3VE3A

Structure of it intermediate from time-resolved laue crystallography
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ve3A00
1X0OA 5HWWA 2PD7A 4GW9A 5KIZA 4I38A 3KX0X 4BBTA 3MQQA 3IBRA 4L9EA 2ZOIA 1UGUA 4GS9A 1DP9A 1F98A 1XJ3A 2YKHA 4WN5A 5IS1A 2V0WA 4HP4A 4HQAA 1JNUA 2INWA 4L9GA 3RTYA 1T1CA 3UMDA 3SW1A 3FC7A 3BY8A 2R78A 1GSWA 4JGPA 3K3DA 4MN5A 4H6JA 5DKLA 5F69A 1TS0A 1T19A 3D72A 3F1PA 5HZHA 4HH2A 2QKPA 1OJGA 1DP6A 1DP8A 3UE6A 3VE3A 1TS6A 1OTEA 4LLOB 5AVEA 1XJ2A 1S66L 4I3JA 2W0NA 3E4OA 1TS7A 4XT2B 3UB7A 2VV7A 4YWZA 2HV1A 3GECA 5G4YA 3HJIA 4I39A 4HY8A 4NXBA 2V1AA 1ODVA 1V9YA 5IU1A 3RH8B 5DKKA 2PR5A 1GSXA 1D06A 3LIAA 1D7EA 1TS8A 3UB9A 3OLOA 1OTIA 5J3WA 4RQ9A 2PHYA 3A0VA 4HOIA 3GDIA 2CMNA 4HJ6A 1GSVA 4LPZA 3CLOA 2D01A 1OTDA 2YKFA 3PYPA 2JN7A 3F1OB 2V0UA 4JGRA 3LIBA 3NJAA 4LRYC 4R3AA 1S1YA 3IS2B 3MQOA 3LICA 5F6AA 5HWVA 2ZOHA 1OT6A 3ICYA 3NOUC 2OWJA 3EWKA 3UMEA 4HH3A 3P7NA 3LIDA 1P0ZA 4K08A 4R6LA 1XJ4A 4DJ3A 3H82B 3FG8A 5G4ZA 3UB8A 5F5YA 4BBVA 4WL9A 4DJ2A 3LUQA 2L0WA 1G28A 1F9IA 4L9FA 3C2WA 2Z6CA 5DJTA 3LIEA 1XJ6A 2L1MA 3H9WA 4EW7A 4PKYA 1WA9A 4XT2A 4EETB 1UWNX 3VOLA 4HJ4A 2D02A 3MXQA 2A24B 3HJKA 3F1NB 5I5LA 4PKYG 4HNBA 2V1BA 3EEHA 5J7EA 4EERA 4HIAA 2PD8A 2JHEA 1S67L 2QHKA 4WLAA 4I5SA 4NXGA 2KX6A 2K7SA 1S4SA 4HJ3A 3BWLA 4EQ1A 4HI4A 1LSWA 1N9LA 2PR6A 3UB6A 1OTBA 2B02A 4GCZA 3CAXA 3LYXA 4EEUA 4F3LB 4NXEA 3CWFA 4WF0A 3F1OA 3T50A 2M1CA 1UWPX 1KOUA 2H28A 2QJ5A 4KQDA 4JGOA 2WKRA 3IS2A 4BBUA 1LL8A 1S4RA 2QJ7A 1Y28A 2WKQA 4I3AA 2PYRA 2VV8A 4NXFA 3NHQA 4R38A 5HWTA 3BY9A 4WUJA 2GJ3A 2OOLA 3G6OA 3H82A 3H7WA 4EEPA 2PYPA 1OT9A 5DJUA 3H7WB 2BASA 5EFWA 1V9ZA 4LRXC 5TBMA 4HHDA 4GS9B 2EA9A 1OTAA 1T1AA 3PHYA 4MN6A 4KUKA 3NOTC 5TBMB 3B33A 3E4PA 4JGQA 2P7JA 3VE4A 3LIFA 1OJ5A 1NWZA 3E4QA 3A0RA 4B9OA 5HDCA 2W27A 2Z6DA 3LI8A 1LT0A 4GHIA 2A24A 2OWHA 3F1NA 4LRZE 2QWSA 3NOPC 3K3CA 4GHIB 5HD5A 2V9AA 1P97A 4EXOA 4H6JB 4HP9A 1EW0A 1T18A 2VLGA 3F1PB 4R70A 1LSVA 1XFNA 5F68A 2I9VA 4M4XA 3A0SA 5HDDA 2VV6A 4E04A 5HDSA 1N9OA 1LSXA 2VEAA 4KUOA 1VB6A 1S1ZA 2WKPA 1DRMA 4F3LA 3MFXA 3ULFA 2PDRA 2ZBBA 3C8CA 4I3IA 3MJQA 1XFQA 2KDKA 3ZQ5A 1T1BA 5AVFA 1N9NA 3LI9A 4EESA 1MZUA 5HSQA 2L4RA 1BYWA 5HD3A 5A8BA 2J80A 3MR0A 5J4EA
chains in the Genus database with same CATH superfamily
4IVIA 4U0TA 1G5UA 1Z09A 1BLPA 3NULA 4P6ZM 3MQQA 2K31A 2ZOIA 2X01A 1F98A 2WAEA 2B95A 3CZDA 3MZDA 1ERQA 2XSSA 4X1MA 1JNUA 3A3DA 4O0PA 1AXBA 4UHUA 4L9GA 4WZ5C 4P87A 2NUTC 2XRNA 3UMDA 3G2YA 5FASA 1E25A 3FC7A 4GOGA 4MN5A 5M18A 2ZD8A 3VV4A 4H6JA 2Q9NA 5DKLA 1YAXA 2AVXA 2Y2KA 1KDWA 1DY6A 5HZHA 3WRTA 4HH2A 1ZHHB 2ACGA 2E8IA 1LLBA 4JBFA 1EWZA 1KE0A 3VP4A 1KVLA 1OTEA 3TSGA 4GKUA 4MEZA 5FSRA 5JYPA 3BFCA 1S66L 4FTXA 3ZHHA 3NDEA 3OPHA 2W1TA 3HJIA 1W8YA 1PRQA 3G35A 4RYEA 3WS5A 1V9YA 3RH8B 2FFFB 3MZFA 1EI5A 1I2SA 1D06A 3LIAA 1XXMA 1GHIA 4B93A 2WZZA 5FAQA 3UB9A 4YFMA 3B42A 5J3WA 2W3DA 2GX5A 3SZTA 4N92A 5E2HA 3GDIA 2CMNA 1GSVA 3CLOA 2D01A 4ARZB 4CLCD 4FOFA 1SKOB 4PM6A 3HUOA 4ME4A 4JGRA 2IWCA 1CQAA 3PBNA 3MKFA 1S1YA 3T4JA 3CUEA 3MQOA 3LICA 5FAOA 3ZVTA 3LEZA 3QP8A 1VQQA 3QP2A 2E8JA 1OT6A 5CERA 3OCLA 5CGSA 2BLSA 3UMEA 4LCMA 2JKTM 3LIDA 3ZG9B 4R4RA 2WYXA 1P0ZA 5GHYA 3TJZC 2PU4A 1Q2QA 2O9CA 5G4ZA 1EROA 1YLYA 1ZTUA 2JE5A 4DMZA 3OPRA 3ZCZA 4JLFA 4S2NC 4Z1WA 1VM1A 4RX3A 2L0WA 4Q0JA 4EV4A 1SDEA 5DJTA 1W63Q 3Q1FA 3U2AA 2GZAA 3MXRA 1YMXA 3IX3A 4KZBA 1IKGA 1GCEA 5DTKA 5AQ9A 3SH9A 4U3TA 4ID4A 4JXSA 4Q8IA 3S7PA 4IHQA 4HJ4A 3V50A 5CEDA 4IBXA 1KVMA 5C5KA 3E0YA 3MSHA 4HIAA 2PD8A 1G6AA 3PAGA 3BW6A 1XGJA 2Y2HA 3DWZA 4KZ9A 2Y4AA 2WADA 3E98A 2W1RA 4CJNA 4K0XA 3Q7ZA 3LR0A 1LSWA 1IFQA 1DJAA 2G2WA 1BULA 1N9LA 3EGXC 3ZG0A 4D2OA 5HPIA 3BJNA 4HEFA 3IXHA 2ZC4B 4WYYA 1NZOA 4U0XA 4ARZA 2ZMFA 3CWFA 3PBRA 1SKOA 3MZEA 5FQIA 5EVIA 1HTZA 1YLWA 5IT5A 3L7HA 1PI4A 1KOUA 2H28A 3BLSA 2XH9A 3ZG5A 3EOIA 4R4SA 3V67A 1MWUA 1Y28A 2LB5A 4UEYA 2ZM0A 3N8SA 4I3AA 4ZJ3A 1VEUB 3AGDA 3D3OA 3ITAA 4R38A 3ZFZA 3OC2A 4KQOA 5GHXA 3H7WA 4BMWA 1L2SA 1JVJA 4PM7A 3VP0A 2P9VB 3IX8A 1V9ZA 4LRXC 4MMNA 1XPBA 2X02A 4GS9B 2EA9A 3VOZA 4NG2A 3DW0A 3NOTC 3VP3A 1FCMA 2X71A 2DCFA 4E3KA 4RVAA 1OJ5A 4B9OA 2MJ6A 3LI8A 2Z6DA 5EM0A 5HDCA 5JYOA 3LGOA 1NY0A 4Y15A 3G31A 3S1YA 2ZM8A 3K3CA 2PBYA 3G4PA 2JKFA 3P98A 2Y59A 2O9BA 1DJBA 4IBRA 1JTDA 1ERMA 2QYBA 1NLYA 2ZQCA 4QPRA 1FCNA 3SS4A 4KZ3A 3LO7A 4EUZA 3FPWA 2Y2IA 2VEAA 1WYBA 4E6XA 1PI5A 2I72A 4LV0A 1VB6A 1S1ZA 2P74A 1SKFA 4WZ5A 2WAFA 1L3LA 3MFXA 1HVBA 3SOIA 1W63M 3M6HA 3WRZA 3ZGAB 1PW1A 4KZ8A 1VHMA 1HD8A 4OP8A 2GNXA 1IYPA 2KDKA 3V3SA 1PW8A 2XFSA 5G18A 3IWOA 2W3FA 5EOEA 3UNWA 5HD3A 5A8BA 4O01A 4EBLA 2J80A 3MR0A 1ALQA 1X0OA 1L0EA 3CJMA 5KIZA 4DF6A 2A2LA 3U4LP 3IX4A 3UB5P 3IBRA 4L9EA 4IUHA 2WUQA 3TW8A 1UGUA 4GS9A 5FQQA 1YLJA 3LFVA 1DP9A 2EX9A 2ZMVA 2YKHA 3QNBA 1H8MA 4NEED 2VGKA 4NETA 3UPNA 4H8RA 2H0TA 1T1CA 3OOVA 3UO9A 1BZAA 4KZAA 3SW1A 5CHMA 4DN0A 3C4PA 3HLEA 4BQMA 1H5XA 3QP1A 2R78A 5CHUA 4KG5A 3IWIA 2W3HA 2EWWA 1U60A 1YSQA 5EVIC 4E3JA 4BJPA 4Y0UA 3MQ0A 2QKPA 3IWQA 3EQUA 3LR5A 4Z9QA 1GA0A 1TS6A 1XJ2A 1YT4A 2JKGA 2W0NA 5L09A 2M7UA 4OLDA 1FOFA 4XT2B 2VZWA 4YWZA 3CI6A 4S2MA 3DBAA 5E2EA 5L07A 4GDBA 3S7QA 4KQRA 2DRWA 4KG2A 3HUNA 2PAVP 3BLMA 3R4KA 4S2NA 3VP2A 4MBHA 1GHPA 3NY4A 4XUZA 3UPPA 2XD5A 1ONHA 3OLOA 5DF7A 3HCYA 3HLBA 1OTIA 3EGDC 5EVID 5F83A 3A0VA 3C30A 4OPZA 1JTGA 4OVDA 2YKFA 3T4OA 3PYPA 2JN7A 3WWXA 5EOOA 3RXXA 1CJFA 2V0UA 2HGVA 2ZMAA 1ESIA 5CXWA 3AGEA 4R3AA 1Z6FA 2P08A 3HL9A 2HF6A 1N4OA 4R0QA 1ACFA 3LY3A 5F6AA 3C38A 4QJGA 3LEQA 2H10A 3EWKA 3FKWA 3P7NA 1K54C 5D3OA 1XJ4A 4S2OA 3FG8A 4JF4A 2VGJA 4GJ4A 4CLCE 4B88A 2XFTA 1YKDA 4BBVA 4MNRA 4PAUA 1MBLA 5KZHA 4EQIA 3O87A 1E3UD 1G28A 3Q7VA 1I5QA 4WELA 2C6WB 3BEBA 5HPFA 2BTFP 1F5MA 2L1MA 3BECA 1O7EA 2J9OA 3V39A 1I2WA 4XT2A 5F1GA 3ZNYA 3CHWP 4WM9A 2G7UA 4BD0A 2D02A 3MXQA 5AJGA 2A24B 1YLPA 4Y17A 1BLCA 4IEDA 3N8RA 4EBPA 4LFUA 4I5SA 5KSHA 2KX6A 1W8QA 2J3TC 3BRMA 2K7SA 5FI7A 4HJ3A 3BWLA 3JVVA 1M6KA 4EQ1A 5GL9A 3QNCA 4BD1A 5AQBA 4DE2A 3T4QA 1TDGA 3FWLA 2PR6A 3M2JA 3N7WA 2ZQDA 5EUAA 3N6IA 4DE1A 5M1AA 1ZG6A 1FILA 4C75A 4MBFA 4HESA 1AWIA 5FQJA 4KQDA 1UWPX 2QJ5A 4JGOA 2XROA 2WKRA 1LL8A 3N4IA 1S4RA 5EVIB 3MS6A 1H3QA 3NDGA 4MN7A 2Y79A 3KO6A 2VV8A 4JKTA 1M40A 4FSFA 1ZC2A 5HWTA 1PWGA 1FSYA 5EV0A 2DMWA 5EVEA 4GZBA 1G6OA 5FATA 1ESUA 3W4QA 3H7WB 3KYQA 1C3BA 5EFWA 2XLNA 4Q0IA 4HHDA 4DDSA 2VGLS 3OPLA 4KENB 4ZTKA 3BQ8A 3CG5A 1FR1A 4MN6A 2WGIA 3B33A 5K5BA 2BG1A 3E4PA 3I7JA 2HZ5A 4JGQA 4JF6A 1CI8A 3VE4A 1NWZA 3A0RA 4PM9A 5HFOA 1MWTA 2ZC6B 3G2ZA 1LL5A 2HP9A 2A24A 1MXOA 1JWPA 4LRZE 4CQHA 2QWSA 2EFUA 5HD5A 4EXOA 4DE3A 2EX2A 3T1QB 2Y2LA 1PFLA 1T18A 2VLGA 3F1PB 4R70A 1LSVA 5CRFA 3UPOA 1XFNA 5FI2A 1NRJA 3QHYA 3VMAA 3WS1A 2Q9MA 4F94A 2LB9A 2EX6A 3G34A 2M7VA 1S0WA 5FDHA 2RL3A 2WKEA 1ES3A 2A49A 4BENA 4E3NA 5I94A 2WGWB 1MKIA 4UA6A 3ULFA 4G3VA 1BLSA 3JPUA 3E2KA 3C8CA 1FR6A 4I3IA 2O99A 3UDFA 3ZVWA 5BOHA 2QMIA 2H0YA 2J7VA 3PBOA 3ZQ5A 1RP5A 5AVFA 3ISGA 4PMAA 3BQAA 3LI9A 3VFFA 4E3LA 3WS4A 3PBTA 1MZUA 1KDSA 5EECA 5L2FA 5L10A 4GB7A 4MDZA 5HWWA 1KE4A 3S22A 1XP4A 4I38A 4FCFA 3KX0X 4Y2FA 4BBTA 1K55C 1XGIA 3T1SA 3QP5A 3C5AA 5FI6A 3GQZA 3JVUA 1XJ3A 4B4XA 4WN5A 1RGZA 5AQ7A 3EQVA 3R7WB 2VX8A 4BLMA 5IS1A 1LHYA 3FPVA 4HP4A 1PZPA 4UQIM 4R23A 4YNRA 3HBRA 2INWA 4KZ4A 3ZNTA 3RTYA 1YLTA 2JC7A 5CEBA 5HAPA 3GMWA 4ZDXA 4ZBEA 5FEFA 3BY8A 5GHZA 3C7UA 4KZ6A 1E3UA 1G68A 3A3FA 2V2FF 1GA9A 1GSWA 4JGPA 1OMEA 2VA0A 4WZ4A 3PXPA 3A3IA 4X56A 5F69A 1TS0A 1T19A 3D72A 3F1PA 3IQAA 3ZDJA 2PBDP 4LV1A 5U47A 2FFYA 3DAVA 4OQIA 5E43A 1L0GA 1OJGA 4GD8A 1DP8A 3UE6A 3VE3A 4LLOB 4QD4A 5MC7A 2ZQ9A 4ZRRA 1ES5A 2OSUA 3PBSA 5DVAA 4I3JA 4ZAMA 1IELA 1TS7A 2WGWA 5TGFA 2HV1A 3GECA 3NECA 3MKEA 1XX2A 1SDNA 3DWKA 4I39A 4IJGA 1K54A 4GD6A 2W3GA 3ZG7B 1P9WA 1YLZA 1K56A 5IU1A 5DKKA 4MLLA 1DJCA 3NBLA 2WZXA 1D7EA 3T4SA 3CPTA 4OOLA 3PBQA 1BTLA 5CX7A 2R9WA 1IYOA 5GLAA 4RQ9A 3P09A 5HARA 4HOIA 3WS2A 3GV9A 4HJ6A 4LPZA 2O9AA 2HDQA 2Y91A 3F1OB 2UV0E 3LIBA 4R3BA 4C3QA 1PWDA 3R7WA 2QZ6A 3HLGA 3LCEA 1CEGA 1D1JA 2ZOHA 4OQHA 3P01A 3NOUC 2EXAA 3EEAA 4UQIS 3IH8A 2XD1A 4KG6A 3CMZA 3N8LA 4R6LA 4DJ3A 2IWDA 3KSIA 5KSCA 2OAQ1 2H5SA 3IXGA 3UB8A 5F5YA 1Y4OA 3QP4A 2ZLYA 4L9FA 2XEPA 1FSWA 1K38A 2CC1A 2Z6CA 3C2WA 3M6BA 4EWFA 4RX2A 4KZ7A 4B4ZA 3TE8A 3Q7VB 1XJ6A 5F1FA 3W8KA 4DXBA 3QP6A 3H9WA 1K4FA 4EW7A 4X25A 4L0LA 3HLCA 2HP6A 4OONA 1UWNX 3VOLA 2B5RA 4HBUA 5L8MA 3TOIA 3MBZA 1L0FA 1SCWA 1QMEA 2G2UA 4K0WA 4P0MA 4KQQA 1WE4A 1H8ZA 1TD5A 3LR4A 5I5LA 4PKYG 4HNBA 2V1BA 1K25A 3MMHA 1MC0A 5HL1A 3FZCA 5GLCA 3A3JA 1SZVA 1SHVA 2QHKA 5TJJA 2R9XA 2V8FA 5J8XA 2O0YA 1YQSA 1CEFA 4P6BA 4UA9A 4QB8A 3UE3A 5FL3A 4GDNA 2OLUA 4C6YA 2KLIA 2Y55A 1IEMA 3O3VA 1OTBA 3MFDA 3W4OA 1IOUA 3CAXA 4N1XA 3LYXA 2Y2QA 4EEUA 5FEGA 2IA2A 4F3LB 1BSGA 4G3WA 2EFXA 3F1OA 1KGFA 3T50A 2M1CA 2Y2MA 1TF1A 3L9KA 4S2KA 4O7DA 4PHTA 3VSKA 2WKQA 2KOIA 4NK3A 4OQGA 5TFQA 2PYRA 2NUPC 2ZL1B 4NXFA 2JKRI 3NHQA 3ZYTA 3BY9A 1YM1A 2ZC3B 3B3XA 3G6OA 5CGXA 4UA7A 4EEPA 3ZG8B 1KGEA 3DTIA 1PWCA 5EM1A 2A3UA 5FQ9A 1H8YA 3KYZA 1H0MA 1OT9A 3IF6C 2V20A 2BASA 3LY4A 2XR0A 5TBMA 2W3EA 2ZQ8A 1BT5A 4JPMA 2VGLM 1P9RA 1Q2PA 4X1LA 3OZHA 2P7JA 3KSGA 4GNUA 1LI9A 3E4QA 2W27A 4WMCD 1LT0A 1VETA 4FH2A 1TDLA 3V5MA 5EVLA 3WS0A 3IXBA 4GHIA 4CPKA 4DRTA 4E3OA 5A90A 3Q81A 2WK0A 3HLFA 2FZ0A 4ZJ2A 2OAP1 2V9AA 2XGNA 2Y2JA 5CECA 4HP9A 3E2LA 4CLCC 1K6RA 3GRJA 3PAEA 4BL3A 1K55A 4M4XA 3A0SA 5DTSA 4BWIA 3BFEA 4Y7PA 2GDNA 3TG9A 3M2KA 2VV6A 4E04A 5HDSA 1LSXA 1PNEA 1PZOA 4JXVA 4OPQA 4KUOA 1XA7A 3B47A 2WKPA 4OPRA 5GLBA 1K56D 4F3LA 1ZKJA 4LENA 1ZG4A 2V8CA 4DDYA 1MPLA 4QHCA 3O5YA 1MWRA 5F82A 1XFQA 5FQKA 4QWOA 1FIKA 4ETXA 1K57C 1LL9A 2ZQAA 1T1BA 4X69A 2ZL1A 5HL6A 4EESA 2L4RA 4HBTA 3RFBA 3GTCA 5FDSA 5J4EA 3GSGA 2J9PA 3SS5A 2PD7A 4GW9A 1CI9A 4EBNA 4P6ZS 3TRCA 2J3TD 4YOFA 5DF8A 2ZC5B 4OKPA 4X53A 1FQGA 2K2NA 1ES4A 1S6RA 1N9BA 5FAPA 2V0WA 1W5DA 3KSHA 2Z2LB 4HQAA 2HDRA 3VFHA 4WEJA 5A91A 3S4XA 4PM5A 3KSFA 3G30A 4UAAA 4Y0OA 4FUWA 3UE1A 1CK3A 3K3DA 4DKIA 2XK1A 1HLUP 3VSLA 1MKMA 1IYSA 2B18A 4Y0TA 2HDSA 5HX9A 1PYYA 4OOMA 1DP6A 1FCOA 5A92A 3IXDA 5AVEA 4LV3A 1KE3A 3OCNA 3E4OA 3HUMA 1KGGA 4G3KA 5A93A 3UDXA 5E2FA 3UB7A 2VV7A 5G4YA 3BFFA 2WKIA 4X55A 2J8YA 2JCHA 4LV2A 2HDUA 4IVKA 1JWZA 5CHJA 4HY8A 4NKPA 4JXWA 4NXBA 2V1AA 4WEKA 2ZM2A 3HLDA 1PIOA 3SS3A 5EE8A 2OV5A 1ODVA 1BLHA 2Y2NA 5CTNA 4JF5A 3IF6B 2PR5A 1GSXA 5M19A 3GR2A 4JXGA 2ZC7A 1TS8A 4ESPA 1STZA 1YSPA 2Y2GA 3K2NA 3RJUA 2Y8HA 2PHYA 3IHAA 3NC8A 1TVFA 3CPTB 3W2ZA 4R3JA 5HW3A 4WBGA 2IWBA 2DNSA 1ES2A 1OTDA 3S7OA 4RA7A 5EPHA 4S2IA 3T1XA 3BYDA 4S2PA 2HPBA 5DFYA 4PM8A 4Y13A 3NJAA 3IT9A 4LRYC 2QPNA 3OPPA 3IS2B 3FV7A 3UN7A 3OBFA 4GLQA 3LR3A 4IUKA 2VK3A 4CLCB 5HWVA 2C5WB 3HREA 1MWSA 3ICYA 1L0DA 4E6WA 2OWJA 5HAQA 3NIAA 4LGWA 4KZ5A 4HH3A 3CITA 2JKTI 3FKVA 2P04A 3DTKA 4K08A 1J9MA 1K6SA 4MBKA 3H82B 4OOYA 4QU3A 5CTMA 4DJ2A 4Y5FA 4WL9A 4DE0A 4DXCA 3LUQA 3ITBA 4AFIA 3RXWA 2Y2PA 4WMCA 1F9IA 2EX8A 3LIEA 4ETZA 3BFGA 1YPRA 2VJWA 5AQAA 1O07A 4PKYA 1WA9A 1XKZA 4EETB 1IKIA 4II7A 2RCXA 5DF9A 3HJKA 3F1NB 3EEHA 1ONGA 5J7EA 4EERA 2PT7A 3CUEC 2JHEA 1S67L 4E3IA 4OLGA 1OPXA 3D4FA 5E2GA 4OQ0A 4WLAA 4YINA 1NRFA 4NXGA 3PR6A 3IF6A 2PRFA 3GVBA 3Q07A 1S4SA 4A5RA 2ZJ9A 4N1HA 1JWVA 4FD8A 3BM6A 1NYMA 2EXBA 2ZQ7A 3C4OA 4HI4A 2XDMA 3AGFA 2OLVA 4P85A 1NYYA 4MCWA 1NLZA 3NCKA 4N9LA 3UB6A 2B02A 1HZOA 4GCZA 4R1GA 4Q0HA 3VP1A 2EWVA 4OP5A 4NXEA 1F2KA 4WF0A 3DTMA 2UWXA 2XA7M 3O86A 3SH8A 3G32A 4LCLA 1RCJA 4PPRA 5DTTA 1TEMA 2HJEA 3KYEA 3IS2A 4BBUA 1XA1A 3PTEA 1VEUA 2Z2MB 2QJ7A 3IH9A 4O8GA 5DFXA 3UDIA 2VKSA 4CLCA 3HVFA 2XQZA 1K4EA 1RGYA 2JKRM 3IHBA 3VOYA 1E4DA 4WUJA 2GJ3A 2OOLA 2WKHA 4S2JA 2P9VA 3H82A 1GHMA 3NI9A 4OH0A 3T4KA 3SH7A 4QY6A 3MXSA 4GN2A 2PYPA 1MY8A 5DJUA 2HJ9C 2HP5A 3T4LA 2JBFA 1LI0A 1OTAA 1T1AA 3PHYA 4KUKA 4FH4A 4X68A 5TBMB 4OPYA 1NXYA 5HAIA 1NJ4A 2Y2OA 3LIFA 4XUXA 5CGWA 4EU0A 1K57A 4X6TA 3T4TA 2XF3A 5GLDA 5IHVA 2OWHA 3F1NA 4K91A 1VETB 1NZUA 3DTEA 2PU2A 4Y3IA 3NOPC 1CF0A 3UE0A 3FYZA 1K0KA 4GHIB 3MF0A 1IYQA 3W4PA 1P97A 4H6JB 3IF5A 1EW0A 5F68A 2WGVA 1A0KA 3V3RA 1J3WA 2I9VA 3IBJA 3HLWA 4XXRA 5HDDA 4BL2A 2Q0OA 1W79A 1N9OA 3JYIA 4N9KA 1YMSA 3O88A 4EUVA 5LBRA 5FQMA 2V1ZA 3Q82A 1QMFA 1DRMA 1Y54A 3S7NA 4S2LA 2FH5A 2W1TB 1BUEA 2PDRA 2ZBBA 5KMWA 3A3EA 3MJQA 3C7VA 4D60A 2J3WA 2XA7S 1WYCA 4ZJ1A 3UY6A 1W7FA 3BFDA 1N9NA 3T1RA 3T12B 4E3MA 5HSQA 4QY5A 1BYWA 3D9YA 5TR7A 4M3KA 5FA7A
chains in the Genus database with same CATH topology
1X0OA 4MDZA 5HWWA 2PD7A 4GW9A 5KIZA 4I38A 4P6ZS 3KX0X 2A2LA 4P6ZM 4Y2FA 4BBTA 3MQQA 3TRCA 3IBRA 4L9EA 2J3TD 4IUHA 2K31A 3TW8A 4YOFA 2ZOIA 1UGUA 4GS9A 3LFVA 1DP9A 2K2NA 1F98A 3JVUA 1XJ3A 2ZMVA 2YKHA 4WN5A 3EQVA 3R7WB 1H8MA 4NEED 2VX8A 2XSSA 5IS1A 3FPVA 2V0WA 3KSHA 4HP4A 4HQAA 1JNUA 4O0PA 4UQIM 4YNRA 2INWA 4WEJA 4L9GA 3RTYA 1T1CA 3OOVA 2NUTC 2XRNA 3UMDA 3SW1A 3KSFA 3FC7A 4DN0A 3BY8A 2R78A 1GSWA 4JGPA 2VA0A 3PXPA 2W3HA 3K3DA 4MN5A 2EWWA 1YSQA 3VV4A 4H6JA 5DKLA 5F69A 1TS0A 1T19A 1YAXA 3D72A 3F1PA 4BJPA 5HZHA 1MKMA 4HH2A 1ZHHB 3MQ0A 2QKPA 2B18A 3EQUA 1OJGA 4OOMA 3LR5A 1DP6A 1DP8A 3UE6A 3VE3A 1TS6A 1OTEA 4LLOB 5AVEA 1XJ2A 5MC7A 4ZRRA 1S66L 3PBSA 4I3JA 3OCNA 2W0NA 3E4OA 1TS7A 2M7UA 4G3KA 4XT2B 2VZWA 3UB7A 2VV7A 4YWZA 3CI6A 2HV1A 3GECA 5G4YA 3DBAA 2W1TA 3HJIA 4I39A 4IJGA 2W3GA 4HY8A 3S7QA 4NKPA 4NXBA 2V1AA 4WEKA 1P9WA 1ODVA 1V9YA 5IU1A 3RH8B 5DKKA 3R4KA 2PR5A 1GSXA 1D06A 3LIAA 1D7EA 3T4SA 4B93A 1TS8A 4OOLA 3UB9A 3PBQA 1STZA 1YSPA 3OLOA 3HCYA 5CX7A 3B42A 1OTIA 3EGDC 3K2NA 2Y8HA 2W3DA 5J3WA 4RQ9A 2PHYA 2GX5A 3A0VA 3C30A 4HOIA 3W2ZA 3GDIA 2CMNA 4HJ6A 1GSVA 4LPZA 2O9AA 3CLOA 2D01A 4ARZB 1OTDA 4FOFA 3S7OA 4CLCD 2YKFA 3T4OA 3PYPA 2JN7A 3F1OB 2V0UA 2HGVA 5DFYA 4ME4A 4JGRA 3LIBA 3PBNA 3NJAA 4LRYC 4R3AA 1S1YA 3IS2B 3T4JA 3CUEA 3MQOA 3R7WA 3LICA 2P08A 2HF6A 3OBFA 4GLQA 3LR3A 4IUKA 4CLCB 5F6AA 3C38A 5HWVA 2ZOHA 1OT6A 3ICYA 3P01A 3NOUC 2OWJA 3OCLA 3EWKA 3UMEA 3EEAA 4UQIS 4HH3A 3CITA 3P7NA 2JKTI 2JKTM 2P04A 3LIDA 1P0ZA 4K08A 4R6LA 1XJ4A 3TJZC 4DJ3A 3H82B 3FG8A 3KSIA 2O9CA 5G4ZA 1ZTUA 2OAQ1 4DMZA 4GJ4A 4CLCE 1YKDA 3UB8A 5F5YA 4Y5FA 4WL9A 4Z1WA 4BBVA 4DJ2A 4PAUA 3LUQA 4AFIA 2L0WA 1G28A 4Q0JA 1F9IA 4L9FA 4WELA 5HPFA 3C2WA 2Z6CA 5DJTA 1W63Q 3LIEA 3U2AA 2GZAA 3TE8A 1XJ6A 4ETZA 1F5MA 2L1MA 2VJWA 3H9WA 4EW7A 4PKYA 1WA9A 4L0LA 4XT2A 4EETB 1UWNX 3S7PA 4IHQA 5L8MA 3VOLA 4HJ4A 4II7A 2G7UA 2D02A 3MXQA 5AJGA 2A24B 5DF9A 3HJKA 1TD5A 3F1NB 3LR4A 5I5LA 4PKYG 4HNBA 2V1BA 3EEHA 3MMHA 3E0YA 5C5KA 5J7EA 4EERA 2PT7A 1MC0A 4HIAA 2PD8A 3BW6A 2JHEA 1S67L 3CUEC 1OPXA 2QHKA 4WLAA 4I5SA 4NXGA 2KX6A 5KSHA 3PR6A 2J3TC 5TJJA 2K7SA 3E98A 1S4SA 4HJ3A 3BWLA 3JVVA 2W1RA 4EQ1A 2O0YA 3LR0A 4HI4A 1LSWA 3T4QA 1IFQA 3UE3A 5FL3A 1N9LA 3EGXC 1NLZA 4MCWA 2KLIA 5HPIA 3BJNA 2PR6A 3UB6A 1OTBA 2B02A 4GCZA 1IOUA 3CAXA 4Q0HA 3LYXA 4EEUA 4ARZA 2IA2A 2ZMFA 2EWVA 4F3LB 4NXEA 3CWFA 3PBRA 4G3WA 4WF0A 3F1OA 2XA7M 3T50A 2M1CA 1TF1A 5IT5A 1UWPX 1KOUA 2H28A 2HJEA 2QJ5A 4KQDA 4JGOA 2XROA 3EOIA 2WKRA 3IS2A 4BBUA 1LL8A 3V67A 4PHTA 1S4RA 2QJ7A 1Y28A 2LB5A 4UEYA 2WKQA 4O8GA 5DFXA 1H3QA 2KOIA 2VKSA 4MN7A 4CLCA 2Y79A 3KO6A 4I3AA 2PYRA 2VV8A 2NUPC 3D3OA 4NXFA 2JKRI 2JKRM 3NHQA 4FSFA 4R38A 3ZYTA 5HWTA 3BY9A 3OC2A 4KQOA 4WUJA 2GJ3A 2DMWA 2OOLA 3G6OA 3H82A 3H7WA 4BMWA 4EEPA 1G6OA 3T4KA 2PYPA 3KYZA 1OT9A 5DJUA 3H7WB 2HJ9C 3KYQA 2BASA 5EFWA 1V9ZA 4LRXC 4MMNA 5TBMA 3T4LA 2W3EA 4Q0IA 4HHDA 4GS9B 2EA9A 1OTAA 2VGLS 2VGLM 1P9RA 1T1AA 3BQ8A 3PHYA 4MN6A 4KUKA 3NOTC 5TBMB 3B33A 5K5BA 3E4PA 4JGQA 2P7JA 3VE4A 3KSGA 3LIFA 1OJ5A 1NWZA 3E4QA 4EU0A 3A0RA 4B9OA 2MJ6A 2W27A 2Z6DA 3LI8A 1LT0A 5HDCA 3T4TA 4GHIA 2A24A 2OWHA 3F1NA 4LRZE 4CQHA 2QWSA 4Y3IA 3NOPC 2FZ0A 3K3CA 2OAP1 4GHIB 5HD5A 2V9AA 3MF0A 1P97A 4EXOA 4H6JB 4HP9A 1EW0A 1T18A 2VLGA 3F1PB 4R70A 1LSVA 4CLCC 1XFNA 1NRJA 2O9BA 5F68A 2QYBA 1NLYA 2I9VA 4QPRA 3IBJA 2LB9A 3A0SA 4M4XA 4BWIA 5HDDA 2M7VA 2VV6A 3FPWA 5HDSA 4E04A 1N9OA 1LSXA 2VEAA 4EUVA 5LBRA 4KUOA 1VB6A 1S1ZA 3B47A 2WKPA 1DRMA 3S7NA 4F3LA 2FH5A 3MFXA 3ULFA 2W1TB 4G3VA 2PDRA 1W63M 2ZBBA 3C8CA 4I3IA 3MJQA 1VHMA 2O99A 2J3WA 3O5YA 2XA7S 2GNXA 1XFQA 2KDKA 3PBOA 4ETXA 3ZQ5A 1T1BA 5AVFA 1N9NA 3BQAA 2W3FA 3LI9A 3PBTA 1MZUA 5HL6A 4EESA 5HSQA 2L4RA 1BYWA 3RFBA 5HD3A 5A8BA 4O01A 2J80A 3MR0A 5J4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0O A;  5HWW A;  2PD7 A;  4GW9 A;  5KIZ A;  4I38 A;  3KX0 X;  4BBT A;  3MQQ A;  3IBR A;  4L9E A;  2ZOI A;  1UGU A;  4GS9 A;  1DP9 A;  1F98 A;  1XJ3 A;  2YKH A;  4WN5 A;  5IS1 A;  2V0W A;  4HP4 A;  4HQA A;  1JNU A;  2INW A;  4L9G A;  3RTY A;  1T1C A;  3UMD A;  3SW1 A;  3FC7 A;  3BY8 A;  2R78 A;  1GSW A;  4JGP A;  3K3D A;  4MN5 A;  4H6J A;  5DKL A;  5F69 A;  1TS0 A;  1T19 A;  3D72 A;  3F1P A;  5HZH A;  4HH2 A;  2QKP A;  1OJG A;  1DP6 A;  1DP8 A;  3UE6 A;  3VE3 A;  1TS6 A;  1OTE A;  4LLO B;  5AVE A;  1XJ2 A;  1S66 L;  4I3J A;  2W0N A;  3E4O A;  1TS7 A;  4XT2 B;  3UB7 A;  2VV7 A;  4YWZ A;  2HV1 A;  3GEC A;  5G4Y A;  3HJI A;  4I39 A;  4HY8 A;  4NXB A;  2V1A A;  1ODV A;  1V9Y A;  5IU1 A;  3RH8 B;  5DKK A;  2PR5 A;  1GSX A;  1D06 A;  3LIA A;  1D7E A;  1TS8 A;  3UB9 A;  3OLO A;  1OTI A;  5J3W A;  4RQ9 A;  2PHY A;  3A0V A;  4HOI A;  3GDI A;  2CMN A;  4HJ6 A;  1GSV A;  4LPZ A;  3CLO A;  2D01 A;  1OTD A;  2YKF A;  3PYP A;  2JN7 A;  3F1O B;  2V0U A;  4JGR A;  3LIB A;  3NJA A;  4LRY C;  4R3A A;  1S1Y A;  3IS2 B;  3MQO A;  3LIC A;  5F6A A;  5HWV A;  2ZOH A;  1OT6 A;  3ICY A;  3NOU C;  2OWJ A;  3EWK A;  3UME A;  4HH3 A;  3P7N A;  3LID A;  1P0Z A;  4K08 A;  4R6L A;  1XJ4 A;  4DJ3 A;  3H82 B;  3FG8 A;  5G4Z A;  3UB8 A;  5F5Y A;  4BBV A;  4WL9 A;  4DJ2 A;  3LUQ A;  2L0W A;  1G28 A;  1F9I A;  4L9F A;  3C2W A;  2Z6C A;  5DJT A;  3LIE A;  1XJ6 A;  2L1M A;  3H9W A;  4EW7 A;  4PKY A;  1WA9 A;  4XT2 A;  4EET B;  1UWN X;  3VOL A;  4HJ4 A;  2D02 A;  3MXQ A;  2A24 B;  3HJK A;  3F1N B;  5I5L A;  4PKY G;  4HNB A;  2V1B A;  3EEH A;  5J7E A;  4EER A;  4HIA A;  2PD8 A;  2JHE A;  1S67 L;  2QHK A;  4WLA A;  4I5S A;  4NXG A;  2KX6 A;  2K7S A;  1S4S A;  4HJ3 A;  3BWL A;  4EQ1 A;  4HI4 A;  1LSW A;  1N9L A;  2PR6 A;  3UB6 A;  1OTB A;  2B02 A;  4GCZ A;  3CAX A;  3LYX A;  4EEU A;  4F3L B;  4NXE A;  3CWF A;  4WF0 A;  3F1O A;  3T50 A;  2M1C A;  1UWP X;  1KOU A;  2H28 A;  2QJ5 A;  4KQD A;  4JGO A;  2WKR A;  3IS2 A;  4BBU A;  1LL8 A;  1S4R A;  2QJ7 A;  1Y28 A;  2WKQ A;  4I3A A;  2PYR A;  2VV8 A;  4NXF A;  3NHQ A;  4R38 A;  5HWT A;  3BY9 A;  4WUJ A;  2GJ3 A;  2OOL A;  3G6O A;  3H82 A;  3H7W A;  4EEP A;  2PYP A;  1OT9 A;  5DJU A;  3H7W B;  2BAS A;  5EFW A;  1V9Z A;  4LRX C;  5TBM A;  4HHD A;  4GS9 B;  2EA9 A;  1OTA A;  1T1A A;  3PHY A;  4MN6 A;  4KUK A;  3NOT C;  5TBM B;  3B33 A;  3E4P A;  4JGQ A;  2P7J A;  3VE4 A;  3LIF A;  1OJ5 A;  1NWZ A;  3E4Q A;  3A0R A;  4B9O A;  5HDC A;  2W27 A;  2Z6D A;  3LI8 A;  1LT0 A;  4GHI A;  2A24 A;  2OWH A;  3F1N A;  4LRZ E;  2QWS A;  3NOP C;  3K3C A;  4GHI B;  5HD5 A;  2V9A A;  1P97 A;  4EXO A;  4H6J B;  4HP9 A;  1EW0 A;  1T18 A;  2VLG A;  3F1P B;  4R70 A;  1LSV A;  1XFN A;  5F68 A;  2I9V A;  4M4X A;  3A0S A;  5HDD A;  2VV6 A;  4E04 A;  5HDS A;  1N9O A;  1LSX A;  2VEA A;  4KUO A;  1VB6 A;  1S1Z A;  2WKP A;  1DRM A;  4F3L A;  3MFX A;  3ULF A;  2PDR A;  2ZBB A;  3C8C A;  4I3I A;  3MJQ A;  1XFQ A;  2KDK A;  3ZQ5 A;  1T1B A;  5AVF A;  1N9N A;  3LI9 A;  4EES A;  1MZU A;  5HSQ A;  2L4R A;  1BYW A;  5HD3 A;  5A8B A;  2J80 A;  3MR0 A;  5J4E A; 
#chains in the Genus database with same CATH topology
 4IVI A;  4U0T A;  1G5U A;  1Z09 A;  1BLP A;  3NUL A;  4P6Z M;  3MQQ A;  2K31 A;  2ZOI A;  2X01 A;  1F98 A;  2WAE A;  2B95 A;  3CZD A;  3MZD A;  1ERQ A;  2XSS A;  4X1M A;  1JNU A;  3A3D A;  4O0P A;  1AXB A;  4UHU A;  4L9G A;  4WZ5 C;  4P87 A;  2NUT C;  2XRN A;  3UMD A;  3G2Y A;  5FAS A;  1E25 A;  3FC7 A;  4GOG A;  4MN5 A;  5M18 A;  2ZD8 A;  3VV4 A;  4H6J A;  2Q9N A;  5DKL A;  1YAX A;  2AVX A;  2Y2K A;  1KDW A;  1DY6 A;  5HZH A;  3WRT A;  4HH2 A;  1ZHH B;  2ACG A;  2E8I A;  1LLB A;  4JBF A;  1EWZ A;  1KE0 A;  3VP4 A;  1KVL A;  1OTE A;  3TSG A;  4GKU A;  4MEZ A;  5FSR A;  5JYP A;  3BFC A;  1S66 L;  4FTX A;  3ZHH A;  3NDE A;  3OPH A;  2W1T A;  3HJI A;  1W8Y A;  1PRQ A;  3G35 A;  4RYE A;  3WS5 A;  1V9Y A;  3RH8 B;  2FFF B;  3MZF A;  1EI5 A;  1I2S A;  1D06 A;  3LIA A;  1XXM A;  1GHI A;  4B93 A;  2WZZ A;  5FAQ A;  3UB9 A;  4YFM A;  3B42 A;  5J3W A;  2W3D A;  2GX5 A;  3SZT A;  4N92 A;  5E2H A;  3GDI A;  2CMN A;  1GSV A;  3CLO A;  2D01 A;  4ARZ B;  4CLC D;  4FOF A;  1SKO B;  4PM6 A;  3HUO A;  4ME4 A;  4JGR A;  2IWC A;  1CQA A;  3PBN A;  3MKF A;  1S1Y A;  3T4J A;  3CUE A;  3MQO A;  3LIC A;  5FAO A;  3ZVT A;  3LEZ A;  3QP8 A;  1VQQ A;  3QP2 A;  2E8J A;  1OT6 A;  5CER A;  3OCL A;  5CGS A;  2BLS A;  3UME A;  4LCM A;  2JKT M;  3LID A;  3ZG9 B;  4R4R A;  2WYX A;  1P0Z A;  5GHY A;  3TJZ C;  2PU4 A;  1Q2Q A;  2O9C A;  5G4Z A;  1ERO A;  1YLY A;  1ZTU A;  2JE5 A;  4DMZ A;  3OPR A;  3ZCZ A;  4JLF A;  4S2N C;  4Z1W A;  1VM1 A;  4RX3 A;  2L0W A;  4Q0J A;  4EV4 A;  1SDE A;  5DJT A;  1W63 Q;  3Q1F A;  3U2A A;  2GZA A;  3MXR A;  1YMX A;  3IX3 A;  4KZB A;  1IKG A;  1GCE A;  5DTK A;  5AQ9 A;  3SH9 A;  4U3T A;  4ID4 A;  4JXS A;  4Q8I A;  3S7P A;  4IHQ A;  4HJ4 A;  3V50 A;  5CED A;  4IBX A;  1KVM A;  5C5K A;  3E0Y A;  3MSH A;  4HIA A;  2PD8 A;  1G6A A;  3PAG A;  3BW6 A;  1XGJ A;  2Y2H A;  3DWZ A;  4KZ9 A;  2Y4A A;  2WAD A;  3E98 A;  2W1R A;  4CJN A;  4K0X A;  3Q7Z A;  3LR0 A;  1LSW A;  1IFQ A;  1DJA A;  2G2W A;  1BUL A;  1N9L A;  3EGX C;  3ZG0 A;  4D2O A;  5HPI A;  3BJN A;  4HEF A;  3IXH A;  2ZC4 B;  4WYY A;  1NZO A;  4U0X A;  4ARZ A;  2ZMF A;  3CWF A;  3PBR A;  1SKO A;  3MZE A;  5FQI A;  5EVI A;  1HTZ A;  1YLW A;  5IT5 A;  3L7H A;  1PI4 A;  1KOU A;  2H28 A;  3BLS A;  2XH9 A;  3ZG5 A;  3EOI A;  4R4S A;  3V67 A;  1MWU A;  1Y28 A;  2LB5 A;  4UEY A;  2ZM0 A;  3N8S A;  4I3A A;  4ZJ3 A;  1VEU B;  3AGD A;  3D3O A;  3ITA A;  4R38 A;  3ZFZ A;  3OC2 A;  4KQO A;  5GHX A;  3H7W A;  4BMW A;  1L2S A;  1JVJ A;  4PM7 A;  3VP0 A;  2P9V B;  3IX8 A;  1V9Z A;  4LRX C;  4MMN A;  1XPB A;  2X02 A;  4GS9 B;  2EA9 A;  3VOZ A;  4NG2 A;  3DW0 A;  3NOT C;  3VP3 A;  1FCM A;  2X71 A;  2DCF A;  4E3K A;  4RVA A;  1OJ5 A;  4B9O A;  2MJ6 A;  3LI8 A;  2Z6D A;  5EM0 A;  5HDC A;  5JYO A;  3LGO A;  1NY0 A;  4Y15 A;  3G31 A;  3S1Y A;  2ZM8 A;  3K3C A;  2PBY A;  3G4P A;  2JKF A;  3P98 A;  2Y59 A;  2O9B A;  1DJB A;  4IBR A;  1JTD A;  1ERM A;  2QYB A;  1NLY A;  2ZQC A;  4QPR A;  1FCN A;  3SS4 A;  4KZ3 A;  3LO7 A;  4EUZ A;  3FPW A;  2Y2I A;  2VEA A;  1WYB A;  4E6X A;  1PI5 A;  2I72 A;  4LV0 A;  1VB6 A;  1S1Z A;  2P74 A;  1SKF A;  4WZ5 A;  2WAF A;  1L3L A;  3MFX A;  1HVB A;  3SOI A;  1W63 M;  3M6H A;  3WRZ A;  3ZGA B;  1PW1 A;  4KZ8 A;  1VHM A;  1HD8 A;  4OP8 A;  2GNX A;  1IYP A;  2KDK A;  3V3S A;  1PW8 A;  2XFS A;  5G18 A;  3IWO A;  2W3F A;  5EOE A;  3UNW A;  5HD3 A;  5A8B A;  4O01 A;  4EBL A;  2J80 A;  3MR0 A;  1ALQ A;  1X0O A;  1L0E A;  3CJM A;  5KIZ A;  4DF6 A;  2A2L A;  3U4L P;  3IX4 A;  3UB5 P;  3IBR A;  4L9E A;  4IUH A;  2WUQ A;  3TW8 A;  1UGU A;  4GS9 A;  5FQQ A;  1YLJ A;  3LFV A;  1DP9 A;  2EX9 A;  2ZMV A;  2YKH A;  3QNB A;  1H8M A;  4NEE D;  2VGK A;  4NET A;  3UPN A;  4H8R A;  2H0T A;  1T1C A;  3OOV A;  3UO9 A;  1BZA A;  4KZA A;  3SW1 A;  5CHM A;  4DN0 A;  3C4P A;  3HLE A;  4BQM A;  1H5X A;  3QP1 A;  2R78 A;  5CHU A;  4KG5 A;  3IWI A;  2W3H A;  2EWW A;  1U60 A;  1YSQ A;  5EVI C;  4E3J A;  4BJP A;  4Y0U A;  3MQ0 A;  2QKP A;  3IWQ A;  3EQU A;  3LR5 A;  4Z9Q A;  1GA0 A;  1TS6 A;  1XJ2 A;  1YT4 A;  2JKG A;  2W0N A;  5L09 A;  2M7U A;  4OLD A;  1FOF A;  4XT2 B;  2VZW A;  4YWZ A;  3CI6 A;  4S2M A;  3DBA A;  5E2E A;  5L07 A;  4GDB A;  3S7Q A;  4KQR A;  2DRW A;  4KG2 A;  3HUN A;  2PAV P;  3BLM A;  3R4K A;  4S2N A;  3VP2 A;  4MBH A;  1GHP A;  3NY4 A;  4XUZ A;  3UPP A;  2XD5 A;  1ONH A;  3OLO A;  5DF7 A;  3HCY A;  3HLB A;  1OTI A;  3EGD C;  5EVI D;  5F83 A;  3A0V A;  3C30 A;  4OPZ A;  1JTG A;  4OVD A;  2YKF A;  3T4O A;  3PYP A;  2JN7 A;  3WWX A;  5EOO A;  3RXX A;  1CJF A;  2V0U A;  2HGV A;  2ZMA A;  1ESI A;  5CXW A;  3AGE A;  4R3A A;  1Z6F A;  2P08 A;  3HL9 A;  2HF6 A;  1N4O A;  4R0Q A;  1ACF A;  3LY3 A;  5F6A A;  3C38 A;  4QJG A;  3LEQ A;  2H10 A;  3EWK A;  3FKW A;  3P7N A;  1K54 C;  5D3O A;  1XJ4 A;  4S2O A;  3FG8 A;  4JF4 A;  2VGJ A;  4GJ4 A;  4CLC E;  4B88 A;  2XFT A;  1YKD A;  4BBV A;  4MNR A;  4PAU A;  1MBL A;  5KZH A;  4EQI A;  3O87 A;  1E3U D;  1G28 A;  3Q7V A;  1I5Q A;  4WEL A;  2C6W B;  3BEB A;  5HPF A;  2BTF P;  1F5M A;  2L1M A;  3BEC A;  1O7E A;  2J9O A;  3V39 A;  1I2W A;  4XT2 A;  5F1G A;  3ZNY A;  3CHW P;  4WM9 A;  2G7U A;  4BD0 A;  2D02 A;  3MXQ A;  5AJG A;  2A24 B;  1YLP A;  4Y17 A;  1BLC A;  4IED A;  3N8R A;  4EBP A;  4LFU A;  4I5S A;  5KSH A;  2KX6 A;  1W8Q A;  2J3T C;  3BRM A;  2K7S A;  5FI7 A;  4HJ3 A;  3BWL A;  3JVV A;  1M6K A;  4EQ1 A;  5GL9 A;  3QNC A;  4BD1 A;  5AQB A;  4DE2 A;  3T4Q A;  1TDG A;  3FWL A;  2PR6 A;  3M2J A;  3N7W A;  2ZQD A;  5EUA A;  3N6I A;  4DE1 A;  5M1A A;  1ZG6 A;  1FIL A;  4C75 A;  4MBF A;  4HES A;  1AWI A;  5FQJ A;  4KQD A;  1UWP X;  2QJ5 A;  4JGO A;  2XRO A;  2WKR A;  1LL8 A;  3N4I A;  1S4R A;  5EVI B;  3MS6 A;  1H3Q A;  3NDG A;  4MN7 A;  2Y79 A;  3KO6 A;  2VV8 A;  4JKT A;  1M40 A;  4FSF A;  1ZC2 A;  5HWT A;  1PWG A;  1FSY A;  5EV0 A;  2DMW A;  5EVE A;  4GZB A;  1G6O A;  5FAT A;  1ESU A;  3W4Q A;  3H7W B;  3KYQ A;  1C3B A;  5EFW A;  2XLN A;  4Q0I A;  4HHD A;  4DDS A;  2VGL S;  3OPL A;  4KEN B;  4ZTK A;  3BQ8 A;  3CG5 A;  1FR1 A;  4MN6 A;  2WGI A;  3B33 A;  5K5B A;  2BG1 A;  3E4P A;  3I7J A;  2HZ5 A;  4JGQ A;  4JF6 A;  1CI8 A;  3VE4 A;  1NWZ A;  3A0R A;  4PM9 A;  5HFO A;  1MWT A;  2ZC6 B;  3G2Z A;  1LL5 A;  2HP9 A;  2A24 A;  1MXO A;  1JWP A;  4LRZ E;  4CQH A;  2QWS A;  2EFU A;  5HD5 A;  4EXO A;  4DE3 A;  2EX2 A;  3T1Q B;  2Y2L A;  1PFL A;  1T18 A;  2VLG A;  3F1P B;  4R70 A;  1LSV A;  5CRF A;  3UPO A;  1XFN A;  5FI2 A;  1NRJ A;  3QHY A;  3VMA A;  3WS1 A;  2Q9M A;  4F94 A;  2LB9 A;  2EX6 A;  3G34 A;  2M7V A;  1S0W A;  5FDH A;  2RL3 A;  2WKE A;  1ES3 A;  2A49 A;  4BEN A;  4E3N A;  5I94 A;  2WGW B;  1MKI A;  4UA6 A;  3ULF A;  4G3V A;  1BLS A;  3JPU A;  3E2K A;  3C8C A;  1FR6 A;  4I3I A;  2O99 A;  3UDF A;  3ZVW A;  5BOH A;  2QMI A;  2H0Y A;  2J7V A;  3PBO A;  3ZQ5 A;  1RP5 A;  5AVF A;  3ISG A;  4PMA A;  3BQA A;  3LI9 A;  3VFF A;  4E3L A;  3WS4 A;  3PBT A;  1MZU A;  1KDS A;  5EEC A;  5L2F A;  5L10 A;  4GB7 A;  4MDZ A;  5HWW A;  1KE4 A;  3S22 A;  1XP4 A;  4I38 A;  4FCF A;  3KX0 X;  4Y2F A;  4BBT A;  1K55 C;  1XGI A;  3T1S A;  3QP5 A;  3C5A A;  5FI6 A;  3GQZ A;  3JVU A;  1XJ3 A;  4B4X A;  4WN5 A;  1RGZ A;  5AQ7 A;  3EQV A;  3R7W B;  2VX8 A;  4BLM A;  5IS1 A;  1LHY A;  3FPV A;  4HP4 A;  1PZP A;  4UQI M;  4R23 A;  4YNR A;  3HBR A;  2INW A;  4KZ4 A;  3ZNT A;  3RTY A;  1YLT A;  2JC7 A;  5CEB A;  5HAP A;  3GMW A;  4ZDX A;  4ZBE A;  5FEF A;  3BY8 A;  5GHZ A;  3C7U A;  4KZ6 A;  1E3U A;  1G68 A;  3A3F A;  2V2F F;  1GA9 A;  1GSW A;  4JGP A;  1OME A;  2VA0 A;  4WZ4 A;  3PXP A;  3A3I A;  4X56 A;  5F69 A;  1TS0 A;  1T19 A;  3D72 A;  3F1P A;  3IQA A;  3ZDJ A;  2PBD P;  4LV1 A;  5U47 A;  2FFY A;  3DAV A;  4OQI A;  5E43 A;  1L0G A;  1OJG A;  4GD8 A;  1DP8 A;  3UE6 A;  3VE3 A;  4LLO B;  4QD4 A;  5MC7 A;  2ZQ9 A;  4ZRR A;  1ES5 A;  2OSU A;  3PBS A;  5DVA A;  4I3J A;  4ZAM A;  1IEL A;  1TS7 A;  2WGW A;  5TGF A;  2HV1 A;  3GEC A;  3NEC A;  3MKE A;  1XX2 A;  1SDN A;  3DWK A;  4I39 A;  4IJG A;  1K54 A;  4GD6 A;  2W3G A;  3ZG7 B;  1P9W A;  1YLZ A;  1K56 A;  5IU1 A;  5DKK A;  4MLL A;  1DJC A;  3NBL A;  2WZX A;  1D7E A;  3T4S A;  3CPT A;  4OOL A;  3PBQ A;  1BTL A;  5CX7 A;  2R9W A;  1IYO A;  5GLA A;  4RQ9 A;  3P09 A;  5HAR A;  4HOI A;  3WS2 A;  3GV9 A;  4HJ6 A;  4LPZ A;  2O9A A;  2HDQ A;  2Y91 A;  3F1O B;  2UV0 E;  3LIB A;  4R3B A;  4C3Q A;  1PWD A;  3R7W A;  2QZ6 A;  3HLG A;  3LCE A;  1CEG A;  1D1J A;  2ZOH A;  4OQH A;  3P01 A;  3NOU C;  2EXA A;  3EEA A;  4UQI S;  3IH8 A;  2XD1 A;  4KG6 A;  3CMZ A;  3N8L A;  4R6L A;  4DJ3 A;  2IWD A;  3KSI A;  5KSC A;  2OAQ 1;  2H5S A;  3IXG A;  3UB8 A;  5F5Y A;  1Y4O A;  3QP4 A;  2ZLY A;  4L9F A;  2XEP A;  1FSW A;  1K38 A;  2CC1 A;  2Z6C A;  3C2W A;  3M6B A;  4EWF A;  4RX2 A;  4KZ7 A;  4B4Z A;  3TE8 A;  3Q7V B;  1XJ6 A;  5F1F A;  3W8K A;  4DXB A;  3QP6 A;  3H9W A;  1K4F A;  4EW7 A;  4X25 A;  4L0L A;  3HLC A;  2HP6 A;  4OON A;  1UWN X;  3VOL A;  2B5R A;  4HBU A;  5L8M A;  3TOI A;  3MBZ A;  1L0F A;  1SCW A;  1QME A;  2G2U A;  4K0W A;  4P0M A;  4KQQ A;  1WE4 A;  1H8Z A;  1TD5 A;  3LR4 A;  5I5L A;  4PKY G;  4HNB A;  2V1B A;  1K25 A;  3MMH A;  1MC0 A;  5HL1 A;  3FZC A;  5GLC A;  3A3J A;  1SZV A;  1SHV A;  2QHK A;  5TJJ A;  2R9X A;  2V8F A;  5J8X A;  2O0Y A;  1YQS A;  1CEF A;  4P6B A;  4UA9 A;  4QB8 A;  3UE3 A;  5FL3 A;  4GDN A;  2OLU A;  4C6Y A;  2KLI A;  2Y55 A;  1IEM A;  3O3V A;  1OTB A;  3MFD A;  3W4O A;  1IOU A;  3CAX A;  4N1X A;  3LYX A;  2Y2Q A;  4EEU A;  5FEG A;  2IA2 A;  4F3L B;  1BSG A;  4G3W A;  2EFX A;  3F1O A;  1KGF A;  3T50 A;  2M1C A;  2Y2M A;  1TF1 A;  3L9K A;  4S2K A;  4O7D A;  4PHT A;  3VSK A;  2WKQ A;  2KOI A;  4NK3 A;  4OQG A;  5TFQ A;  2PYR A;  2NUP C;  2ZL1 B;  4NXF A;  2JKR I;  3NHQ A;  3ZYT A;  3BY9 A;  1YM1 A;  2ZC3 B;  3B3X A;  3G6O A;  5CGX A;  4UA7 A;  4EEP A;  3ZG8 B;  1KGE A;  3DTI A;  1PWC A;  5EM1 A;  2A3U A;  5FQ9 A;  1H8Y A;  3KYZ A;  1H0M A;  1OT9 A;  3IF6 C;  2V20 A;  2BAS A;  3LY4 A;  2XR0 A;  5TBM A;  2W3E A;  2ZQ8 A;  1BT5 A;  4JPM A;  2VGL M;  1P9R A;  1Q2P A;  4X1L A;  3OZH A;  2P7J A;  3KSG A;  4GNU A;  1LI9 A;  3E4Q A;  2W27 A;  4WMC D;  1LT0 A;  1VET A;  4FH2 A;  1TDL A;  3V5M A;  5EVL A;  3WS0 A;  3IXB A;  4GHI A;  4CPK A;  4DRT A;  4E3O A;  5A90 A;  3Q81 A;  2WK0 A;  3HLF A;  2FZ0 A;  4ZJ2 A;  2OAP 1;  2V9A A;  2XGN A;  2Y2J A;  5CEC A;  4HP9 A;  3E2L A;  4CLC C;  1K6R A;  3GRJ A;  3PAE A;  4BL3 A;  1K55 A;  4M4X A;  3A0S A;  5DTS A;  4BWI A;  3BFE A;  4Y7P A;  2GDN A;  3TG9 A;  3M2K A;  2VV6 A;  4E04 A;  5HDS A;  1LSX A;  1PNE A;  1PZO A;  4JXV A;  4OPQ A;  4KUO A;  1XA7 A;  3B47 A;  2WKP A;  4OPR A;  5GLB A;  1K56 D;  4F3L A;  1ZKJ A;  4LEN A;  1ZG4 A;  2V8C A;  4DDY A;  1MPL A;  4QHC A;  3O5Y A;  1MWR A;  5F82 A;  1XFQ A;  5FQK A;  4QWO A;  1FIK A;  4ETX A;  1K57 C;  1LL9 A;  2ZQA A;  1T1B A;  4X69 A;  2ZL1 A;  5HL6 A;  4EES A;  2L4R A;  4HBT A;  3RFB A;  3GTC A;  5FDS A;  5J4E A;  3GSG A;  2J9P A;  3SS5 A;  2PD7 A;  4GW9 A;  1CI9 A;  4EBN A;  4P6Z S;  3TRC A;  2J3T D;  4YOF A;  5DF8 A;  2ZC5 B;  4OKP A;  4X53 A;  1FQG A;  2K2N A;  1ES4 A;  1S6R A;  1N9B A;  5FAP A;  2V0W A;  1W5D A;  3KSH A;  2Z2L B;  4HQA A;  2HDR A;  3VFH A;  4WEJ A;  5A91 A;  3S4X A;  4PM5 A;  3KSF A;  3G30 A;  4UAA A;  4Y0O A;  4FUW A;  3UE1 A;  1CK3 A;  3K3D A;  4DKI A;  2XK1 A;  1HLU P;  3VSL A;  1MKM A;  1IYS A;  2B18 A;  4Y0T A;  2HDS A;  5HX9 A;  1PYY A;  4OOM A;  1DP6 A;  1FCO A;  5A92 A;  3IXD A;  5AVE A;  4LV3 A;  1KE3 A;  3OCN A;  3E4O A;  3HUM A;  1KGG A;  4G3K A;  5A93 A;  3UDX A;  5E2F A;  3UB7 A;  2VV7 A;  5G4Y A;  3BFF A;  2WKI A;  4X55 A;  2J8Y A;  2JCH A;  4LV2 A;  2HDU A;  4IVK A;  1JWZ A;  5CHJ A;  4HY8 A;  4NKP A;  4JXW A;  4NXB A;  2V1A A;  4WEK A;  2ZM2 A;  3HLD A;  1PIO A;  3SS3 A;  5EE8 A;  2OV5 A;  1ODV A;  1BLH A;  2Y2N A;  5CTN A;  4JF5 A;  3IF6 B;  2PR5 A;  1GSX A;  5M19 A;  3GR2 A;  4JXG A;  2ZC7 A;  1TS8 A;  4ESP A;  1STZ A;  1YSP A;  2Y2G A;  3K2N A;  3RJU A;  2Y8H A;  2PHY A;  3IHA A;  3NC8 A;  1TVF A;  3CPT B;  3W2Z A;  4R3J A;  5HW3 A;  4WBG A;  2IWB A;  2DNS A;  1ES2 A;  1OTD A;  3S7O A;  4RA7 A;  5EPH A;  4S2I A;  3T1X A;  3BYD A;  4S2P A;  2HPB A;  5DFY A;  4PM8 A;  4Y13 A;  3NJA A;  3IT9 A;  4LRY C;  2QPN A;  3OPP A;  3IS2 B;  3FV7 A;  3UN7 A;  3OBF A;  4GLQ A;  3LR3 A;  4IUK A;  2VK3 A;  4CLC B;  5HWV A;  2C5W B;  3HRE A;  1MWS A;  3ICY A;  1L0D A;  4E6W A;  2OWJ A;  5HAQ A;  3NIA A;  4LGW A;  4KZ5 A;  4HH3 A;  3CIT A;  2JKT I;  3FKV A;  2P04 A;  3DTK A;  4K08 A;  1J9M A;  1K6S A;  4MBK A;  3H82 B;  4OOY A;  4QU3 A;  5CTM A;  4DJ2 A;  4Y5F A;  4WL9 A;  4DE0 A;  4DXC A;  3LUQ A;  3ITB A;  4AFI A;  3RXW A;  2Y2P A;  4WMC A;  1F9I A;  2EX8 A;  3LIE A;  4ETZ A;  3BFG A;  1YPR A;  2VJW A;  5AQA A;  1O07 A;  4PKY A;  1WA9 A;  1XKZ A;  4EET B;  1IKI A;  4II7 A;  2RCX A;  5DF9 A;  3HJK A;  3F1N B;  3EEH A;  1ONG A;  5J7E A;  4EER A;  2PT7 A;  3CUE C;  2JHE A;  1S67 L;  4E3I A;  4OLG A;  1OPX A;  3D4F A;  5E2G A;  4OQ0 A;  4WLA A;  4YIN A;  1NRF A;  4NXG A;  3PR6 A;  3IF6 A;  2PRF A;  3GVB A;  3Q07 A;  1S4S A;  4A5R A;  2ZJ9 A;  4N1H A;  1JWV A;  4FD8 A;  3BM6 A;  1NYM A;  2EXB A;  2ZQ7 A;  3C4O A;  4HI4 A;  2XDM A;  3AGF A;  2OLV A;  4P85 A;  1NYY A;  4MCW A;  1NLZ A;  3NCK A;  4N9L A;  3UB6 A;  2B02 A;  1HZO A;  4GCZ A;  4R1G A;  4Q0H A;  3VP1 A;  2EWV A;  4OP5 A;  4NXE A;  1F2K A;  4WF0 A;  3DTM A;  2UWX A;  2XA7 M;  3O86 A;  3SH8 A;  3G32 A;  4LCL A;  1RCJ A;  4PPR A;  5DTT A;  1TEM A;  2HJE A;  3KYE A;  3IS2 A;  4BBU A;  1XA1 A;  3PTE A;  1VEU A;  2Z2M B;  2QJ7 A;  3IH9 A;  4O8G A;  5DFX A;  3UDI A;  2VKS A;  4CLC A;  3HVF A;  2XQZ A;  1K4E A;  1RGY A;  2JKR M;  3IHB A;  3VOY A;  1E4D A;  4WUJ A;  2GJ3 A;  2OOL A;  2WKH A;  4S2J A;  2P9V A;  3H82 A;  1GHM A;  3NI9 A;  4OH0 A;  3T4K A;  3SH7 A;  4QY6 A;  3MXS A;  4GN2 A;  2PYP A;  1MY8 A;  5DJU A;  2HJ9 C;  2HP5 A;  3T4L A;  2JBF A;  1LI0 A;  1OTA A;  1T1A A;  3PHY A;  4KUK A;  4FH4 A;  4X68 A;  5TBM B;  4OPY A;  1NXY A;  5HAI A;  1NJ4 A;  2Y2O A;  3LIF A;  4XUX A;  5CGW A;  4EU0 A;  1K57 A;  4X6T A;  3T4T A;  2XF3 A;  5GLD A;  5IHV A;  2OWH A;  3F1N A;  4K91 A;  1VET B;  1NZU A;  3DTE A;  2PU2 A;  4Y3I A;  3NOP C;  1CF0 A;  3UE0 A;  3FYZ A;  1K0K A;  4GHI B;  3MF0 A;  1IYQ A;  3W4P A;  1P97 A;  4H6J B;  3IF5 A;  1EW0 A;  5F68 A;  2WGV A;  1A0K A;  3V3R A;  1J3W A;  2I9V A;  3IBJ A;  3HLW A;  4XXR A;  5HDD A;  4BL2 A;  2Q0O A;  1W79 A;  1N9O A;  3JYI A;  4N9K A;  1YMS A;  3O88 A;  4EUV A;  5LBR A;  5FQM A;  2V1Z A;  3Q82 A;  1QMF A;  1DRM A;  1Y54 A;  3S7N A;  4S2L A;  2FH5 A;  2W1T B;  1BUE A;  2PDR A;  2ZBB A;  5KMW A;  3A3E A;  3MJQ A;  3C7V A;  4D60 A;  2J3W A;  2XA7 S;  1WYC A;  4ZJ1 A;  3UY6 A;  1W7F A;  3BFD A;  1N9N A;  3T1R A;  3T12 B;  4E3M A;  5HSQ A;  4QY5 A;  1BYW A;  3D9Y A;  5TR7 A;  4M3K A;  5FA7 A; 
#chains in the Genus database with same CATH homology
 1X0O A;  4MDZ A;  5HWW A;  2PD7 A;  4GW9 A;  5KIZ A;  4I38 A;  4P6Z S;  3KX0 X;  2A2L A;  4P6Z M;  4Y2F A;  4BBT A;  3MQQ A;  3TRC A;  3IBR A;  4L9E A;  2J3T D;  4IUH A;  2K31 A;  3TW8 A;  4YOF A;  2ZOI A;  1UGU A;  4GS9 A;  3LFV A;  1DP9 A;  2K2N A;  1F98 A;  3JVU A;  1XJ3 A;  2ZMV A;  2YKH A;  4WN5 A;  3EQV A;  3R7W B;  1H8M A;  4NEE D;  2VX8 A;  2XSS A;  5IS1 A;  3FPV A;  2V0W A;  3KSH A;  4HP4 A;  4HQA A;  1JNU A;  4O0P A;  4UQI M;  4YNR A;  2INW A;  4WEJ A;  4L9G A;  3RTY A;  1T1C A;  3OOV A;  2NUT C;  2XRN A;  3UMD A;  3SW1 A;  3KSF A;  3FC7 A;  4DN0 A;  3BY8 A;  2R78 A;  1GSW A;  4JGP A;  2VA0 A;  3PXP A;  2W3H A;  3K3D A;  4MN5 A;  2EWW A;  1YSQ A;  3VV4 A;  4H6J A;  5DKL A;  5F69 A;  1TS0 A;  1T19 A;  1YAX A;  3D72 A;  3F1P A;  4BJP A;  5HZH A;  1MKM A;  4HH2 A;  1ZHH B;  3MQ0 A;  2QKP A;  2B18 A;  3EQU A;  1OJG A;  4OOM A;  3LR5 A;  1DP6 A;  1DP8 A;  3UE6 A;  3VE3 A;  1TS6 A;  1OTE A;  4LLO B;  5AVE A;  1XJ2 A;  5MC7 A;  4ZRR A;  1S66 L;  3PBS A;  4I3J A;  3OCN A;  2W0N A;  3E4O A;  1TS7 A;  2M7U A;  4G3K A;  4XT2 B;  2VZW A;  3UB7 A;  2VV7 A;  4YWZ A;  3CI6 A;  2HV1 A;  3GEC A;  5G4Y A;  3DBA A;  2W1T A;  3HJI A;  4I39 A;  4IJG A;  2W3G A;  4HY8 A;  3S7Q A;  4NKP A;  4NXB A;  2V1A A;  4WEK A;  1P9W A;  1ODV A;  1V9Y A;  5IU1 A;  3RH8 B;  5DKK A;  3R4K A;  2PR5 A;  1GSX A;  1D06 A;  3LIA A;  1D7E A;  3T4S A;  4B93 A;  1TS8 A;  4OOL A;  3UB9 A;  3PBQ A;  1STZ A;  1YSP A;  3OLO A;  3HCY A;  5CX7 A;  3B42 A;  1OTI A;  3EGD C;  3K2N A;  2Y8H A;  2W3D A;  5J3W A;  4RQ9 A;  2PHY A;  2GX5 A;  3A0V A;  3C30 A;  4HOI A;  3W2Z A;  3GDI A;  2CMN A;  4HJ6 A;  1GSV A;  4LPZ A;  2O9A A;  3CLO A;  2D01 A;  4ARZ B;  1OTD A;  4FOF A;  3S7O A;  4CLC D;  2YKF A;  3T4O A;  3PYP A;  2JN7 A;  3F1O B;  2V0U A;  2HGV A;  5DFY A;  4ME4 A;  4JGR A;  3LIB A;  3PBN A;  3NJA A;  4LRY C;  4R3A A;  1S1Y A;  3IS2 B;  3T4J A;  3CUE A;  3MQO A;  3R7W A;  3LIC A;  2P08 A;  2HF6 A;  3OBF A;  4GLQ A;  3LR3 A;  4IUK A;  4CLC B;  5F6A A;  3C38 A;  5HWV A;  2ZOH A;  1OT6 A;  3ICY A;  3P01 A;  3NOU C;  2OWJ A;  3OCL A;  3EWK A;  3UME A;  3EEA A;  4UQI S;  4HH3 A;  3CIT A;  3P7N A;  2JKT I;  2JKT M;  2P04 A;  3LID A;  1P0Z A;  4K08 A;  4R6L A;  1XJ4 A;  3TJZ C;  4DJ3 A;  3H82 B;  3FG8 A;  3KSI A;  2O9C A;  5G4Z A;  1ZTU A;  2OAQ 1;  4DMZ A;  4GJ4 A;  4CLC E;  1YKD A;  3UB8 A;  5F5Y A;  4Y5F A;  4WL9 A;  4Z1W A;  4BBV A;  4DJ2 A;  4PAU A;  3LUQ A;  4AFI A;  2L0W A;  1G28 A;  4Q0J A;  1F9I A;  4L9F A;  4WEL A;  5HPF A;  3C2W A;  2Z6C A;  5DJT A;  1W63 Q;  3LIE A;  3U2A A;  2GZA A;  3TE8 A;  1XJ6 A;  4ETZ A;  1F5M A;  2L1M A;  2VJW A;  3H9W A;  4EW7 A;  4PKY A;  1WA9 A;  4L0L A;  4XT2 A;  4EET B;  1UWN X;  3S7P A;  4IHQ A;  5L8M A;  3VOL A;  4HJ4 A;  4II7 A;  2G7U A;  2D02 A;  3MXQ A;  5AJG A;  2A24 B;  5DF9 A;  3HJK A;  1TD5 A;  3F1N B;  3LR4 A;  5I5L A;  4PKY G;  4HNB A;  2V1B A;  3EEH A;  3MMH A;  3E0Y A;  5C5K A;  5J7E A;  4EER A;  2PT7 A;  1MC0 A;  4HIA A;  2PD8 A;  3BW6 A;  2JHE A;  1S67 L;  3CUE C;  1OPX A;  2QHK A;  4WLA A;  4I5S A;  4NXG A;  2KX6 A;  5KSH A;  3PR6 A;  2J3T C;  5TJJ A;  2K7S A;  3E98 A;  1S4S A;  4HJ3 A;  3BWL A;  3JVV A;  2W1R A;  4EQ1 A;  2O0Y A;  3LR0 A;  4HI4 A;  1LSW A;  3T4Q A;  1IFQ A;  3UE3 A;  5FL3 A;  1N9L A;  3EGX C;  1NLZ A;  4MCW A;  2KLI A;  5HPI A;  3BJN A;  2PR6 A;  3UB6 A;  1OTB A;  2B02 A;  4GCZ A;  1IOU A;  3CAX A;  4Q0H A;  3LYX A;  4EEU A;  4ARZ A;  2IA2 A;  2ZMF A;  2EWV A;  4F3L B;  4NXE A;  3CWF A;  3PBR A;  4G3W A;  4WF0 A;  3F1O A;  2XA7 M;  3T50 A;  2M1C A;  1TF1 A;  5IT5 A;  1UWP X;  1KOU A;  2H28 A;  2HJE A;  2QJ5 A;  4KQD A;  4JGO A;  2XRO A;  3EOI A;  2WKR A;  3IS2 A;  4BBU A;  1LL8 A;  3V67 A;  4PHT A;  1S4R A;  2QJ7 A;  1Y28 A;  2LB5 A;  4UEY A;  2WKQ A;  4O8G A;  5DFX A;  1H3Q A;  2KOI A;  2VKS A;  4MN7 A;  4CLC A;  2Y79 A;  3KO6 A;  4I3A A;  2PYR A;  2VV8 A;  2NUP C;  3D3O A;  4NXF A;  2JKR I;  2JKR M;  3NHQ A;  4FSF A;  4R38 A;  3ZYT A;  5HWT A;  3BY9 A;  3OC2 A;  4KQO A;  4WUJ A;  2GJ3 A;  2DMW A;  2OOL A;  3G6O A;  3H82 A;  3H7W A;  4BMW A;  4EEP A;  1G6O A;  3T4K A;  2PYP A;  3KYZ A;  1OT9 A;  5DJU A;  3H7W B;  2HJ9 C;  3KYQ A;  2BAS A;  5EFW A;  1V9Z A;  4LRX C;  4MMN A;  5TBM A;  3T4L A;  2W3E A;  4Q0I A;  4HHD A;  4GS9 B;  2EA9 A;  1OTA A;  2VGL S;  2VGL M;  1P9R A;  1T1A A;  3BQ8 A;  3PHY A;  4MN6 A;  4KUK A;  3NOT C;  5TBM B;  3B33 A;  5K5B A;  3E4P A;  4JGQ A;  2P7J A;  3VE4 A;  3KSG A;  3LIF A;  1OJ5 A;  1NWZ A;  3E4Q A;  4EU0 A;  3A0R A;  4B9O A;  2MJ6 A;  2W27 A;  2Z6D A;  3LI8 A;  1LT0 A;  5HDC A;  3T4T A;  4GHI A;  2A24 A;  2OWH A;  3F1N A;  4LRZ E;  4CQH A;  2QWS A;  4Y3I A;  3NOP C;  2FZ0 A;  3K3C A;  2OAP 1;  4GHI B;  5HD5 A;  2V9A A;  3MF0 A;  1P97 A;  4EXO A;  4H6J B;  4HP9 A;  1EW0 A;  1T18 A;  2VLG A;  3F1P B;  4R70 A;  1LSV A;  4CLC C;  1XFN A;  1NRJ A;  2O9B A;  5F68 A;  2QYB A;  1NLY A;  2I9V A;  4QPR A;  3IBJ A;  2LB9 A;  3A0S A;  4M4X A;  4BWI A;  5HDD A;  2M7V A;  2VV6 A;  3FPW A;  5HDS A;  4E04 A;  1N9O A;  1LSX A;  2VEA A;  4EUV A;  5LBR A;  4KUO A;  1VB6 A;  1S1Z A;  3B47 A;  2WKP A;  1DRM A;  3S7N A;  4F3L A;  2FH5 A;  3MFX A;  3ULF A;  2W1T B;  4G3V A;  2PDR A;  1W63 M;  2ZBB A;  3C8C A;  4I3I A;  3MJQ A;  1VHM A;  2O99 A;  2J3W A;  3O5Y A;  2XA7 S;  2GNX A;  1XFQ A;  2KDK A;  3PBO A;  4ETX A;  3ZQ5 A;  1T1B A;  5AVF A;  1N9N A;  3BQA A;  2W3F A;  3LI9 A;  3PBT A;  1MZU A;  5HL6 A;  4EES A;  5HSQ A;  2L4R A;  1BYW A;  3RFB A;  5HD3 A;  5A8B A;  4O01 A;  2J80 A;  3MR0 A;  5J4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...