3VDZA

Tailoring encodable lanthanide-binding tags as mri contrast agents: xq-dse3-ubiquitin at 2.4 angstroms
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
GAGYIDTDNDGSIDGDELYIDTDNDGSIDGDELLAMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-40S ribosomal protein S27a
publication title Tailoring encodable lanthanide-binding tags as MRI contrast agents.
pubmed doi rcsb
source organism Synthetic construct, homo sapiens
molecule tags Metal binding protein, de novo design
total genus 24
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vdzA02
4W9JA 2RGFA 2WX0A 3M95A 3UF8A 3VH3B 2C7MB 4NQKE 3EC8A 2YVCA 4WQOB 3KUZA 1Q1OA 1WXVA 4MJSA 2I1JA 5DCNA 2MP2A 1WZ0A 4WJQA 2NBVB 1NBFC 4LJPB 4DBGA 3VTUA 3RD2A 3ZW3A 3QK0A 1XQQA 2DZKA 2ZZPB 1EUVB 2PE9A 2G45B 2NR2A 3B1LX 2PE6B 3MTNB 4PS7A 1PQSA 1TGZB 2L0FA 4EEWA 1YX5B 2KJHB 3K9PB 2GBNA 4M8MA 2R2OA 1WRDB 2MBOA 3VFKA 2LI5A 4RM9A 2JY6A 2IBIB 2LVOA 1R4MI 3ENEA 3H6NA 4JLCA 4EUTA 2MLBA 4I6PA 3IBEA 1P98A 1T0YA 2IO3B 4IWOA 3B08A 2D2QA 3ECIA 2YLMA 2MBQA 2J0MA 2KVRA 2K25A 3TMPB 2RD0A 3DOWA 3DVNV 4WWPA 4PYUA 3VH4B 1P3QU 2L05A 3WANA 2NVUI 4NNJB 2DYBA 1V80A 1UGMA 3NOBA 2C5LC 3LJ3A 5DPRA 3VAWA 3ZNHB 2LRUA 3AULA 4ZYNA 2BWES 4GDKA 3PZDA 3WIMA 4DDID 4DWFA 2KWCA 2K8HA 2DHZA 2KLCA 2LGYA 4JIOU 4X57B 2KFKA 5TR5A 1SIFA 5J18A 2G4DB 4FLHA 3RZFA 2LWPA 2FCQA 4E71A 2HJ8A 2JZZA 1I35A 4FJYA 1WGDA 2UYZB 2XK5B 2O6VA 2LUEA 2BGFA 2VRRB 1QZEA 2KTRB 3JYUA 2W9NA 3HIZA 3WAMA 1FXTB 4KVGB 3GZNI 4WWNA 3QX1A 3R7RA 4B95A 3V61A 2DZMA 4HJKA 3PLVA 5CX3A 3TCAA 3V6CB 2OJRA 3X0WA 2ZNVB 3L08A 1EF1A 2MBEA 2NPTA 3VUWA 2MSED 2KJRA 1KJTA 3CSFA 2BKFA 4EKUA 2FIFA 2KQSA 1WM2A 4GXBA 4K7UA 3RCZA 3CSTA 5DPTA 3DPDA 3DCGA 2KLGA 3KUDB 4G50A 1WZ3A 3ZUNA 2JRHA 4W9LA 1LXDA 1TZ1A 3ALBA 2N7DA 3APCA 2ZNVC 2EMTA 2K8CA 4AJYB 4IM3A 1J0GA 4MSMB 2K6QA 3ML9A 3VXWA 2IY1B 4HK2A 4IWPA 4MEMA 3VUYA 2D07B 2DAJA 2KKCA 4CYEA 4K7SA 3N3KB 2KOXA 2ZCBA 1IYFA 3AU5A 2C60A 3U7DA 2O6VD 2CHWA 3OJ3A 5JH5C 3U30A 1D3ZA 2ZCCA 4LCDE 2JT4B 1ISNA 4MJSB 5E6PA 3N32A 2MP2B 1KM7A 4HPLB 2GBKA 5CHWA 1P9DU 1V5OA 4LDTD 2RSUA 2M1MA 3C0RB 1A5RA 2JRIB 5AZFA 4KIKA 2AL3A 4ANVA 2LGDA 1L7YA 3QARA 2UWQA 1YX6B 3KYDD 3IG3A 4ZRKA 4ANUA 1YD8U 2MW5A 3KH0A 2BWFA 5C1ZA 2DZIA 4NAWA 3PPAA 1WI0A 4KZ0A 2KDBA 2K6DB 4JQWC 1VCBA 3L10B 5D6JB 1UBIA 1WJNA 3H7PA 3TBLD 5JHAA 3L13A 3DVGY 5JHBA 4RMAA 2Z0EB 5GMVA 3A9KA 2M8SA 3W1SA 2FCSA 3DBHI 1WJUA 2KN5A 3PS6A 3P2BA 2ASQA 1XT9B 1C3TA 1KLVA 3ZNZB 2M0XA 3EFUA 4M0WB 3SDLC 3PSEB 3RUIB 4HWIB 4GDKB 2JWZA 2O2VA 1GG3A 4GSWA 5CHFA 1E8WA 4DHZE 2AEHA 4AJWA 4EZJA 2KFKB 2CKHB 4ANXA 1JRUA 1V5TA 3PHWB 4TKNA 1UZXB 3DBSA 2AL6A 1WGYA 1WGGA 4PYZA 5G2NA 2L76A 3UIOB 2O6VB 4FN2A 4LJOB 4BFRA 2CS4A 2KX0A 2ZPNA 2R2QA 4CO7A 2IO2B 3KUCB 3KVFB 3VHTC 2N1WA 3UIPB 2A4ZA 2JVCA 3L0WB 3ZNGC 3ZVVA 1WR1A 2KO3A 2MA9B 1BT0A 4DHJD 4BKSA 3L54A 2M4NA 3K9OB 4W9HA 3IFWB 4FA6A 4IWQA 2KD0A 3R3MA 1J8CA 2NPTB 3AI5A 2N9XA 5L83A 4BVUC 3OLMD 4BBNC 3QAQA 3RULA 4WJOA 1YIWA 2IYDB 1WYWB 2Z0DB 1UH6A 4GDLB 4MDKE 2C7HA 2KANA 2KX3A 1V81A 2PEAA 2KHWB 4OVUA 5D7GA 4I6NB 1U4AA 1EF5A 3OJ4B 5IAAC 4A3OA 2EKEC 1S1QB 3ZO5B 2WWZA 2DAFA 1E8XA 1YQBA 4K7WA 3QJZA 4PS3A 3WA0A 2J0JA 3M63B 4FHKA 2MX2A 3V62A 4HPMB 1WY8A 2KQ7A 2N4FA 3L17A 1M94A 4NQLB 4KSKC 1GNUA 4IG7B 2KNBA 4MGZE 3VTWA 3PREA 4TQ0A 2KC2A 3SHQA 1Z2MA 3ZTDA 2HD5B 2ZJDA 4G3XB 3NS8A 4DXAB 2GBMA 1WXMA 4F8CB 1WX8A 4HCPB 1L2NA 3IVFA 1E8ZA 4DHZB 1S3SG 2D3GA 2J0KA 1Y8RC 3A4SC 3R7QA 4E74A 3GOEA 1EO6A 2NS5A 3JSVA 1V2YA 2DENB 1E90A 1H4RA 2BPSA 3BY4B 3H7SA 4BKSD 3HM3A 4JL9A 4XX5A 4AOFA 2KDIA 4NY0A 2LASA 2LXCA 3PT2B 4A3PA 1Q0WB 2KJ6A 2ZEQA 2DX5B 3NY5A 4M8NA 3A33B 4DHJB 1V86A 3A9JB 1WXSA 4NAWB 2L3ZA 1TBEA 1RFAA 1LQBA 2KC1A 3NHEB 1E8YA 3PVLA 5D2MB 3QHTA 1WM3A 3O65B 2V1YA 2L00B 1KOTA 4N9F4 3H7PB 1WGRA 1HE8A 4IM0A 1WE7A 2D11A 2XK5A 1GC7A 1OEYA 1TTNA 1WGHA 3DBLI 2RPQA 3LDZE 4GMVA 4JGHB 3UGBB 3ZLZA 2LJ5A 3A9KB 3PRMB 4ZRIA 2KWVB 4ZRJA 3OAWA 4J6IA 4W9IA 3TJPA 1OGWA 2G3QB 1P1AA 2DYOA 3M62B 4FULA 5FR6A 4RM8A 4AP4C 1XD3B 3ZNID 2C7NB 4GB9A 4KDIC 3BINA 4AWJA 4HCNB 4IM2A 4WJPA 2Z59B 4EOYA 5DPWA 3QWZB 1VD2A 2IY0B 2CR5A 3MHSD 2EMSA 5J2RA 2JPHA 2O2VB 4MGIE 1WFYA 3NZUA 3APDA 3DBRI 1R4NI 3S2AA 3A4RA 4W9FA 2L7RA 4HDQA 3W1SC 4DK5A 2FIDA 3Q3FA 4MH0E 2BYFA 2FCNA 4HLEA 2K8BA 3A1QA 3PGEA 5CHVC 2PPHA 4ANWA 3EECA 3DQVA 2LD9A 3EHVA 4G0NB 2ZVNA 4TQ1A 4HXDA 4W9EA 2C9WB 5E6NA 4F7ZA 3ML8A 4W9GA 4W9KA 1MG8A 1RRBA 2KXJA 4G11A 4FBJB 3PRPB 1ZGUB 2OOBB 2QHOA 4EZKA 1E7VA 2LRWA 3AU4A 3RYTA 1OEYJ 2N1VA 2LGXA 2IO1B 1WX7A 2AYOB 2BYVE 1ZW7A 5AZHA 1X1MA 5E6OA 2MWSB 4IW0A 4GGQA 1WXAA 4WJNA 3X23A 2KTFA 1V49A 3PTFC 1RLFA 5C23A 2KDFB 3ZTCA 2REXA 2N9PC 2Y5BB 4TV3A 2JXXA 3ONSA 3VTVA 1V6EA 1WMHA 5CTRC 3ZRFA 2KDEB 1I42A 2DZJA 3VQIA 3QA8A 1H8CA 2KMCA 2GBRA 3TIXA 3PLUA 1V9JA 2AWTA 3WAPA 1CMXB 4LDTB 2GOWA 5L95C 1GC6A 3ZIMA 2V4LA 1WE6A 1WJ4A 2MCNB 2WYQA 4IUMB 1AARA 3RZWC 2G4SA 2WDTB 4KZCA 4B9KA 5EDSA 2PJHA 3VVWB 2JF5A 4XC2A 3JVZX 4EFOA 1WIAA 1P0RA 3V6EB 1ZKHA 4KV2A 4XZ4A 3DDCB 5J17A 1WJ6A 4W9CA 2GBJA 2FAZA 4II2B 4ICVA 5AZGA 2MBBB 4URKA 3U8ZA 3H9DA 4MM3A 3UINB 3JSVB 1F9JA 1LFDA 4MGYE 2XEWA 4FADA 1C1YB 3VUXA 3QCAA 4NJ6A 4IC7B 2JZ3B 1UD7A 4KSLC 1NI2A 1K8RB 3HM6X 4BBNF 2FUHB 4ASWC 4TUUA 3CMMB 1Q5WB 3N30A 2DYMA 2ZVOA 3VDZA 3UQBA 2ZPYA 5LXHA 2HE7A 1J19A 3CF6E 4MELA 4GIVA 3QC8B 5JZEB 2L0TA 3R66C 3QIJA 3Q3JA 3T8MA 3DVNU 3H1UA 2D10A 5G55A 2B3AA 1WX9A 5LXIB 5KHOA 5KHQA 3WALA 1G6JA 2XBBC 1E7UA 3KYCD 3ZDTA 1E5WA 1WH3A 1WF9A 4KIKB 2GMIC 3APFA 4NJ7A 3L16A 2CU1A 4HVBA 3ZKJC 2J7QB 2JUOA 2MBHA 2LZ6A 2HTHA 2KFJA 1IPGA 2K39A 4GN1A 4MSQB 4WAAA 4YL8A 2LVQA 4WWOA 4BOSC 3UQAA 2KZRA 3NZSA 5D94A 3ZDMC 3A1QB 4GDLA 3D32A 3HHMA 4ICUA 4P7IA 1SGHA 4CHKA 4W9DA 3TL5A 4MGKE 1GJZA 4FJZA 2KTRA 2IO0B 1GUAB 4II3B 3PV1A 2FNJB 1NDDA 4AUQC 3M3JA 5DPSA 1UBQA 2NCNA 4PS8A 1OTRB 1UELA 1Z5SB 2BF8B 4B6WA 2KK8A 3MJWA 1RAXA 2CHXA 2LVPA 2N7EA 3ZRCA 3SU8X 4BKTA 4ZDVA 2IZVB 5HKHA 2L8JA 4HDOA 4FJVB 3W1YA 2I1KA 2BYEA 3HK0A 2FCMA 3PHXB 4A20A 4GOCA 5IA7A 3QQ8B 2M17A 3T9LA 1WR6E 1SE9A 2A5UA 3AXCA 2V3SA 3KW5B 3IHPC 3PRZA 2CHZA 5AEKB 2RR9A 4E3CA 4EZLA 1WMHB 2KWUB 3JW0X 2KMAA 1IP9A 3I3TB 3B0AA 2MQJA 4KDLB 3WAOA 3V60A 2WX1A 2LXAA 4BKGA 4K1RB 2NBUA 2MRPA 1YJ1A 1LM8B 4GU2A 4NPNA 4K81A 2N9EB 5BO4B 2NBWB 4BOZB 4F1SA 4I6LB 2BKRB 3A9JA 3DVGX 1OQYA 5LLIA 4FHJA 4DDGD 3SD5A 4OVVA 3RT3B 2K1FA
chains in the Genus database with same CATH superfamily
5EE9A 2RGFA 3UF8A 3VH3B 1FNUA 1ZE3D 5DCNA 4MJSA 4BAXA 1WZ0A 2WXKA 4LNNA 2QDFA 1XQQA 2ZZPB 2BW2A 1PQSA 2CJNA 2RDGA 2KJHB 1K52A 1R4MI 2LVOA 2G9HD 4I6PA 3BK2A 1SBBB 4USAA 1E9MA 3AMZA 2VZKB 4RGOS 2JX5A 2HJ1A 4US9A 2YLMA 2MBQA 2J0MA 2XN9C 2K22A 3DVNV 4WWPA 2NVUI 1F2RC 1VZ6A 3VAWA 2EKIA 4ZYNA 3PZDA 2DHZA 2KLCA 4X57B 2G1EA 2KFKA 2FCQA 5D3DA 1I35A 4FJYA 4LLGM 2V4IB 1T0RC 5JXVA 3HIZA 3RFZB 1FXTB 5LNK1 2MHJA 3PLVA 2L1AA 2OJRA 1I4QA 3GB1A 2MBEA 3EGRA 4UDUC 2KJRA 1KJTA 3CSFA 2X8XX 4EKUA 2KQSA 3FILB 4OZCA 2BS4B 1E0ZA 1E6EB 2JRHA 2W3RA 4RH6A 4W9LA 3ALBA 3APCA 2ZNVC 2DBYA 2K6QA 2IY1B 2I2YA 3FAHA 1AW7A 3DBRB 2KKCA 4K7SA 5T8IA 1YOVB 4N58A 1J7CA 1KM7A 4HPLB 5CHWA 1P9DU 4P1BC 2RSUA 5C3JB 2PIAA 3I63C 2N0SB 1A5RA 1L6UA 2JRIB 1OFFA 5AZFA 5HI1A 4KIKA 1KRHA 4ANVA 2LGDA 1L7YA 3Q3MC 4D2KA 4LNKA 3ZJTA 3NVWA 1YD8U 2DZIA 3NUHB 4JQWC 1UBIA 5JHBA 5GMVA 2Y3AA 3A9KA 3MHZA 3DBHI 2JWUA 4GDKB 4NAMA 4AJWA 4ANXA 3DHGC 1DOIA 2AL6A 2GRIA 1D4BA 2CS4A 2ZPNA 4CO7A 2JVCA 2QC8A 3L0WB 2KO3A 4YXDB 1FMAD 3RN9C 1Q10A 1J8CA 2NPTB 3AI5A 5IO9A 4RGNA 3TSSA 1DOXA 2WXLA 3ZGZA 4C56C 4YTMB 1YIWA 2IJ0A 2C7HA 2PEAA 2QSDA 4I6NB 3OJ4B 3ZO5B 1E8XA 1C78A 2WS3B 3R2IA 3V62A 4HPMB 1WY8A 2N4FA 1N63A 2JSVX 4IG7B 1F1HA 3PREA 2KC2A 3ZTDA 3OWEB 3V05A 1WXMA 1WX8A 1SIJA 2D3GA 4E74A 1EO6A 3MC8A 2NS5A 3MC9A 2IGGA 4XX5A 3BYTB 4HRSA 1L0VB 2KDIA 3IT6B 4XDDA 3N1XC 1Q0WB 4REZA 2DX5B 1KLGD 1QOFA 3A9JB 1WXSA 1C76A 1TBEA 1RFAA 3NHEB 3T3NA 3O65B 1KOTA 1VDVA 2K5PA 1GC7A 2WP9B 4JGHB 4BBNF 3NS1A 4HROA 1JWBD 4FULA 4AP4C 4GB9A 5BMHA 4IM2A 4EE2A 2QMTA 5H8YE 2WDVB 2BB5A 2O2VB 2MH7A 2WXNA 3NZUA 4MGIE 3DBRI 2BS2B 3A4RA 2VH2A 2AX5A 1NI3A 3PZ8A 4A90A 2VZKD 3FILA 4DK5A 2FIDA 4MH0E 1GOZA 3PGEA 1AN8A 4TSSA 2KVZA 4G0NB 4TQ1A 4FBJB 4G11A 1P7EA 2V3NA 4WQMA 2N1VA 5E6OA 1NEKB 2MWSB 4WAFA 1V49A 3PTFC 4TV3A 2KDEB 2J42A 1I42A 3VQIA 3QA8A 1GC6A 3ZIMA 4KGTA 4B0MA 2JF5A 1WIAA 1P0RA 1GAQB 2RDBC 1ZDVA 1F2RI 1WJ6A 2GBJA 2FAZA 1TKYA 2IPKD 5AZGA 2MBBB 4URKA 4MM3A 1I4HA 3VUXA 2WXRA 4IC7B 4QAYA 1L4DB 1NI2A 5AUIA 3HM6X 4TUUA 3I9V1 1EWCA 3UQBA 1HA5A 2HE7A 2HTME 3Q69A 2K0PA 3R66C 4KKJA 3QIJA 3H1UA 4DQOC 5KHQA 4CQNA 1E5WA 1N5XA 4M02A 5EE1A 1T6BX 4WAAA 4BOSC 3UQAA 2CU3A 2W55A 4JE3B 4K3BA 4O1NA 5G5GA 1NYRA 1GJZA 2AQ2B 2IO0B 3M3JA 2NCNA 1D6EC 1OTRB 1T3QA 1F52A 1Z5SB 5HG2A 2M19A 1K53A 2Y5PA 2N7EA 4KGRA 3SU8X 2IZVB 2L8JA 1C77A 2FCMA 3AE2B 2L32A 5AEKB 3GE8C 4E3CA 4EZLA 1IP9A 4N6EB 3I3TB 2HDEA 4P16A 3WAOA 3V60A 1KF6B 2MRPA 1FNWA 3A9JA 3DVGX 5LLIA 3SD5A 3RT3B 2D5GA 2C7MB 3KUZA 1PUTA 2I1JA 1RFKA 4WJQA 2NBVB 2KACA 4ZOHC 4LJPB 1SJED 4DXFA 3P42A 3SEBA 3RD2A 3QK0A 3Q3NC 2DZKA 2WU2B 3MTNB 2WXPA 4HEA1 1V1OA 1WRDB 3VFKA 2IBIB 4JLCA 4EUTA 3IBEA 1JWMD 1MG4A 2D2QA 1DOYA 1FIQA 2KVRA 5BYRA 1YQ3B 4PYUA 3WANA 3AE9B 2DYBA 1V80A 1UGMA 2C5LC 3LJ3A 3ZNHB 1LO5D 2BWES 2KWCA 1FM0D 1N6ZA 4E71A 2HJ8A 2JZZA 2XK5B 2VRRB 2KTRB 2W9NA 4KVGB 4WWNA 4WH4A 3V61A 5CX3A 4XE0A 2OHFA 1ET9A 3W2DA 3VUWA 5BMIA 1WM2A 3MFGA 3CSTA 3AEBB 5DPTA 2WHIA 1FRDA 4FXCA 2KLGA 3KUDB 4G50A 3GP7A 2KMMA 2FE8A 2N7DA 3U4EG 1ESFA 2K8CA 4IM3A 1IBXA 3ML9A 1Y56A 4IWPA 1TY2A 2BBCA 5H92C 4CYEA 2KOXA 3RMKC 1ZXIA 1UWXA 3AU5A 3R2TA 2C60A 3U7DA 1UNSA 3OJ3A 5JH5C 3U30A 4H2AA 1TIFA 2GB1A 2WQYB 3N32A 2MP2B 1V5OA 2JU6X 3C0RB 3Q8CA 2EELA 4LNIA 3QARA 1FCCC 3C8YA 5C1ZA 4NAWA 3PPAA 1ENFA 4RGTA 4ARCA 1VCBA 1OQQA 1HEZE 3H7PA 3TBLD 3DVGY 2Z0EB 2FCSA 1WJUA 4PK1A 2KN5A 3P2BA 1C3TA 1KLVA 2YEPB 4M0WB 1P7FA 4JWSC 4DXGA 1SE4A 5IOIA 1PYWD 4DHZE 1WGYA 5G2NA 3UIOB 2O6VB 4BFRA 2R2QA 3KUCB 3KVFB 2A4ZA 3ZNGC 4XYCA 4GLSC 1WR1A 2MA9B 1WXQA 1BT0A 2INDC 3RNEC 2KQ4X 3K9OB 3IFWB 3FKYA 2KD0A 5L83A 1TS3A 4TMAB 4GDLB 4OVUA 5D7GA 3ZJUA 1S1QB 2WWZA 4PS3A 4HPPA 5FR3A 4FHKA 2MX2A 1TZOA 5BYQA 2GLSA 1M94A 3Q8BA 1MFWA 4NQLB 4KSKC 4MGZE 2INPE 3EA6A 1RWSA 3VTWA 3SHQA 4DXAB 3NS8A 4HCPB 1E8ZA 1S3SG 2J0KA 1Y8RC 4WWMA 1YN3A 2TSSA 3ETRA 2DENB 1H4RA 1EM7A 3HM3A 4JL9A 1N60A 3TEZA 2LASA 3PT2B 1GB1A 5C2TB 4A3PA 2KJ6A 1ET6A 2ZEQA 4DHJB 1V86A 2L3ZA 4A8XC 1LQBA 1J7BA 1WM3A 4IM0A 1WGRA 1HE8A 2V9HA 4GMVA 2XK5A 1OEYA 1JQ4A 2JYTA 2RPQA 3DBLI 3RPFC 4ZYSA 4ZRJA 1OGWA 1OQRA 1P1AA 1L4ZB 2DYOA 3SFDB 5FR6A 4RM8A 4LK0M 1XD3B 1JALA 4AWJA 5G5HA 3QWZB 2CR5A 1V1PB 4L1BA 1VRAB 2L52A 2L7RA 1HTOA 2BYFA 5CHVC 3AB5A 1YJJA 4ANWA 3EECA 4PT5A 1XO3A 1V8CA 4YSXB 5E6NA 4WURA 3V3XA 4W9KA 1RRBA 2KXJA 3BVZA 3PRPB 2OOBB 5EE0A 2XNAC 2QHOA 1E7VA 1OEYJ 2LGXA 2IO1B 1WX7A 1ZW7A 5AZHA 4IW0A 4JPSA 1C79A 4WJNA 1PFDA 1DYQA 1RLFA 2N9PC 2JXXA 1QF6A 3NVYA 1V6EA 3ZRFA 4NJCA 1H8CA 3URYA 3ZJVA 1V9JA 1CMXB 1VR9A 1ZDXA 2V4LA 2MCNB 4A6QA 3AE7B 4B9KA 5EDSA 3JVZX 2N9LA 4KV2A 5J17A 3DDCB 4W9CA 4MACA 3U8ZA 1L0XB 3JSVB 1RYJA 4OHJA 3QCAA 5FKAC 2IDYA 4OZBA 3BK1A 1M4VA 1FFUA 3Q3OC 3N30A 1L6VA 2DYMA 2ZVOA 3VDZA 2ZPYA 4S0RA 1SEBD 3PO0A 3RNAC 1SE2A 4IKGA 2ONQA 5G55A 1G6JA 4YTNB 3AEAB 1E7UA 3ZDTA 2NMQA 1FXIA 4RFBA 3L16A 2RDHA 5IP4D 2CU1A 2IGHA 2K39A 2UU7A 4GN1A 4YL8A 2LVQA 4WWOA 2WGSA 5D94A 2QEJC 3A1QB 3CIRB 4GDLA 1AYFA 1SGHA 5BYSA 3LYYA 2K9XA 4II3B 3HVZA 3PV1A 4AUQC 1UBQA 4KX6B 2D3AA 2ACZB 3TUOA 1SE3A 3MJWA 1RAXA 2LVPA 4ZDVA 1XLPA 1I4PA 4HDOA 4FJVB 1VZ8A 2OEDA 3PHXB 1UWMA 4N59A 2A5UA 2MJ3A 3PRZA 2WXGA 1TKEA 1BXTA 1WMHB 2KWUB 3JW0X 1VJKA 2LGSA 3PZ7A 2WXOA 2NBUA 1UGJA 4NPNA 3B2GA 2LHEA 4F1SA 4M01A 1V97A 5MPOA 2N7JA 4B6WA 4OVVA 3L4PA 4EZKA 3AE5B 3M95A 4NQKE 3EC8A 1Q1OA 2ZW0A 3ZXRA 2WXQA 4DBGA 1WWTA 3VTUA 1E7PB 2GI9A 2BYTA 2G45B 1TGZB 2L0FA 3OG5A 1I4XA 4EEWA 2INCC 2OJWA 1AWDA 3K9PB 2GBNA 1T0QC 2LI5A 4RM9A 3H6NA 4XGAB 2MLBA 2PTLA 2MJEA 2ZW1A 1T0YA 2WXFA 3TMPB 1ROEA 3DOWA 3VH4B 4NNJB 4C4VB 1ACCA 2LRUA 3AULA 4GDKA 4DDID 4DWFA 1I7HA 2Z8LA 1ZOYB 1PGBA 2K8HA 4JIOU 5TR5A 4MT5A 2LWPA 2VH1A 4HKQA 2LUEA 1K50A 1QZEA 3DHHC 1FEHA 4KKIA 3QX1A 3R7RA 1YNTE 3L08A 2PVOD 1TKGA 1MI0A 2NPTA 1ZXHA 3AH7A 3DPDA 1WZ3A 3ZUNA 1N61A 1FXAA 1F0ZA 1LXDA 1CQVA 4L23A 4AJYB 1J0GA 3BVMA 4B0EA 4HK2A 3IXSA 3AV8A 2D07B 3RNGC 3N3KB 1BMLC 4RNAA 1D3ZA 2LGIA 2KN4A 2FUG1 4MJSB 1QOAA 1D5XC 5I4DA 1IGDA 3N1YC 2M1MA 2AQ1B 1EWYC 1YX6B 3KH0A 2AQ3B 3AE1B 4OW0A 1WJNA 2WXIA 5JHAA 3L13A 4RMAA 4XDCA 3KWLA 2PW9A 2WDRB 4RCOA 3PS6A 1XT9B 2M0XA 1N62A 2L83A 3EFUA 3RUIB 4XWTA 3EFCA 2JWZA 2O2VA 3DHIC 5CHFA 4EZJA 2KFKB 2PKOA 1SXTA 3PHWB 4TKNA 1UZXB 1WGGA 1NVID 3AN1A 1MJDA 2KDMA 2X38A 2KX0A 1STEA 2IO2B 3NVZA 5FK9C 2N1WA 3UIPB 2WXMA 4ZHOA 4BKSA 3L54A 2M4NA 4FA6A 3W5UB 2V0GA 1TS4A 3QAQA 3CWIA 4ACFA 2IYDB 2KANA 1V81A 1U4AA 1EF5A 4A3OA 4IOIE 5E6JA 1WSPA 2DAFA 3WA0A 3M63B 2KQ7A 3L17A 1VZ7A 1GNUA 3B9JA 1Z2MA 2ZJDA 4F8CB 1XLQA 1L2NA 4ITKA 3A4SC 3R7QA 3RI7C 3GOEA 2WNMA 1WYGA 1B1ZA 1V2YA 2BPSA 3H7SA 4LTUA 4BKSD 4RF0A 3P4RB 2NTTA 4AOFA 1EU3A 4NY0A 3B2FA 1UUPA 4C4VA 3NY5A 3HUIA 4M8NA 3AEFB 3A33B 3IT4B 2Y5CA 1TS2A 2KC1A 5D2MB 3PVLA 3QHTA 2NTSA 2V1YA 2D11A 1TTNA 5IKCM 2LJ5A 3A9KB 2KWVB 5EE3A 4J6IA 4W9IA 4YWGG 3Q8FA 2G3QB 2KWDA 4KDIC 2MEKA 2SEBD 4WJPA 4A55A 2Z59B 3IAS1 1VD2A 1C4AA 2WXJA 3MHSD 5J2RA 1MVKA 2JXTA 1WFYA 1L0YB 3S2AA 2LMCA 4W9FA 4HDQA 3W1SC 2LFIA 3Q3FA 3N20C 3VRBB 5HHDG 3DBHB 3DQVA 3W5VB 4HXDA 1D5MC 1FNVA 4W9GA 3Q14C 1JWSD 1ZGUB 5TSSA 4JX1C 4YSYB 3RYTA 1FO4A 1HQRD 2AYOB 1MHHE 1X1MA 1JW9D 2KAJA 4GGQA 3MJ5A 1XXGA 2KTFA 1QLBB 4ZRPA 2M56B 2Y5BB 1XF5L 4P6VF 4YSZB 3U52E 3MP9A 2GBRA 3MC0B 3TIXA 3PLUA 2AWTA 1SSNA 1TY0A 3WAPA 4LDTB 1YMHE 3AEGB 1WE6A 1WJ4A 2WYQA 4IUMB 3P4SB 4KZCA 2WDTB 1YN4A 2PJHA 3VVWB 2BQQA 3V6EB 4Q2JA 1ZKHA 1TYGB 4XZ4A 4II2B 4ICVA 3UINB 4NZLB 1F9JA 4MGYE 4FADA 3GZNB 1XEEA 1TJEA 5BMGA 4NJ6A 2JZ3B 1UD7A 4US8A 5IN7A 4ASWC 4HKZE 3CMMB 3WCQA 5LXHA 1J19A 2LJIA 1JCKB 2L0TA 3Q3JA 1SJHD 2CJOA 2D10A 2QJLA 3WALA 1GB4A 2XBBC 1WH3A 1JMLA 5HFYA 4NJ7A 3VRAB 4HVBA 4C7YA 2MBHA 2HTHA 1IPGA 2KZRA 3H8HA 2I38A 3SFEB 3HVDA 4P7IA 3U2SC 4W9DA 2DNFA 3TL5A 4MGKE 2KTRA 1GUAB 2FNJB 5DPSA 2B76B 4PS8A 1UELA 2BF8B 3UI3A 2LUMA 2KK8A 3ZRCA 4BKTA 3W1YA 2I1KA 4ZHPA 2BYEA 1JWAD 3AECB 4A20A 3P4QB 4GOCA 3QQ8B 5IA7A 3T9LA 1WR6E 1SE9A 4K3CA 3AXCA 2V3SA 4OZAA 1SF0A 2CHZA 2RR9A 2WXHA 3GE3C 3AEEB 3Q8EA 2MQJA 3RNCC 2WX1A 1KTKA 1YJ1A 1A70A 1LM8B 4GU2A 2N9EB 5BO4B 3W9CB 2NBWB 1QKZA 4BOZB 4I6LB 2BKRB 3NRZA 3BWUD 2RMMA 1OQYA 4DDGD 3AE6B 3VTVA 2QCZA 4W9JA 2WX0A 3P4PB 1BUIC 1J7AA 2YVCA 4WQOB 1WXVA 2MP2A 4MM3B 1FRRA 1NBFC 4P1CC 3ZW3A 4RGMA 3NJTA 4M00A 3DWGC 1EUVB 2H89B 2PE9A 2NR2A 2PVGC 2PE6B 3B1LX 4PS7A 4C7ZA 1XCQL 1YX5B 4M8MA 2R2OA 4C80A 2MBOA 1MPEA 2K3UA 2JY6A 3ENEA 1XLNA 1P98A 2IO3B 4IWOA 3B08A 3ECIA 4WIPA 2K25A 2RD0A 1P3QU 2L05A 4M0WA 2DLBA 3NOBA 5DPRA 3HRDD 3WIMA 2E3TA 2IGDA 2E6XA 2LGYA 5J18A 1SIFA 2G4DB 4ARIA 4FLHA 3RZFA 1QOGA 3Q2AC 1WGDA 2UYZB 2O6VA 2BGFA 2Q5WD 1TT5B 4YT0B 1FPYA 3JYUA 4LNOA 3WAMA 3DWMA 3GZNI 4AS1A 4B95A 1I4GA 2DZMA 4HJKA 4JWUC 3TCAA 3V6CB 1UF0A 3X0WA 2ZNVB 1EF1A 2MSED 2BKFA 2FIFA 3R8BA 4GXBA 4K7UA 3RCZA 2R61A 3DCGA 3AE8B 1IUEA 1TZ1A 1FCLA 2EMTA 4MSMB 2BS3B 3VXWA 2MJDA 4MEMA 1JROA 2SAKA 3VUYA 1R4NB 2DAJA 2ZCBA 1IYFA 4KGSA 2O6VD 2CHWA 2ZCCA 4LCDE 2D3CA 2JT4B 1ISNA 5E6PA 1E10A 1CK1A 3AE4B 2GBKA 2FBWB 1HXYD 3AE3B 4LDTD 3LXFA 2BT6A 3BIID 2AL3A 2UWQA 3TEWA 1ZP0B 3KYDD 1F77A 1K51A 3IG3A 2QIEB 4ZRKA 3SR6A 4ANUA 2MW5A 2BWFA 1WI0A 4KZ0A 2KDBA 2K6DB 3L10B 5D6JB 3U7ZA 3EUB2 2M8SA 3W1SA 3N9YC 2LHDA 3RNBC 4HJGE 2ASQA 1R7SA 2PLPA 3ZNZB 1HZ5A 1ZUD2 2J52A 4J3OD 5AUKA 3SDLC 3PSEB 4HWIB 3AM9A 1V1PA 4GSWA 1GG3A 1E8WA 2AEHA 3E56A 2CKHB 1JRUA 1V5TA 4PYZA 3DBSA 2L76A 4LJOB 4FN2A 2N9KA 2PMVA 3NZ3A 4LNFA 3VHTC 3ZVVA 2J4XA 1PGAA 4DHJD 1GPXA 2D3BA 2JZPA 4W9HA 2BB6A 1C4PA 4IWQA 3R3MA 4RF1A 2N9XA 4BVUC 3OLMD 4BBNC 2WU5B 3RULA 4WJOA 1WYWB 2Z0DB 1UH6A 4MDKE 2KX3A 2KHWB 3J9CA 5IAAC 2JYEA 2EKEC 1FFVA 4A9AA 3VR8B 1YQBA 4K7WA 1CJEA 3QJZA 2J0JA 1IBXB 3TEXA 2DWQA 2KNBA 2W54A 4TQ0A 2HD5B 4BZAA 4G3XB 2GBMA 3IVFA 3LB8C 4MH8A 4DHZB 2V3PA 4IDIA 1ZPSA 3JSVA 1E90A 3ZXVA 3BY4B 3Q6BA 1C4CA 2YEPF 1MHXA 1LGRA 2LXCA 1XLOA 4AQ7A 1PGXA 4NAWB 3GS2A 2BTEA 1E8YA 4R3DA 2L00B 4N9F4 3H7PB 1WE7A 3LDZE 3KQ4A 3UGBB 1WGHA 3ZLZA 3PRMB 4ZRIA 1TS5A 3OAWA 1JWUD 3TJPA 3P1MA 3M62B 3ZNID 2C7NB 3BINA 1CZPA 4HCNB 4EOYA 5DPWA 1FD6A 2IY0B 2J53A 1JRPA 2BVCA 2EMSA 3VR9B 2JPHA 4S17A 3APDA 1R4NI 1QT9A 4L2YA 1IGCA 2FCNA 4HLEA 2K8BA 3A1QA 2PPHA 5GXGB 3IAM1 2LD9A 3EHVA 1YQ4B 3N1ZC 2ZVNA 1C9FA 2ICIA 4W9EA 2C9WB 4F7ZA 3ML8A 1MG8A 3ZYYX 3Q8AA 2LRWA 3AU4A 2WLBA 2BYVE 1WXAA 3X23A 2JQRB 1R4MB 4OVZA 5C23A 2KDFB 3ZTCA 2REXA 1B9RA 4C00A 1HTQA 3ONSA 1RM6C 1WMHA 5CTRC 3BYYB 2W3SA 2DZJA 2KMCA 3E9SA 3FC4A 3KWVA 2INNE 1QOBA 2GOWA 5L95C 1T0SC 3NVVA 1AARA 3RZWC 2G4SA 4XC2A 4EFOA 1I4RA 4YTPB 1N5WA 3H9DA 1NYQA 2LEKA 1LFDA 3BZDB 2XEWA 1C1YB 1WRIA 2M0AA 4KSLC 1K8RB 2FUHB 1DGJA 1XCTL 1Q5WB 3TEYA 3CF6E 4MELA 4GIVA 3QC8B 5JZEB 2KYWA 2W82A 1D5ZC 3T8MA 3DVNU 2B3AA 1WX9A 5LXIB 5KHOA 1KFYB 3KYCD 1WF9A 1T5XD 4KIKB 2GMIC 3APFA 4XWWA 2RPVA 3ZKJC 2J7QB 2JUOA 2LZ6A 1EU4A 2KFJA 4MSQB 3ZDMC 3P63A 3NZSA 3DBLB 2KT7A 3T3OA 3D32A 3HHMA 4ICUA 4CHKA 3RNFC 4FJZA 1NENB 3C19A 1NDDA 1QQRA 1HZ6A 1L5PA 1PDXA 3ABVB 3KLSX 2CHXA 1SB3C 3ZQ4A 5HKHA 1YN5A 3HK0A 2WDQB 2M17A 3BVGA 3O13A 1YJIA 3KW5B 3IHPC 3NG0A 1WGKA 2KMAA 3B0AA 3I57A 1QILA 4KDLB 2LXAA 4BKGA 4K1RB 3AEDB 1KH0A 3I5JC 4K81A 1KLUD 4ZRQA 5D3IB 1VLBA 4FHJA 2ON8A 2K1FA 2H88B 2QILA
chains in the Genus database with same CATH topology
4W9JA 2RGFA 2WX0A 3M95A 3UF8A 3VH3B 2C7MB 4NQKE 3EC8A 2YVCA 4WQOB 3KUZA 1Q1OA 1WXVA 4MJSA 2I1JA 5DCNA 2MP2A 1WZ0A 4WJQA 2NBVB 1NBFC 4LJPB 4DBGA 3VTUA 3RD2A 3ZW3A 3QK0A 1XQQA 2DZKA 2ZZPB 1EUVB 2PE9A 2G45B 2NR2A 3B1LX 2PE6B 3MTNB 4PS7A 1PQSA 1TGZB 2L0FA 4EEWA 1YX5B 2KJHB 3K9PB 2GBNA 4M8MA 2R2OA 1WRDB 2MBOA 3VFKA 2LI5A 4RM9A 2JY6A 2IBIB 2LVOA 1R4MI 3ENEA 3H6NA 4JLCA 4EUTA 2MLBA 4I6PA 3IBEA 1P98A 1T0YA 2IO3B 4IWOA 3B08A 2D2QA 3ECIA 2YLMA 2MBQA 2J0MA 2KVRA 2K25A 3TMPB 2RD0A 3DOWA 3DVNV 4WWPA 4PYUA 3VH4B 1P3QU 2L05A 3WANA 2NVUI 4NNJB 2DYBA 1V80A 1UGMA 3NOBA 2C5LC 3LJ3A 5DPRA 3VAWA 3ZNHB 2LRUA 3AULA 4ZYNA 2BWES 4GDKA 3PZDA 3WIMA 4DDID 4DWFA 2KWCA 2K8HA 2DHZA 2KLCA 2LGYA 4JIOU 4X57B 2KFKA 5TR5A 1SIFA 5J18A 2G4DB 4FLHA 3RZFA 2LWPA 2FCQA 4E71A 2HJ8A 2JZZA 1I35A 4FJYA 1WGDA 2UYZB 2XK5B 2O6VA 2LUEA 2BGFA 2VRRB 1QZEA 2KTRB 3JYUA 2W9NA 3HIZA 3WAMA 1FXTB 4KVGB 3GZNI 4WWNA 3QX1A 3R7RA 4B95A 3V61A 2DZMA 4HJKA 3PLVA 5CX3A 3TCAA 3V6CB 2OJRA 3X0WA 2ZNVB 3L08A 1EF1A 2MBEA 2NPTA 3VUWA 2MSED 2KJRA 1KJTA 3CSFA 2BKFA 4EKUA 2FIFA 2KQSA 1WM2A 4GXBA 4K7UA 3RCZA 3CSTA 5DPTA 3DPDA 3DCGA 2KLGA 3KUDB 4G50A 1WZ3A 3ZUNA 2JRHA 4W9LA 1LXDA 1TZ1A 3ALBA 2N7DA 3APCA 2ZNVC 2EMTA 2K8CA 4AJYB 4IM3A 1J0GA 4MSMB 2K6QA 3ML9A 3VXWA 2IY1B 4HK2A 4IWPA 4MEMA 3VUYA 2D07B 2DAJA 2KKCA 4CYEA 4K7SA 3N3KB 2KOXA 2ZCBA 1IYFA 3AU5A 2C60A 3U7DA 2O6VD 2CHWA 3OJ3A 5JH5C 3U30A 1D3ZA 2ZCCA 4LCDE 2JT4B 1ISNA 4MJSB 5E6PA 3N32A 2MP2B 1KM7A 4HPLB 2GBKA 5CHWA 1P9DU 1V5OA 4LDTD 2RSUA 2M1MA 3C0RB 1A5RA 2JRIB 5AZFA 4KIKA 2AL3A 4ANVA 2LGDA 1L7YA 3QARA 2UWQA 1YX6B 3KYDD 3IG3A 4ZRKA 4ANUA 1YD8U 2MW5A 3KH0A 2BWFA 5C1ZA 2DZIA 4NAWA 3PPAA 1WI0A 4KZ0A 2KDBA 2K6DB 4JQWC 1VCBA 3L10B 5D6JB 1UBIA 1WJNA 3H7PA 3TBLD 5JHAA 3L13A 3DVGY 5JHBA 4RMAA 2Z0EB 5GMVA 3A9KA 2M8SA 3W1SA 2FCSA 3DBHI 1WJUA 2KN5A 3PS6A 3P2BA 2ASQA 1XT9B 1C3TA 1KLVA 3ZNZB 2M0XA 3EFUA 4M0WB 3SDLC 3PSEB 3RUIB 4HWIB 4GDKB 2JWZA 2O2VA 1GG3A 4GSWA 5CHFA 1E8WA 4DHZE 2AEHA 4AJWA 4EZJA 2KFKB 2CKHB 4ANXA 1JRUA 1V5TA 3PHWB 4TKNA 1UZXB 3DBSA 2AL6A 1WGYA 1WGGA 4PYZA 5G2NA 2L76A 3UIOB 2O6VB 4FN2A 4LJOB 4BFRA 2CS4A 2KX0A 2ZPNA 2R2QA 4CO7A 2IO2B 3KUCB 3KVFB 3VHTC 2N1WA 3UIPB 2A4ZA 2JVCA 3L0WB 3ZNGC 3ZVVA 1WR1A 2KO3A 2MA9B 1BT0A 4DHJD 4BKSA 3L54A 2M4NA 3K9OB 4W9HA 3IFWB 4FA6A 4IWQA 2KD0A 3R3MA 1J8CA 2NPTB 3AI5A 2N9XA 5L83A 4BVUC 3OLMD 4BBNC 3QAQA 3RULA 4WJOA 1YIWA 2IYDB 1WYWB 2Z0DB 1UH6A 4GDLB 4MDKE 2C7HA 2KANA 2KX3A 1V81A 2PEAA 2KHWB 4OVUA 5D7GA 4I6NB 1U4AA 1EF5A 3OJ4B 5IAAC 4A3OA 2EKEC 1S1QB 3ZO5B 2WWZA 2DAFA 1E8XA 1YQBA 4K7WA 3QJZA 4PS3A 3WA0A 2J0JA 3M63B 4FHKA 2MX2A 3V62A 4HPMB 1WY8A 2KQ7A 2N4FA 3L17A 1M94A 4NQLB 4KSKC 1GNUA 4IG7B 2KNBA 4MGZE 3VTWA 3PREA 4TQ0A 2KC2A 3SHQA 1Z2MA 3ZTDA 2HD5B 2ZJDA 4G3XB 3NS8A 4DXAB 2GBMA 1WXMA 4F8CB 1WX8A 4HCPB 1L2NA 3IVFA 1E8ZA 4DHZB 1S3SG 2D3GA 2J0KA 1Y8RC 3A4SC 3R7QA 4E74A 3GOEA 1EO6A 2NS5A 3JSVA 1V2YA 2DENB 1E90A 1H4RA 2BPSA 3BY4B 3H7SA 4BKSD 3HM3A 4JL9A 4XX5A 4AOFA 2KDIA 4NY0A 2LASA 2LXCA 3PT2B 4A3PA 1Q0WB 2KJ6A 2ZEQA 2DX5B 3NY5A 4M8NA 3A33B 4DHJB 1V86A 3A9JB 1WXSA 4NAWB 2L3ZA 1TBEA 1RFAA 1LQBA 2KC1A 3NHEB 1E8YA 3PVLA 5D2MB 3QHTA 1WM3A 3O65B 2V1YA 2L00B 1KOTA 4N9F4 3H7PB 1WGRA 1HE8A 4IM0A 1WE7A 2D11A 2XK5A 1GC7A 1OEYA 1TTNA 1WGHA 3DBLI 2RPQA 3LDZE 4GMVA 4JGHB 3UGBB 3ZLZA 2LJ5A 3A9KB 3PRMB 4ZRIA 2KWVB 4ZRJA 3OAWA 4J6IA 4W9IA 3TJPA 1OGWA 2G3QB 1P1AA 2DYOA 3M62B 4FULA 5FR6A 4RM8A 4AP4C 1XD3B 3ZNID 2C7NB 4GB9A 4KDIC 3BINA 4AWJA 4HCNB 4IM2A 4WJPA 2Z59B 4EOYA 5DPWA 3QWZB 1VD2A 2IY0B 2CR5A 3MHSD 2EMSA 5J2RA 2JPHA 2O2VB 4MGIE 1WFYA 3NZUA 3APDA 3DBRI 1R4NI 3S2AA 3A4RA 4W9FA 2L7RA 4HDQA 3W1SC 4DK5A 2FIDA 3Q3FA 4MH0E 2BYFA 2FCNA 4HLEA 2K8BA 3A1QA 3PGEA 5CHVC 2PPHA 4ANWA 3EECA 3DQVA 2LD9A 3EHVA 4G0NB 2ZVNA 4TQ1A 4HXDA 4W9EA 2C9WB 5E6NA 4F7ZA 3ML8A 4W9GA 4W9KA 1MG8A 1RRBA 2KXJA 4G11A 4FBJB 3PRPB 1ZGUB 2OOBB 2QHOA 4EZKA 1E7VA 2LRWA 3AU4A 3RYTA 1OEYJ 2N1VA 2LGXA 2IO1B 1WX7A 2AYOB 2BYVE 1ZW7A 5AZHA 1X1MA 5E6OA 2MWSB 4IW0A 4GGQA 1WXAA 4WJNA 3X23A 2KTFA 1V49A 3PTFC 1RLFA 5C23A 2KDFB 3ZTCA 2REXA 2N9PC 2Y5BB 4TV3A 2JXXA 3ONSA 3VTVA 1V6EA 1WMHA 5CTRC 3ZRFA 2KDEB 1I42A 2DZJA 3VQIA 3QA8A 1H8CA 2KMCA 2GBRA 3TIXA 3PLUA 1V9JA 2AWTA 3WAPA 1CMXB 4LDTB 2GOWA 5L95C 1GC6A 3ZIMA 2V4LA 1WE6A 1WJ4A 2MCNB 2WYQA 4IUMB 1AARA 3RZWC 2G4SA 2WDTB 4KZCA 4B9KA 5EDSA 2PJHA 3VVWB 2JF5A 4XC2A 3JVZX 4EFOA 1WIAA 1P0RA 3V6EB 1ZKHA 4KV2A 4XZ4A 3DDCB 5J17A 1WJ6A 4W9CA 2GBJA 2FAZA 4II2B 4ICVA 5AZGA 2MBBB 4URKA 3U8ZA 3H9DA 4MM3A 3UINB 3JSVB 1F9JA 1LFDA 4MGYE 2XEWA 4FADA 1C1YB 3VUXA 3QCAA 4NJ6A 4IC7B 2JZ3B 1UD7A 4KSLC 1NI2A 1K8RB 3HM6X 4BBNF 2FUHB 4ASWC 4TUUA 3CMMB 1Q5WB 3N30A 2DYMA 2ZVOA 3VDZA 3UQBA 2ZPYA 5LXHA 2HE7A 1J19A 3CF6E 4MELA 4GIVA 3QC8B 5JZEB 2L0TA 3R66C 3QIJA 3Q3JA 3T8MA 3DVNU 3H1UA 2D10A 5G55A 2B3AA 1WX9A 5LXIB 5KHOA 5KHQA 3WALA 1G6JA 2XBBC 1E7UA 3KYCD 3ZDTA 1E5WA 1WH3A 1WF9A 4KIKB 2GMIC 3APFA 4NJ7A 3L16A 2CU1A 4HVBA 3ZKJC 2J7QB 2JUOA 2MBHA 2LZ6A 2HTHA 2KFJA 1IPGA 2K39A 4GN1A 4MSQB 4WAAA 4YL8A 2LVQA 4WWOA 4BOSC 3UQAA 2KZRA 3NZSA 5D94A 3ZDMC 3A1QB 4GDLA 3D32A 3HHMA 4ICUA 4P7IA 1SGHA 4CHKA 4W9DA 3TL5A 4MGKE 1GJZA 4FJZA 2KTRA 2IO0B 1GUAB 4II3B 3PV1A 2FNJB 1NDDA 4AUQC 3M3JA 5DPSA 1UBQA 2NCNA 4PS8A 1OTRB 1UELA 1Z5SB 2BF8B 4B6WA 2KK8A 3MJWA 1RAXA 2CHXA 2LVPA 2N7EA 3ZRCA 3SU8X 4BKTA 4ZDVA 2IZVB 5HKHA 2L8JA 4HDOA 4FJVB 3W1YA 2I1KA 2BYEA 3HK0A 2FCMA 3PHXB 4A20A 4GOCA 5IA7A 3QQ8B 2M17A 3T9LA 1WR6E 1SE9A 2A5UA 3AXCA 2V3SA 3KW5B 3IHPC 3PRZA 2CHZA 5AEKB 2RR9A 4E3CA 4EZLA 1WMHB 2KWUB 3JW0X 2KMAA 1IP9A 3I3TB 3B0AA 2MQJA 4KDLB 3WAOA 3V60A 2WX1A 2LXAA 4BKGA 4K1RB 2NBUA 2MRPA 1YJ1A 1LM8B 4GU2A 4NPNA 4K81A 2N9EB 5BO4B 2NBWB 4BOZB 4F1SA 4I6LB 2BKRB 3A9JA 3DVGX 1OQYA 5LLIA 4FHJA 4DDGD 3SD5A 4OVVA 3RT3B 2K1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9J A;  2RGF A;  2WX0 A;  3M95 A;  3UF8 A;  3VH3 B;  2C7M B;  4NQK E;  3EC8 A;  2YVC A;  4WQO B;  3KUZ A;  1Q1O A;  1WXV A;  4MJS A;  2I1J A;  5DCN A;  2MP2 A;  1WZ0 A;  4WJQ A;  2NBV B;  1NBF C;  4LJP B;  4DBG A;  3VTU A;  3RD2 A;  3ZW3 A;  3QK0 A;  1XQQ A;  2DZK A;  2ZZP B;  1EUV B;  2PE9 A;  2G45 B;  2NR2 A;  3B1L X;  2PE6 B;  3MTN B;  4PS7 A;  1PQS A;  1TGZ B;  2L0F A;  4EEW A;  1YX5 B;  2KJH B;  3K9P B;  2GBN A;  4M8M A;  2R2O A;  1WRD B;  2MBO A;  3VFK A;  2LI5 A;  4RM9 A;  2JY6 A;  2IBI B;  2LVO A;  1R4M I;  3ENE A;  3H6N A;  4JLC A;  4EUT A;  2MLB A;  4I6P A;  3IBE A;  1P98 A;  1T0Y A;  2IO3 B;  4IWO A;  3B08 A;  2D2Q A;  3ECI A;  2YLM A;  2MBQ A;  2J0M A;  2KVR A;  2K25 A;  3TMP B;  2RD0 A;  3DOW A;  3DVN V;  4WWP A;  4PYU A;  3VH4 B;  1P3Q U;  2L05 A;  3WAN A;  2NVU I;  4NNJ B;  2DYB A;  1V80 A;  1UGM A;  3NOB A;  2C5L C;  3LJ3 A;  5DPR A;  3VAW A;  3ZNH B;  2LRU A;  3AUL A;  4ZYN A;  2BWE S;  4GDK A;  3PZD A;  3WIM A;  4DDI D;  4DWF A;  2KWC A;  2K8H A;  2DHZ A;  2KLC A;  2LGY A;  4JIO U;  4X57 B;  2KFK A;  5TR5 A;  1SIF A;  5J18 A;  2G4D B;  4FLH A;  3RZF A;  2LWP A;  2FCQ A;  4E71 A;  2HJ8 A;  2JZZ A;  1I35 A;  4FJY A;  1WGD A;  2UYZ B;  2XK5 B;  2O6V A;  2LUE A;  2BGF A;  2VRR B;  1QZE A;  2KTR B;  3JYU A;  2W9N A;  3HIZ A;  3WAM A;  1FXT B;  4KVG B;  3GZN I;  4WWN A;  3QX1 A;  3R7R A;  4B95 A;  3V61 A;  2DZM A;  4HJK A;  3PLV A;  5CX3 A;  3TCA A;  3V6C B;  2OJR A;  3X0W A;  2ZNV B;  3L08 A;  1EF1 A;  2MBE A;  2NPT A;  3VUW A;  2MSE D;  2KJR A;  1KJT A;  3CSF A;  2BKF A;  4EKU A;  2FIF A;  2KQS A;  1WM2 A;  4GXB A;  4K7U A;  3RCZ A;  3CST A;  5DPT A;  3DPD A;  3DCG A;  2KLG A;  3KUD B;  4G50 A;  1WZ3 A;  3ZUN A;  2JRH A;  4W9L A;  1LXD A;  1TZ1 A;  3ALB A;  2N7D A;  3APC A;  2ZNV C;  2EMT A;  2K8C A;  4AJY B;  4IM3 A;  1J0G A;  4MSM B;  2K6Q A;  3ML9 A;  3VXW A;  2IY1 B;  4HK2 A;  4IWP A;  4MEM A;  3VUY A;  2D07 B;  2DAJ A;  2KKC A;  4CYE A;  4K7S A;  3N3K B;  2KOX A;  2ZCB A;  1IYF A;  3AU5 A;  2C60 A;  3U7D A;  2O6V D;  2CHW A;  3OJ3 A;  5JH5 C;  3U30 A;  1D3Z A;  2ZCC A;  4LCD E;  2JT4 B;  1ISN A;  4MJS B;  5E6P A;  3N32 A;  2MP2 B;  1KM7 A;  4HPL B;  2GBK A;  5CHW A;  1P9D U;  1V5O A;  4LDT D;  2RSU A;  2M1M A;  3C0R B;  1A5R A;  2JRI B;  5AZF A;  4KIK A;  2AL3 A;  4ANV A;  2LGD A;  1L7Y A;  3QAR A;  2UWQ A;  1YX6 B;  3KYD D;  3IG3 A;  4ZRK A;  4ANU A;  1YD8 U;  2MW5 A;  3KH0 A;  2BWF A;  5C1Z A;  2DZI A;  4NAW A;  3PPA A;  1WI0 A;  4KZ0 A;  2KDB A;  2K6D B;  4JQW C;  1VCB A;  3L10 B;  5D6J B;  1UBI A;  1WJN A;  3H7P A;  3TBL D;  5JHA A;  3L13 A;  3DVG Y;  5JHB A;  4RMA A;  2Z0E B;  5GMV A;  3A9K A;  2M8S A;  3W1S A;  2FCS A;  3DBH I;  1WJU A;  2KN5 A;  3PS6 A;  3P2B A;  2ASQ A;  1XT9 B;  1C3T A;  1KLV A;  3ZNZ B;  2M0X A;  3EFU A;  4M0W B;  3SDL C;  3PSE B;  3RUI B;  4HWI B;  4GDK B;  2JWZ A;  2O2V A;  1GG3 A;  4GSW A;  5CHF A;  1E8W A;  4DHZ E;  2AEH A;  4AJW A;  4EZJ A;  2KFK B;  2CKH B;  4ANX A;  1JRU A;  1V5T A;  3PHW B;  4TKN A;  1UZX B;  3DBS A;  2AL6 A;  1WGY A;  1WGG A;  4PYZ A;  5G2N A;  2L76 A;  3UIO B;  2O6V B;  4FN2 A;  4LJO B;  4BFR A;  2CS4 A;  2KX0 A;  2ZPN A;  2R2Q A;  4CO7 A;  2IO2 B;  3KUC B;  3KVF B;  3VHT C;  2N1W A;  3UIP B;  2A4Z A;  2JVC A;  3L0W B;  3ZNG C;  3ZVV A;  1WR1 A;  2KO3 A;  2MA9 B;  1BT0 A;  4DHJ D;  4BKS A;  3L54 A;  2M4N A;  3K9O B;  4W9H A;  3IFW B;  4FA6 A;  4IWQ A;  2KD0 A;  3R3M A;  1J8C A;  2NPT B;  3AI5 A;  2N9X A;  5L83 A;  4BVU C;  3OLM D;  4BBN C;  3QAQ A;  3RUL A;  4WJO A;  1YIW A;  2IYD B;  1WYW B;  2Z0D B;  1UH6 A;  4GDL B;  4MDK E;  2C7H A;  2KAN A;  2KX3 A;  1V81 A;  2PEA A;  2KHW B;  4OVU A;  5D7G A;  4I6N B;  1U4A A;  1EF5 A;  3OJ4 B;  5IAA C;  4A3O A;  2EKE C;  1S1Q B;  3ZO5 B;  2WWZ A;  2DAF A;  1E8X A;  1YQB A;  4K7W A;  3QJZ A;  4PS3 A;  3WA0 A;  2J0J A;  3M63 B;  4FHK A;  2MX2 A;  3V62 A;  4HPM B;  1WY8 A;  2KQ7 A;  2N4F A;  3L17 A;  1M94 A;  4NQL B;  4KSK C;  1GNU A;  4IG7 B;  2KNB A;  4MGZ E;  3VTW A;  3PRE A;  4TQ0 A;  2KC2 A;  3SHQ A;  1Z2M A;  3ZTD A;  2HD5 B;  2ZJD A;  4G3X B;  3NS8 A;  4DXA B;  2GBM A;  1WXM A;  4F8C B;  1WX8 A;  4HCP B;  1L2N A;  3IVF A;  1E8Z A;  4DHZ B;  1S3S G;  2D3G A;  2J0K A;  1Y8R C;  3A4S C;  3R7Q A;  4E74 A;  3GOE A;  1EO6 A;  2NS5 A;  3JSV A;  1V2Y A;  2DEN B;  1E90 A;  1H4R A;  2BPS A;  3BY4 B;  3H7S A;  4BKS D;  3HM3 A;  4JL9 A;  4XX5 A;  4AOF A;  2KDI A;  4NY0 A;  2LAS A;  2LXC A;  3PT2 B;  4A3P A;  1Q0W B;  2KJ6 A;  2ZEQ A;  2DX5 B;  3NY5 A;  4M8N A;  3A33 B;  4DHJ B;  1V86 A;  3A9J B;  1WXS A;  4NAW B;  2L3Z A;  1TBE A;  1RFA A;  1LQB A;  2KC1 A;  3NHE B;  1E8Y A;  3PVL A;  5D2M B;  3QHT A;  1WM3 A;  3O65 B;  2V1Y A;  2L00 B;  1KOT A;  4N9F 4;  3H7P B;  1WGR A;  1HE8 A;  4IM0 A;  1WE7 A;  2D11 A;  2XK5 A;  1GC7 A;  1OEY A;  1TTN A;  1WGH A;  3DBL I;  2RPQ A;  3LDZ E;  4GMV A;  4JGH B;  3UGB B;  3ZLZ A;  2LJ5 A;  3A9K B;  3PRM B;  4ZRI A;  2KWV B;  4ZRJ A;  3OAW A;  4J6I A;  4W9I A;  3TJP A;  1OGW A;  2G3Q B;  1P1A A;  2DYO A;  3M62 B;  4FUL A;  5FR6 A;  4RM8 A;  4AP4 C;  1XD3 B;  3ZNI D;  2C7N B;  4GB9 A;  4KDI C;  3BIN A;  4AWJ A;  4HCN B;  4IM2 A;  4WJP A;  2Z59 B;  4EOY A;  5DPW A;  3QWZ B;  1VD2 A;  2IY0 B;  2CR5 A;  3MHS D;  2EMS A;  5J2R A;  2JPH A;  2O2V B;  4MGI E;  1WFY A;  3NZU A;  3APD A;  3DBR I;  1R4N I;  3S2A A;  3A4R A;  4W9F A;  2L7R A;  4HDQ A;  3W1S C;  4DK5 A;  2FID A;  3Q3F A;  4MH0 E;  2BYF A;  2FCN A;  4HLE A;  2K8B A;  3A1Q A;  3PGE A;  5CHV C;  2PPH A;  4ANW A;  3EEC A;  3DQV A;  2LD9 A;  3EHV A;  4G0N B;  2ZVN A;  4TQ1 A;  4HXD A;  4W9E A;  2C9W B;  5E6N A;  4F7Z A;  3ML8 A;  4W9G A;  4W9K A;  1MG8 A;  1RRB A;  2KXJ A;  4G11 A;  4FBJ B;  3PRP B;  1ZGU B;  2OOB B;  2QHO A;  4EZK A;  1E7V A;  2LRW A;  3AU4 A;  3RYT A;  1OEY J;  2N1V A;  2LGX A;  2IO1 B;  1WX7 A;  2AYO B;  2BYV E;  1ZW7 A;  5AZH A;  1X1M A;  5E6O A;  2MWS B;  4IW0 A;  4GGQ A;  1WXA A;  4WJN A;  3X23 A;  2KTF A;  1V49 A;  3PTF C;  1RLF A;  5C23 A;  2KDF B;  3ZTC A;  2REX A;  2N9P C;  2Y5B B;  4TV3 A;  2JXX A;  3ONS A;  3VTV A;  1V6E A;  1WMH A;  5CTR C;  3ZRF A;  2KDE B;  1I42 A;  2DZJ A;  3VQI A;  3QA8 A;  1H8C A;  2KMC A;  2GBR A;  3TIX A;  3PLU A;  1V9J A;  2AWT A;  3WAP A;  1CMX B;  4LDT B;  2GOW A;  5L95 C;  1GC6 A;  3ZIM A;  2V4L A;  1WE6 A;  1WJ4 A;  2MCN B;  2WYQ A;  4IUM B;  1AAR A;  3RZW C;  2G4S A;  2WDT B;  4KZC A;  4B9K A;  5EDS A;  2PJH A;  3VVW B;  2JF5 A;  4XC2 A;  3JVZ X;  4EFO A;  1WIA A;  1P0R A;  3V6E B;  1ZKH A;  4KV2 A;  4XZ4 A;  3DDC B;  5J17 A;  1WJ6 A;  4W9C A;  2GBJ A;  2FAZ A;  4II2 B;  4ICV A;  5AZG A;  2MBB B;  4URK A;  3U8Z A;  3H9D A;  4MM3 A;  3UIN B;  3JSV B;  1F9J A;  1LFD A;  4MGY E;  2XEW A;  4FAD A;  1C1Y B;  3VUX A;  3QCA A;  4NJ6 A;  4IC7 B;  2JZ3 B;  1UD7 A;  4KSL C;  1NI2 A;  1K8R B;  3HM6 X;  4BBN F;  2FUH B;  4ASW C;  4TUU A;  3CMM B;  1Q5W B;  3N30 A;  2DYM A;  2ZVO A;  3VDZ A;  3UQB A;  2ZPY A;  5LXH A;  2HE7 A;  1J19 A;  3CF6 E;  4MEL A;  4GIV A;  3QC8 B;  5JZE B;  2L0T A;  3R66 C;  3QIJ A;  3Q3J A;  3T8M A;  3DVN U;  3H1U A;  2D10 A;  5G55 A;  2B3A A;  1WX9 A;  5LXI B;  5KHO A;  5KHQ A;  3WAL A;  1G6J A;  2XBB C;  1E7U A;  3KYC D;  3ZDT A;  1E5W A;  1WH3 A;  1WF9 A;  4KIK B;  2GMI C;  3APF A;  4NJ7 A;  3L16 A;  2CU1 A;  4HVB A;  3ZKJ C;  2J7Q B;  2JUO A;  2MBH A;  2LZ6 A;  2HTH A;  2KFJ A;  1IPG A;  2K39 A;  4GN1 A;  4MSQ B;  4WAA A;  4YL8 A;  2LVQ A;  4WWO A;  4BOS C;  3UQA A;  2KZR A;  3NZS A;  5D94 A;  3ZDM C;  3A1Q B;  4GDL A;  3D32 A;  3HHM A;  4ICU A;  4P7I A;  1SGH A;  4CHK A;  4W9D A;  3TL5 A;  4MGK E;  1GJZ A;  4FJZ A;  2KTR A;  2IO0 B;  1GUA B;  4II3 B;  3PV1 A;  2FNJ B;  1NDD A;  4AUQ C;  3M3J A;  5DPS A;  1UBQ A;  2NCN A;  4PS8 A;  1OTR B;  1UEL A;  1Z5S B;  2BF8 B;  4B6W A;  2KK8 A;  3MJW A;  1RAX A;  2CHX A;  2LVP A;  2N7E A;  3ZRC A;  3SU8 X;  4BKT A;  4ZDV A;  2IZV B;  5HKH A;  2L8J A;  4HDO A;  4FJV B;  3W1Y A;  2I1K A;  2BYE A;  3HK0 A;  2FCM A;  3PHX B;  4A20 A;  4GOC A;  5IA7 A;  3QQ8 B;  2M17 A;  3T9L A;  1WR6 E;  1SE9 A;  2A5U A;  3AXC A;  2V3S A;  3KW5 B;  3IHP C;  3PRZ A;  2CHZ A;  5AEK B;  2RR9 A;  4E3C A;  4EZL A;  1WMH B;  2KWU B;  3JW0 X;  2KMA A;  1IP9 A;  3I3T B;  3B0A A;  2MQJ A;  4KDL B;  3WAO A;  3V60 A;  2WX1 A;  2LXA A;  4BKG A;  4K1R B;  2NBU A;  2MRP A;  1YJ1 A;  1LM8 B;  4GU2 A;  4NPN A;  4K81 A;  2N9E B;  5BO4 B;  2NBW B;  4BOZ B;  4F1S A;  4I6L B;  2BKR B;  3A9J A;  3DVG X;  1OQY A;  5LLI A;  4FHJ A;  4DDG D;  3SD5 A;  4OVV A;  3RT3 B;  2K1F A; 
#chains in the Genus database with same CATH topology
 5EE9 A;  2RGF A;  3UF8 A;  3VH3 B;  1FNU A;  1ZE3 D;  5DCN A;  4MJS A;  4BAX A;  1WZ0 A;  2WXK A;  4LNN A;  2QDF A;  1XQQ A;  2ZZP B;  2BW2 A;  1PQS A;  2CJN A;  2RDG A;  2KJH B;  1K52 A;  1R4M I;  2LVO A;  2G9H D;  4I6P A;  3BK2 A;  1SBB B;  4USA A;  1E9M A;  3AMZ A;  2VZK B;  4RGO S;  2JX5 A;  2HJ1 A;  4US9 A;  2YLM A;  2MBQ A;  2J0M A;  2XN9 C;  2K22 A;  3DVN V;  4WWP A;  2NVU I;  1F2R C;  1VZ6 A;  3VAW A;  2EKI A;  4ZYN A;  3PZD A;  2DHZ A;  2KLC A;  4X57 B;  2G1E A;  2KFK A;  2FCQ A;  5D3D A;  1I35 A;  4FJY A;  4LLG M;  2V4I B;  1T0R C;  5JXV A;  3HIZ A;  3RFZ B;  1FXT B;  5LNK 1;  2MHJ A;  3PLV A;  2L1A A;  2OJR A;  1I4Q A;  3GB1 A;  2MBE A;  3EGR A;  4UDU C;  2KJR A;  1KJT A;  3CSF A;  2X8X X;  4EKU A;  2KQS A;  3FIL B;  4OZC A;  2BS4 B;  1E0Z A;  1E6E B;  2JRH A;  2W3R A;  4RH6 A;  4W9L A;  3ALB A;  3APC A;  2ZNV C;  2DBY A;  2K6Q A;  2IY1 B;  2I2Y A;  3FAH A;  1AW7 A;  3DBR B;  2KKC A;  4K7S A;  5T8I A;  1YOV B;  4N58 A;  1J7C A;  1KM7 A;  4HPL B;  5CHW A;  1P9D U;  4P1B C;  2RSU A;  5C3J B;  2PIA A;  3I63 C;  2N0S B;  1A5R A;  1L6U A;  2JRI B;  1OFF A;  5AZF A;  5HI1 A;  4KIK A;  1KRH A;  4ANV A;  2LGD A;  1L7Y A;  3Q3M C;  4D2K A;  4LNK A;  3ZJT A;  3NVW A;  1YD8 U;  2DZI A;  3NUH B;  4JQW C;  1UBI A;  5JHB A;  5GMV A;  2Y3A A;  3A9K A;  3MHZ A;  3DBH I;  2JWU A;  4GDK B;  4NAM A;  4AJW A;  4ANX A;  3DHG C;  1DOI A;  2AL6 A;  2GRI A;  1D4B A;  2CS4 A;  2ZPN A;  4CO7 A;  2JVC A;  2QC8 A;  3L0W B;  2KO3 A;  4YXD B;  1FMA D;  3RN9 C;  1Q10 A;  1J8C A;  2NPT B;  3AI5 A;  5IO9 A;  4RGN A;  3TSS A;  1DOX A;  2WXL A;  3ZGZ A;  4C56 C;  4YTM B;  1YIW A;  2IJ0 A;  2C7H A;  2PEA A;  2QSD A;  4I6N B;  3OJ4 B;  3ZO5 B;  1E8X A;  1C78 A;  2WS3 B;  3R2I A;  3V62 A;  4HPM B;  1WY8 A;  2N4F A;  1N63 A;  2JSV X;  4IG7 B;  1F1H A;  3PRE A;  2KC2 A;  3ZTD A;  3OWE B;  3V05 A;  1WXM A;  1WX8 A;  1SIJ A;  2D3G A;  4E74 A;  1EO6 A;  3MC8 A;  2NS5 A;  3MC9 A;  2IGG A;  4XX5 A;  3BYT B;  4HRS A;  1L0V B;  2KDI A;  3IT6 B;  4XDD A;  3N1X C;  1Q0W B;  4REZ A;  2DX5 B;  1KLG D;  1QOF A;  3A9J B;  1WXS A;  1C76 A;  1TBE A;  1RFA A;  3NHE B;  3T3N A;  3O65 B;  1KOT A;  1VDV A;  2K5P A;  1GC7 A;  2WP9 B;  4JGH B;  4BBN F;  3NS1 A;  4HRO A;  1JWB D;  4FUL A;  4AP4 C;  4GB9 A;  5BMH A;  4IM2 A;  4EE2 A;  2QMT A;  5H8Y E;  2WDV B;  2BB5 A;  2O2V B;  2MH7 A;  2WXN A;  3NZU A;  4MGI E;  3DBR I;  2BS2 B;  3A4R A;  2VH2 A;  2AX5 A;  1NI3 A;  3PZ8 A;  4A90 A;  2VZK D;  3FIL A;  4DK5 A;  2FID A;  4MH0 E;  1GOZ A;  3PGE A;  1AN8 A;  4TSS A;  2KVZ A;  4G0N B;  4TQ1 A;  4FBJ B;  4G11 A;  1P7E A;  2V3N A;  4WQM A;  2N1V A;  5E6O A;  1NEK B;  2MWS B;  4WAF A;  1V49 A;  3PTF C;  4TV3 A;  2KDE B;  2J42 A;  1I42 A;  3VQI A;  3QA8 A;  1GC6 A;  3ZIM A;  4KGT A;  4B0M A;  2JF5 A;  1WIA A;  1P0R A;  1GAQ B;  2RDB C;  1ZDV A;  1F2R I;  1WJ6 A;  2GBJ A;  2FAZ A;  1TKY A;  2IPK D;  5AZG A;  2MBB B;  4URK A;  4MM3 A;  1I4H A;  3VUX A;  2WXR A;  4IC7 B;  4QAY A;  1L4D B;  1NI2 A;  5AUI A;  3HM6 X;  4TUU A;  3I9V 1;  1EWC A;  3UQB A;  1HA5 A;  2HE7 A;  2HTM E;  3Q69 A;  2K0P A;  3R66 C;  4KKJ A;  3QIJ A;  3H1U A;  4DQO C;  5KHQ A;  4CQN A;  1E5W A;  1N5X A;  4M02 A;  5EE1 A;  1T6B X;  4WAA A;  4BOS C;  3UQA A;  2CU3 A;  2W55 A;  4JE3 B;  4K3B A;  4O1N A;  5G5G A;  1NYR A;  1GJZ A;  2AQ2 B;  2IO0 B;  3M3J A;  2NCN A;  1D6E C;  1OTR B;  1T3Q A;  1F52 A;  1Z5S B;  5HG2 A;  2M19 A;  1K53 A;  2Y5P A;  2N7E A;  4KGR A;  3SU8 X;  2IZV B;  2L8J A;  1C77 A;  2FCM A;  3AE2 B;  2L32 A;  5AEK B;  3GE8 C;  4E3C A;  4EZL A;  1IP9 A;  4N6E B;  3I3T B;  2HDE A;  4P16 A;  3WAO A;  3V60 A;  1KF6 B;  2MRP A;  1FNW A;  3A9J A;  3DVG X;  5LLI A;  3SD5 A;  3RT3 B;  2D5G A;  2C7M B;  3KUZ A;  1PUT A;  2I1J A;  1RFK A;  4WJQ A;  2NBV B;  2KAC A;  4ZOH C;  4LJP B;  1SJE D;  4DXF A;  3P42 A;  3SEB A;  3RD2 A;  3QK0 A;  3Q3N C;  2DZK A;  2WU2 B;  3MTN B;  2WXP A;  4HEA 1;  1V1O A;  1WRD B;  3VFK A;  2IBI B;  4JLC A;  4EUT A;  3IBE A;  1JWM D;  1MG4 A;  2D2Q A;  1DOY A;  1FIQ A;  2KVR A;  5BYR A;  1YQ3 B;  4PYU A;  3WAN A;  3AE9 B;  2DYB A;  1V80 A;  1UGM A;  2C5L C;  3LJ3 A;  3ZNH B;  1LO5 D;  2BWE S;  2KWC A;  1FM0 D;  1N6Z A;  4E71 A;  2HJ8 A;  2JZZ A;  2XK5 B;  2VRR B;  2KTR B;  2W9N A;  4KVG B;  4WWN A;  4WH4 A;  3V61 A;  5CX3 A;  4XE0 A;  2OHF A;  1ET9 A;  3W2D A;  3VUW A;  5BMI A;  1WM2 A;  3MFG A;  3CST A;  3AEB B;  5DPT A;  2WHI A;  1FRD A;  4FXC A;  2KLG A;  3KUD B;  4G50 A;  3GP7 A;  2KMM A;  2FE8 A;  2N7D A;  3U4E G;  1ESF A;  2K8C A;  4IM3 A;  1IBX A;  3ML9 A;  1Y56 A;  4IWP A;  1TY2 A;  2BBC A;  5H92 C;  4CYE A;  2KOX A;  3RMK C;  1ZXI A;  1UWX A;  3AU5 A;  3R2T A;  2C60 A;  3U7D A;  1UNS A;  3OJ3 A;  5JH5 C;  3U30 A;  4H2A A;  1TIF A;  2GB1 A;  2WQY B;  3N32 A;  2MP2 B;  1V5O A;  2JU6 X;  3C0R B;  3Q8C A;  2EEL A;  4LNI A;  3QAR A;  1FCC C;  3C8Y A;  5C1Z A;  4NAW A;  3PPA A;  1ENF A;  4RGT A;  4ARC A;  1VCB A;  1OQQ A;  1HEZ E;  3H7P A;  3TBL D;  3DVG Y;  2Z0E B;  2FCS A;  1WJU A;  4PK1 A;  2KN5 A;  3P2B A;  1C3T A;  1KLV A;  2YEP B;  4M0W B;  1P7F A;  4JWS C;  4DXG A;  1SE4 A;  5IOI A;  1PYW D;  4DHZ E;  1WGY A;  5G2N A;  3UIO B;  2O6V B;  4BFR A;  2R2Q A;  3KUC B;  3KVF B;  2A4Z A;  3ZNG C;  4XYC A;  4GLS C;  1WR1 A;  2MA9 B;  1WXQ A;  1BT0 A;  2IND C;  3RNE C;  2KQ4 X;  3K9O B;  3IFW B;  3FKY A;  2KD0 A;  5L83 A;  1TS3 A;  4TMA B;  4GDL B;  4OVU A;  5D7G A;  3ZJU A;  1S1Q B;  2WWZ A;  4PS3 A;  4HPP A;  5FR3 A;  4FHK A;  2MX2 A;  1TZO A;  5BYQ A;  2GLS A;  1M94 A;  3Q8B A;  1MFW A;  4NQL B;  4KSK C;  4MGZ E;  2INP E;  3EA6 A;  1RWS A;  3VTW A;  3SHQ A;  4DXA B;  3NS8 A;  4HCP B;  1E8Z A;  1S3S G;  2J0K A;  1Y8R C;  4WWM A;  1YN3 A;  2TSS A;  3ETR A;  2DEN B;  1H4R A;  1EM7 A;  3HM3 A;  4JL9 A;  1N60 A;  3TEZ A;  2LAS A;  3PT2 B;  1GB1 A;  5C2T B;  4A3P A;  2KJ6 A;  1ET6 A;  2ZEQ A;  4DHJ B;  1V86 A;  2L3Z A;  4A8X C;  1LQB A;  1J7B A;  1WM3 A;  4IM0 A;  1WGR A;  1HE8 A;  2V9H A;  4GMV A;  2XK5 A;  1OEY A;  1JQ4 A;  2JYT A;  2RPQ A;  3DBL I;  3RPF C;  4ZYS A;  4ZRJ A;  1OGW A;  1OQR A;  1P1A A;  1L4Z B;  2DYO A;  3SFD B;  5FR6 A;  4RM8 A;  4LK0 M;  1XD3 B;  1JAL A;  4AWJ A;  5G5H A;  3QWZ B;  2CR5 A;  1V1P B;  4L1B A;  1VRA B;  2L52 A;  2L7R A;  1HTO A;  2BYF A;  5CHV C;  3AB5 A;  1YJJ A;  4ANW A;  3EEC A;  4PT5 A;  1XO3 A;  1V8C A;  4YSX B;  5E6N A;  4WUR A;  3V3X A;  4W9K A;  1RRB A;  2KXJ A;  3BVZ A;  3PRP B;  2OOB B;  5EE0 A;  2XNA C;  2QHO A;  1E7V A;  1OEY J;  2LGX A;  2IO1 B;  1WX7 A;  1ZW7 A;  5AZH A;  4IW0 A;  4JPS A;  1C79 A;  4WJN A;  1PFD A;  1DYQ A;  1RLF A;  2N9P C;  2JXX A;  1QF6 A;  3NVY A;  1V6E A;  3ZRF A;  4NJC A;  1H8C A;  3URY A;  3ZJV A;  1V9J A;  1CMX B;  1VR9 A;  1ZDX A;  2V4L A;  2MCN B;  4A6Q A;  3AE7 B;  4B9K A;  5EDS A;  3JVZ X;  2N9L A;  4KV2 A;  5J17 A;  3DDC B;  4W9C A;  4MAC A;  3U8Z A;  1L0X B;  3JSV B;  1RYJ A;  4OHJ A;  3QCA A;  5FKA C;  2IDY A;  4OZB A;  3BK1 A;  1M4V A;  1FFU A;  3Q3O C;  3N30 A;  1L6V A;  2DYM A;  2ZVO A;  3VDZ A;  2ZPY A;  4S0R A;  1SEB D;  3PO0 A;  3RNA C;  1SE2 A;  4IKG A;  2ONQ A;  5G55 A;  1G6J A;  4YTN B;  3AEA B;  1E7U A;  3ZDT A;  2NMQ A;  1FXI A;  4RFB A;  3L16 A;  2RDH A;  5IP4 D;  2CU1 A;  2IGH A;  2K39 A;  2UU7 A;  4GN1 A;  4YL8 A;  2LVQ A;  4WWO A;  2WGS A;  5D94 A;  2QEJ C;  3A1Q B;  3CIR B;  4GDL A;  1AYF A;  1SGH A;  5BYS A;  3LYY A;  2K9X A;  4II3 B;  3HVZ A;  3PV1 A;  4AUQ C;  1UBQ A;  4KX6 B;  2D3A A;  2ACZ B;  3TUO A;  1SE3 A;  3MJW A;  1RAX A;  2LVP A;  4ZDV A;  1XLP A;  1I4P A;  4HDO A;  4FJV B;  1VZ8 A;  2OED A;  3PHX B;  1UWM A;  4N59 A;  2A5U A;  2MJ3 A;  3PRZ A;  2WXG A;  1TKE A;  1BXT A;  1WMH B;  2KWU B;  3JW0 X;  1VJK A;  2LGS A;  3PZ7 A;  2WXO A;  2NBU A;  1UGJ A;  4NPN A;  3B2G A;  2LHE A;  4F1S A;  4M01 A;  1V97 A;  5MPO A;  2N7J A;  4B6W A;  4OVV A;  3L4P A;  4EZK A;  3AE5 B;  3M95 A;  4NQK E;  3EC8 A;  1Q1O A;  2ZW0 A;  3ZXR A;  2WXQ A;  4DBG A;  1WWT A;  3VTU A;  1E7P B;  2GI9 A;  2BYT A;  2G45 B;  1TGZ B;  2L0F A;  3OG5 A;  1I4X A;  4EEW A;  2INC C;  2OJW A;  1AWD A;  3K9P B;  2GBN A;  1T0Q C;  2LI5 A;  4RM9 A;  3H6N A;  4XGA B;  2MLB A;  2PTL A;  2MJE A;  2ZW1 A;  1T0Y A;  2WXF A;  3TMP B;  1ROE A;  3DOW A;  3VH4 B;  4NNJ B;  4C4V B;  1ACC A;  2LRU A;  3AUL A;  4GDK A;  4DDI D;  4DWF A;  1I7H A;  2Z8L A;  1ZOY B;  1PGB A;  2K8H A;  4JIO U;  5TR5 A;  4MT5 A;  2LWP A;  2VH1 A;  4HKQ A;  2LUE A;  1K50 A;  1QZE A;  3DHH C;  1FEH A;  4KKI A;  3QX1 A;  3R7R A;  1YNT E;  3L08 A;  2PVO D;  1TKG A;  1MI0 A;  2NPT A;  1ZXH A;  3AH7 A;  3DPD A;  1WZ3 A;  3ZUN A;  1N61 A;  1FXA A;  1F0Z A;  1LXD A;  1CQV A;  4L23 A;  4AJY B;  1J0G A;  3BVM A;  4B0E A;  4HK2 A;  3IXS A;  3AV8 A;  2D07 B;  3RNG C;  3N3K B;  1BML C;  4RNA A;  1D3Z A;  2LGI A;  2KN4 A;  2FUG 1;  4MJS B;  1QOA A;  1D5X C;  5I4D A;  1IGD A;  3N1Y C;  2M1M A;  2AQ1 B;  1EWY C;  1YX6 B;  3KH0 A;  2AQ3 B;  3AE1 B;  4OW0 A;  1WJN A;  2WXI A;  5JHA A;  3L13 A;  4RMA A;  4XDC A;  3KWL A;  2PW9 A;  2WDR B;  4RCO A;  3PS6 A;  1XT9 B;  2M0X A;  1N62 A;  2L83 A;  3EFU A;  3RUI B;  4XWT A;  3EFC A;  2JWZ A;  2O2V A;  3DHI C;  5CHF A;  4EZJ A;  2KFK B;  2PKO A;  1SXT A;  3PHW B;  4TKN A;  1UZX B;  1WGG A;  1NVI D;  3AN1 A;  1MJD A;  2KDM A;  2X38 A;  2KX0 A;  1STE A;  2IO2 B;  3NVZ A;  5FK9 C;  2N1W A;  3UIP B;  2WXM A;  4ZHO A;  4BKS A;  3L54 A;  2M4N A;  4FA6 A;  3W5U B;  2V0G A;  1TS4 A;  3QAQ A;  3CWI A;  4ACF A;  2IYD B;  2KAN A;  1V81 A;  1U4A A;  1EF5 A;  4A3O A;  4IOI E;  5E6J A;  1WSP A;  2DAF A;  3WA0 A;  3M63 B;  2KQ7 A;  3L17 A;  1VZ7 A;  1GNU A;  3B9J A;  1Z2M A;  2ZJD A;  4F8C B;  1XLQ A;  1L2N A;  4ITK A;  3A4S C;  3R7Q A;  3RI7 C;  3GOE A;  2WNM A;  1WYG A;  1B1Z A;  1V2Y A;  2BPS A;  3H7S A;  4LTU A;  4BKS D;  4RF0 A;  3P4R B;  2NTT A;  4AOF A;  1EU3 A;  4NY0 A;  3B2F A;  1UUP A;  4C4V A;  3NY5 A;  3HUI A;  4M8N A;  3AEF B;  3A33 B;  3IT4 B;  2Y5C A;  1TS2 A;  2KC1 A;  5D2M B;  3PVL A;  3QHT A;  2NTS A;  2V1Y A;  2D11 A;  1TTN A;  5IKC M;  2LJ5 A;  3A9K B;  2KWV B;  5EE3 A;  4J6I A;  4W9I A;  4YWG G;  3Q8F A;  2G3Q B;  2KWD A;  4KDI C;  2MEK A;  2SEB D;  4WJP A;  4A55 A;  2Z59 B;  3IAS 1;  1VD2 A;  1C4A A;  2WXJ A;  3MHS D;  5J2R A;  1MVK A;  2JXT A;  1WFY A;  1L0Y B;  3S2A A;  2LMC A;  4W9F A;  4HDQ A;  3W1S C;  2LFI A;  3Q3F A;  3N20 C;  3VRB B;  5HHD G;  3DBH B;  3DQV A;  3W5V B;  4HXD A;  1D5M C;  1FNV A;  4W9G A;  3Q14 C;  1JWS D;  1ZGU B;  5TSS A;  4JX1 C;  4YSY B;  3RYT A;  1FO4 A;  1HQR D;  2AYO B;  1MHH E;  1X1M A;  1JW9 D;  2KAJ A;  4GGQ A;  3MJ5 A;  1XXG A;  2KTF A;  1QLB B;  4ZRP A;  2M56 B;  2Y5B B;  1XF5 L;  4P6V F;  4YSZ B;  3U52 E;  3MP9 A;  2GBR A;  3MC0 B;  3TIX A;  3PLU A;  2AWT A;  1SSN A;  1TY0 A;  3WAP A;  4LDT B;  1YMH E;  3AEG B;  1WE6 A;  1WJ4 A;  2WYQ A;  4IUM B;  3P4S B;  4KZC A;  2WDT B;  1YN4 A;  2PJH A;  3VVW B;  2BQQ A;  3V6E B;  4Q2J A;  1ZKH A;  1TYG B;  4XZ4 A;  4II2 B;  4ICV A;  3UIN B;  4NZL B;  1F9J A;  4MGY E;  4FAD A;  3GZN B;  1XEE A;  1TJE A;  5BMG A;  4NJ6 A;  2JZ3 B;  1UD7 A;  4US8 A;  5IN7 A;  4ASW C;  4HKZ E;  3CMM B;  3WCQ A;  5LXH A;  1J19 A;  2LJI A;  1JCK B;  2L0T A;  3Q3J A;  1SJH D;  2CJO A;  2D10 A;  2QJL A;  3WAL A;  1GB4 A;  2XBB C;  1WH3 A;  1JML A;  5HFY A;  4NJ7 A;  3VRA B;  4HVB A;  4C7Y A;  2MBH A;  2HTH A;  1IPG A;  2KZR A;  3H8H A;  2I38 A;  3SFE B;  3HVD A;  4P7I A;  3U2S C;  4W9D A;  2DNF A;  3TL5 A;  4MGK E;  2KTR A;  1GUA B;  2FNJ B;  5DPS A;  2B76 B;  4PS8 A;  1UEL A;  2BF8 B;  3UI3 A;  2LUM A;  2KK8 A;  3ZRC A;  4BKT A;  3W1Y A;  2I1K A;  4ZHP A;  2BYE A;  1JWA D;  3AEC B;  4A20 A;  3P4Q B;  4GOC A;  3QQ8 B;  5IA7 A;  3T9L A;  1WR6 E;  1SE9 A;  4K3C A;  3AXC A;  2V3S A;  4OZA A;  1SF0 A;  2CHZ A;  2RR9 A;  2WXH A;  3GE3 C;  3AEE B;  3Q8E A;  2MQJ A;  3RNC C;  2WX1 A;  1KTK A;  1YJ1 A;  1A70 A;  1LM8 B;  4GU2 A;  2N9E B;  5BO4 B;  3W9C B;  2NBW B;  1QKZ A;  4BOZ B;  4I6L B;  2BKR B;  3NRZ A;  3BWU D;  2RMM A;  1OQY A;  4DDG D;  3AE6 B;  3VTV A;  2QCZ A;  4W9J A;  2WX0 A;  3P4P B;  1BUI C;  1J7A A;  2YVC A;  4WQO B;  1WXV A;  2MP2 A;  4MM3 B;  1FRR A;  1NBF C;  4P1C C;  3ZW3 A;  4RGM A;  3NJT A;  4M00 A;  3DWG C;  1EUV B;  2H89 B;  2PE9 A;  2NR2 A;  2PVG C;  2PE6 B;  3B1L X;  4PS7 A;  4C7Z A;  1XCQ L;  1YX5 B;  4M8M A;  2R2O A;  4C80 A;  2MBO A;  1MPE A;  2K3U A;  2JY6 A;  3ENE A;  1XLN A;  1P98 A;  2IO3 B;  4IWO A;  3B08 A;  3ECI A;  4WIP A;  2K25 A;  2RD0 A;  1P3Q U;  2L05 A;  4M0W A;  2DLB A;  3NOB A;  5DPR A;  3HRD D;  3WIM A;  2E3T A;  2IGD A;  2E6X A;  2LGY A;  5J18 A;  1SIF A;  2G4D B;  4ARI A;  4FLH A;  3RZF A;  1QOG A;  3Q2A C;  1WGD A;  2UYZ B;  2O6V A;  2BGF A;  2Q5W D;  1TT5 B;  4YT0 B;  1FPY A;  3JYU A;  4LNO A;  3WAM A;  3DWM A;  3GZN I;  4AS1 A;  4B95 A;  1I4G A;  2DZM A;  4HJK A;  4JWU C;  3TCA A;  3V6C B;  1UF0 A;  3X0W A;  2ZNV B;  1EF1 A;  2MSE D;  2BKF A;  2FIF A;  3R8B A;  4GXB A;  4K7U A;  3RCZ A;  2R61 A;  3DCG A;  3AE8 B;  1IUE A;  1TZ1 A;  1FCL A;  2EMT A;  4MSM B;  2BS3 B;  3VXW A;  2MJD A;  4MEM A;  1JRO A;  2SAK A;  3VUY A;  1R4N B;  2DAJ A;  2ZCB A;  1IYF A;  4KGS A;  2O6V D;  2CHW A;  2ZCC A;  4LCD E;  2D3C A;  2JT4 B;  1ISN A;  5E6P A;  1E10 A;  1CK1 A;  3AE4 B;  2GBK A;  2FBW B;  1HXY D;  3AE3 B;  4LDT D;  3LXF A;  2BT6 A;  3BII D;  2AL3 A;  2UWQ A;  3TEW A;  1ZP0 B;  3KYD D;  1F77 A;  1K51 A;  3IG3 A;  2QIE B;  4ZRK A;  3SR6 A;  4ANU A;  2MW5 A;  2BWF A;  1WI0 A;  4KZ0 A;  2KDB A;  2K6D B;  3L10 B;  5D6J B;  3U7Z A;  3EUB 2;  2M8S A;  3W1S A;  3N9Y C;  2LHD A;  3RNB C;  4HJG E;  2ASQ A;  1R7S A;  2PLP A;  3ZNZ B;  1HZ5 A;  1ZUD 2;  2J52 A;  4J3O D;  5AUK A;  3SDL C;  3PSE B;  4HWI B;  3AM9 A;  1V1P A;  4GSW A;  1GG3 A;  1E8W A;  2AEH A;  3E56 A;  2CKH B;  1JRU A;  1V5T A;  4PYZ A;  3DBS A;  2L76 A;  4LJO B;  4FN2 A;  2N9K A;  2PMV A;  3NZ3 A;  4LNF A;  3VHT C;  3ZVV A;  2J4X A;  1PGA A;  4DHJ D;  1GPX A;  2D3B A;  2JZP A;  4W9H A;  2BB6 A;  1C4P A;  4IWQ A;  3R3M A;  4RF1 A;  2N9X A;  4BVU C;  3OLM D;  4BBN C;  2WU5 B;  3RUL A;  4WJO A;  1WYW B;  2Z0D B;  1UH6 A;  4MDK E;  2KX3 A;  2KHW B;  3J9C A;  5IAA C;  2JYE A;  2EKE C;  1FFV A;  4A9A A;  3VR8 B;  1YQB A;  4K7W A;  1CJE A;  3QJZ A;  2J0J A;  1IBX B;  3TEX A;  2DWQ A;  2KNB A;  2W54 A;  4TQ0 A;  2HD5 B;  4BZA A;  4G3X B;  2GBM A;  3IVF A;  3LB8 C;  4MH8 A;  4DHZ B;  2V3P A;  4IDI A;  1ZPS A;  3JSV A;  1E90 A;  3ZXV A;  3BY4 B;  3Q6B A;  1C4C A;  2YEP F;  1MHX A;  1LGR A;  2LXC A;  1XLO A;  4AQ7 A;  1PGX A;  4NAW B;  3GS2 A;  2BTE A;  1E8Y A;  4R3D A;  2L00 B;  4N9F 4;  3H7P B;  1WE7 A;  3LDZ E;  3KQ4 A;  3UGB B;  1WGH A;  3ZLZ A;  3PRM B;  4ZRI A;  1TS5 A;  3OAW A;  1JWU D;  3TJP A;  3P1M A;  3M62 B;  3ZNI D;  2C7N B;  3BIN A;  1CZP A;  4HCN B;  4EOY A;  5DPW A;  1FD6 A;  2IY0 B;  2J53 A;  1JRP A;  2BVC A;  2EMS A;  3VR9 B;  2JPH A;  4S17 A;  3APD A;  1R4N I;  1QT9 A;  4L2Y A;  1IGC A;  2FCN A;  4HLE A;  2K8B A;  3A1Q A;  2PPH A;  5GXG B;  3IAM 1;  2LD9 A;  3EHV A;  1YQ4 B;  3N1Z C;  2ZVN A;  1C9F A;  2ICI A;  4W9E A;  2C9W B;  4F7Z A;  3ML8 A;  1MG8 A;  3ZYY X;  3Q8A A;  2LRW A;  3AU4 A;  2WLB A;  2BYV E;  1WXA A;  3X23 A;  2JQR B;  1R4M B;  4OVZ A;  5C23 A;  2KDF B;  3ZTC A;  2REX A;  1B9R A;  4C00 A;  1HTQ A;  3ONS A;  1RM6 C;  1WMH A;  5CTR C;  3BYY B;  2W3S A;  2DZJ A;  2KMC A;  3E9S A;  3FC4 A;  3KWV A;  2INN E;  1QOB A;  2GOW A;  5L95 C;  1T0S C;  3NVV A;  1AAR A;  3RZW C;  2G4S A;  4XC2 A;  4EFO A;  1I4R A;  4YTP B;  1N5W A;  3H9D A;  1NYQ A;  2LEK A;  1LFD A;  3BZD B;  2XEW A;  1C1Y B;  1WRI A;  2M0A A;  4KSL C;  1K8R B;  2FUH B;  1DGJ A;  1XCT L;  1Q5W B;  3TEY A;  3CF6 E;  4MEL A;  4GIV A;  3QC8 B;  5JZE B;  2KYW A;  2W82 A;  1D5Z C;  3T8M A;  3DVN U;  2B3A A;  1WX9 A;  5LXI B;  5KHO A;  1KFY B;  3KYC D;  1WF9 A;  1T5X D;  4KIK B;  2GMI C;  3APF A;  4XWW A;  2RPV A;  3ZKJ C;  2J7Q B;  2JUO A;  2LZ6 A;  1EU4 A;  2KFJ A;  4MSQ B;  3ZDM C;  3P63 A;  3NZS A;  3DBL B;  2KT7 A;  3T3O A;  3D32 A;  3HHM A;  4ICU A;  4CHK A;  3RNF C;  4FJZ A;  1NEN B;  3C19 A;  1NDD A;  1QQR A;  1HZ6 A;  1L5P A;  1PDX A;  3ABV B;  3KLS X;  2CHX A;  1SB3 C;  3ZQ4 A;  5HKH A;  1YN5 A;  3HK0 A;  2WDQ B;  2M17 A;  3BVG A;  3O13 A;  1YJI A;  3KW5 B;  3IHP C;  3NG0 A;  1WGK A;  2KMA A;  3B0A A;  3I57 A;  1QIL A;  4KDL B;  2LXA A;  4BKG A;  4K1R B;  3AED B;  1KH0 A;  3I5J C;  4K81 A;  1KLU D;  4ZRQ A;  5D3I B;  1VLB A;  4FHJ A;  2ON8 A;  2K1F A;  2H88 B;  2QIL A; 
#chains in the Genus database with same CATH homology
 4W9J A;  2RGF A;  2WX0 A;  3M95 A;  3UF8 A;  3VH3 B;  2C7M B;  4NQK E;  3EC8 A;  2YVC A;  4WQO B;  3KUZ A;  1Q1O A;  1WXV A;  4MJS A;  2I1J A;  5DCN A;  2MP2 A;  1WZ0 A;  4WJQ A;  2NBV B;  1NBF C;  4LJP B;  4DBG A;  3VTU A;  3RD2 A;  3ZW3 A;  3QK0 A;  1XQQ A;  2DZK A;  2ZZP B;  1EUV B;  2PE9 A;  2G45 B;  2NR2 A;  3B1L X;  2PE6 B;  3MTN B;  4PS7 A;  1PQS A;  1TGZ B;  2L0F A;  4EEW A;  1YX5 B;  2KJH B;  3K9P B;  2GBN A;  4M8M A;  2R2O A;  1WRD B;  2MBO A;  3VFK A;  2LI5 A;  4RM9 A;  2JY6 A;  2IBI B;  2LVO A;  1R4M I;  3ENE A;  3H6N A;  4JLC A;  4EUT A;  2MLB A;  4I6P A;  3IBE A;  1P98 A;  1T0Y A;  2IO3 B;  4IWO A;  3B08 A;  2D2Q A;  3ECI A;  2YLM A;  2MBQ A;  2J0M A;  2KVR A;  2K25 A;  3TMP B;  2RD0 A;  3DOW A;  3DVN V;  4WWP A;  4PYU A;  3VH4 B;  1P3Q U;  2L05 A;  3WAN A;  2NVU I;  4NNJ B;  2DYB A;  1V80 A;  1UGM A;  3NOB A;  2C5L C;  3LJ3 A;  5DPR A;  3VAW A;  3ZNH B;  2LRU A;  3AUL A;  4ZYN A;  2BWE S;  4GDK A;  3PZD A;  3WIM A;  4DDI D;  4DWF A;  2KWC A;  2K8H A;  2DHZ A;  2KLC A;  2LGY A;  4JIO U;  4X57 B;  2KFK A;  5TR5 A;  1SIF A;  5J18 A;  2G4D B;  4FLH A;  3RZF A;  2LWP A;  2FCQ A;  4E71 A;  2HJ8 A;  2JZZ A;  1I35 A;  4FJY A;  1WGD A;  2UYZ B;  2XK5 B;  2O6V A;  2LUE A;  2BGF A;  2VRR B;  1QZE A;  2KTR B;  3JYU A;  2W9N A;  3HIZ A;  3WAM A;  1FXT B;  4KVG B;  3GZN I;  4WWN A;  3QX1 A;  3R7R A;  4B95 A;  3V61 A;  2DZM A;  4HJK A;  3PLV A;  5CX3 A;  3TCA A;  3V6C B;  2OJR A;  3X0W A;  2ZNV B;  3L08 A;  1EF1 A;  2MBE A;  2NPT A;  3VUW A;  2MSE D;  2KJR A;  1KJT A;  3CSF A;  2BKF A;  4EKU A;  2FIF A;  2KQS A;  1WM2 A;  4GXB A;  4K7U A;  3RCZ A;  3CST A;  5DPT A;  3DPD A;  3DCG A;  2KLG A;  3KUD B;  4G50 A;  1WZ3 A;  3ZUN A;  2JRH A;  4W9L A;  1LXD A;  1TZ1 A;  3ALB A;  2N7D A;  3APC A;  2ZNV C;  2EMT A;  2K8C A;  4AJY B;  4IM3 A;  1J0G A;  4MSM B;  2K6Q A;  3ML9 A;  3VXW A;  2IY1 B;  4HK2 A;  4IWP A;  4MEM A;  3VUY A;  2D07 B;  2DAJ A;  2KKC A;  4CYE A;  4K7S A;  3N3K B;  2KOX A;  2ZCB A;  1IYF A;  3AU5 A;  2C60 A;  3U7D A;  2O6V D;  2CHW A;  3OJ3 A;  5JH5 C;  3U30 A;  1D3Z A;  2ZCC A;  4LCD E;  2JT4 B;  1ISN A;  4MJS B;  5E6P A;  3N32 A;  2MP2 B;  1KM7 A;  4HPL B;  2GBK A;  5CHW A;  1P9D U;  1V5O A;  4LDT D;  2RSU A;  2M1M A;  3C0R B;  1A5R A;  2JRI B;  5AZF A;  4KIK A;  2AL3 A;  4ANV A;  2LGD A;  1L7Y A;  3QAR A;  2UWQ A;  1YX6 B;  3KYD D;  3IG3 A;  4ZRK A;  4ANU A;  1YD8 U;  2MW5 A;  3KH0 A;  2BWF A;  5C1Z A;  2DZI A;  4NAW A;  3PPA A;  1WI0 A;  4KZ0 A;  2KDB A;  2K6D B;  4JQW C;  1VCB A;  3L10 B;  5D6J B;  1UBI A;  1WJN A;  3H7P A;  3TBL D;  5JHA A;  3L13 A;  3DVG Y;  5JHB A;  4RMA A;  2Z0E B;  5GMV A;  3A9K A;  2M8S A;  3W1S A;  2FCS A;  3DBH I;  1WJU A;  2KN5 A;  3PS6 A;  3P2B A;  2ASQ A;  1XT9 B;  1C3T A;  1KLV A;  3ZNZ B;  2M0X A;  3EFU A;  4M0W B;  3SDL C;  3PSE B;  3RUI B;  4HWI B;  4GDK B;  2JWZ A;  2O2V A;  1GG3 A;  4GSW A;  5CHF A;  1E8W A;  4DHZ E;  2AEH A;  4AJW A;  4EZJ A;  2KFK B;  2CKH B;  4ANX A;  1JRU A;  1V5T A;  3PHW B;  4TKN A;  1UZX B;  3DBS A;  2AL6 A;  1WGY A;  1WGG A;  4PYZ A;  5G2N A;  2L76 A;  3UIO B;  2O6V B;  4FN2 A;  4LJO B;  4BFR A;  2CS4 A;  2KX0 A;  2ZPN A;  2R2Q A;  4CO7 A;  2IO2 B;  3KUC B;  3KVF B;  3VHT C;  2N1W A;  3UIP B;  2A4Z A;  2JVC A;  3L0W B;  3ZNG C;  3ZVV A;  1WR1 A;  2KO3 A;  2MA9 B;  1BT0 A;  4DHJ D;  4BKS A;  3L54 A;  2M4N A;  3K9O B;  4W9H A;  3IFW B;  4FA6 A;  4IWQ A;  2KD0 A;  3R3M A;  1J8C A;  2NPT B;  3AI5 A;  2N9X A;  5L83 A;  4BVU C;  3OLM D;  4BBN C;  3QAQ A;  3RUL A;  4WJO A;  1YIW A;  2IYD B;  1WYW B;  2Z0D B;  1UH6 A;  4GDL B;  4MDK E;  2C7H A;  2KAN A;  2KX3 A;  1V81 A;  2PEA A;  2KHW B;  4OVU A;  5D7G A;  4I6N B;  1U4A A;  1EF5 A;  3OJ4 B;  5IAA C;  4A3O A;  2EKE C;  1S1Q B;  3ZO5 B;  2WWZ A;  2DAF A;  1E8X A;  1YQB A;  4K7W A;  3QJZ A;  4PS3 A;  3WA0 A;  2J0J A;  3M63 B;  4FHK A;  2MX2 A;  3V62 A;  4HPM B;  1WY8 A;  2KQ7 A;  2N4F A;  3L17 A;  1M94 A;  4NQL B;  4KSK C;  1GNU A;  4IG7 B;  2KNB A;  4MGZ E;  3VTW A;  3PRE A;  4TQ0 A;  2KC2 A;  3SHQ A;  1Z2M A;  3ZTD A;  2HD5 B;  2ZJD A;  4G3X B;  3NS8 A;  4DXA B;  2GBM A;  1WXM A;  4F8C B;  1WX8 A;  4HCP B;  1L2N A;  3IVF A;  1E8Z A;  4DHZ B;  1S3S G;  2D3G A;  2J0K A;  1Y8R C;  3A4S C;  3R7Q A;  4E74 A;  3GOE A;  1EO6 A;  2NS5 A;  3JSV A;  1V2Y A;  2DEN B;  1E90 A;  1H4R A;  2BPS A;  3BY4 B;  3H7S A;  4BKS D;  3HM3 A;  4JL9 A;  4XX5 A;  4AOF A;  2KDI A;  4NY0 A;  2LAS A;  2LXC A;  3PT2 B;  4A3P A;  1Q0W B;  2KJ6 A;  2ZEQ A;  2DX5 B;  3NY5 A;  4M8N A;  3A33 B;  4DHJ B;  1V86 A;  3A9J B;  1WXS A;  4NAW B;  2L3Z A;  1TBE A;  1RFA A;  1LQB A;  2KC1 A;  3NHE B;  1E8Y A;  3PVL A;  5D2M B;  3QHT A;  1WM3 A;  3O65 B;  2V1Y A;  2L00 B;  1KOT A;  4N9F 4;  3H7P B;  1WGR A;  1HE8 A;  4IM0 A;  1WE7 A;  2D11 A;  2XK5 A;  1GC7 A;  1OEY A;  1TTN A;  1WGH A;  3DBL I;  2RPQ A;  3LDZ E;  4GMV A;  4JGH B;  3UGB B;  3ZLZ A;  2LJ5 A;  3A9K B;  3PRM B;  4ZRI A;  2KWV B;  4ZRJ A;  3OAW A;  4J6I A;  4W9I A;  3TJP A;  1OGW A;  2G3Q B;  1P1A A;  2DYO A;  3M62 B;  4FUL A;  5FR6 A;  4RM8 A;  4AP4 C;  1XD3 B;  3ZNI D;  2C7N B;  4GB9 A;  4KDI C;  3BIN A;  4AWJ A;  4HCN B;  4IM2 A;  4WJP A;  2Z59 B;  4EOY A;  5DPW A;  3QWZ B;  1VD2 A;  2IY0 B;  2CR5 A;  3MHS D;  2EMS A;  5J2R A;  2JPH A;  2O2V B;  4MGI E;  1WFY A;  3NZU A;  3APD A;  3DBR I;  1R4N I;  3S2A A;  3A4R A;  4W9F A;  2L7R A;  4HDQ A;  3W1S C;  4DK5 A;  2FID A;  3Q3F A;  4MH0 E;  2BYF A;  2FCN A;  4HLE A;  2K8B A;  3A1Q A;  3PGE A;  5CHV C;  2PPH A;  4ANW A;  3EEC A;  3DQV A;  2LD9 A;  3EHV A;  4G0N B;  2ZVN A;  4TQ1 A;  4HXD A;  4W9E A;  2C9W B;  5E6N A;  4F7Z A;  3ML8 A;  4W9G A;  4W9K A;  1MG8 A;  1RRB A;  2KXJ A;  4G11 A;  4FBJ B;  3PRP B;  1ZGU B;  2OOB B;  2QHO A;  4EZK A;  1E7V A;  2LRW A;  3AU4 A;  3RYT A;  1OEY J;  2N1V A;  2LGX A;  2IO1 B;  1WX7 A;  2AYO B;  2BYV E;  1ZW7 A;  5AZH A;  1X1M A;  5E6O A;  2MWS B;  4IW0 A;  4GGQ A;  1WXA A;  4WJN A;  3X23 A;  2KTF A;  1V49 A;  3PTF C;  1RLF A;  5C23 A;  2KDF B;  3ZTC A;  2REX A;  2N9P C;  2Y5B B;  4TV3 A;  2JXX A;  3ONS A;  3VTV A;  1V6E A;  1WMH A;  5CTR C;  3ZRF A;  2KDE B;  1I42 A;  2DZJ A;  3VQI A;  3QA8 A;  1H8C A;  2KMC A;  2GBR A;  3TIX A;  3PLU A;  1V9J A;  2AWT A;  3WAP A;  1CMX B;  4LDT B;  2GOW A;  5L95 C;  1GC6 A;  3ZIM A;  2V4L A;  1WE6 A;  1WJ4 A;  2MCN B;  2WYQ A;  4IUM B;  1AAR A;  3RZW C;  2G4S A;  2WDT B;  4KZC A;  4B9K A;  5EDS A;  2PJH A;  3VVW B;  2JF5 A;  4XC2 A;  3JVZ X;  4EFO A;  1WIA A;  1P0R A;  3V6E B;  1ZKH A;  4KV2 A;  4XZ4 A;  3DDC B;  5J17 A;  1WJ6 A;  4W9C A;  2GBJ A;  2FAZ A;  4II2 B;  4ICV A;  5AZG A;  2MBB B;  4URK A;  3U8Z A;  3H9D A;  4MM3 A;  3UIN B;  3JSV B;  1F9J A;  1LFD A;  4MGY E;  2XEW A;  4FAD A;  1C1Y B;  3VUX A;  3QCA A;  4NJ6 A;  4IC7 B;  2JZ3 B;  1UD7 A;  4KSL C;  1NI2 A;  1K8R B;  3HM6 X;  4BBN F;  2FUH B;  4ASW C;  4TUU A;  3CMM B;  1Q5W B;  3N30 A;  2DYM A;  2ZVO A;  3VDZ A;  3UQB A;  2ZPY A;  5LXH A;  2HE7 A;  1J19 A;  3CF6 E;  4MEL A;  4GIV A;  3QC8 B;  5JZE B;  2L0T A;  3R66 C;  3QIJ A;  3Q3J A;  3T8M A;  3DVN U;  3H1U A;  2D10 A;  5G55 A;  2B3A A;  1WX9 A;  5LXI B;  5KHO A;  5KHQ A;  3WAL A;  1G6J A;  2XBB C;  1E7U A;  3KYC D;  3ZDT A;  1E5W A;  1WH3 A;  1WF9 A;  4KIK B;  2GMI C;  3APF A;  4NJ7 A;  3L16 A;  2CU1 A;  4HVB A;  3ZKJ C;  2J7Q B;  2JUO A;  2MBH A;  2LZ6 A;  2HTH A;  2KFJ A;  1IPG A;  2K39 A;  4GN1 A;  4MSQ B;  4WAA A;  4YL8 A;  2LVQ A;  4WWO A;  4BOS C;  3UQA A;  2KZR A;  3NZS A;  5D94 A;  3ZDM C;  3A1Q B;  4GDL A;  3D32 A;  3HHM A;  4ICU A;  4P7I A;  1SGH A;  4CHK A;  4W9D A;  3TL5 A;  4MGK E;  1GJZ A;  4FJZ A;  2KTR A;  2IO0 B;  1GUA B;  4II3 B;  3PV1 A;  2FNJ B;  1NDD A;  4AUQ C;  3M3J A;  5DPS A;  1UBQ A;  2NCN A;  4PS8 A;  1OTR B;  1UEL A;  1Z5S B;  2BF8 B;  4B6W A;  2KK8 A;  3MJW A;  1RAX A;  2CHX A;  2LVP A;  2N7E A;  3ZRC A;  3SU8 X;  4BKT A;  4ZDV A;  2IZV B;  5HKH A;  2L8J A;  4HDO A;  4FJV B;  3W1Y A;  2I1K A;  2BYE A;  3HK0 A;  2FCM A;  3PHX B;  4A20 A;  4GOC A;  5IA7 A;  3QQ8 B;  2M17 A;  3T9L A;  1WR6 E;  1SE9 A;  2A5U A;  3AXC A;  2V3S A;  3KW5 B;  3IHP C;  3PRZ A;  2CHZ A;  5AEK B;  2RR9 A;  4E3C A;  4EZL A;  1WMH B;  2KWU B;  3JW0 X;  2KMA A;  1IP9 A;  3I3T B;  3B0A A;  2MQJ A;  4KDL B;  3WAO A;  3V60 A;  2WX1 A;  2LXA A;  4BKG A;  4K1R B;  2NBU A;  2MRP A;  1YJ1 A;  1LM8 B;  4GU2 A;  4NPN A;  4K81 A;  2N9E B;  5BO4 B;  2NBW B;  4BOZ B;  4F1S A;  4I6L B;  2BKR B;  3A9J A;  3DVG X;  1OQY A;  5LLI A;  4FHJ A;  4DDG D;  3SD5 A;  4OVV A;  3RT3 B;  2K1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...