LQ 4EQ5A 2F4VQ 1N36L 4F87A 3U4VA 3K58A 3I91A 1SRUA 1KDCA 2VL6A 3A5UA 3CCSA 4BBSH 1G6ZA 5HGQA 2JEAI 4POFA 4DXGA 3SK6A 2ZTEA 2HUGA 1GOZA 1TQOA 2KCTA 2L11A 3VDYA 2NVXB 2E2HB 1LTBD 1HNWL 2ES2A 1AZPA 4I7AA 1KRTA 2E2JB 2KHSA 1GKHA 5IYBG 5C44B 3KLWA 4ZK9B 3OOCA 1PH3A 1F9PA 3BVMA 3CMAA 2F0LA 1SJED 1KNAA 2SDFA 2AMCB 4XYOA 4FXDA 3NUCA 5JEAH 1VQDA 1Z9FA 4BA1I 2B2YC 5ELFA 4DUYQ 4KHZA 3GV3A 3WOFA 2JA5G 4DV0L 4H7BA 5C3XA 4A3CG 2R93H 3ICEA 1VQKA 3A5ZB 3NBIA 2B2VC 2K32A 5CV5A 4O2DA 1XMOQ 3FHWA 3CRKC 1TIID 1HR0W 2HHHQ 1IXRA 1DOLA 3MHBA 1DGSA 4HJ9A 4QB4A 3F2UA 1KXLA 1J6QA 2JA6B 1D6EC 3UE1A 1AW7A 4ME3A 1I94L 5EBDA 1TWHB 3STBD 3A55A 1MSGA 5K5PA 4GOPC 2N78A 1M90C 1I6HB 5BR8Q 3GTJH 1A2TA 2LMCB 2VZAA 3HOVG 3MFGA 3NK9A 3SE0A 3MXGA 2EE1A 2DJFC 1WVLA 4CDCC 4IQZA 1X3PA 4JI8Q 1XX8A 5C4HA 4A3FG 3HOYG 4RHRA 2F0GA 4HIDA 2SNSA 4UP8A 5DLQE 4JI4Q 1K3RA 1EOVA 4AYBG 1PRTC 3RZOH 4F88A 5C4XH 5I6YA 4B3RL 1LTTD 1GUGA 4IOAA 4YHHL 2K5VA 3AYHB 1XPRA 1MJEA 1UE5A 4PG3A 1O7LA 2MPMA 4X65Q 4C3HG 1IKLA 4A3EG 2WP8J 3T4AC 1FJGL 2WAQE 2Q2UA 2EY1A 2EDGA 4H0LC 1HA5A 3W1GA 3J7AV 3LWEA 2ATWA 4DR3Q 5FO8B 1HRJA 2K14A 4LNQA 1VQHA 5E4XA 5IWAL 5F2DA 1LV9A 1EQVA 3KF6A 5IODA 3GTPH 1HR0L 4OELB 1WCMH 5KNBA 2F3WA 2R93B 5LMUL 1O7YA 1VQIA 2EYLA 5CV4A 2QEJC 1S5DD 5C0XH 2LFNA 1F9QA 1JWSD 4ME5A 1VQFA 3FEWX 3OWFA 1WTHA 3F2BA 1EIFA 2AUKA 3I4OA 1SNMA 2XVSA 5C5LA 1YITA 1N36Q 3S9WA 3D31A 1AP0A 1PH6A 1CFMA 1IBLL 5CYUA 3KJOA 1FL0A 4UHVA 3S1RH 3GTJB 3AU7A 1VQPA 1M1KC 1XMQL 1M4VA 1NR4A 1HNWQ 2V4DA 3AFPA 4BY1H 3KBGA 2ICEC 2D62A 4ZUIA 3CCQA 2LY7A 4KY6A 5LL6X 1IBML 1TKWB 3RZOB 1Y8OB 1A0IA 1BXTA 1KNEA 2UUCL 3A7AB 1FR3A 1DXMA 3QG1A 2BA0A 3GO5A 3NE5B 3K59A 2Q8RE 1MI2A 1SE4A 2IPKD 3S24A 1KL9A 4DV0Q 3D4WA 2CQAA 4CHTB 4X64L 3TS0A 3KLRA 4IN3A 1U4LA 2K52A 2BOSA 5M5WH 5EGTA 1EYAA 4RKLA 3VR5A 1X3GA 5EPLA 3CF5A 1KQSA 3GTLH 4JG2A 4CKBA 3H0GH 4DFAA 2OF1A 3BYYB 3OPOA 4ZAIA 4R4TA 3GTPB 1CQVA 3BZKA 5T1IA 3DUZA 4U673 2I5MX 4JC0A 4HR7B 4R4IA 1JT8A 1M8AA 1N9WA 3NBHA 3J80i 2NZOA 1UE6A 1PTOC 3OWEB 2DNCA 4A3LG 1SMYD 1JR0D 3NELA 1PYWD 4P2CB 3RLNA 3CC4A 1PA6A 2YTYA 1O78A 3HGBA 1SROA 4DR4L 4LF4L 1CKOA 3PUZA 1A62A 2LKVA 3HOZH 3TS2A 4DGZA 1GXDC 1SMXA 3TMEA 5IYDH 2OQ0A 4YHHQ 3T1HL 1KIXA 1F9SA 2BDNA 3GTKH 4BY1B 2R92G 2VS1A 3F2DA 3E3XA 2LSSA 2C9OA 1PLFA 3C1EA 2KENA 4XQQA 1VQNA 3QWNA 2K33A 3PCOB 1O80A 1RL2A 2BDOA 3Q23A 1FJGQ 4JYAL 2Y0SG 4R8NA 5LHY1 4CDFC 1KDBA 5C3WA 1EY8A 2A5HA 2QEXA 4J15A 2J4XA 3NWTA 1BCPB 3HOUG 3K8AA 5IWAQ 1STAA 4FF4A 4MNOA 3LNNA 1HR0Q 4B3ML 1JWMD 3Q6SA 5LMUQ 3GQBA 5IYCG 1VQ8A 1Q12A 1E22A 1IKMA 1F2LA 4KJOA 2MQHA 4ABNA 2JA8G 3GTLB 3H0GB 4P71A 4QGUA 4OWXB 2SNMA 2XNAC 2I5LX 2UUBL 1DOMA 3T16A 1IYJB 3CW2C 4KY7A 2BE5C 5IYBH 4ZYSA 1FNWA 3G4SA 1LT5D 4IJLA 3L2PA 1IBLQ 4U68A 3KYHC 4O0AA 5JJIA 1U9RA 4GLVB 3K57A 4CJ0B 3CKIB 1CKNB 2DJGC 1KDAA 1RKNA 3LWUA 1Z47A 2IX0A 1XMQQ 4A3BG 1WD1A 1AE3A 1YNJC 3PV0A 2JA5H 1BDOA 1GUTA 3M4OH 2KCMA 1G2TA 1BKBA 3I8ZA 1GHKA 3MXPA 3UDGA 1B9NA 3HOZB 1IBMQ 2Q2TA 2RKSA 4M8AA 4CKCA 1TVXA 1HPCA 1HUNA 3GTKB 1VQLA 4FNFA 1YNNC 4GNXB 1BR9A 3BDLA 3GD7A 3WWVA 4X3UA 1ASYA 4X64Q 2FMMA 1D5XC 2L5TA 3JAML 1W2BA 2ZXPA 2DUDA 3NTKA 2PZTA 3A74A 3HOVH 2LXJA 4G7OC 1CSPA 1G51A 2O5JC 4HJ7A 1Y14B 2AQ2B 1CK1A 4A3FH 1DONA 4KJNA 2R6GA 2VUMH 3AQQA 4H44C 1UE1A 2EJGC 4DV2L 1Y1VH 1NCVA 1TWFB 4IFDG 1A15A 4KK7A 4A3KH 2RF4A 1RTNA 1K8AC 4C3HH 4GN5A 2DY8A 4A3EH 5KYIA 1JOOA 4KKTA 3OW2A 4DR4Q 4LF4Q 2AWNA 2EIFA 2FFKB 1IW7C 1EQRA 2AHOB 4C3IG 1DYQA 4HEDA 2J7ZA 2JA5B 1KRSA 3E9HA 4KHVA 3M4OB 3N52A 1RODA 3E6ZX 3GTOH 1SE8A 1ET9A 3D8GA 1RF2D 3V2TA 4JYAQ 4DV6L 4DK0A 1TS2A 1NY4A 1QUQB 4NB3A 3K6OA 3VR3A 4HSVA 1NJIC 2KEDA 1VQJA 3CC2A 2PMZE 4IZ8A 1GO3E 4IPCA 2Z4IA 5C3EH 2R7FA 4B3MQ 1F9RA 2K75A 3MWYW 2WAQG 3ND9A 2IWHA 4ZLTF 2A8VA 4XQJA 3I70A 4LK1C 1H9MA 1P8LA 1DJRD 1TU2B 2F4IA 4PZ7A 5G3LF 5HY6A 2UUBQ 3HOYB 4A3FB 1YEZA 1PRTF 1R4PB 1GJXA 1B2TA 1LTAD 3K81C 3EVQA 5A35A 1KC8C 4AYBB 2A6EC 1QWYA 1X3FA 1JOKA 4DAYB 1IBKL 3GV6A 4R4OA 3VYSA 1WJJA 2D0PA 1GUNA 3DWQA 2FMCA 3RZDH 1EU4A 2I5HA 3V96A 2E2DC 1KHIA 4DR6L 1TT2A 2RDGA 4A3EB 1OTCA 3DM1A 2MP1A 4OWTB 1AH9A 1NAPA 1X55A 2PO4A 4QMGA 2Z1CA 4LJZC 2G9DA 1GM5A 1XNRL 2A1AA 2RQXA 2QF7A 4O1NA 1PH9A 3H3VH 2M2LA 2AWOA 2ICIA 1K0RA 3PUYA 1CQFA 1SYDA 3GTOB 3QOJA 3FKIG 1Y1WG 2CCZA 4CJ2C 4K6DA 1PH2A 3MXNA 3KOJA 5CR3A 1G6PA 3OMCA 3NTHA 3KBXA 4IUTA 4A3LH 2IHEA 3L7ZC 2NVTH 1Y69U 2E76C 4HJAA 1F2YA 4X66L 2CW0D 1K3BC 1RTOA 2LS01 4HTHA 1X32A 1YIJA 3WDNA 5HURA 3HS0C 1OXSC 2ZJRA 3FPUB 3K5MA 2MO0A 3M4QA 4DV2Q 1YHBA 1A2UA 3MVVA 4DN4M 2R92H 4CKEA 3H3VI 4RGOS 4FF3A 4TKOB 1PMRA 4CDEC 1EY7A 1PFMA 3A54A 5CBEE 4YCUA 4PMCA 3QJYA 3RZDB 4JI3Q 4IOCA 1PZJD 4XDXA 2F3VA 1KLGD 3VR4A 3AMUA 2XSCA 3OSOA 3RLOA 1ILPA 3HOUH 4X3SA 3RNUA 2YYZA 5M3MG 4HCSA 4L5RC 1EL0A 3CHBD 2Q2IA 4CDDC 4DR2L 1L0XB 1AEXA 3EBEA 3KUPA 2JA8H 5J22A 4YCVA 5IT9E 3TBIB 2YV5A 3D3RA 3PMFA 4JI0Q 5FLXL 4DR3L 1PTOF 1STHA 2EQSA 2QILA 1VMCA 3I3CA 1JJ2A 5KNCA 4UY8C 4A3JG 1PDQA 1SEBD 3VYTA 3TN2A 1CSQA 2F0IA 2NVTB 1H9SB 2X69A 3K7UC 2QDBA 2NZHA 2AQ3B 2F0EA 2IT1A 4A3BH 4QUFA 4K2LA 1HZAA 3ZJYC 2E8GA 2PQAB 4K8JA 1EU3A 1D1KA 1F2MA 1IBKQ 3CD6A 1VF5C 3IFDA 2PW5A 2L9HA 3A8KE 2EYFA 1LTID 4PZ8A 2VNUD 2R92B 1FNVA 4BXXG 3I4NG 2K5DA 1TS3A 2NYZD 4DR6Q 1HTLD 2RSNA 1KAAA 5IT9c 3RUZA 3T51B 2KEEA 4FDBA 5EKKA 2Y0SB 3DEPA 4NXML 1EYCA 2TSSA 4RFBA 1S40A 1NBWA 1XNRQ 3H6MA 3J81L 4JBKA 3I4MG 3HOUB 1O7ZA 1W3SA 4NMZA 2JA7G 1OO9B 2ENBA 2MHVA 2ZTCA 2FHTA 5IP7H 4QIWB 2KA7A 3PIPA 4A3MG 1JQYD 2JA8B 2MO1A 2RVLA 3LGJA 4R9WA 4FO2A 2F0UA 1CZGA 4IFDH 3M3YH 2ASBA 1JJGA 3TZUA 2ZXRA 3FDTA 4X66Q 4Q0FA 4HIKA 5CGKA 3G48A 1BQQT 1X3EA 2C5CA 2KUMA 1S4ZA 3LX0A 1TXYA 5IY0A 3G6JB 3X3NA 5M3FG 3Q0AA 2JEBI 3R93A 4DAVA 5LMNQ 4A3BB 1SYCA 3OYYA 4C3IH 2GVBA 1Z6HA 1ASZA 4P72A 3SVMA 5KIXA 3K5OA 1HZ9A 4A75A 4YCWA 1C0AA 2E2IB 1VCIA 3OMGA 2XWBB 2K04A 2DGYA 3OHXC 5CV7A 3S2DH 3MTSA 3IRBA 2C35B 4GS3A 1WFQA 1G91A 3VA5A 3NQTA 2A73B 2Z4HA 1S3OA 1HZCA 4DR2Q 5M9OA 2WV6D 2KJXA 2B39A 1X9NA 2F3IA 4BWGB 1GHJA 1PZKD 5DEHA 4Y7NH 1WI5A 1MHWC 3I7FA 4R4QA 5M5XH 1E2WA 1BUVT 3MA2B 5L37A 1K8GA 2A69C 3R2IA 1Q3LA 1EY6A 2RDHA 4RAUC 4K14A 1ENCA 3M3YB 1QILA 1HNZL 5G3LD 1F77A 3DHQA 2PI2A 4IPHA 3SR1A 3T53B 1PRTD 1AE2A 5IT9L 5ELBA 3IFTA 4B9WA 3HKZE 5I9PA 5JJKA 4K6LA 5DNFA 1DOKA 4KI0A 4C3IB 1YBYA 3R3OA 2JP1A 1LT3D 1E2VA 1EY5A 3FVQA 1YJWA 3FKIH 3S17B 4WJ4A 2NTTA 1XYIA 4BS9A 1XPOA 3JAME 1B4OA 5IOCA 4NXMQ 3S2DB 1K83H 3PUWA 4WJWA 3KF8B 2V1CC 1HFGA 1C7YA 4HIMA 4R1JA 4DV5L 3QIAA 5DM73 2WAQB 2P5ZX 1TR5A 3I90A 4JI5L 5C0XI 5CV8A 2JK8A 2K6AA 4GZYC 1LUZA 2LXKA 2Q2HA 1AFPA 4Z9CB 4Y7NB 1T9HA 1VQOA 3CCRA 1I4HA 2IW3A 3W1BA 1EQTA 1ENFA 3MAQA 1MKHA 1QJOA 5TSSA 5M5XB 2VB2X 4KMUC 4WRDA 3RD4A 1AN8A 3J7ZC 4KD4A 5EPJA 1NE3A 1BBWA 4BA2I 2F0JA 1I5FA 4TVAB 4APVA 1N8RC 1G8ZD 5GAEC 2IY5B 3HOWG 1KD1C 3JAMc 1Q1EA 3PSIA 5FOBB 5M3MH 4ZKCB 1OXVA 4YY3L 4RG1A 2A68C 2FXQA 2EVBA 3BVZA 2R61A 4RCNA 4FF1A 4RKBA 2XRSD 1KTKA 3PQIA 2NN6G 2PQEA 4KV6A 2VQFL 2UXDL 4A76A 4K5WA 4NPSA 5EKLA 1UEAB 3FKIB 1Y1WB 2L15A 3CCMA 1QE6A 3PO3G 3VR6A 3H94A 4XIGS 3FMCA 3FP9A 4IO9A 4A3JH 5FJ8G 1U4RA 1K83B 4QL5A 2DNEA 1GD7A 5JPNC 2ALYB 2KOLA 3R8BA 3SXHA 3J80L 1ZEQX 3I55A 1OXXK 3P7JA 4YWKA 3KK7A 3ONAB 2MJ8A 2QCPX 1T5EA 2XGTA 4QQBX 1PTOD 1PH7A 3TP8A 2RCFA 1LTSD 1BNZA 2B2TA 2L4NA 2KHJA 3GDEA 5ELCA 1SN8A 1OXUA 3I4NH 4ODGA 1HNZQ 1PH4A 4K0KL 2QW7A 2CKZB 5BN4A 2F0FA 1TWFH 3KDFB 5IGEA 4BBRG 1MD2D 3I4MH 4KLKA 3A7LA 2JA7H 1X54A 4A3IG 1CKNA 1PFBA 3BVGA 3EQLC 1PYBA 2H5XA 5M3MB 2N8NA
chains in the Genus database with same CATH topology
4R4OA 1I6HH 2QGQA 2K50A 1WJJA 1LM0A 2D0PA 4EQ5A 2E5LQ 2B63G 2F4VQ 1N36L 4HJ5A 3S1NH 4DV7Q 3U4VA 3RZDH 1SRUA 4JOIA 1IZ6A 2I5HA 2VL6A 3A5UA 1KHIA 4C3JH 1Q7YC 4DR6L 4A3DH 3S1MH 3CCSA 4BBSH 5HGQA 1OTCA 2JEAI 5C3EG 1PYSB 4OWTB 4A3CH 1AH9A 4POFA 1X55A 2ZTEA 3VDYA 2KCTA 2N49A 4P75A 3B6YA 4DR7L 1B7YB 4DV1Q 4GNXA 4JI6L 2CWAA 1GM5A 3NEMA 4DV5Q 2A1AA 3JC66 2ES2A 2UUAQ 1XNRL 1HNWL 1PH9A 2UXBL 3H3VH 4DR7Q 3MEFA 2AWOA 1KRTA 1E24A 5E7NA 4JI5Q 3PUVA 1GKHA 1K0RA 5IYBG 3CMEA 5M3FH 1X56A 3KLWA 3PUYA 1PH3A 4LFBL 3CMAA 2AMCB 3FKIG 1Y1WG 2CCZA 1VQDA 1PH2A 2XTIA 1Z9FA 1SFOH 3KOJA 4BA1I 1G6PA 2F52A 1H95A 4AQYL 2BA1A 1JJCB 4DUYQ 4KHZA 1BBUA 4A3LH 2IHEA 4HJ8A 4LF8Q 3L7ZC 2JA5G 2NVTH 4DV0L 4BBSG 1QVGA 1A8VA 2VQEL 4HJAA 1C9OA 3HOYH 4JBMA 4X66L 1R9TH 4A3CG 3ICEA 2R93H 3TQYA 3U4ZA 1VQKA 3A5ZB 2ZJPA 4YWMA 4AH6A 1YIJA 4O2DA 1XMOQ 4L5QA 3FHWA 4DUZL 1OXSC 2ZJRA 1HR0W 2HHHQ 2ZM6Q 1IXRA 1G291 4WJ3M 1DGSA 4HJ9A 2MO0A 3M4QA 4GN4B 4DV2Q 2K5NA 4TQUS 4YY3Q 3OTOL 2QA4A 1YHBA 2WB1G 2I0QA 1KXLA 4QY7A 1J6QA 3CQZH 1RIPA 1TWAH 3K7AH 3UE1A 2R92H 4LWCA 4ME3A 3HOXH 4PMWA 1VQBA 1I94L 3H3VI 3STBD 4H02A 2CWPA 3RLFA 1YHQA 2Z6KA 4GOPC 4LFAL 1KAWA 2N78A 1M90C 1I94Q 4OO1G 4JI3L 2VQFQ 5BR8Q 3GTJH 4A93H 3U58A 2UXDQ 4YCUA 1VS0A 1L1OB 2VZAA 1V1QA 3HOVG 4JV5Q 4Y52H 3NBHB 4JI3Q 4DKAC 2R7DA 4IOCA 4JCVE 4LF6L 4HIOA 2CFMA 4JI8Q 1JE5A 4LF9L 4A3FG 3HOYG 3RN2A 3RLOA 1EUJA 3HOUH 5FLMG 4A3GH 4X62L 3RNUA 4HIDA 4UP8A 2YYZA 5GROA 1YNXA 5DLQE 4JI4Q 1K3RA 1CKMA 1EOVA 4AYBG 5M3MG 4L5RC 4X62Q 3RZOH 1QUQA 5C4XH 2Q2IA 3I56A 4DR2L 4B3RL 4IOAA 4YHHL 1QVCA 3EBEA 4JBWA 4LF7L 4MTNA 4LFCL 2JA8H 3S15H 4B3RQ 2K5VA 3AYHB 3PF5A 1XPRA 1MJEA 1UE5A 1VQAA 2EXDA 4JI0L 4PG3A 4EX5A 1VQ6A 4YCVA 4X65Q 2YV5A 2KHIA 4JI0Q 4NXNQ 4A3EG 1VQ5A 1E1OA 2WP8J 4DR3L 4GLXA 1FJGL 2WAQE 4IJHA 2Q2UA 3ULLA 2OTLA 4BXXH 1N32L 3W1GA 2N3SA 2EQSA 2ATWA 4DR3Q 1VQGA 3EN2A 3DM3A 2K14A 1JJ2A 2ID0A 3KDFA 5AJ3L 4LNQA 1TWCH 5K36G 4IPDA 2GN5A 1VQHA 4UY8C 1XPUA 4K0KQ 4A3JG 2R7ZH 5IWAL 5FLXc 4JI7L 1CSQA 3TEHB 5AJ3Q 3UE0A 5C44G 4DK3C 3KF6A 3G71A 1HNXL 3GTPH 1HR0L 1WCMH 3K7UC 2NZHA 2IT1A 3NENA 4A3BH 4AIMA 5LMUL 3PO2G 1HZAA 1VQIA 3ZJYC 2E8GA 2PQAB 1X65A 5LMNW 1VQFA 1Q86C 5GAGC 3E0EA 3Q8DA 4LF5Q 4JI1L 3F2BA 4A3MH 1EIFA 2CQOA 1IBKQ 3CD6A 1IBKL 2ZTDA 3K80C 1BVSA 3I4OA 4L5TA 2A19A 1IL2A 3I2ZA 2OWOA 5IYDH 3HKZG 1YITA 1N36Q 4P73A 4PZ8A 2VNUD 3D31A 4DR1L 4DV4L 1PH6A 4BXXG 3I4NG 4JOIC 1IBLL 4DR6Q 3CAMA 3ULJA 3KJOA 1I3QH 5ELOA 4DV4Q 5IT9c 1FL0A 1VQ9A 3CC7A 2JE6I 3S1RH 4FDBA 1HJPA 1VQPA 2BH2A 1M1KC 1A63A 3JAMi 1XMQL 4NXML 1N34L 4A4IA 1NBWA 4GNXC 1S40A 2HQLA 1B8AA 2UU9L 4JI6Q 1XNRQ 3AFQA 1HNWQ 2OTJA 2UXBQ 4JBKA 2JA6G 3AFPA 3I4MG 4BY1H 3K0XA 1W3SA 4OONA 2JA7G 2D62A 3CCQA 3S16H 1Y1WH 1E7ZA 1IBML 2ZTCA 1QZHA 1UWVA 5IP7H 1A0IA 1VQCA 3BZCA 3H15A 4LFBQ 2UUCL 3HOWH 3PIPA 2RHQB 4A3MG 3J81c 2MO1A 5ELNA 2UUCQ 2BA0A 1VQ7A 4GKJL 3LGJA 3GO5A 1QVFA 2RCNA 4A3DG 4AQYQ 4KHPL 1YZ6A 2NVQH 4P74A 2HIXA 3UDXA 5GQOA 3S24A 1YI2A 1KL9A 3M3YH 2ASBA 4DV0Q 2VQEQ 1JJGA 4X64L 4X66Q 3TS0A 4HIKA 2K52A 5M5WH 3G48A 3UDIA 1MJCA 1PH1A 1X3GA 3CF5A 4YWLA 1KQSA 3GTLH 1X3EA 2WB1E 4JG2A 3H0GH 4DUZQ 5LMNL 1LYLA 1TXYA 5IY0A 5M3FG 4R4TA 3GTGH 2JEBI 3BZKA 3MXNB 3PO3H 4GKKL 3OTOQ 5LMNQ 1PH5A 4BY7H 2I5MX 4LUVA 3OYYA 4JC0A 3U50C 5FJ8H 4C3IH 5C4JH 4R4IA 3BJUA 5GAHC 1J5EL 1JT8A 1N9WA 2GVBA 3F2CA 1L1OA 4RMFA 4P72A 5JEAG 5IP7G 1ASZA 2ZJQA 1N33L 3J80i 2NZOA 2NVYH 1UE6A 1HZ9A 4R4CA 4LUZA 4LFAQ 4YCWA 4A75A 2Z6KC 1C0AA 4JI2L 1YJNA 1VCIA 4A3LG 2VY3A 3DLLA 3NELA 2DGYA 4LUOA 5JEAJ 2R93G 3RLNA 3S2DH 3T1YL 3CC4A 4LF6Q 4GKKQ 1PA6A 4AYBE 4LF9Q 2YTYA 3BU2A 4GLAC 3IRBA 2C35B 1SROA 1P16A 1WFQA 4GS3A 4LF4L 4DR4L 1CKOA 3PUZA 1A62A 4GOPB 5JJLA 5IYCH 3HOZH 1I50H 1YVCA 3TS2A 1SMXA 2D0OA 2PNHA 2HT1A 1S3OA 1HZCA 2Z0SA 5J3BA 4DR2Q 2OQ0A 1K9MC 3M4PA 4YHHQ 3CCUA 3T1HL 1KIXA 3M7NA 4LF7Q 4LFCQ 3GTKH 1X9NA 2R92G 2F3IA 2VS1A 3HOXG 1K73C 3GTQH 4IPGA 3T1HQ 3F2DA 2LSSA 2KENA 4Y7NH 4BBRH 4DR5L 1WI5A 1VQNA 1GVPA 4IFDI 3PCOB 5IP9H 1E1TA 1RL2A 3CPWA 3CCLA 4A3IH 1FJGQ 4JYAL 4A93G 3I7FA 3M9BA 4GN3B 3TRZA 1N32Q 4R4QA 3HFZB 2Y0SG 2YTXA 2K4KA 5M5XH 3S1QH 4C2MH 2QEXA 4J15A 1K8GA 2KBNA 1UEBA 2B63H 3HOUG 3J81j 4A3GG 3K8AA 2PQAA 5IWAQ 4JI7Q 3PUXA 1QZGA 4MNOA 4BA2I 1HNXQ 1HR0Q 4QIWE 4DV3L 1HNZL 4B3ML 5C4XG 3RR5A 4LW1A 1L0WA 5LMUQ 5IYCG 1VQ8A 1Q12A 2PI2A 4IPHA 1E22A 2IX1A 1AE2A 3KFUA 2MQHA 2JA8G 4P71A 4QGUA 2E2IH 4OWXB 4B3SL 2I5LX 4X6AH 3HKZE 2UUBL 4OX9L 4JI1Q 1WOCA 2MNAA 5JJKA 1XNQL 1IYJB 3CW2C 3ERSX 1D7QA 4ALPA 4B3TL 2OQKA 4KI0A 3PF4A 5IYBH 1Q1BA 1YBYA 3G4SA 4DR1Q 4IJLA 3L2PA 1IBLQ 3KYHC 1V43A 1YJWA 4O0AA 2E5LL 1PFSA 1EQQA 3FKIH 2F4VL 1EWIA 3GTMH 2R7ZG 4WJ4A 4GLVB 5JJIA 1CKNB 3ULPA 1XPOA 1Q81C 3EIVA 5EAYA 1WCMG 1Z47A 2IX0A 4POGA 2RHSB 1UE7A 2YTVA 1XMQQ 4NXMQ 3S14H 1N34Q 4A3BG 1AE3A 2UU9Q 3PV0A 3CCJA 1K83H 3CCVA 2JA5H 3CXCA 1VQMA 3PUWA 3KF8B 5C0XG 2BH8A 2V1CC 2YU9H 4XTCS 1NTGA 3W5OA 2KCMA 4MZ9A 1C7YA 3M4OH 1BKBA 4DV1L 4HIMA 3S2HH 3E9IA 3UDGA 4R1JA 3PGZA 4DV5L 2UUAL 1IBMQ 2GVAA 3F1ZA 2Q2TA 4JI5L 5C0XI 4PZ6A 1SLJA 2JK8A 5C0XJ 1VQLA 4GNXB 4GKJQ 2JQOA 2UXCL 1LUZA 2LXKA 2Q2HA 3STBC 4QJFA 3CCEA 4KHPQ 3GD7A 1T9HA 3WWVA 3G6EA 1B70B 3CCRA 1FVIA 1VQOA 2UXCQ 3W1BA 1O7IA 2JJQA 1MKHA 1ASYA 4X64Q 4DPGA 1YHAA 1XJVA 4DUYL 3AEVA 1W2BA 1NMGA 1EFWA 2DUDA 4LF8L 3A74A 4UPAA 3UDFA 3HOVH 2LXJA 4BY1G 3J7ZC 1CSPA 1G51A 1JMCA 3ER0A 4HJ7A 1CUKA 1NE3A 1Y14B 1BBWA 4A3FH 3D0FA 1YJ9A 1I5FA 4TVAB 4APVA 4OXPA 1N8RC 5FLMH 1WYDA 3A0JA 1XMOL 5GAEC 2IY5B 4L5SA 2R6GA 3HOWG 1KD1C 3JAMc 1Q1EA 3PSIA 2VUMH 1J5EQ 2HHHL 2ZM6L 3AQQA 5M3MH 1L1OC 1UE1A 1OXVA 4DV2L 1N33Q 4YY3L 4RG1A 3S17H 1Y1VH 2VW9A 1HZBA 2FXQA 4JI2Q 1PHJA 4IFDG 2AKWB 4A3KH 2RF4A 4GOPA 1K8AC 4C3HH 1PH8A 4GN5A 1Q8KA 4A3EH 2NN6G 3T1YQ 1EYGA 2VQFL 2UXDL 5BR8L 2JA9A 4NPSA 4A76A 1JB7A 3OW2A 4DR4Q 4JV5L 4DNIA 2NVXH 4LF4Q 2PI2E 1NMFA 2L15A 2K5HA 3H0GG 3L0OA 5H1SE 2AWNA 3KJPA 2EIFA 4IFDJ 3CCMA 1Q82C 2E2HH 4JI8L 3CP0A 5M5YH 3PO3G 1EQRA 2NN6I 4XIGS 4JBJA 4BY7G 2AHOB 3FP9A 4DK6C 4IO9A 4A3JH 1L2FA 2E2JH 5FJ8G 1V9PA 5C44H 4QL5A 4JI4L 1KRSA 4OO1I 1OXTA 1GD7A 1X6OA 3E9HA 1U0LA 2VUMG 2ALYB 4DAMA 3PO2H 2Y0SE 1LTLA 3I55A 3GTOH 1SE8A 4UP9A 4DR5Q 1OXXK 1EIYB 1Y1VG 4YWKA 1SR3A 2IHFA 4JYAQ 1TWGH 4DV6L 3HKSA 2XGTA 4X65L 4QQBX 1PH7A 1MIUA 1Q46A 1NY4A 1QUQB 2OCEA 2WFWA 3CPFA 4NB3A 4NXNL 4A3KG 2B3GA 4DV6Q 1NJIC 1VQJA 1PVOA 1E3PA 3CC2A 2PMZE 2KHJA 2HIVA 1U5KA 3GDEA 3J80c 1GO3E 3TREA 4IPCA 1SN8A 3PIOA 3M85A 1OXUA 5C3EH 3I4NH 2R7FA 4B3MQ 1HNZQ 4DV3Q 5GADC 2K75A 3HOZG 2WAQG 1PH4A 5IYDG 3J7A5 4K0KL 2A8VA 3RN5A 4UP7A 2B29A 1S72A 1HH2P 1P8LA 4PZ7A 5HY6A 4B3SQ 2CKZB 3J81i 1TWFH 3KDFB 2UUBQ 4OX9Q 3F8TA 4BBRG 1YEZA 1XNQQ 2JA6H 3I4MH 4KLKA 1PV4A 4OWWB 5IP9G 2MFIA 4B3TQ 2JA7H 1X54A 3SGIA 3K81C 1CKNA 1TWHH 3KF6B 5IE8A 4A3IG 1VQ4A 4LF5L 1PYBA 1VQEA 2H5XA 1KC8C 1XTDA 1D8LA 4DAYB 1X3FA 2N8NA 4DV7L 1FGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4O A;  1I6H H;  2QGQ A;  2K50 A;  1WJJ A;  1LM0 A;  2D0P A;  4EQ5 A;  2E5L Q;  2B63 G;  2F4V Q;  1N36 L;  4HJ5 A;  3S1N H;  4DV7 Q;  3U4V A;  3RZD H;  1SRU A;  4JOI A;  1IZ6 A;  2I5H A;  2VL6 A;  3A5U A;  1KHI A;  4C3J H;  1Q7Y C;  4DR6 L;  4A3D H;  3S1M H;  3CCS A;  4BBS H;  5HGQ A;  1OTC A;  2JEA I;  5C3E G;  1PYS B;  4OWT B;  4A3C H;  1AH9 A;  4POF A;  1X55 A;  2ZTE A;  3VDY A;  2KCT A;  2N49 A;  4P75 A;  3B6Y A;  4DR7 L;  1B7Y B;  4DV1 Q;  4GNX A;  4JI6 L;  2CWA A;  1GM5 A;  3NEM A;  4DV5 Q;  2A1A A;  3JC6 6;  2ES2 A;  2UUA Q;  1XNR L;  1HNW L;  1PH9 A;  2UXB L;  3H3V H;  4DR7 Q;  3MEF A;  2AWO A;  1KRT A;  1E24 A;  5E7N A;  4JI5 Q;  3PUV A;  1GKH A;  1K0R A;  5IYB G;  3CME A;  5M3F H;  1X56 A;  3KLW A;  3PUY A;  1PH3 A;  4LFB L;  3CMA A;  2AMC B;  3FKI G;  1Y1W G;  2CCZ A;  1VQD A;  1PH2 A;  2XTI A;  1Z9F A;  1SFO H;  3KOJ A;  4BA1 I;  1G6P A;  2F52 A;  1H95 A;  4AQY L;  2BA1 A;  1JJC B;  4DUY Q;  4KHZ A;  1BBU A;  4A3L H;  2IHE A;  4HJ8 A;  4LF8 Q;  3L7Z C;  2JA5 G;  2NVT H;  4DV0 L;  4BBS G;  1QVG A;  1A8V A;  2VQE L;  4HJA A;  1C9O A;  3HOY H;  4JBM A;  4X66 L;  1R9T H;  4A3C G;  3ICE A;  2R93 H;  3TQY A;  3U4Z A;  1VQK A;  3A5Z B;  2ZJP A;  4YWM A;  4AH6 A;  1YIJ A;  4O2D A;  1XMO Q;  4L5Q A;  3FHW A;  4DUZ L;  1OXS C;  2ZJR A;  1HR0 W;  2HHH Q;  2ZM6 Q;  1IXR A;  1G29 1;  4WJ3 M;  1DGS A;  4HJ9 A;  2MO0 A;  3M4Q A;  4GN4 B;  4DV2 Q;  2K5N A;  4TQU S;  4YY3 Q;  3OTO L;  2QA4 A;  1YHB A;  2WB1 G;  2I0Q A;  1KXL A;  4QY7 A;  1J6Q A;  3CQZ H;  1RIP A;  1TWA H;  3K7A H;  3UE1 A;  2R92 H;  4LWC A;  4ME3 A;  3HOX H;  4PMW A;  1VQB A;  1I94 L;  3H3V I;  3STB D;  4H02 A;  2CWP A;  3RLF A;  1YHQ A;  2Z6K A;  4GOP C;  4LFA L;  1KAW A;  2N78 A;  1M90 C;  1I94 Q;  4OO1 G;  4JI3 L;  2VQF Q;  5BR8 Q;  3GTJ H;  4A93 H;  3U58 A;  2UXD Q;  4YCU A;  1VS0 A;  1L1O B;  2VZA A;  1V1Q A;  3HOV G;  4JV5 Q;  4Y52 H;  3NBH B;  4JI3 Q;  4DKA C;  2R7D A;  4IOC A;  4JCV E;  4LF6 L;  4HIO A;  2CFM A;  4JI8 Q;  1JE5 A;  4LF9 L;  4A3F G;  3HOY G;  3RN2 A;  3RLO A;  1EUJ A;  3HOU H;  5FLM G;  4A3G H;  4X62 L;  3RNU A;  4HID A;  4UP8 A;  2YYZ A;  5GRO A;  1YNX A;  5DLQ E;  4JI4 Q;  1K3R A;  1CKM A;  1EOV A;  4AYB G;  5M3M G;  4L5R C;  4X62 Q;  3RZO H;  1QUQ A;  5C4X H;  2Q2I A;  3I56 A;  4DR2 L;  4B3R L;  4IOA A;  4YHH L;  1QVC A;  3EBE A;  4JBW A;  4LF7 L;  4MTN A;  4LFC L;  2JA8 H;  3S15 H;  4B3R Q;  2K5V A;  3AYH B;  3PF5 A;  1XPR A;  1MJE A;  1UE5 A;  1VQA A;  2EXD A;  4JI0 L;  4PG3 A;  4EX5 A;  1VQ6 A;  4YCV A;  4X65 Q;  2YV5 A;  2KHI A;  4JI0 Q;  4NXN Q;  4A3E G;  1VQ5 A;  1E1O A;  2WP8 J;  4DR3 L;  4GLX A;  1FJG L;  2WAQ E;  4IJH A;  2Q2U A;  3ULL A;  2OTL A;  4BXX H;  1N32 L;  3W1G A;  2N3S A;  2EQS A;  2ATW A;  4DR3 Q;  1VQG A;  3EN2 A;  3DM3 A;  2K14 A;  1JJ2 A;  2ID0 A;  3KDF A;  5AJ3 L;  4LNQ A;  1TWC H;  5K36 G;  4IPD A;  2GN5 A;  1VQH A;  4UY8 C;  1XPU A;  4K0K Q;  4A3J G;  2R7Z H;  5IWA L;  5FLX c;  4JI7 L;  1CSQ A;  3TEH B;  5AJ3 Q;  3UE0 A;  5C44 G;  4DK3 C;  3KF6 A;  3G71 A;  1HNX L;  3GTP H;  1HR0 L;  1WCM H;  3K7U C;  2NZH A;  2IT1 A;  3NEN A;  4A3B H;  4AIM A;  5LMU L;  3PO2 G;  1HZA A;  1VQI A;  3ZJY C;  2E8G A;  2PQA B;  1X65 A;  5LMN W;  1VQF A;  1Q86 C;  5GAG C;  3E0E A;  3Q8D A;  4LF5 Q;  4JI1 L;  3F2B A;  4A3M H;  1EIF A;  2CQO A;  1IBK Q;  3CD6 A;  1IBK L;  2ZTD A;  3K80 C;  1BVS A;  3I4O A;  4L5T A;  2A19 A;  1IL2 A;  3I2Z A;  2OWO A;  5IYD H;  3HKZ G;  1YIT A;  1N36 Q;  4P73 A;  4PZ8 A;  2VNU D;  3D31 A;  4DR1 L;  4DV4 L;  1PH6 A;  4BXX G;  3I4N G;  4JOI C;  1IBL L;  4DR6 Q;  3CAM A;  3ULJ A;  3KJO A;  1I3Q H;  5ELO A;  4DV4 Q;  5IT9 c;  1FL0 A;  1VQ9 A;  3CC7 A;  2JE6 I;  3S1R H;  4FDB A;  1HJP A;  1VQP A;  2BH2 A;  1M1K C;  1A63 A;  3JAM i;  1XMQ L;  4NXM L;  1N34 L;  4A4I A;  1NBW A;  4GNX C;  1S40 A;  2HQL A;  1B8A A;  2UU9 L;  4JI6 Q;  1XNR Q;  3AFQ A;  1HNW Q;  2OTJ A;  2UXB Q;  4JBK A;  2JA6 G;  3AFP A;  3I4M G;  4BY1 H;  3K0X A;  1W3S A;  4OON A;  2JA7 G;  2D62 A;  3CCQ A;  3S16 H;  1Y1W H;  1E7Z A;  1IBM L;  2ZTC A;  1QZH A;  1UWV A;  5IP7 H;  1A0I A;  1VQC A;  3BZC A;  3H15 A;  4LFB Q;  2UUC L;  3HOW H;  3PIP A;  2RHQ B;  4A3M G;  3J81 c;  2MO1 A;  5ELN A;  2UUC Q;  2BA0 A;  1VQ7 A;  4GKJ L;  3LGJ A;  3GO5 A;  1QVF A;  2RCN A;  4A3D G;  4AQY Q;  4KHP L;  1YZ6 A;  2NVQ H;  4P74 A;  2HIX A;  3UDX A;  5GQO A;  3S24 A;  1YI2 A;  1KL9 A;  3M3Y H;  2ASB A;  4DV0 Q;  2VQE Q;  1JJG A;  4X64 L;  4X66 Q;  3TS0 A;  4HIK A;  2K52 A;  5M5W H;  3G48 A;  3UDI A;  1MJC A;  1PH1 A;  1X3G A;  3CF5 A;  4YWL A;  1KQS A;  3GTL H;  1X3E A;  2WB1 E;  4JG2 A;  3H0G H;  4DUZ Q;  5LMN L;  1LYL A;  1TXY A;  5IY0 A;  5M3F G;  4R4T A;  3GTG H;  2JEB I;  3BZK A;  3MXN B;  3PO3 H;  4GKK L;  3OTO Q;  5LMN Q;  1PH5 A;  4BY7 H;  2I5M X;  4LUV A;  3OYY A;  4JC0 A;  3U50 C;  5FJ8 H;  4C3I H;  5C4J H;  4R4I A;  3BJU A;  5GAH C;  1J5E L;  1JT8 A;  1N9W A;  2GVB A;  3F2C A;  1L1O A;  4RMF A;  4P72 A;  5JEA G;  5IP7 G;  1ASZ A;  2ZJQ A;  1N33 L;  3J80 i;  2NZO A;  2NVY H;  1UE6 A;  1HZ9 A;  4R4C A;  4LUZ A;  4LFA Q;  4YCW A;  4A75 A;  2Z6K C;  1C0A A;  4JI2 L;  1YJN A;  1VCI A;  4A3L G;  2VY3 A;  3DLL A;  3NEL A;  2DGY A;  4LUO A;  5JEA J;  2R93 G;  3RLN A;  3S2D H;  3T1Y L;  3CC4 A;  4LF6 Q;  4GKK Q;  1PA6 A;  4AYB E;  4LF9 Q;  2YTY A;  3BU2 A;  4GLA C;  3IRB A;  2C35 B;  1SRO A;  1P16 A;  1WFQ A;  4GS3 A;  4LF4 L;  4DR4 L;  1CKO A;  3PUZ A;  1A62 A;  4GOP B;  5JJL A;  5IYC H;  3HOZ H;  1I50 H;  1YVC A;  3TS2 A;  1SMX A;  2D0O A;  2PNH A;  2HT1 A;  1S3O A;  1HZC A;  2Z0S A;  5J3B A;  4DR2 Q;  2OQ0 A;  1K9M C;  3M4P A;  4YHH Q;  3CCU A;  3T1H L;  1KIX A;  3M7N A;  4LF7 Q;  4LFC Q;  3GTK H;  1X9N A;  2R92 G;  2F3I A;  2VS1 A;  3HOX G;  1K73 C;  3GTQ H;  4IPG A;  3T1H Q;  3F2D A;  2LSS A;  2KEN A;  4Y7N H;  4BBR H;  4DR5 L;  1WI5 A;  1VQN A;  1GVP A;  4IFD I;  3PCO B;  5IP9 H;  1E1T A;  1RL2 A;  3CPW A;  3CCL A;  4A3I H;  1FJG Q;  4JYA L;  4A93 G;  3I7F A;  3M9B A;  4GN3 B;  3TRZ A;  1N32 Q;  4R4Q A;  3HFZ B;  2Y0S G;  2YTX A;  2K4K A;  5M5X H;  3S1Q H;  4C2M H;  2QEX A;  4J15 A;  1K8G A;  2KBN A;  1UEB A;  2B63 H;  3HOU G;  3J81 j;  4A3G G;  3K8A A;  2PQA A;  5IWA Q;  4JI7 Q;  3PUX A;  1QZG A;  4MNO A;  4BA2 I;  1HNX Q;  1HR0 Q;  4QIW E;  4DV3 L;  1HNZ L;  4B3M L;  5C4X G;  3RR5 A;  4LW1 A;  1L0W A;  5LMU Q;  5IYC G;  1VQ8 A;  1Q12 A;  2PI2 A;  4IPH A;  1E22 A;  2IX1 A;  1AE2 A;  3KFU A;  2MQH A;  2JA8 G;  4P71 A;  4QGU A;  2E2I H;  4OWX B;  4B3S L;  2I5L X;  4X6A H;  3HKZ E;  2UUB L;  4OX9 L;  4JI1 Q;  1WOC A;  2MNA A;  5JJK A;  1XNQ L;  1IYJ B;  3CW2 C;  3ERS X;  1D7Q A;  4ALP A;  4B3T L;  2OQK A;  4KI0 A;  3PF4 A;  5IYB H;  1Q1B A;  1YBY A;  3G4S A;  4DR1 Q;  4IJL A;  3L2P A;  1IBL Q;  3KYH C;  1V43 A;  1YJW A;  4O0A A;  2E5L L;  1PFS A;  1EQQ A;  3FKI H;  2F4V L;  1EWI A;  3GTM H;  2R7Z G;  4WJ4 A;  4GLV B;  5JJI A;  1CKN B;  3ULP A;  1XPO A;  1Q81 C;  3EIV A;  5EAY A;  1WCM G;  1Z47 A;  2IX0 A;  4POG A;  2RHS B;  1UE7 A;  2YTV A;  1XMQ Q;  4NXM Q;  3S14 H;  1N34 Q;  4A3B G;  1AE3 A;  2UU9 Q;  3PV0 A;  3CCJ A;  1K83 H;  3CCV A;  2JA5 H;  3CXC A;  1VQM A;  3PUW A;  3KF8 B;  5C0X G;  2BH8 A;  2V1C C;  2YU9 H;  4XTC S;  1NTG A;  3W5O A;  2KCM A;  4MZ9 A;  1C7Y A;  3M4O H;  1BKB A;  4DV1 L;  4HIM A;  3S2H H;  3E9I A;  3UDG A;  4R1J A;  3PGZ A;  4DV5 L;  2UUA L;  1IBM Q;  2GVA A;  3F1Z A;  2Q2T A;  4JI5 L;  5C0X I;  4PZ6 A;  1SLJ A;  2JK8 A;  5C0X J;  1VQL A;  4GNX B;  4GKJ Q;  2JQO A;  2UXC L;  1LUZ A;  2LXK A;  2Q2H A;  3STB C;  4QJF A;  3CCE A;  4KHP Q;  3GD7 A;  1T9H A;  3WWV A;  3G6E A;  1B70 B;  3CCR A;  1FVI A;  1VQO A;  2UXC Q;  3W1B A;  1O7I A;  2JJQ A;  1MKH A;  1ASY A;  4X64 Q;  4DPG A;  1YHA A;  1XJV A;  4DUY L;  3AEV A;  1W2B A;  1NMG A;  1EFW A;  2DUD A;  4LF8 L;  3A74 A;  4UPA A;  3UDF A;  3HOV H;  2LXJ A;  4BY1 G;  3J7Z C;  1CSP A;  1G51 A;  1JMC A;  3ER0 A;  4HJ7 A;  1CUK A;  1NE3 A;  1Y14 B;  1BBW A;  4A3F H;  3D0F A;  1YJ9 A;  1I5F A;  4TVA B;  4APV A;  4OXP A;  1N8R C;  5FLM H;  1WYD A;  3A0J A;  1XMO L;  5GAE C;  2IY5 B;  4L5S A;  2R6G A;  3HOW G;  1KD1 C;  3JAM c;  1Q1E A;  3PSI A;  2VUM H;  1J5E Q;  2HHH L;  2ZM6 L;  3AQQ A;  5M3M H;  1L1O C;  1UE1 A;  1OXV A;  4DV2 L;  1N33 Q;  4YY3 L;  4RG1 A;  3S17 H;  1Y1V H;  2VW9 A;  1HZB A;  2FXQ A;  4JI2 Q;  1PHJ A;  4IFD G;  2AKW B;  4A3K H;  2RF4 A;  4GOP A;  1K8A C;  4C3H H;  1PH8 A;  4GN5 A;  1Q8K A;  4A3E H;  2NN6 G;  3T1Y Q;  1EYG A;  2VQF L;  2UXD L;  5BR8 L;  2JA9 A;  4NPS A;  4A76 A;  1JB7 A;  3OW2 A;  4DR4 Q;  4JV5 L;  4DNI A;  2NVX H;  4LF4 Q;  2PI2 E;  1NMF A;  2L15 A;  2K5H A;  3H0G G;  3L0O A;  5H1S E;  2AWN A;  3KJP A;  2EIF A;  4IFD J;  3CCM A;  1Q82 C;  2E2H H;  4JI8 L;  3CP0 A;  5M5Y H;  3PO3 G;  1EQR A;  2NN6 I;  4XIG S;  4JBJ A;  4BY7 G;  2AHO B;  3FP9 A;  4DK6 C;  4IO9 A;  4A3J H;  1L2F A;  2E2J H;  5FJ8 G;  1V9P A;  5C44 H;  4QL5 A;  4JI4 L;  1KRS A;  4OO1 I;  1OXT A;  1GD7 A;  1X6O A;  3E9H A;  1U0L A;  2VUM G;  2ALY B;  4DAM A;  3PO2 H;  2Y0S E;  1LTL A;  3I55 A;  3GTO H;  1SE8 A;  4UP9 A;  4DR5 Q;  1OXX K;  1EIY B;  1Y1V G;  4YWK A;  1SR3 A;  2IHF A;  4JYA Q;  1TWG H;  4DV6 L;  3HKS A;  2XGT A;  4X65 L;  4QQB X;  1PH7 A;  1MIU A;  1Q46 A;  1NY4 A;  1QUQ B;  2OCE A;  2WFW A;  3CPF A;  4NB3 A;  4NXN L;  4A3K G;  2B3G A;  4DV6 Q;  1NJI C;  1VQJ A;  1PVO A;  1E3P A;  3CC2 A;  2PMZ E;  2KHJ A;  2HIV A;  1U5K A;  3GDE A;  3J80 c;  1GO3 E;  3TRE A;  4IPC A;  1SN8 A;  3PIO A;  3M85 A;  1OXU A;  5C3E H;  3I4N H;  2R7F A;  4B3M Q;  1HNZ Q;  4DV3 Q;  5GAD C;  2K75 A;  3HOZ G;  2WAQ G;  1PH4 A;  5IYD G;  3J7A 5;  4K0K L;  2A8V A;  3RN5 A;  4UP7 A;  2B29 A;  1S72 A;  1HH2 P;  1P8L A;  4PZ7 A;  5HY6 A;  4B3S Q;  2CKZ B;  3J81 i;  1TWF H;  3KDF B;  2UUB Q;  4OX9 Q;  3F8T A;  4BBR G;  1YEZ A;  1XNQ Q;  2JA6 H;  3I4M H;  4KLK A;  1PV4 A;  4OWW B;  5IP9 G;  2MFI A;  4B3T Q;  2JA7 H;  1X54 A;  3SGI A;  3K81 C;  1CKN A;  1TWH H;  3KF6 B;  5IE8 A;  4A3I G;  1VQ4 A;  4LF5 L;  1PYB A;  1VQE A;  2H5X A;  1KC8 C;  1XTD A;  1D8L A;  4DAY B;  1X3F A;  2N8N A;  4DV7 L;  1FGU A; 
#chains in the Genus database with same CATH topology
 2F0H A;  3ERO A;  2EXZ A;  4UAI A;  5E1F A;  2B63 G;  4HJ5 A;  1LAB A;  3W3A A;  4DV7 Q;  3GP7 A;  4JOI A;  1IZ6 A;  3KLS A;  4JW0 A;  1Q7Y C;  3S1M H;  3SK8 A;  5KRU A;  2G5D A;  4QF4 A;  3D4D A;  1PYS B;  2Q8T A;  2A74 C;  4A3C H;  5ELD A;  1ENA A;  1IHZ A;  1ICW A;  2N49 A;  4P75 A;  3B6Y A;  4GNX A;  2CWA A;  4DV5 Q;  1WTQ A;  1D2B A;  2UXB L;  2N88 A;  4DR7 Q;  4CBV A;  4A3J B;  3I72 A;  5E7N A;  4JI5 Q;  2AQ1 B;  5M3F H;  1X56 A;  2X6L A;  1QG7 A;  1RJT A;  4R8I A;  2BE5 D;  1ZYR C;  1SE3 A;  4HAE A;  1K28 A;  2XTI A;  1SFO H;  3K0Y A;  2F52 A;  1H95 A;  1D1I A;  4PQX A;  2E75 C;  4AQY L;  1JJC B;  1BBU A;  3CU7 A;  1W6K A;  4ZQ3 A;  4BBS G;  3RMH A;  1A8V A;  3HOY H;  2N55 A;  4NP5 A;  1YNJ D;  3I4N B;  2ZJP A;  1XTC D;  2RBM A;  2D2C C;  4HMJ A;  1LTG D;  4WJ3 M;  1G29 1;  4G7H C;  4X3K A;  3C3L A;  4TQU S;  4YY3 Q;  3OTO L;  2A6H C;  2MUY A;  4FXK C;  2I0Q A;  1B50 A;  2CVR A;  4EQN A;  3CQZ H;  1RIP A;  3I4M B;  1YNN D;  3K7A H;  2DY7 A;  1HA6 A;  4LWC A;  1I4X A;  4LMQ D;  2JA7 B;  2FJ2 A;  1GUO A;  5FLX E;  4LFA L;  1ICF B;  1KAW A;  3HZX A;  4DK1 A;  4OO1 G;  4JI3 L;  2VQF Q;  4OL7 A;  2UXD Q;  4UDU C;  5J1Z A;  1L1O B;  4A3M B;  4B9X A;  2QKI C;  4DKA C;  4HIO A;  2AUJ D;  3S1M B;  4HMI A;  5FLM G;  2O5I C;  4MTK A;  1SYB A;  1YNX A;  1CKM A;  1STB A;  4X62 Q;  2WKC A;  4L63 B;  1QUQ A;  3I56 A;  5EPK A;  1UNS A;  2EYH A;  4JBW A;  1ESR A;  1BCP C;  4RGN A;  3PF5 A;  1S5F D;  4JI0 L;  2I07 B;  5NUC A;  1VQ6 A;  4EX5 A;  3BG3 A;  2TMP A;  5M3F B;  1I6V C;  3FRP B;  1R4Q B;  1VQ5 A;  2K01 A;  3S16 B;  3P20 A;  4GLX A;  1WTR A;  3QOL A;  1J9O A;  2B2T C;  2OTL A;  4IUQ A;  4V19 0;  2NWG A;  2N3S A;  3A8J E;  1SFO B;  3EN2 A;  3DM3 A;  1ESF A;  2ID0 A;  2PW7 A;  1EOT A;  1K8O A;  5K36 G;  4IPD A;  2GN5 A;  3EA6 A;  1XPU A;  4K0K Q;  5J39 A;  5EQ0 A;  4CGY B;  3SEB A;  5FLX c;  4JI7 L;  3TEH B;  5AJ3 Q;  3MXU A;  2F0T A;  1HNX L;  2FIN B;  3X3M A;  2XRQ D;  4DAY A;  3PO2 G;  3J81 E;  1TS5 A;  1SNP A;  3AB9 A;  2WII B;  5LMN W;  1Q86 C;  5GAG C;  5C4Z A;  3E0E A;  2CQO A;  3K80 C;  4RWS C;  4QCL A;  2WIN B;  1IL2 A;  3CQZ B;  3HKZ G;  5CMD A;  3K7A B;  2PNR C;  4JOI C;  1KAB A;  4HCE A;  4KKU A;  1JCK B;  3CAM A;  4DV4 Q;  1VQ9 A;  5I4D A;  2JE6 I;  1HJP A;  1NR2 A;  5IGC A;  1H9J A;  1N34 L;  4GNX C;  1ML0 D;  2HQL A;  1B8A A;  2UU9 L;  2UXB Q;  1TY0 A;  4OON A;  3KLS X;  1EFI D;  3HP3 A;  1E7Z A;  2PMZ B;  1QZH A;  1UUP A;  1WTW A;  4KY5 A;  1VQC A;  3BZC A;  1A6X A;  3HOW H;  1MBY A;  4B08 A;  2RHQ B;  5IGF A;  3J81 c;  5CV9 A;  5ELN A;  1EWC A;  1VQ7 A;  3H91 A;  5DAU A;  4K8I A;  3HEJ A;  4C3J G;  4A3D G;  4AQY Q;  4KHP L;  2HDL A;  2NVQ H;  4G4K A;  4F7X A;  3UDX A;  5GQO A;  4EQP A;  1V8Q A;  1SNC A;  2NN6 H;  4KN7 C;  1MJC A;  1L0Y B;  1PH1 A;  3VR2 A;  2OEO A;  2WB1 E;  4C2M B;  5LMN L;  2D5D A;  3MXN B;  1IYU A;  3PO3 H;  4GKK L;  3OTO Q;  3HRZ C;  3D6W A;  1RCV D;  1JIC A;  4LUV A;  3U50 C;  5FO9 B;  5FJ8 H;  5C4J H;  3DEO A;  5EBC A;  2ZJQ A;  2HCC A;  1N33 L;  4LFA Q;  1RD9 D;  4K5V A;  1YJN A;  2KVM A;  2L1B A;  4EVO A;  2VY3 A;  3DLL A;  3QR8 A;  4ZRZ A;  5JEA J;  5A2Q E;  2O4X A;  5FK9 C;  3ITP A;  1K0S A;  5COY A;  2XWJ B;  4ZUJ A;  4GLA C;  4J6H A;  1P16 A;  3MEH A;  4V0B A;  5FKA C;  4GOP B;  5IYC H;  1YVC A;  2D0O A;  2PNH A;  2HT1 A;  5J3B A;  1VDZ A;  2JSO A;  3CCU A;  1DM0 B;  3M7N A;  3T56 B;  1HXY D;  1F2Z A;  2PZW A;  3S14 B;  3HOX G;  1K73 C;  1STG A;  4IPG A;  3HG9 A;  2DN8 A;  4BBR H;  1EIG A;  2IX3 A;  1E1T A;  3CPW A;  3HOW B;  4A3I H;  4A93 G;  2MGS A;  3M9B A;  1PRT B;  1H9R A;  2NTS A;  1H9S A;  4KN4 C;  2KBN A;  3TDQ A;  3TP7 A;  1UEB A;  2B63 H;  4A3G G;  2NVQ B;  3TP5 A;  2PQA A;  4JI7 Q;  3PUX A;  3NQI A;  1QZG A;  1HNX Q;  4QIW E;  4TSS A;  4FP5 D;  2RA4 A;  3RR5 A;  4LW1 A;  3SDZ A;  3O13 A;  2IX1 A;  3KFU A;  2E2I H;  4B3S L;  4OX9 L;  1Y8N B;  2L55 A;  1WOC A;  3PO3 B;  4ZCK A;  4KD3 A;  1LTR D;  5C4J B;  4ALP A;  2OQK A;  3PF4 A;  1Q1B A;  4XT1 B;  1HTP A;  1U4M A;  3E0J A;  1V43 A;  1PFS A;  1EWI A;  2R7Z G;  1V1P B;  1EWH A;  1Q81 C;  3EIV A;  1PTO H;  5EAY A;  4POG A;  1XWE A;  1TY2 A;  2RHS B;  2F0S A;  1N34 Q;  2UU9 Q;  2PZU A;  1VQM A;  4NKL A;  4FXG C;  2BH8 A;  4TRD A;  2YU9 H;  4XTC S;  3G7L A;  1SE2 A;  1HUM A;  4DV1 L;  4O42 A;  3E9I A;  1Y8P B;  2UUA L;  3F1Z A;  2HCI A;  1II3 A;  1QNU A;  5M5Y B;  4PZ6 A;  5JPM C;  1LT6 D;  5C0X J;  2F0M A;  4EGV A;  2JQO A;  3STB C;  1LLR D;  4KHP Q;  3CCE A;  4BBR B;  3I73 A;  2UXC Q;  3G6E A;  1B70 B;  1JC7 A;  3MZ5 A;  3ZYY X;  1WTV A;  5JOB A;  4A3I B;  3C1F A;  1S5C D;  4DPG A;  1UAP A;  1Z7T A;  2O2L D;  5ELE A;  1XJV A;  4RH6 A;  1NMG A;  2K28 A;  5AFW A;  2ZXO A;  4DNT B;  4OO1 H;  1WTP A;  4LF8 L;  4X3T A;  2B63 B;  1SSO A;  2K1B A;  2F03 A;  1PFN A;  2WAC A;  1JMC A;  4ULL A;  1YJ9 A;  4GKK Q;  5FLM H;  1WYD A;  3C2P A;  2M9V A;  2B8G A;  2ZM6 L;  2KCC A;  1N33 Q;  3S17 H;  3J80 E;  1MSH A;  4FF2 A;  3J7Y W;  1HZB A;  1PHJ A;  4L8J A;  1C8C A;  2J0T D;  1PH8 A;  3SK4 A;  1Q8K A;  1SAP A;  2Z8L A;  2JA9 A;  4JV5 L;  4IFD I;  2PI2 E;  3L0O A;  2K5H A;  3H3V C;  3K5L A;  1EY0 A;  4N9T A;  1FGB D;  1Q82 C;  1PTO B;  2M00 A;  4DU9 A;  3U9O A;  5K36 H;  4BY7 G;  4DK6 C;  1L2F A;  5IIF A;  4BBS B;  4OO1 I;  1OXT A;  5JJZ A;  2YU9 B;  1H9K A;  2HD3 A;  4OGQ C;  1U0L A;  2VUM G;  4DAM A;  3PO2 H;  1FNU A;  4OIK A;  1K8M A;  3BYT B;  1EIY B;  2VXW A;  1Y1V G;  1SR3 A;  2RSO A;  1TWG H;  5A2Q L;  4PMB A;  1MIU A;  1Q46 A;  2K05 A;  3A8I E;  4NW2 A;  4NXN L;  4A3K G;  4EQO A;  2HIV A;  1U5K A;  2B2U A;  2IJ0 A;  3J80 c;  4LAA A;  3Q22 A;  5JVG 3;  3M85 A;  2EYM A;  1HCZ A;  2K03 A;  1DCZ A;  3RN5 A;  4L6T B;  4UP7 A;  1EEF D;  4C1N K;  1HH2 P;  4B3S Q;  4QUC A;  1W6J A;  4OX9 Q;  3F8T A;  4OHJ A;  4I65 A;  1EIH A;  1PV4 A;  5IP9 G;  2MFI A;  3KF6 B;  5IE8 A;  1VQ4 A;  1ZXT A;  4LF5 L;  1VQE A;  3UI2 A;  5D14 A;  3DXJ C;  1BCP F;  1Y1W H;  4X6A H;  4DV7 L;  1EZ8 A;  4H13 C;  3BS1 A;  2QGQ A;  1JB3 A;  2K50 A;  3SK5 A;  4J1M A;  3S1N H;  3KF8 A;  3NP8 A;  4HN7 A;  2A69 D;  2QDL A;  4C3J H;  4A3D H;  4I7Z C;  5C3E G;  5EKI A;  1LAC A;  3T13 A;  1VMP A;  3ERQ A;  5FO7 B;  4DR7 L;  1B7Y B;  4DV1 Q;  4JI6 L;  2OXP A;  3NEM A;  2UUA Q;  3JC6 6;  1BBX C;  3MEF A;  2SOB A;  1E24 A;  2PYK A;  2Z6B A;  3PUV A;  3CME A;  2EY2 A;  4OEM B;  3A56 A;  2EPB A;  4LFB L;  3PO2 B;  4KTA A;  5C4X B;  2WKD A;  1I4R A;  1QOH A;  1CA6 A;  1SMY C;  1B3A A;  1TWG B;  2NBF A;  1RHP A;  4JK1 C;  5CV6 A;  2BA1 A;  4IUR A;  1GUS A;  4HJ8 A;  4LF8 Q;  3HKZ B;  1QB5 D;  2VQE L;  1QVG A;  1C9O A;  4JBM A;  1R9T H;  3TQY A;  3U4Z A;  4YWM A;  4AH6 A;  1ONL A;  1E0B A;  1STE A;  4L5Q A;  3IL8 A;  4E6I A;  3DWP A;  2NB0 A;  4DUZ L;  2ZM6 Q;  1I4Q A;  4GN4 B;  2K5N A;  2QA4 A;  1ILQ A;  2WB1 G;  4QY7 A;  1QCB D;  2SEB D;  1WCM B;  3D6C A;  5E3F A;  1TWA H;  4DF7 A;  3HOX H;  4PMW A;  1VQB A;  4H02 A;  2CWP A;  3RLF A;  1YHQ A;  2CH4 A;  2Z6K A;  1I94 Q;  4JPB W;  5HGT A;  3DMU A;  4A93 H;  3U58 A;  1VS0 A;  4Y52 H;  1EY4 A;  1V1Q A;  4JV5 Q;  1A3U A;  1JWU D;  1NUC A;  3NBH B;  5JVH 3;  3S1N B;  1VF7 A;  2KQ3 A;  2R7D A;  2X6G A;  2KCN A;  2XN9 C;  4JCV E;  4LF6 L;  3C46 A;  2CFM A;  1JE5 A;  1FYC A;  4C3J B;  3OW7 A;  3RN2 A;  4LF9 L;  4A3D B;  1EUJ A;  1S5E D;  4YIJ A;  4A3G H;  1J8I A;  4X62 L;  1EYD A;  5GRO A;  4F8M A;  3VYR A;  5KEE A;  3S1R B;  4IUV A;  4DNR B;  5BN5 A;  5DM6 3;  2OT2 A;  1QVC A;  4LF7 L;  4MTN A;  4LFC L;  3S15 H;  4B3R Q;  1VQA A;  2EXD A;  2A68 D;  5D3I B;  1BF4 A;  1SYF A;  4MIU A;  2KHI A;  4NXN Q;  1XXG A;  1E1O A;  2HDM A;  1N32 L;  4IJH A;  4BXX H;  3ULL A;  2B2U C;  3U9S A;  1CI3 M;  1VQG A;  3KDF A;  1B44 D;  2F0V A;  5AJ3 L;  1TWC H;  4IUN A;  1SYE A;  2R3Z A;  2R7Z H;  2ZT9 C;  4FVM A;  2L0C A;  4N8F A;  3UE0 A;  4DK3 C;  5C44 G;  3G71 A;  3NEN A;  1R9T B;  4AIM A;  2F0O A;  3R2T A;  2F0K A;  3TZD A;  2BCO A;  4DA2 A;  4XQN A;  1X65 A;  3EJI A;  5M5W B;  1QNK A;  1EY9 A;  2F0Q A;  3Q8D A;  4LF5 Q;  4JI1 L;  4A3M H;  3IKJ A;  2CH4 W;  2ZTD A;  4L5T A;  1BVS A;  1V1O A;  2A19 A;  3I2Z A;  2OWO A;  1TWA B;  4P73 A;  3OIP A;  4G7Z C;  2H4O A;  3HOX B;  4DR1 L;  4DV4 L;  2H1E A;  2IL8 A;  2I46 A;  2Q8I B;  4DAP A;  1GUW A;  3ULJ A;  1I3Q H;  1BO0 A;  5ELO A;  3CC7 A;  3TSS A;  4A93 B;  5I2Y A;  3L9A X;  2BH2 A;  1A63 A;  3JAM i;  2B8F A;  1ZKO A;  4HSP A;  4JI6 Q;  4K2K A;  4A4I A;  1CA5 A;  3VA7 A;  3AFQ A;  2OTJ A;  3OIQ A;  2JA6 G;  3K0X A;  4A3G B;  1CTM A;  1LT4 D;  3S16 H;  1D5M C;  1UWV A;  3H15 A;  4LFB Q;  3L3O C;  4Q5V A;  5COR A;  2K5W A;  1SNQ A;  3S15 B;  2UUC Q;  4GKJ L;  1CZW A;  3NSW A;  1QVF A;  2RCN A;  2JXM B;  1YZ6 A;  1SND A;  4RHS A;  4P74 A;  2HIX A;  4OIJ A;  3P1H A;  1YI2 A;  2VQE Q;  5KYL A;  3M7G A;  3MFY A;  3UDI A;  1TWC B;  4YWL A;  1B9M A;  3SHL A;  5I6W A;  2PPB C;  4IUP A;  2R7Z B;  1AZQ A;  4WOR A;  4DUZ Q;  1SDF A;  3N6R A;  1LYL A;  3TP6 A;  3PIO 3;  1SXT A;  2K5Q A;  1X3Q A;  5D3D A;  3GTG H;  5IGG A;  1PZI D;  1PH5 A;  4BY7 H;  3VYU A;  1E2Z A;  3BJU A;  1BOS A;  5GAH C;  1J5E L;  3F2C A;  1L1O A;  4RMF A;  5JEA G;  5IP7 G;  1CM9 A;  5CBA E;  1EZ6 A;  1ZYR D;  2NVY H;  4R4C A;  4LUZ A;  2Z6K C;  2RDF A;  4JI2 L;  3QO2 A;  1Q8I A;  4WFN 3;  4LUO A;  2R93 G;  3BDC A;  1IYV A;  3T1Y L;  4LF6 Q;  2F0N A;  5KGU A;  4AYB E;  4LF9 Q;  3BU2 A;  1STY A;  3BDO A;  4RGT A;  1I3Q B;  1HHV A;  2F0D A;  1D5Z C;  1NNX A;  5CC4 A;  5JJL A;  1I50 H;  3BZD B;  2EY6 A;  2Z0S A;  1K9M C;  2PCF B;  3M4P A;  5I2X A;  1CHQ D;  1SBB B;  4M1U B;  4LF7 Q;  1G2S A;  4LFC Q;  3GTQ H;  2A6H D;  4ZKB B;  3T1H Q;  2JN4 A;  2EOT A;  3P75 A;  4DR5 L;  1GVP A;  5IP9 H;  1MGS A;  1B3Q A;  4RA8 A;  2NUC A;  3CCL A;  1N32 Q;  4GN3 B;  3TRZ A;  3HFZ B;  2YTX A;  1Q90 A;  2F0W A;  2K4K A;  3DWA A;  4IAL A;  3S1Q H;  4C2M H;  1IW7 D;  1CT1 D;  3MC0 B;  3V05 A;  1B53 A;  4XYQ A;  3J81 j;  2K7V A;  2EJF C;  3WOE A;  3PIP 3;  4DV3 L;  3K5N A;  5C4X G;  4K5X A;  1L0W A;  2EZV A;  1A3V A;  3NWS A;  2B2W A;  1DD2 A;  4XXE A;  4S3S A;  1JOR A;  3HOV B;  4JI1 Q;  2MNA A;  2HQE A;  3GTG B;  1XNQ L;  1BCP D;  3ERS X;  1D7Q A;  4BY7 B;  4B3T L;  3NPP A;  4DR1 Q;  3Q24 A;  2VUM B;  4CJ1 B;  1ET6 A;  2NVY B;  5KND A;  1LO5 D;  2E5L L;  2F4V L;  3GTM H;  1EQQ A;  4JVZ A;  2EYP A;  1Y1V B;  4ILW A;  3ULP A;  4RCO A;  1WCM G;  1SNO A;  1UE7 A;  2F1M A;  2YTV A;  3S14 H;  2CW0 C;  4MN3 A;  4A3K B;  3CCJ A;  3CCV A;  4C3H B;  3CXC A;  5C0X G;  1NTG A;  3W5O A;  5C5M A;  4MZ9 A;  1B1Z A;  5IGD A;  3S2H H;  3E5S A;  3PGZ A;  3IAY A;  1I50 B;  2GVA A;  3CRL C;  3I4L A;  2A6E D;  3ND8 A;  5ISR A;  4NDX A;  5BN3 A;  1SLJ A;  2F0P A;  4N9P A;  1FD7 D;  5D65 A;  3GTQ B;  4GKJ Q;  2D9U A;  3URY A;  2UXC L;  1KLU D;  3QB3 A;  4QJF A;  3M4Y A;  2NZ1 D;  1FVI A;  1I4P A;  4IUU A;  5I9O A;  1O7I A;  2B2Y A;  2JJQ A;  4G57 A;  1YHA A;  2EJM A;  2GA4 B;  4DUY L;  3AEV A;  1RDP D;  5EJW A;  2XIW A;  3S1Q B;  1EFW A;  1CHP D;  4RGM A;  4UPA A;  3UDF A;  4BY1 G;  3ER0 A;  1CUK A;  5LL6 S;  2B2V A;  3D0F A;  4OXP A;  3A0J A;  1XMO L;  2VB3 X;  5C3E B;  4L5S A;  4FYD A;  1IL8 A;  1J5E Q;  2HHH L;  1DZ1 A;  1L1O C;  1HQM C;  2VW9 A;  1EEI D;  1WTX A;  4JI2 Q;  5IGB A;  3NXW A;  2AKW B;  4MHE A;  1JE4 A;  3NHH A;  1NSN S;  1HQR D;  2EYO A;  1T5X D;  2G9H D;  4GOP A;  4PV1 C;  3T1Y Q;  1PXU A;  2Z9H A;  1EYG A;  1SYG A;  5T1G A;  3EFX D;  5BR8 L;  1JB7 A;  5C6A A;  3GTM B;  4DNI A;  2NVX H;  3KJP A;  1NMF A;  1SJH D;  3H0G G;  4N8X 1;  5H1S E;  4KKS A;  4IFD J;  2E2H H;  1S5B D;  4JI8 L;  3CP0 A;  2CHB D;  5M5Y H;  1JOQ A;  4J8Q A;  2NN6 I;  4JBJ A;  2E2J H;  4XT3 B;  2EYJ A;  1V9P A;  5C44 H;  4JI4 L;  1X6O A;  3S2H B;  2Y0S E;  1LTL A;  4UP9 A;  4DR5 Q;  5JAV A;  3FPP A;  2IHF A;  3W2D A;  3HKS A;  4X65 L;  2OCE A;  2WFW A;  3CPF A;  2B3G A;  4DV6 Q;  1U4P A;  2E74 C;  1E3P A;  2EY5 A;  2WB1 B;  1PVO A;  4ID6 A;  3TRE A;  4PNY A;  3PIO A;  3H09 A;  2KEC A;  4C1N I;  4DV3 Q;  5GAD C;  4DXF A;  3HOZ G;  1C4Q A;  5IYD G;  2L12 A;  3J7A 5;  2B2W C;  2B29 A;  1S72 A;  3J7A F;  1WD0 A;  1WTO A;  3D4R A;  1I4G A;  3J81 i;  1A3T A;  1TS4 A;  1XNQ Q;  2JA6 H;  4OWW B;  4B3T Q;  3SGI A;  1C48 A;  1TWH H;  1V1P A;  2JYO A;  1STN A;  1XTD A;  1D8L A;  5E4W C;  1HFN A;  3NTI A;  1FGU A;  4C56 C;  1I6H H;  1LM0 A;  2E5L Q;  4EQ5 A;  2F4V Q;  1N36 L;  4F87 A;  3U4V A;  3K58 A;  3I91 A;  1SRU A;  1KDC A;  2VL6 A;  3A5U A;  3CCS A;  4BBS H;  1G6Z A;  5HGQ A;  2JEA I;  4POF A;  4DXG A;  3SK6 A;  2ZTE A;  2HUG A;  1GOZ A;  1TQO A;  2KCT A;  2L11 A;  3VDY A;  2NVX B;  2E2H B;  1LTB D;  1HNW L;  2ES2 A;  1AZP A;  4I7A A;  1KRT A;  2E2J B;  2KHS A;  1GKH A;  5IYB G;  5C44 B;  3KLW A;  4ZK9 B;  3OOC A;  1PH3 A;  1F9P A;  3BVM A;  3CMA A;  2F0L A;  1SJE D;  1KNA A;  2SDF A;  2AMC B;  4XYO A;  4FXD A;  3NUC A;  5JEA H;  1VQD A;  1Z9F A;  4BA1 I;  2B2Y C;  5ELF A;  4DUY Q;  4KHZ A;  3GV3 A;  3WOF A;  2JA5 G;  4DV0 L;  4H7B A;  5C3X A;  4A3C G;  2R93 H;  3ICE A;  1VQK A;  3A5Z B;  3NBI A;  2B2V C;  2K32 A;  5CV5 A;  4O2D A;  1XMO Q;  3FHW A;  3CRK C;  1TII D;  1HR0 W;  2HHH Q;  1IXR A;  1DOL A;  3MHB A;  1DGS A;  4HJ9 A;  4QB4 A;  3F2U A;  1KXL A;  1J6Q A;  2JA6 B;  1D6E C;  3UE1 A;  1AW7 A;  4ME3 A;  1I94 L;  5EBD A;  1TWH B;  3STB D;  3A55 A;  1MSG A;  5K5P A;  4GOP C;  2N78 A;  1M90 C;  1I6H B;  5BR8 Q;  3GTJ H;  1A2T A;  2LMC B;  2VZA A;  3HOV G;  3MFG A;  3NK9 A;  3SE0 A;  3MXG A;  2EE1 A;  2DJF C;  1WVL A;  4CDC C;  4IQZ A;  1X3P A;  4JI8 Q;  1XX8 A;  5C4H A;  4A3F G;  3HOY G;  4RHR A;  2F0G A;  4HID A;  2SNS A;  4UP8 A;  5DLQ E;  4JI4 Q;  1K3R A;  1EOV A;  4AYB G;  1PRT C;  3RZO H;  4F88 A;  5C4X H;  5I6Y A;  4B3R L;  1LTT D;  1GUG A;  4IOA A;  4YHH L;  2K5V A;  3AYH B;  1XPR A;  1MJE A;  1UE5 A;  4PG3 A;  1O7L A;  2MPM A;  4X65 Q;  4C3H G;  1IKL A;  4A3E G;  2WP8 J;  3T4A C;  1FJG L;  2WAQ E;  2Q2U A;  2EY1 A;  2EDG A;  4H0L C;  1HA5 A;  3W1G A;  3J7A V;  3LWE A;  2ATW A;  4DR3 Q;  5FO8 B;  1HRJ A;  2K14 A;  4LNQ A;  1VQH A;  5E4X A;  5IWA L;  5F2D A;  1LV9 A;  1EQV A;  3KF6 A;  5IOD A;  3GTP H;  1HR0 L;  4OEL B;  1WCM H;  5KNB A;  2F3W A;  2R93 B;  5LMU L;  1O7Y A;  1VQI A;  2EYL A;  5CV4 A;  2QEJ C;  1S5D D;  5C0X H;  2LFN A;  1F9Q A;  1JWS D;  4ME5 A;  1VQF A;  3FEW X;  3OWF A;  1WTH A;  3F2B A;  1EIF A;  2AUK A;  3I4O A;  1SNM A;  2XVS A;  5C5L A;  1YIT A;  1N36 Q;  3S9W A;  3D31 A;  1AP0 A;  1PH6 A;  1CFM A;  1IBL L;  5CYU A;  3KJO A;  1FL0 A;  4UHV A;  3S1R H;  3GTJ B;  3AU7 A;  1VQP A;  1M1K C;  1XMQ L;  1M4V A;  1NR4 A;  1HNW Q;  2V4D A;  3AFP A;  4BY1 H;  3KBG A;  2ICE C;  2D62 A;  4ZUI A;  3CCQ A;  2LY7 A;  4KY6 A;  5LL6 X;  1IBM L;  1TKW B;  3RZO B;  1Y8O B;  1A0I A;  1BXT A;  1KNE A;  2UUC L;  3A7A B;  1FR3 A;  1DXM A;  3QG1 A;  2BA0 A;  3GO5 A;  3NE5 B;  3K59 A;  2Q8R E;  1MI2 A;  1SE4 A;  2IPK D;  3S24 A;  1KL9 A;  4DV0 Q;  3D4W A;  2CQA A;  4CHT B;  4X64 L;  3TS0 A;  3KLR A;  4IN3 A;  1U4L A;  2K52 A;  2BOS A;  5M5W H;  5EGT A;  1EYA A;  4RKL A;  3VR5 A;  1X3G A;  5EPL A;  3CF5 A;  1KQS A;  3GTL H;  4JG2 A;  4CKB A;  3H0G H;  4DFA A;  2OF1 A;  3BYY B;  3OPO A;  4ZAI A;  4R4T A;  3GTP B;  1CQV A;  3BZK A;  5T1I A;  3DUZ A;  4U67 3;  2I5M X;  4JC0 A;  4HR7 B;  4R4I A;  1JT8 A;  1M8A A;  1N9W A;  3NBH A;  3J80 i;  2NZO A;  1UE6 A;  1PTO C;  3OWE B;  2DNC A;  4A3L G;  1SMY D;  1JR0 D;  3NEL A;  1PYW D;  4P2C B;  3RLN A;  3CC4 A;  1PA6 A;  2YTY A;  1O78 A;  3HGB A;  1SRO A;  4DR4 L;  4LF4 L;  1CKO A;  3PUZ A;  1A62 A;  2LKV A;  3HOZ H;  3TS2 A;  4DGZ A;  1GXD C;  1SMX A;  3TME A;  5IYD H;  2OQ0 A;  4YHH Q;  3T1H L;  1KIX A;  1F9S A;  2BDN A;  3GTK H;  4BY1 B;  2R92 G;  2VS1 A;  3F2D A;  3E3X A;  2LSS A;  2C9O A;  1PLF A;  3C1E A;  2KEN A;  4XQQ A;  1VQN A;  3QWN A;  2K33 A;  3PCO B;  1O80 A;  1RL2 A;  2BDO A;  3Q23 A;  1FJG Q;  4JYA L;  2Y0S G;  4R8N A;  5LHY 1;  4CDF C;  1KDB A;  5C3W A;  1EY8 A;  2A5H A;  2QEX A;  4J15 A;  2J4X A;  3NWT A;  1BCP B;  3HOU G;  3K8A A;  5IWA Q;  1STA A;  4FF4 A;  4MNO A;  3LNN A;  1HR0 Q;  4B3M L;  1JWM D;  3Q6S A;  5LMU Q;  3GQB A;  5IYC G;  1VQ8 A;  1Q12 A;  1E22 A;  1IKM A;  1F2L A;  4KJO A;  2MQH A;  4ABN A;  2JA8 G;  3GTL B;  3H0G B;  4P71 A;  4QGU A;  4OWX B;  2SNM A;  2XNA C;  2I5L X;  2UUB L;  1DOM A;  3T16 A;  1IYJ B;  3CW2 C;  4KY7 A;  2BE5 C;  5IYB H;  4ZYS A;  1FNW A;  3G4S A;  1LT5 D;  4IJL A;  3L2P A;  1IBL Q;  4U68 A;  3KYH C;  4O0A A;  5JJI A;  1U9R A;  4GLV B;  3K57 A;  4CJ0 B;  3CKI B;  1CKN B;  2DJG C;  1KDA A;  1RKN A;  3LWU A;  1Z47 A;  2IX0 A;  1XMQ Q;  4A3B G;  1WD1 A;  1AE3 A;  1YNJ C;  3PV0 A;  2JA5 H;  1BDO A;  1GUT A;  3M4O H;  2KCM A;  1G2T A;  1BKB A;  3I8Z A;  1GHK A;  3MXP A;  3UDG A;  1B9N A;  3HOZ B;  1IBM Q;  2Q2T A;  2RKS A;  4M8A A;  4CKC A;  1TVX A;  1HPC A;  1HUN A;  3GTK B;  1VQL A;  4FNF A;  1YNN C;  4GNX B;  1BR9 A;  3BDL A;  3GD7 A;  3WWV A;  4X3U A;  1ASY A;  4X64 Q;  2FMM A;  1D5X C;  2L5T A;  3JAM L;  1W2B A;  2ZXP A;  2DUD A;  3NTK A;  2PZT A;  3A74 A;  3HOV H;  2LXJ A;  4G7O C;  1CSP A;  1G51 A;  2O5J C;  4HJ7 A;  1Y14 B;  2AQ2 B;  1CK1 A;  4A3F H;  1DON A;  4KJN A;  2R6G A;  2VUM H;  3AQQ A;  4H44 C;  1UE1 A;  2EJG C;  4DV2 L;  1Y1V H;  1NCV A;  1TWF B;  4IFD G;  1A15 A;  4KK7 A;  4A3K H;  2RF4 A;  1RTN A;  1K8A C;  4C3H H;  4GN5 A;  2DY8 A;  4A3E H;  5KYI A;  1JOO A;  4KKT A;  3OW2 A;  4DR4 Q;  4LF4 Q;  2AWN A;  2EIF A;  2FFK B;  1IW7 C;  1EQR A;  2AHO B;  4C3I G;  1DYQ A;  4HED A;  2J7Z A;  2JA5 B;  1KRS A;  3E9H A;  4KHV A;  3M4O B;  3N52 A;  1ROD A;  3E6Z X;  3GTO H;  1SE8 A;  1ET9 A;  3D8G A;  1RF2 D;  3V2T A;  4JYA Q;  4DV6 L;  4DK0 A;  1TS2 A;  1NY4 A;  1QUQ B;  4NB3 A;  3K6O A;  3VR3 A;  4HSV A;  1NJI C;  2KED A;  1VQJ A;  3CC2 A;  2PMZ E;  4IZ8 A;  1GO3 E;  4IPC A;  2Z4I A;  5C3E H;  2R7F A;  4B3M Q;  1F9R A;  2K75 A;  3MWY W;  2WAQ G;  3ND9 A;  2IWH A;  4ZLT F;  2A8V A;  4XQJ A;  3I70 A;  4LK1 C;  1H9M A;  1P8L A;  1DJR D;  1TU2 B;  2F4I A;  4PZ7 A;  5G3L F;  5HY6 A;  2UUB Q;  3HOY B;  4A3F B;  1YEZ A;  1PRT F;  1R4P B;  1GJX A;  1B2T A;  1LTA D;  3K81 C;  3EVQ A;  5A35 A;  1KC8 C;  4AYB B;  2A6E C;  1QWY A;  1X3F A;  1JOK A;  4DAY B;  1IBK L;  3GV6 A;  4R4O A;  3VYS A;  1WJJ A;  2D0P A;  1GUN A;  3DWQ A;  2FMC A;  3RZD H;  1EU4 A;  2I5H A;  3V96 A;  2E2D C;  1KHI A;  4DR6 L;  1TT2 A;  2RDG A;  4A3E B;  1OTC A;  3DM1 A;  2MP1 A;  4OWT B;  1AH9 A;  1NAP A;  1X55 A;  2PO4 A;  4QMG A;  2Z1C A;  4LJZ C;  2G9D A;  1GM5 A;  1XNR L;  2A1A A;  2RQX A;  2QF7 A;  4O1N A;  1PH9 A;  3H3V H;  2M2L A;  2AWO A;  2ICI A;  1K0R A;  3PUY A;  1CQF A;  1SYD A;  3GTO B;  3QOJ A;  3FKI G;  1Y1W G;  2CCZ A;  4CJ2 C;  4K6D A;  1PH2 A;  3MXN A;  3KOJ A;  5CR3 A;  1G6P A;  3OMC A;  3NTH A;  3KBX A;  4IUT A;  4A3L H;  2IHE A;  3L7Z C;  2NVT H;  1Y69 U;  2E76 C;  4HJA A;  1F2Y A;  4X66 L;  2CW0 D;  1K3B C;  1RTO A;  2LS0 1;  4HTH A;  1X32 A;  1YIJ A;  3WDN A;  5HUR A;  3HS0 C;  1OXS C;  2ZJR A;  3FPU B;  3K5M A;  2MO0 A;  3M4Q A;  4DV2 Q;  1YHB A;  1A2U A;  3MVV A;  4DN4 M;  2R92 H;  4CKE A;  3H3V I;  4RGO S;  4FF3 A;  4TKO B;  1PMR A;  4CDE C;  1EY7 A;  1PFM A;  3A54 A;  5CBE E;  4YCU A;  4PMC A;  3QJY A;  3RZD B;  4JI3 Q;  4IOC A;  1PZJ D;  4XDX A;  2F3V A;  1KLG D;  3VR4 A;  3AMU A;  2XSC A;  3OSO A;  3RLO A;  1ILP A;  3HOU H;  4X3S A;  3RNU A;  2YYZ A;  5M3M G;  4HCS A;  4L5R C;  1EL0 A;  3CHB D;  2Q2I A;  4CDD C;  4DR2 L;  1L0X B;  1AEX A;  3EBE A;  3KUP A;  2JA8 H;  5J22 A;  4YCV A;  5IT9 E;  3TBI B;  2YV5 A;  3D3R A;  3PMF A;  4JI0 Q;  5FLX L;  4DR3 L;  1PTO F;  1STH A;  2EQS A;  2QIL A;  1VMC A;  3I3C A;  1JJ2 A;  5KNC A;  4UY8 C;  4A3J G;  1PDQ A;  1SEB D;  3VYT A;  3TN2 A;  1CSQ A;  2F0I A;  2NVT B;  1H9S B;  2X69 A;  3K7U C;  2QDB A;  2NZH A;  2AQ3 B;  2F0E A;  2IT1 A;  4A3B H;  4QUF A;  4K2L A;  1HZA A;  3ZJY C;  2E8G A;  2PQA B;  4K8J A;  1EU3 A;  1D1K A;  1F2M A;  1IBK Q;  3CD6 A;  1VF5 C;  3IFD A;  2PW5 A;  2L9H A;  3A8K E;  2EYF A;  1LTI D;  4PZ8 A;  2VNU D;  2R92 B;  1FNV A;  4BXX G;  3I4N G;  2K5D A;  1TS3 A;  2NYZ D;  4DR6 Q;  1HTL D;  2RSN A;  1KAA A;  5IT9 c;  3RUZ A;  3T51 B;  2KEE A;  4FDB A;  5EKK A;  2Y0S B;  3DEP A;  4NXM L;  1EYC A;  2TSS A;  4RFB A;  1S40 A;  1NBW A;  1XNR Q;  3H6M A;  3J81 L;  4JBK A;  3I4M G;  3HOU B;  1O7Z A;  1W3S A;  4NMZ A;  2JA7 G;  1OO9 B;  2ENB A;  2MHV A;  2ZTC A;  2FHT A;  5IP7 H;  4QIW B;  2KA7 A;  3PIP A;  4A3M G;  1JQY D;  2JA8 B;  2MO1 A;  2RVL A;  3LGJ A;  4R9W A;  4FO2 A;  2F0U A;  1CZG A;  4IFD H;  3M3Y H;  2ASB A;  1JJG A;  3TZU A;  2ZXR A;  3FDT A;  4X66 Q;  4Q0F A;  4HIK A;  5CGK A;  3G48 A;  1BQQ T;  1X3E A;  2C5C A;  2KUM A;  1S4Z A;  3LX0 A;  1TXY A;  5IY0 A;  3G6J B;  3X3N A;  5M3F G;  3Q0A A;  2JEB I;  3R93 A;  4DAV A;  5LMN Q;  4A3B B;  1SYC A;  3OYY A;  4C3I H;  2GVB A;  1Z6H A;  1ASZ A;  4P72 A;  3SVM A;  5KIX A;  3K5O A;  1HZ9 A;  4A75 A;  4YCW A;  1C0A A;  2E2I B;  1VCI A;  3OMG A;  2XWB B;  2K04 A;  2DGY A;  3OHX C;  5CV7 A;  3S2D H;  3MTS A;  3IRB A;  2C35 B;  4GS3 A;  1WFQ A;  1G91 A;  3VA5 A;  3NQT A;  2A73 B;  2Z4H A;  1S3O A;  1HZC A;  4DR2 Q;  5M9O A;  2WV6 D;  2KJX A;  2B39 A;  1X9N A;  2F3I A;  4BWG B;  1GHJ A;  1PZK D;  5DEH A;  4Y7N H;  1WI5 A;  1MHW C;  3I7F A;  4R4Q A;  5M5X H;  1E2W A;  1BUV T;  3MA2 B;  5L37 A;  1K8G A;  2A69 C;  3R2I A;  1Q3L A;  1EY6 A;  2RDH A;  4RAU C;  4K14 A;  1ENC A;  3M3Y B;  1QIL A;  1HNZ L;  5G3L D;  1F77 A;  3DHQ A;  2PI2 A;  4IPH A;  3SR1 A;  3T53 B;  1PRT D;  1AE2 A;  5IT9 L;  5ELB A;  3IFT A;  4B9W A;  3HKZ E;  5I9P A;  5JJK A;  4K6L A;  5DNF A;  1DOK A;  4KI0 A;  4C3I B;  1YBY A;  3R3O A;  2JP1 A;  1LT3 D;  1E2V A;  1EY5 A;  3FVQ A;  1YJW A;  3FKI H;  3S17 B;  4WJ4 A;  2NTT A;  1XYI A;  4BS9 A;  1XPO A;  3JAM E;  1B4O A;  5IOC A;  4NXM Q;  3S2D B;  1K83 H;  3PUW A;  4WJW A;  3KF8 B;  2V1C C;  1HFG A;  1C7Y A;  4HIM A;  4R1J A;  4DV5 L;  3QIA A;  5DM7 3;  2WAQ B;  2P5Z X;  1TR5 A;  3I90 A;  4JI5 L;  5C0X I;  5CV8 A;  2JK8 A;  2K6A A;  4GZY C;  1LUZ A;  2LXK A;  2Q2H A;  1AFP A;  4Z9C B;  4Y7N B;  1T9H A;  1VQO A;  3CCR A;  1I4H A;  2IW3 A;  3W1B A;  1EQT A;  1ENF A;  3MAQ A;  1MKH A;  1QJO A;  5TSS A;  5M5X B;  2VB2 X;  4KMU C;  4WRD A;  3RD4 A;  1AN8 A;  3J7Z C;  4KD4 A;  5EPJ A;  1NE3 A;  1BBW A;  4BA2 I;  2F0J A;  1I5F A;  4TVA B;  4APV A;  1N8R C;  1G8Z D;  5GAE C;  2IY5 B;  3HOW G;  1KD1 C;  3JAM c;  1Q1E A;  3PSI A;  5FOB B;  5M3M H;  4ZKC B;  1OXV A;  4YY3 L;  4RG1 A;  2A68 C;  2FXQ A;  2EVB A;  3BVZ A;  2R61 A;  4RCN A;  4FF1 A;  4RKB A;  2XRS D;  1KTK A;  3PQI A;  2NN6 G;  2PQE A;  4KV6 A;  2VQF L;  2UXD L;  4A76 A;  4K5W A;  4NPS A;  5EKL A;  1UEA B;  3FKI B;  1Y1W B;  2L15 A;  3CCM A;  1QE6 A;  3PO3 G;  3VR6 A;  3H94 A;  4XIG S;  3FMC A;  3FP9 A;  4IO9 A;  4A3J H;  5FJ8 G;  1U4R A;  1K83 B;  4QL5 A;  2DNE A;  1GD7 A;  5JPN C;  2ALY B;  2KOL A;  3R8B A;  3SXH A;  3J80 L;  1ZEQ X;  3I55 A;  1OXX K;  3P7J A;  4YWK A;  3KK7 A;  3ONA B;  2MJ8 A;  2QCP X;  1T5E A;  2XGT A;  4QQB X;  1PTO D;  1PH7 A;  3TP8 A;  2RCF A;  1LTS D;  1BNZ A;  2B2T A;  2L4N A;  2KHJ A;  3GDE A;  5ELC A;  1SN8 A;  1OXU A;  3I4N H;  4ODG A;  1HNZ Q;  1PH4 A;  4K0K L;  2QW7 A;  2CKZ B;  5BN4 A;  2F0F A;  1TWF H;  3KDF B;  5IGE A;  4BBR G;  1MD2 D;  3I4M H;  4KLK A;  3A7L A;  2JA7 H;  1X54 A;  4A3I G;  1CKN A;  1PFB A;  3BVG A;  3EQL C;  1PYB A;  2H5X A;  5M3M B;  2N8N A; 
#chains in the Genus database with same CATH homology
 4R4O A;  1I6H H;  2QGQ A;  2K50 A;  1WJJ A;  1LM0 A;  2D0P A;  4EQ5 A;  2E5L Q;  2B63 G;  2F4V Q;  1N36 L;  4HJ5 A;  3S1N H;  4DV7 Q;  3U4V A;  3RZD H;  1SRU A;  4JOI A;  1IZ6 A;  2I5H A;  2VL6 A;  3A5U A;  1KHI A;  4C3J H;  1Q7Y C;  4DR6 L;  4A3D H;  3S1M H;  3CCS A;  4BBS H;  5HGQ A;  1OTC A;  2JEA I;  5C3E G;  1PYS B;  4OWT B;  4A3C H;  1AH9 A;  4POF A;  1X55 A;  2ZTE A;  3VDY A;  2KCT A;  2N49 A;  4P75 A;  3B6Y A;  4DR7 L;  1B7Y B;  4DV1 Q;  4GNX A;  4JI6 L;  2CWA A;  1GM5 A;  3NEM A;  4DV5 Q;  2A1A A;  3JC6 6;  2ES2 A;  2UUA Q;  1XNR L;  1HNW L;  1PH9 A;  2UXB L;  3H3V H;  4DR7 Q;  3MEF A;  2AWO A;  1KRT A;  1E24 A;  5E7N A;  4JI5 Q;  3PUV A;  1GKH A;  1K0R A;  5IYB G;  3CME A;  5M3F H;  1X56 A;  3KLW A;  3PUY A;  1PH3 A;  4LFB L;  3CMA A;  2AMC B;  3FKI G;  1Y1W G;  2CCZ A;  1VQD A;  1PH2 A;  2XTI A;  1Z9F A;  1SFO H;  3KOJ A;  4BA1 I;  1G6P A;  2F52 A;  1H95 A;  4AQY L;  2BA1 A;  1JJC B;  4DUY Q;  4KHZ A;  1BBU A;  4A3L H;  2IHE A;  4HJ8 A;  4LF8 Q;  3L7Z C;  2JA5 G;  2NVT H;  4DV0 L;  4BBS G;  1QVG A;  1A8V A;  2VQE L;  4HJA A;  1C9O A;  3HOY H;  4JBM A;  4X66 L;  1R9T H;  4A3C G;  3ICE A;  2R93 H;  3TQY A;  3U4Z A;  1VQK A;  3A5Z B;  2ZJP A;  4YWM A;  4AH6 A;  1YIJ A;  4O2D A;  1XMO Q;  4L5Q A;  3FHW A;  4DUZ L;  1OXS C;  2ZJR A;  1HR0 W;  2HHH Q;  2ZM6 Q;  1IXR A;  1G29 1;  4WJ3 M;  1DGS A;  4HJ9 A;  2MO0 A;  3M4Q A;  4GN4 B;  4DV2 Q;  2K5N A;  4TQU S;  4YY3 Q;  3OTO L;  2QA4 A;  1YHB A;  2WB1 G;  2I0Q A;  1KXL A;  4QY7 A;  1J6Q A;  3CQZ H;  1RIP A;  1TWA H;  3K7A H;  3UE1 A;  2R92 H;  4LWC A;  4ME3 A;  3HOX H;  4PMW A;  1VQB A;  1I94 L;  3H3V I;  3STB D;  4H02 A;  2CWP A;  3RLF A;  1YHQ A;  2Z6K A;  4GOP C;  4LFA L;  1KAW A;  2N78 A;  1M90 C;  1I94 Q;  4OO1 G;  4JI3 L;  2VQF Q;  5BR8 Q;  3GTJ H;  4A93 H;  3U58 A;  2UXD Q;  4YCU A;  1VS0 A;  1L1O B;  2VZA A;  1V1Q A;  3HOV G;  4JV5 Q;  4Y52 H;  3NBH B;  4JI3 Q;  4DKA C;  2R7D A;  4IOC A;  4JCV E;  4LF6 L;  4HIO A;  2CFM A;  4JI8 Q;  1JE5 A;  4LF9 L;  4A3F G;  3HOY G;  3RN2 A;  3RLO A;  1EUJ A;  3HOU H;  5FLM G;  4A3G H;  4X62 L;  3RNU A;  4HID A;  4UP8 A;  2YYZ A;  5GRO A;  1YNX A;  5DLQ E;  4JI4 Q;  1K3R A;  1CKM A;  1EOV A;  4AYB G;  5M3M G;  4L5R C;  4X62 Q;  3RZO H;  1QUQ A;  5C4X H;  2Q2I A;  3I56 A;  4DR2 L;  4B3R L;  4IOA A;  4YHH L;  1QVC A;  3EBE A;  4JBW A;  4LF7 L;  4MTN A;  4LFC L;  2JA8 H;  3S15 H;  4B3R Q;  2K5V A;  3AYH B;  3PF5 A;  1XPR A;  1MJE A;  1UE5 A;  1VQA A;  2EXD A;  4JI0 L;  4PG3 A;  4EX5 A;  1VQ6 A;  4YCV A;  4X65 Q;  2YV5 A;  2KHI A;  4JI0 Q;  4NXN Q;  4A3E G;  1VQ5 A;  1E1O A;  2WP8 J;  4DR3 L;  4GLX A;  1FJG L;  2WAQ E;  4IJH A;  2Q2U A;  3ULL A;  2OTL A;  4BXX H;  1N32 L;  3W1G A;  2N3S A;  2EQS A;  2ATW A;  4DR3 Q;  1VQG A;  3EN2 A;  3DM3 A;  2K14 A;  1JJ2 A;  2ID0 A;  3KDF A;  5AJ3 L;  4LNQ A;  1TWC H;  5K36 G;  4IPD A;  2GN5 A;  1VQH A;  4UY8 C;  1XPU A;  4K0K Q;  4A3J G;  2R7Z H;  5IWA L;  5FLX c;  4JI7 L;  1CSQ A;  3TEH B;  5AJ3 Q;  3UE0 A;  5C44 G;  4DK3 C;  3KF6 A;  3G71 A;  1HNX L;  3GTP H;  1HR0 L;  1WCM H;  3K7U C;  2NZH A;  2IT1 A;  3NEN A;  4A3B H;  4AIM A;  5LMU L;  3PO2 G;  1HZA A;  1VQI A;  3ZJY C;  2E8G A;  2PQA B;  1X65 A;  5LMN W;  1VQF A;  1Q86 C;  5GAG C;  3E0E A;  3Q8D A;  4LF5 Q;  4JI1 L;  3F2B A;  4A3M H;  1EIF A;  2CQO A;  1IBK Q;  3CD6 A;  1IBK L;  2ZTD A;  3K80 C;  1BVS A;  3I4O A;  4L5T A;  2A19 A;  1IL2 A;  3I2Z A;  2OWO A;  5IYD H;  3HKZ G;  1YIT A;  1N36 Q;  4P73 A;  4PZ8 A;  2VNU D;  3D31 A;  4DR1 L;  4DV4 L;  1PH6 A;  4BXX G;  3I4N G;  4JOI C;  1IBL L;  4DR6 Q;  3CAM A;  3ULJ A;  3KJO A;  1I3Q H;  5ELO A;  4DV4 Q;  5IT9 c;  1FL0 A;  1VQ9 A;  3CC7 A;  2JE6 I;  3S1R H;  4FDB A;  1HJP A;  1VQP A;  2BH2 A;  1M1K C;  1A63 A;  3JAM i;  1XMQ L;  4NXM L;  1N34 L;  4A4I A;  1NBW A;  4GNX C;  1S40 A;  2HQL A;  1B8A A;  2UU9 L;  4JI6 Q;  1XNR Q;  3AFQ A;  1HNW Q;  2OTJ A;  2UXB Q;  4JBK A;  2JA6 G;  3AFP A;  3I4M G;  4BY1 H;  3K0X A;  1W3S A;  4OON A;  2JA7 G;  2D62 A;  3CCQ A;  3S16 H;  1Y1W H;  1E7Z A;  1IBM L;  2ZTC A;  1QZH A;  1UWV A;  5IP7 H;  1A0I A;  1VQC A;  3BZC A;  3H15 A;  4LFB Q;  2UUC L;  3HOW H;  3PIP A;  2RHQ B;  4A3M G;  3J81 c;  2MO1 A;  5ELN A;  2UUC Q;  2BA0 A;  1VQ7 A;  4GKJ L;  3LGJ A;  3GO5 A;  1QVF A;  2RCN A;  4A3D G;  4AQY Q;  4KHP L;  1YZ6 A;  2NVQ H;  4P74 A;  2HIX A;  3UDX A;  5GQO A;  3S24 A;  1YI2 A;  1KL9 A;  3M3Y H;  2ASB A;  4DV0 Q;  2VQE Q;  1JJG A;  4X64 L;  4X66 Q;  3TS0 A;  4HIK A;  2K52 A;  5M5W H;  3G48 A;  3UDI A;  1MJC A;  1PH1 A;  1X3G A;  3CF5 A;  4YWL A;  1KQS A;  3GTL H;  1X3E A;  2WB1 E;  4JG2 A;  3H0G H;  4DUZ Q;  5LMN L;  1LYL A;  1TXY A;  5IY0 A;  5M3F G;  4R4T A;  3GTG H;  2JEB I;  3BZK A;  3MXN B;  3PO3 H;  4GKK L;  3OTO Q;  5LMN Q;  1PH5 A;  4BY7 H;  2I5M X;  4LUV A;  3OYY A;  4JC0 A;  3U50 C;  5FJ8 H;  4C3I H;  5C4J H;  4R4I A;  3BJU A;  5GAH C;  1J5E L;  1JT8 A;  1N9W A;  2GVB A;  3F2C A;  1L1O A;  4RMF A;  4P72 A;  5JEA G;  5IP7 G;  1ASZ A;  2ZJQ A;  1N33 L;  3J80 i;  2NZO A;  2NVY H;  1UE6 A;  1HZ9 A;  4R4C A;  4LUZ A;  4LFA Q;  4YCW A;  4A75 A;  2Z6K C;  1C0A A;  4JI2 L;  1YJN A;  1VCI A;  4A3L G;  2VY3 A;  3DLL A;  3NEL A;  2DGY A;  4LUO A;  5JEA J;  2R93 G;  3RLN A;  3S2D H;  3T1Y L;  3CC4 A;  4LF6 Q;  4GKK Q;  1PA6 A;  4AYB E;  4LF9 Q;  2YTY A;  3BU2 A;  4GLA C;  3IRB A;  2C35 B;  1SRO A;  1P16 A;  1WFQ A;  4GS3 A;  4LF4 L;  4DR4 L;  1CKO A;  3PUZ A;  1A62 A;  4GOP B;  5JJL A;  5IYC H;  3HOZ H;  1I50 H;  1YVC A;  3TS2 A;  1SMX A;  2D0O A;  2PNH A;  2HT1 A;  1S3O A;  1HZC A;  2Z0S A;  5J3B A;  4DR2 Q;  2OQ0 A;  1K9M C;  3M4P A;  4YHH Q;  3CCU A;  3T1H L;  1KIX A;  3M7N A;  4LF7 Q;  4LFC Q;  3GTK H;  1X9N A;  2R92 G;  2F3I A;  2VS1 A;  3HOX G;  1K73 C;  3GTQ H;  4IPG A;  3T1H Q;  3F2D A;  2LSS A;  2KEN A;  4Y7N H;  4BBR H;  4DR5 L;  1WI5 A;  1VQN A;  1GVP A;  4IFD I;  3PCO B;  5IP9 H;  1E1T A;  1RL2 A;  3CPW A;  3CCL A;  4A3I H;  1FJG Q;  4JYA L;  4A93 G;  3I7F A;  3M9B A;  4GN3 B;  3TRZ A;  1N32 Q;  4R4Q A;  3HFZ B;  2Y0S G;  2YTX A;  2K4K A;  5M5X H;  3S1Q H;  4C2M H;  2QEX A;  4J15 A;  1K8G A;  2KBN A;  1UEB A;  2B63 H;  3HOU G;  3J81 j;  4A3G G;  3K8A A;  2PQA A;  5IWA Q;  4JI7 Q;  3PUX A;  1QZG A;  4MNO A;  4BA2 I;  1HNX Q;  1HR0 Q;  4QIW E;  4DV3 L;  1HNZ L;  4B3M L;  5C4X G;  3RR5 A;  4LW1 A;  1L0W A;  5LMU Q;  5IYC G;  1VQ8 A;  1Q12 A;  2PI2 A;  4IPH A;  1E22 A;  2IX1 A;  1AE2 A;  3KFU A;  2MQH A;  2JA8 G;  4P71 A;  4QGU A;  2E2I H;  4OWX B;  4B3S L;  2I5L X;  4X6A H;  3HKZ E;  2UUB L;  4OX9 L;  4JI1 Q;  1WOC A;  2MNA A;  5JJK A;  1XNQ L;  1IYJ B;  3CW2 C;  3ERS X;  1D7Q A;  4ALP A;  4B3T L;  2OQK A;  4KI0 A;  3PF4 A;  5IYB H;  1Q1B A;  1YBY A;  3G4S A;  4DR1 Q;  4IJL A;  3L2P A;  1IBL Q;  3KYH C;  1V43 A;  1YJW A;  4O0A A;  2E5L L;  1PFS A;  1EQQ A;  3FKI H;  2F4V L;  1EWI A;  3GTM H;  2R7Z G;  4WJ4 A;  4GLV B;  5JJI A;  1CKN B;  3ULP A;  1XPO A;  1Q81 C;  3EIV A;  5EAY A;  1WCM G;  1Z47 A;  2IX0 A;  4POG A;  2RHS B;  1UE7 A;  2YTV A;  1XMQ Q;  4NXM Q;  3S14 H;  1N34 Q;  4A3B G;  1AE3 A;  2UU9 Q;  3PV0 A;  3CCJ A;  1K83 H;  3CCV A;  2JA5 H;  3CXC A;  1VQM A;  3PUW A;  3KF8 B;  5C0X G;  2BH8 A;  2V1C C;  2YU9 H;  4XTC S;  1NTG A;  3W5O A;  2KCM A;  4MZ9 A;  1C7Y A;  3M4O H;  1BKB A;  4DV1 L;  4HIM A;  3S2H H;  3E9I A;  3UDG A;  4R1J A;  3PGZ A;  4DV5 L;  2UUA L;  1IBM Q;  2GVA A;  3F1Z A;  2Q2T A;  4JI5 L;  5C0X I;  4PZ6 A;  1SLJ A;  2JK8 A;  5C0X J;  1VQL A;  4GNX B;  4GKJ Q;  2JQO A;  2UXC L;  1LUZ A;  2LXK A;  2Q2H A;  3STB C;  4QJF A;  3CCE A;  4KHP Q;  3GD7 A;  1T9H A;  3WWV A;  3G6E A;  1B70 B;  3CCR A;  1FVI A;  1VQO A;  2UXC Q;  3W1B A;  1O7I A;  2JJQ A;  1MKH A;  1ASY A;  4X64 Q;  4DPG A;  1YHA A;  1XJV A;  4DUY L;  3AEV A;  1W2B A;  1NMG A;  1EFW A;  2DUD A;  4LF8 L;  3A74 A;  4UPA A;  3UDF A;  3HOV H;  2LXJ A;  4BY1 G;  3J7Z C;  1CSP A;  1G51 A;  1JMC A;  3ER0 A;  4HJ7 A;  1CUK A;  1NE3 A;  1Y14 B;  1BBW A;  4A3F H;  3D0F A;  1YJ9 A;  1I5F A;  4TVA B;  4APV A;  4OXP A;  1N8R C;  5FLM H;  1WYD A;  3A0J A;  1XMO L;  5GAE C;  2IY5 B;  4L5S A;  2R6G A;  3HOW G;  1KD1 C;  3JAM c;  1Q1E A;  3PSI A;  2VUM H;  1J5E Q;  2HHH L;  2ZM6 L;  3AQQ A;  5M3M H;  1L1O C;  1UE1 A;  1OXV A;  4DV2 L;  1N33 Q;  4YY3 L;  4RG1 A;  3S17 H;  1Y1V H;  2VW9 A;  1HZB A;  2FXQ A;  4JI2 Q;  1PHJ A;  4IFD G;  2AKW B;  4A3K H;  2RF4 A;  4GOP A;  1K8A C;  4C3H H;  1PH8 A;  4GN5 A;  1Q8K A;  4A3E H;  2NN6 G;  3T1Y Q;  1EYG A;  2VQF L;  2UXD L;  5BR8 L;  2JA9 A;  4NPS A;  4A76 A;  1JB7 A;  3OW2 A;  4DR4 Q;  4JV5 L;  4DNI A;  2NVX H;  4LF4 Q;  2PI2 E;  1NMF A;  2L15 A;  2K5H A;  3H0G G;  3L0O A;  5H1S E;  2AWN A;  3KJP A;  2EIF A;  4IFD J;  3CCM A;  1Q82 C;  2E2H H;  4JI8 L;  3CP0 A;  5M5Y H;  3PO3 G;  1EQR A;  2NN6 I;  4XIG S;  4JBJ A;  4BY7 G;  2AHO B;  3FP9 A;  4DK6 C;  4IO9 A;  4A3J H;  1L2F A;  2E2J H;  5FJ8 G;  1V9P A;  5C44 H;  4QL5 A;  4JI4 L;  1KRS A;  4OO1 I;  1OXT A;  1GD7 A;  1X6O A;  3E9H A;  1U0L A;  2VUM G;  2ALY B;  4DAM A;  3PO2 H;  2Y0S E;  1LTL A;  3I55 A;  3GTO H;  1SE8 A;  4UP9 A;  4DR5 Q;  1OXX K;  1EIY B;  1Y1V G;  4YWK A;  1SR3 A;  2IHF A;  4JYA Q;  1TWG H;  4DV6 L;  3HKS A;  2XGT A;  4X65 L;  4QQB X;  1PH7 A;  1MIU A;  1Q46 A;  1NY4 A;  1QUQ B;  2OCE A;  2WFW A;  3CPF A;  4NB3 A;  4NXN L;  4A3K G;  2B3G A;  4DV6 Q;  1NJI C;  1VQJ A;  1PVO A;  1E3P A;  3CC2 A;  2PMZ E;  2KHJ A;  2HIV A;  1U5K A;  3GDE A;  3J80 c;  1GO3 E;  3TRE A;  4IPC A;  1SN8 A;  3PIO A;  3M85 A;  1OXU A;  5C3E H;  3I4N H;  2R7F A;  4B3M Q;  1HNZ Q;  4DV3 Q;  5GAD C;  2K75 A;  3HOZ G;  2WAQ G;  1PH4 A;  5IYD G;  3J7A 5;  4K0K L;  2A8V A;  3RN5 A;  4UP7 A;  2B29 A;  1S72 A;  1HH2 P;  1P8L A;  4PZ7 A;  5HY6 A;  4B3S Q;  2CKZ B;  3J81 i;  1TWF H;  3KDF B;  2UUB Q;  4OX9 Q;  3F8T A;  4BBR G;  1YEZ A;  1XNQ Q;  2JA6 H;  3I4M H;  4KLK A;  1PV4 A;  4OWW B;  5IP9 G;  2MFI A;  4B3T Q;  2JA7 H;  1X54 A;  3SGI A;  3K81 C;  1CKN A;  1TWH H;  3KF6 B;  5IE8 A;  4A3I G;  1VQ4 A;  4LF5 L;  1PYB A;  1VQE A;  2H5X A;  1KC8 C;  1XTD A;  1D8L A;  4DAY B;  1X3F A;  2N8N A;  4DV7 L;  1FGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...