3VFEA

Virtual screening and x-ray crystallography for human kallikrein 6 inhibitors with an amidinothiophene p1 group
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
222
structure length
222
Chain Sequence
LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human kallikrein 6 inhibitors with a para-amidobenzylanmine P1 group identified through virtual screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-6
total genus 54
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vfeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vfeA02
2XWAA 2PUXB 3D23A 1SGYE 2VIPA 5FPSA 1MU6B 4SGAE 1FV9A 3ATIA 6GCHG 3L3TA 1BTHH 3P8FA 1HAGE 3MU1A 3GCNA 1ZTJA 1JMOH 2ZZUH 1ETTH 4AG1A 3ZVGA 1QB9A 1H4WA 5HXFA 2O8WA 2ZHWH 1UK3A 4JK5A 2Z9KA 2FOAA 4VGCC 1MTSA 2VINA 2I6SA 1QY6A 1HPGA 3SGBE 3QZRA 2C8ZB 2ZU4A 4BAHB 1GVKB 3OX7U 1GDUA 4Y11E 1TE0A 3TH3H 5TCAA 1F0SA 5DGJA 2K1QA 3UNQA 3W94A 1G3CA 4IW4E 2FX6A 3M5OA 3ESTA 3MH4A 1L1JA 1C5XB 1ESAA 2J4IA 3TH4H 1E38B 1FXYA 2XBYA 1P3CA 1ZTKA 3LC5A 1DLEA 3JZ2B 3UPEA 5HYOA 4ZKOU 1F5RA 1MMJN 1RTFB 5DP4A 1C5QA 3FP6E 1KXCA 3HKJB 1HIAB 2ZA5A 5JDUB 1HAOH 2HNTF 3E6PH 3SZNA 2AGIX 1EAWA 1V2OT 2QXHA 2BD7A 1MKWK 3MU8A 2ALPA 2UUFB 5EQQA 4OS7A 1EPTA 1WCZA 1TB6H 3RXTA 1TLDA 1UTLM 1L1GA 1QURH 4GVUA 1CA0C 5ESTE 3SORA 2O8TA 4I8HA 1CU1A 1KLTA 2BDAA 2CJIA 4ABEA 1G3EA 1EZSC 5AFYH 1GJ6A 2V3OH 3SNEA 1FDPA 1LQDB 1P05A 1AFQB 2C90B 1ANBA 1PJPA 3URDA 3HATH 1V2VT 2C93B 3TJUA 3U8TH 4GCHG 2FXRA 4INHA 1CA0B 1HAYB 3OTJE 4CH8B 1ETSH 1Q3XA 2J38A 3PYHA 3RXJA 2GCTC 2IJOB 1ABIH 1DANH 3MMGA 3PWBA 2H5DA 1O34A 1NTPA 5DP9A 1V2PT 3RMLH 2WPMS 1LVOA 3KQDA 5FBEA 2BDYA 2FYQA 3H7TA 3GY4A 1CT4E 2QC2A 2HNTE 3T62A 1V2JT 3E90B 3A89A 4ZHLU 1OWEA 1GHBG 3BV9B 1TABE 2W5EA 3OY5U 4RKOB 1BMAA 1AWHB 4Z0KA 2A2XH 3NPSA 1TA6A 5EXNA 1MKXK 1WQSA 2ZDNA 1J8AA 2UWLA 3TITA 2GCHG 5L6NH 2ZDLA 6GCHF 3KQBA 4H4FA 5BPEA 1P2KA 1GJDB 1K21H 2AYWA 1H1BA 3RXHA 3S7KB 8ESTE 2ZIQH 2JKHA 7GCHF 4X8TH 3RXMA 1O3DA 2ZHFH 2IPHA 3RLYH 1ELVA 1SHYA 1O5FH 3AASA 2VVUA 3JZ1B 1L4DA 1PQAA 3RU4T 4FUGA 1K28D 4J2YB 1KDQA 1TNIA 4B75A 1IAUA 1N1LA 3TK6A 2BLVA 4XE4A 5FX6A 4ABBA 1YPLH 1OP0A 2Y5GA 2VH0A 1QB6A 1MD7A 3SV6A 2P59A 4WF8A 4D76A 3SV7A 4JZEH 3CENA 2VIOA 3S7HB 1G9IE 3TIUA 3OSYA 5A0AE 1M9UA 5E0GA 1O2PA 4X2YA 1SFQB 3R3GB 4JK6A 2RG3A 2AS9A 1PPEE 1K9OE 4NWKA 5E8EH 4YO9A 1GBBA 3O8CA 1KLJH 2G52A 3QK1A 4KGAA 1VITH 2ZQ2A 1QJ7B 1O35A 3A82A 1OX1A 4ZHAA 3ODDA 1GHVH 1AUTC 1AWFH 1EOLA 4BANB 3VB3A 3PB1E 1EX3A 2F9BH 1D6WA 2ODPA 1G32B 1ARCA 1TBQH 2QV1A 2XBXA 2SFAA 3V0XA 1A0LA 2JETC 5FPTA 2HALA 1GI4A 4Y0ZE 2XW9A 3RUOA 3ZZ6A 4R0IA 1EPTC 4HFPB 1LVBA 2O8LA 1WQVH 2GZ9A 1C4Y2 2Q6DA 5AF9H 4UONA 1GHAG 2XRCA 1XUJA 3A8DA 1O2OA 2F9OA 1GI7B 3Q3KA 1W0YH 1LQEA 3GCHC 3ZVCA 2THFB 2ZHQH 3A8CA 1TPPA 1NN6A 2ZC9H 3GDUA 1ANDA 1MQ6A 2NWNA 5JBAS 1ZSLA 2PGBB 3BF6H 4WXIA 1QGFA 1BOQA 2ZCHP 3Q77A 2AMPA 1W2KH 3A7TA 1GL0E 2TPIZ 4O3TA 1FLEE 5E2OA 3BTFE 1QBNA 3KNXA 1JRTA 1MAXA 1TBZH 1C2MA 1K1LA 2D2DA 3A80A 1AI8H 2ZPRA 4UDWH 2XC0A 2BTCE 3G01A 2FO9A 2Y7ZA 1Z6EA 2SGPE 4DCDA 1SGNE 2GVFA 3BIUH 1BTXA 1ARBA 3QTOH 1DY8A 1P57B 2BQ6B 2WPLS 2EEKA 2BLQA 4O97A 3BSQA 4UFEH 3S69A 2B0FA 4AGKA 1YBWA 1O3IA 1NY22 4MLFB 2FI5E 1O33A 1O3CA 3VFEA 2P8OB 4WMEA 1D3TB 4BAMB 1UCYH 1GBCA 1QA0A 4DOQA 1C1NA 1C1SA 8LPRA 1AKSA 3A7XA 2ZECA 3GY2A 3RXEA 1CE5A 2B5TB 3RM0H 4DW2U 1J15A 1C2IA 1TPOA 1V2WT 2VWOA 2XWBI 3PTNA 1MTUA 4K1SA 1EZQA 3MO3A 1PQ8A 3VB7A 6CHAC 3MYWA 1YPGH 2BD8A 2BQWB 1ZJKA 1XXFA 2AMQA 1O3AA 3P70B 2RCEA 5L2YH 4BXWA 1A2CH 3SI3H 5LGOA 3UUZA 3ZZBA 1NU7B 3F1SB 4X6NA 4ZAEA 2J92A 1BMNH 4INKA 1BIOA 5JBBS 1DE7H 5LPRA 5FHTA 5T6DA 5AHGH 1SL3A 1L0ZA 1T8NA 1KDQB 1BMLA 2CV3A 3TGKE 2Z9LA 1DWDH 4FU9A 1O30A 1HAIH 3V3MA 4AX9H 2ODYB 4BTUB 1CO7E 1F2SE 2VIWA 2WYJA 1ELAA 1NRSH 1D3DB 2XNIA 4CR5A 3M61U 5A8XA 3SHAH 3ZVAA 2GZ7A 4K1EA 4H6TA 4WXVA 2AH4X 3LJOA 1GJ9B 2UUKB 3RXCA 3HPTB 4D7FA 1LDTT 2BD3A 2EC9H 3SNDA 1VITF 4GHTA 1QRZA 3FZZA 2GV6A 2BM2A 2FDAA 2BX3A 3A7YA 3T28A 4A7IB 2PHBA 2VIDA 3NUMA 1GI2A 4PROA 4Q80A 4IBLH 1XXDA 2FOMB 2ZGBH 3KIDU 3ZZ4A 3MU0A 4UEHH 1EATA 3LOXA 4JYUH 4YLUA 1O5DH 4AYVB 1T31A 2PSYA 1MCTA 2FLRH 4D8NA 1S5SA 1XKAC 1SG8B 3VPKA 4KTUA 3ZYDA 3T26A 2PKAA 3QO6A 3RMNH 1TWXB 2G4TA 4ESTE 1RTKA 1AY6H 4JYVH 1P9SA 4WY3A 5FAHA 2OP9A 1GI1A 1O2NA 2GV7A 3F9HA 5I46H 1K1JA 4Q7XA 1Q31A 4OS2A 2FIRH 1C4U2 2ODQA 1AE8H 2A5AA 5HGGA 1YPKH 2BDGA 4THNH 1NT1A 1QHRB 2BXUH 1IQLA 2FOEA 4TWWA 1TONA 1A5IA 4DT7B 3M35A 3SUEA 4F4OC 7KMEH 1AVXA 1ZR0A 3A8AA 1VR1H 4OGYA 6CHAB 2OCVB 2R3YA 1F0UA 5A09A 1HAVA 1C2FA 5L2ZH 1GBEA 2GT7A 4FUEA 1TMBH 3LGVA 1TNHA 1O2UA 2QCYA 2BY7X 4Y10E 1O3MA 2BMGB 2ZU5A 1HUTH 2BLOA 2QYIA 3BG4C 1QQUA 4WVPE 4YOIA 1FPHH 3TGIE 1K2I1 1LKBA 4DG4A 1C5LH 5ABWA 1EJAA 2AIQA 1GG6B 2WPKS 1KSNA 3NCLA 4XFQA 1O2VA 1D3PB 4ISIH 1F92A 1QL9A 4DJZB 4TY6A 4Y8ZA 4AB9A 3MFJA 2ZP0H 2Q6FA 3DFLA 2Z94A 4X8SH 1L2EA 4B2CA 3ITIA 1ZRKA 2CN0H 3MNCA 1TX6A 2PUQH 3BIVH 1ZJDA 1B5GH 3SNBA 3EA8A 2GCTB 2OBOA 1ZTLA 2W3IA 2VNTA 2BVSH 1NM6A 3MH5A 4FU7A 3B23B 1O2QA 2PW8H 2BD4A 3A84A 1TRMA 1QL8A 4AFSA 4BOHA 1O2MA 4NSVA 2J95A 1GMDG 3MNXA 1WV7H 2BVXH 1WYKA 1ESBA 4ISLA 2CGAA 5GDSH 1W7XH 1YM0A 1O5BB 2PKSB 3D49H 3TK9A 1TNJA 2A4RA 5CHAB 3MWIU 1OOKB 3A7WA 2A4GA 2CF8H 1LKAA 2W26A 1O5AB 2BY6X 3SGAE 1ELEE 1GHYH 1HGTH 3M5MA 1EPTB 2TRMA 1GVZA 1W11U 3RU4D 3UFAA 1V2ST 4FUJA 2VH6A 3QZQA 4O9VA 1GWAA 1Y3XA 3EA9A 1FPCH 2ZGCA 3QX5H 1P01A 1UTOA 1HCGA 1KIGH 3IITA 1KTSB 3ZVEA 3UIRA 1IQMA 1CHGA 4ZH8A 1L1NA 2SGFE 1XX9A 2BOKA 3AAUA 1TOCB 2W7SA 2G55A 5GWZA 2HLCA 1A46H 2Y7XA 4Y6DA 2D1JA 1AO5A 3E1XB 2UWOA 4MTBA 1SGPE 2ZCLP 1UVPA 3P6ZB 2ZI2H 1P8VC 2Y5HA 1W0ZU 2DUCA 1VCWA 1IQNA 1SMFE 2QF0A 3LGYA 5EXMA 1FAXA 1BCUH 1O2XA 2BQ7B 1F0TA 3ELAH 2BYAX 1C1RA 4TPYA 1O2JA 1C2JA 2OC1A 4WH8A 1S83A 1GHZA 2A32A 1ACBE 3LJJA 1FY5A 1UVUH 1OWKA 5F6MA 3SV2H 3UWJH 1ZOMA 4KTSA 2O8UA 1C2EA 1WOFA 1MTNB 4X2VA 4ZHMU 3LKWA 3TLOA 2DE9A 1GHWH 1CVWH 2WUCA 1UCYE 1F5LA 2TGTA 4CREA 3BTGE 1IQJA 2SNWA 1YPMH 1O3LA 5EOKA 3RXVA 3RMOH 1ZYOA 3M7UA 1C5PA 1N8OB 4Y7AA 2XC5A 1GI9B 3PLKA 1EJNA 5IYTA 1GMDF 1SLUB 5CE1A 4AGJA 1ESTA 1G2MA 1W3CA 3SUGA 3SU0A 1S82A 4Y76A 1C9PA 1H8DH 1P09A 4Y0YE 1Z8IB 3FANA 1OPHB 9ESTA 3F9GA 3Q76A 3QDZB 4D9QA 1GJ7B 1SBWA 2SNVA 3HK6B 1N6XA 3GY3A 1KXDA 1DX5M 2R2MB 4Q2KA 5DP7A 4K8BA 1EZXC 1FIZA 1ZMLA 4CR9A 2OTVA 1O5EH 2F9VA 3T2NA 1QRXA 1SGFG 2RDLA 4D9RA 2STAE 1FI8A 1ELGA 1TOMH 1AVGH 1PYTC 1HJ8A 1MH0A 1HJAC 3PMBB 1EXFA 2EI7A 2PFEA 4KKDA 1B7XB 3RXSA 1UTKA 3MH7A 1GHXH 4JCNA 2JH0D 1TRYA 2VGCB 5FX5A 1HAZB 2OC8A 2GX4A 3U69H 4YESB 1RD3B 1PYTD 2FYRA 1AFQC 1EAIA 1OWIA 3E0PB 1DY9A 2FPZA 1UVTH 3RXPA 1A3BH 4ABJA 1V6DA 2A4OA 5E0HA 1G2LA 2EI6A 3T29A 2ZNKH 1CBWC 1YF4A 2WPIS 3PO1C 1SQTA 4U2WA 1A1RA 2H5CA 2D8WA 1KY9A 3P17H 1Y5AT 1FJSA 3PTBA 4CRFA 1WUNH 1W10U 4X6MA 1V3XA 1DWEH 4I8LA 1BRBE 1SGFA 1TA2A 3MU4A 5A8ZA 2O9QA 3TK5A 1NS3A 1DWCH 3U98H 2QGRA 2FOGA 1A7SA 4X1PU 1GDNA 2Y5FA 2WV5A 4OS6A 4ABAA 4AOQA 1ZMNA 1LHDH 1LPZB 2XCFA 2FTLE 2ZGXH 4Y79A 2ZCKP 4E7RG 1GBTA 1BBRH 4HI3A 1BTWA 5EW2H 3K6YA 3ZZ5A 1C1OA 1GMHF 2NU0E 1HXEH 2GTBA 5DP6A 3RC4A 4AFUA 3O8BA 1L4ZA 1LHFH 1O2IA 2PSXA 4UFFH 4DURA 2ZDAH 5F03A 1SB1H 1O3KA 5BRRE 3BEIB 2QAAA 3RXUA 2WYGA 5L30H 3NZIA 1DITH 2B7DH 3GYMA 1O2RA 1OXGA 3Q3XA 1UTPA 5T6GA 1C1QA 1GJ4H 4OGXA 1XUHA 3SW2B 4CRGA 1S0RA 4ASHA 2PTNA 2BVRH 3ZV8A 2R2WU 3UR9A 2VU8E 4YLQH 1YLDA 1ZPZA 5AVDA 2ANYA 3P8OA 3PMHB 2WINI 3KQEA 1X7AC 4AFZA 1VCPA 3DT0H 1MKXH 1MUEB 2Z9JA 1P2MA 2AGEX 4OS4A 3A86A 1BITA 4ZMAH 4NIWA 1C5YB 4DIHH 1F0RA 1T8OA 1NFXA 3A8BA 1C2GA 1N6YA 3BG8A 4AYYB 3STIA 1Q2WA 3EAJA 4UE7H 5JB8S 1BZXE 3KN2A 2FWWA 1F5KU 3UWIA 4A5TS 3TGJE 4XBCA 3PLBA 3GYLB 4O3UA 1T8LA 1SSXA 1G3DA 4H6SB 1GCDA 1FN6A 2ZHEH 1DWBH 2FM2A 8KME2 2BDCA 2OD3B 1ZZZA 3LONA 4NA7A 5HM9A 5JYIA 2W7UA 1RJXB 1FIWA 1LVMA 3MOCA 5EGMA 2GMTC 2TIOA 1AB9C 3RXIA 1T32A 3K6ZA 1C1MA 4FUFA 2F91A 2IN2A 3S9BA 3QWCH 4HTCH 2AIPA 4NZLA 3LGWA 3ZVFA 1NZQH 1FNIA 2FZZA 1KYNA 1Z8GA 1NO9H 1O2SA 2A1DB 3GCOA 2ZKSA 3BTQE 4KTCA 5SGAE 3KGPA 2G51A 2KAIB 3RP2A 2H9TH 1TMUH 4X2XA 1GMCF 2P93A 4ABGA 4IMQA 3TNSA 4UFDH 1TGBA 1AZZA 1XUFA 1S84A 1C5VA 1BHXF 2BY9X 1AMHA 2FS9A 2JH5D 2ZHDA 3Q00A 4YZUA 5J4QA 2YNAA 2ASUB 5J4SA 3ATMA 3VB5A 2PKAB 3MH6A 3M3SA 1Z1JA 1VGCB 1SGQE 3VXEH 4AZ2B 1AIXH 1MBMA 1A4WH 4IN1A 2VVVA 1W14U 1YPHE 1V2LT 4H42U 3SNCA 1SC8U 1MQ5A 4ZUHA 2G5VA 2XCNA 1P2JA 1A61H 4I32A 1PQ7A 2QIQA 3EDXB 2BD5A 2PV9B 1BDAA 1BJVA 2Z3DA 3SUDA 3A85A 2XYAA 4BNRA 1J14A 4MPXA 2IOTA 2BD9A 4AB8A 2NU2E 4Z6AH 3ATWA 3WY8A 1KXEA 3SNAA 1GHAF 1AHTH 2CHAB 3ZZDA 3FP7E 2QA9E 3BTEE 1ELTA 2ILNA 4M7GA 1FAKH 4ZKRU 3KF2A 2GT8A 5EU8A 2RA0A 3SU2A 1P03A 4WH6A 2BXTH 2NU4E 1FZZA 3F68H 1DM4B 1HAVB 1KXBA 1ELCA 3D65E 3RXOA 2A45B 1P3EA 4FVBA 4ZROA 4B73A 1HV7A 3HK3B 3P8GA 5EXLA 1TYNA 3EGKH 1O2YA 4GHQA 1O5GH 1AE5A 2ZPSA 3HGNA 1O0DH 4A6LA 1D3QB 1THPB 5C5NA 1Z1IA 2YNBA 1BJUA 2BB4A 3EYDA 2P95A 5GCHF 3T27A 5E0JA 1O2WA 3DUXH 2NU3E 4KP0A 3PV4A 2Y80A 4X8VH 3ZZ7A 1GJBB 3GISB 2ZGJA 3I78A 1C5UA 3UQOA 3OYPA 3SU4A 3UOUA 4TY7A 4KELA 4CBOA 5I25A 1Z6JH 1Z7KA 2P3TB 2QXGA 1JXPA 3E16B 5ETXA 5T3HA 1TAWA 8GCHG 1O2HA 1ZLRA 4E06H 1O3PB 1CGIE 3SI4H 3MNSA 1DSTA 3GCTF 2M5TA 4BAOB 1BBRE 3ODFA 1HRTH 1PPFE 2ZFQH 1E36B 5E2PA 2ZFPH 3NXPA 1JIRA 3PLPA 3UREA 1IQGA 1KXAA 3RXLA 1SGEE 4NIVA 2ANWA 2D26C 4RKJB 1IHTH 2F9NA 1IQEA 4U32A 1DXWA 2OXSA 1EKBB 3PO1B 2W3KA 1YCPH 5CHAC 1CBWB 1TPAE 2Z3EA 3LDXH 2RA3A 1CGHA 2Z9IA 1O31A 4XDEA 2HOBA 1GGDB 1EB1H 3VB4A 3A88A 3BEUA 1FY3A 3DA9B 1G37A 1OKXA 3DD2H 4QT8C 1P2NA 1C5MD 3SJOA 2FEQH 3RXKA 3U1JB 1NRQH 2ESTE 1GCTB 3LGIA 2CHAC 4NGAH 4NG9H 1ZSJA 3V13A 1DLKB 1QB1A 3GDSA 4A1XA 1C5ZB 1HJAB 5ESBA 4R8TB 3FVFB 1FY1A 4RSPA 4Y8XA 1QA7A 3ATLA 3RLWH 5C5OA 2ZFRH 1GBJA 3ZV9A 2VWMA 1J17T 1TGNA 3M3VA 2PLXA 1FQ3A 3STJA 1P10A 2Y82A 1SLVB 3GY5A 1T4VH 1GBHA 1IQFA 1PQ5A 2UUYA 2Y81A 3IWMA 2CF9H 1C1TA 1P2IA 4MG3A 1NC6A 4ZKSU 3GOVB 1O39A 1Z8JB 4U01A 5DP3A 4A1VA 3LH1A 1ELBA 1WAYB 4FXGH 2A7JA 2I6QA 3RC6A 2ZWLH 4NIYA 1EQ9A 4X1RU 7ESTE 1CT2E 2OBQA 8GCHF 5C1UA 5JBTA 2YOLA 5DP8A 3EA7A 3SGQE 1T8MA 1KLIH 3F6UH 3TNTA 3SJIA 1WBGB 2EI8A 1TNGA 1HJ9A 2QN5T 1ID5H 1P02A 1A3EH 2ANMH 1YYY1 2C4FH 2ZU1A 3QGNB 1EAUA 2J9NA 1F7ZA 4X1NU 2XTTB 2BLWA 3UNSA 1THRH 3KQCA 1ZPBA 3AW0A 3KEEA 4ABDA 1S0QA 1E0FD 4NWLA 2Z6BD 3RXRA 3URCA 1HAXB 4MQAA 3VGCB 1IQIA 3Q3YA 5F8XA 1RXPA 3RDZA 4I8JA 1UVOA 1AFEH 3F9FA 1XM1A 4J1YA 1GBFA 1NESE 2R0KA 3A7VA 1NFYA 3P8NA 1JOUB 4Q7YA 3M3TA 3LH3A 1V2TT 4MVNA 1EB2A 2CMYA 5EG4A 4F49A 1QR3E 1LO6A 4U30A 1Z8RA 2ZO3H 5AFZH 1YLCA 2B8OH 4FUCA 1AB9B 2LNCA 2R9PA 1PPGE 1D4PB 2GMTB 4O03A 3S0NA 1P12E 1NRPH 3NWUA 1LHCH 1MCVA 2BD2A 2BDHA 4I8GA 1SFIA 4MNWA 2WPHS 1NU9A 4E05H 4OS1A 4CRCA 2Q1JA 4X6OA 2Z3CA 4GLYA 2QXIA 4IMZA 4E7NA 2ZTXA 3P95A 5LPFA 4ZXXH 1DS2E 1GBIA 1KXFA 1QQ4A 3SO3A 2PGQB 2VWLA 3UQVA 3H7OA 1S6FA 4IC5A 1V2MT 1MKWH 2FTMA 1BTZA 1UK4A 3ZVDA 1GBDA 1ZGIA 2C8WB 4WWYA 1HNEE 4MPVA 1C5NH 3TU7H 1IQHA 3MU5A 3L6PA 1SGRE 1GBKA 4GAWA 1OP2A 4B76A 1QL7A 1RIWB 3SBKA 3BTTE 2V0BA 2JH6D 4NFEA 1ABJH 2SGQE 1DOJA 2A4QA 2VB0A 1ZPCA 1O3OA 4NSYA 2PTCE 5G4BA 1VITG 3KL6A 1HBTH 2KAIA 1ANEA 3AVZA 4I31A 3SJKA 1RIWC 1TRNA 5B6OA 2QF3A 5LPEA 1BTYA 1GL1A 2WPJS 3A81A 2UWPA 4MNXA 3TJOA 1C5WB 3AW1A 3RU4E 1QFKH 1VJAU 2VIVA 2ZDKA 1MTVA 1HLTH 2ZTYA 4ABFA 4MNVA 1SHHB 3FFGA 2H6MA 1O32A 1BB0B 1GJAB 1LCYA 1EASA 2ZF0H 4ABHA 1HYLA 3BG4B 3DFJA 3U1IB 1SGDE 4IN2A 2F9UA 4AN7A 4TPIZ 1Y3UA 2BX4A 1H9LB 1T4UH 2P8OC 1GBLA 4HZHA 1ELFA 2FX4A 2P94A 2VIQA 3VEQB 1LPGB 3MI4A 1TIOA 2GP9B 1AUJA 4LZ4B 3EQ0H 3LU9B 1HFDA 2VVCA 1V2RT 1HAHH 3M36A 2VGCC 4X8UH 1OS8A 1CT0E 1C1VH 1LHEH 1E37B 1A5HA 5DO4H 4IS5A 3K2UA 5F8TA 2BOHB 1GBMA 4FUDA 1TQ0B 7GCHG 3B8JA 4ABIA 1C2HA 4D7GA 4DY7B 3MTYA 3SUFA 4YOJA 1UK2A 1O2ZA 3SJ8A 2BHGA 1EJMA 1V2KT 5EW1H 4FU8A 3UR6A 5DK1A 1GBAA 1BTUA 3TH2H 1V2QT 1GMCG 3TJNA 4A92A 1S6HA 3LGTA 3A7ZA 1LHGH 3VGCC 3FZDA 1Y8TA 4B71A 2SGEE 2AGGX 5TCCA 4B2AA 3D62A 3S9CA 2CXVA 3FP8E 2A7CA 3SU6A 3FAOA 2GKVE 2ZFSA 3CP7A 1O38A 1C1UH 1GMHG 1PFXC 1JRSA 1IOEA 1BT7A 3QUMP 4YM9A 3RXDA 3B9FH 2OUAA 3V12A 4DGJA 1QCPA 1SOTA 2NU1E 3W95A 1A0HB 2ZPQA 4YOGA 2ZGHA 4JZDH 2OC0A 1P2OA 1NROH 1VCQA 1SGCA 1IHSH 1C2KA 3M7TA 2C8XB 2P3UB 4JYTA 1O37A 5H4IB 1SGIB 1DVAH 4MPWA 2ZU2A 1QRWA 1ZHRA 3A83A 2EA3A 3GY7A 1HAPH 1CQQA 4BAQB 1MBQA 1A5GH 3ATKA 3SU1A 1HB0B 1QNJA 1OYTH 1QTFA 2ZQ1A 5EODA 4CH2B 3S9AA 3BTDE 5JPMH 3ZZ9A 1TALA 4NA8A 1HIAA 3LC3A 3QN7A 3PWCA 1U6QA 1YP9A 1TNLA 3RMMH 1N8OC 1QJ1B 2FOHA 3E0NB 4XBBA 3UTUH 1GI5A 2Q6GA 3BEFB 1GCTC 3R0FA 1TBRH 1CGJE 1K1PA 1SQAA 4GUXA 2TGDA 4Q7ZA 1CHOG 3KCGH 1GI6A 2HNTC 5DJ7A 1Y5UT 1PPCE 4UD9H 1YGCH 4NIXA 4AFQA 2LPRA 3BTWE 1H8IH 1GGDC 1O3FA 1E34B 5C3NA 3SJ9A 3UOPA 1WU1A 3RC5A 1MZDA 1Y3WA 5JBCS 2H9HA 4BTIB 4CRBA 2HPPH 1C4V2 2SGAA 1XUIA 2P3FH 3UY9A 2BDIA 1ZSKA 3CS0A 1P06A 1OYQA 1ZRBA 4NZQA 1DUEA 2G81E 3SHCH 1KTTB 3GY8A 2HPQH 4IGDA 1C1WH 3ZZ8A 2FOFA 2ULLA 1VZQH 2BZAA 1LTOA 2UUJB 1SLWB 1CA8B 1SQOA 3LT3A 3QGJA 4K5ZA 5PTPA 2F83A 3SU3A 2PWXA 1TPSA 5FCRA 9LPRA 1H9IE 1UCYK 2ZU3A 4ISHH 1FMGA 1WTHD 2Z9GA 5GIBA 1YPHC 4LXBH 1SGTA 5EPNA 1S85A 4Y7BA 1P04A 4WMFA 1UHBA 3U8RH 4MNYA 2OC7A 3OY6U 4Y71A 1UO6A 1W12U 4LK4A 1GJ8B 4CRDA 1GVLA 2FODA 4CBNA 2GD4B 2PR3A 1TGSZ 4K1TA 4GSOA 2A7HA 2FOBA 4WJG2 1W13U 4ISNA 3N7OA 1OWHA 2ZFTA 1FUJA 1XUKA 3BTME 1NFUA 1BRUP 2XXLA 3I29A 2H2ZA 3V7TA 3K65B 1C9TA 4B1TA 1GHBF 1P11E 1NFWA 2STBE 4AORA 4FUBA 5DP5A 3KHVA 5DG6A 1K1MA 3TJVA 1W8BH 1MU8B 2V35A 3A87A 4GPGA 1EP5A 2GDDA 1TNKA 2HWLB 1JBUH 2AEIH 2HGTH 5A0BA 1WTGH 5A2MH 4JZFH 1IQKA 1B0EA 1S81A 4ISOA 2ZTZA 3RM2H 1UTJA 1BRCE 1K1IA 3E91A 2FI3E 5FBIA 3PM3A 3M5LA 1AN1E 1T7CA 1QJ6B 5EPYA 4Y8YA 3H5CB 3UNRA 4I8KA 6LPRA 5CMXH 1RFNA 5HMAA 2J94A 1ELDE 5EQSA 2GCHF 4XOJA 1C1PA 3RXBA 1P2QA 2OQUA 5FXLA 4HGCA 1MD8A 1YCPK 1BQYA 3TVJB 3O8RA 1FN8A 4XSKU 1CHOF 3LGUA 2VJ1A 3MHWU 3MNBA 3C27B 2FI4E 3SU5A 1ANCA 1BTPA 1XUGA 3M5NA 1XVOA 1YC0A 2XBVA 1UTQA 3C1KA 1DDJA 3L33A 1E35B 1TGTA 4WMDA 5JB9S 3PMJA 4X6PA 5DPAA 3ZVBA 2G00A 1NRRH 1YKTA 5A0CA 4NA9H 1UVSH 1WSSH 6ESTA 4YTAA 1V2NT 3MO6A 1MTNC 2J34A 5GPIB 1OSSA 2V6NA 1EP6A 3LPRA 3RXFA 1DXPA 1BA8B 4ZKNU 1YPEH 2AFQB 4MDSA 1TGCA 4B74A 1G36A 3E3TA 1GDQA 1OWDA 4JMYA 1PPZA 1W7GH 1AGJA 3E8LA 3U9AH 3ZZ3A 1LVYA 1G3BA 4JZIA 3F9EA 1TMTH 5FPYA 1GI0A 3TPIZ 1YCPM 2GGVB 3GCTG 1O5CB 2DE8A 2G4UA 2ZDMA 4DIIH 1DT2A 2ANKH 2HVXA 5GXPA 1ETRH 1O2TA 1GPZA 1OWJA 2ZDVH 2QXJA 2ZEBA 3OU0A 4LOYH 1GJ5H 1O2LA 2R3UA 3GDVA 1HDTH 2FESH 3HKIB 1J16A 1C2DA 4NCYA 1SLXB 3GY6A 1INCA 3PMAB 2WV4A 4INLA 2A5IA 5HM2A 1THSH 4MPUA 1LPKB 2OLGA 3EE0B 3RXQA 2VWNA 2G5NA 1GJCB 4K60A 3BTHE 4RN6A 1O3JA 2ZG0H 2C8YB 4XBDA 4ZXYH 5EQRA 4TWYA 5A8YA 1G30B 1EUFA 3ZZAA 5K0HA 3RXGA 3SV9A 1QBOA 2A31A 1DSUA 4IC6A 4K8YA 1AKSB 1Y5BT 3K9XB 3VXFH 1O3HA 3SOSA 3VB6A 1NPMA 1TX8A 2B9LA 1NRNH 4AG2A 2PKSC 4TYDA 1Y3VA 1SI5H 1O3NA 1H9HE 3NKKA 3QTVH 3T5FH 1XMNB 4I7YH 4LZ1H 1UJ1A 3PROA 2FP7B 1AZ8A 5LH8A 5C20A 2QY0B 4BAKB 1FONA 2AMDA 4X2WA 1MTWA 3SN8A 2H1UA 4YT6H 2ZFFH 3CS7A 2BY8X 2SGDE 5DKMA 1UTNA 1RGQA 4CRAA 5C1XA 1V2UT 2O8MA 2FS8A 1BHXB 3ENSB 1SOZA 1O2GH 1BMMH 1AQ7A 2BZ6H 4I33A 3SQHE 4FVDA 2AERH 3AAVA 3HGPA 3M7QA 1O36A 1C5SA 1QIXB 1PPHE 1ZGVA 2HRVA 1D6RA 4X1SU 3MO9A 2WUBA 1SR5C 1C5RA 1VJ9U 5GJ4B 7LPRA 2TGAA 2FMJA 1AD8H 1PPBH 1DFPA 2BY5X 1VGCC 1O3GA 2G8TA 4BTTB 1MZAA 1P9UA 4DVAU 1Y59T 1TQ7B 1HXFH 1BUIA 1DUAA 1GG6C 1C2LA 1JIMA 2V3HH 4JZ1A 1FY8E 1Y3YA 5C2ZA 1BRAA 2Y6TA 2H9EH 3SV8A 2A2QH 1JWTA 2J2UA 1B0FA 2GDEH 3ZYEA 1AVWA 3BN9A 1K1NA 4A1TA 2ALVA 4VGCB 1XKBC 3I77A 3RXAA 2FLBH 1DPOA 3O8DA 1P0SH 3GICB 5C1YA 1LMWB 4B2BA 1OP8A 5K7RA 2F9PA 5C67A 4NFFA 1RTLA 1EAXA 1Z71A 3BTKE 4K3JA 1ZHPA 1C5TA 2XC4A 5IDKA 4X0WU 1UMAH 4BXSA 3SQEE 2F3CE 1DICA 4UFGH 2A5KA 5F8ZA 2XBWA 4SGBE 4X1QU 1ORFA 4FUIA 2Z7FE 2P16A 4K2YA 1GI3A 2TBSA 1K1OA 2TGPZ 1C5OH 1GI8B 1MAYA 3P92A 1EZUC 4FUHA 1D9IA 2GZ8A 1ZMJA 1A0JA 1K22H 1RRKA 2C3SA 2R0LA 4CHAB 1RS0A 4OS5A 5T6FA 4GCHF 3ZZCA 5GCHG 3GCHB 1SPJA 3M37A 1XVMA 2A0QB 1O3BA 1TX7A 2OQ5A 2FOCA 1FY4A 1QBVH 1BBRK 3LIWA 1ZHMA 2OINA 1TFXA 1EOJA 1O3EA 5FCKA 4CHAC 1SVPA 1UHBB 1O2KA 2BDBA 1CSOE 3IG6B 5TJXA 4K69A 1AU8A 3U8OH 1UTMA 3DHKH 1J9CH 3NK8A 3T25A 2JETB 1YPJH 4YT7H 3QLPH
chains in the Genus database with same CATH superfamily
2XWAA 3FKSD 2PUXB 3D23A 3WWFA 1SGYE 2VIPA 1QZ8A 4RT1A 5FPSA 1MU6B 4SGAE 1FV9A 3ATIA 6GCHG 3L3TA 1BTHH 3P8FA 1HAGE 2J98A 3MU1A 3GCNA 1ZTJA 1JMOH 2ZZUH 1ETTH 4I86A 4AG1A 3ZVGA 4ACBA 1QB9A 1H4WA 5HXFA 2O8WA 2ZHWH 1UK3A 4JK5A 2Z9KA 2FOAA 1YLNA 4VGCC 1MTSA 2VINA 2VBCA 2I6SA 1QY6A 1HPGA 3SGBE 3QZRA 1YY3A 2C8ZB 2ZU4A 4BAHB 1GVKB 3OX7U 1GDUA 4Y11E 1TE0A 3TH3H 5TCAA 1F0SA 5DGJA 2K1QA 3UNQA 3W94A 1G3CA 4IW4E 2FX6A 3M5OA 1SKYE 3ESTA 3MH4A 1L1JA 1C5XB 1ESAA 2J4IA 3TH4H 1E38B 1FXYA 2XBYA 1P3CA 1ZTKA 3LC5A 1DLEA 3JZ2B 3UPEA 5HYOA 4ZKOU 1F5RA 1MMJN 1RTFB 5DP4A 1C5QA 3GS9A 3FP6E 1KXCA 3HKJB 1HIAB 2ZA5A 5JDUB 1HAOH 2HNTF 3E6PH 3SZNA 2AGIX 1EAWA 1V2OT 2QXHA 2BD7A 1MKWK 1H8ED 3MU8A 2ALPA 3OE7D 2UUFB 5EQQA 4OS7A 1EPTA 1WCZA 1TB6H 3RXTA 1TLDA 1UTLM 1L1GA 1QURH 4GVUA 1CA0C 5ESTE 3SORA 2O8TA 4I8HA 1CU1A 1KLTA 2BDAA 2CJIA 4ABEA 1G3EA 1EZSC 5AFYH 1GJ6A 2V3OH 3SNEA 1FDPA 1LQDB 1P05A 1AFQB 2C90B 1ANBA 1PJPA 3URDA 3HATH 3EE7A 1V2VT 2C93B 3TJUA 3U8TH 4GCHG 2FXRA 4INHA 1CA0B 1HAYB 3OTJE 3ZIAD 4CH8B 1ETSH 1Q3XA 2J38A 3PYHA 3RXJA 2GCTC 2IJOB 1ABIH 1DANH 2EQNA 3MMGA 3PWBA 2H5DA 1O34A 1NTPA 5DP9A 1V2PT 3RMLH 2WPMS 1LVOA 3KQDA 5FBEA 2BDYA 2FYQA 3H7TA 3GY4A 1CT4E 2QC2A 2HNTE 3T62A 1V2JT 3E90B 3A89A 4ZHLU 1OWEA 1GHBG 3BV9B 1TABE 2W5EA 3OY5U 4RKOB 1BMAA 1AWHB 4Z0KA 2A2XH 3NPSA 1TA6A 5EXNA 1MKXK 1WQSA 2ZDNA 1J8AA 2UWLA 3TITA 2GCHG 5L6NH 2ZDLA 6GCHF 1EFRD 3KQBA 4H4FA 5BPEA 1P2KA 1GJDB 1K21H 2AYWA 1H1BA 3RXHA 3S7KB 8ESTE 2ZIQH 2JJ2D 2JKHA 4M9FA 7GCHF 4X8TH 3RXMA 1O3DA 2ZHFH 2IPHA 3RLYH 1ELVA 1SHYA 1O5FH 3AASA 2VVUA 3JZ1B 1L4DA 1PQAA 3RU4T 4FUGA 1K28D 4J2YB 1KDQA 1TNIA 4B75A 1IAUA 2JJ1D 1N1LA 3TK6A 2BLVA 4XE4A 5FX6A 4ABBA 1UW7A 1OP0A 1YPLH 2Y5GA 2VH0A 1QB6A 1MD7A 4XD7D 2P59A 3SV6A 4WF8A 4D76A 3SV7A 4JZEH 3CENA 2VIOA 3S7HB 1G9IE 3TIUA 3OSYA 5A0AE 1M9UA 5E0GA 1O2PA 4X2YA 1SFQB 3R3GB 4JK6A 2RG3A 2AS9A 1PPEE 1K9OE 5KEDA 4NWKA 5E8EH 4YO9A 1GBBA 3O8CA 1KLJH 3N7EA 2G52A 1NBMD 3QK1A 4KGAA 1VITH 2ZQ2A 1S6LA 1QJ7B 1O35A 3A82A 1OX1A 4ZHAA 3ODDA 1GHVH 1AUTC 1AWFH 1EOLA 4BANB 3VB3A 3PB1E 1EX3A 4ACAA 2F9BH 1D6WA 2ODPA 3PRDA 1G32B 1ARCA 1TBQH 2QV1A 2XBXA 2SFAA 3V0XA 1A0LA 2JETC 5FPTA 2HALA 1GI4A 4Y0ZE 2XW9A 3RUOA 3ZZ6A 4R0IA 1EPTC 4HFPB 5IK2D 1LVBA 2O8LA 1WQVH 2GZ9A 1C4Y2 2Q6DA 5AF9H 4UONA 1GHAG 2XRCA 1XUJA 3A8DA 1O2OA 2F9OA 1GI7B 3Q3KA 1W0YH 1LQEA 4Z1MD 3GCHC 3ZVCA 2THFB 2ZHQH 3A8CA 1TPPA 1NN6A 2ZC9H 3GDUA 1ANDA 1MQ6A 2NWNA 5JBAS 1ZSLA 2PGBB 3BF6H 4WXIA 1QGFA 1BOQA 5C0TA 2ZCHP 3Q77A 2AMPA 1W2KH 3A7TA 1GL0E 2TPIZ 4O3TA 1FLEE 5E2OA 3BTFE 1QBNA 3KNXA 1JRTA 1MAXA 1TBZH 1C2MA 1K1LA 2D2DA 3A80A 1AI8H 2ZPRA 4UDWH 2XC0A 2BTCE 3G01A 2FO9A 2Y7ZA 1Z6EA 2SGPE 4DCDA 1SGNE 2GVFA 3BIUH 1BTXA 1ARBA 3QTOH 1DY8A 1P57B 2BQ6B 2WPLS 2EEKA 2BLQA 4O97A 3BSQA 4UFEH 3S69A 2B0FA 4AGKA 2KZ4A 1YBWA 2KX4A 1O3IA 1NY22 4MLFB 2FI5E 1O33A 1O3CA 3VFEA 2P8OB 4WMEA 1D3TB 2L6OA 4BAMB 1UCYH 2KCYA 1GBCA 1QA0A 4DOQA 1C1NA 3FO8D 1C1SA 8LPRA 1AKSA 3A7XA 2ZECA 3GY2A 3RXEA 1CE5A 2B5TB 3RM0H 4DW2U 1J15A 1C2IA 1TPOA 1V2WT 2VWOA 2XWBI 3PTNA 1MTUA 4K1SA 1EZQA 3MO3A 1PQ8A 2JIZD 3VB7A 6CHAC 3MYWA 1YPGH 2BD8A 2BQWB 1ZJKA 1XXFA 2QF4A 1K0HA 2AMQA 1O3AA 3P70B 2RCEA 5L2YH 4BXWA 5DN6D 1A2CH 3SI3H 5LGOA 3UUZA 3ZZBA 1NU7B 3F1SB 4X6NA 4ZAEA 2J92A 1BMNH 5EJZA 5DSFA 4INKA 1BIOA 5JBBS 1DE7H 5LPRA 5FHTA 1OHHD 5T6DA 2IJD1 5AHGH 1SL3A 1L0ZA 1T8NA 1KDQB 2KCAA 1BMLA 2CV3A 3TGKE 2Z9LA 1DWDH 4FU9A 1O30A 1NBME 1HAIH 3V3MA 4AX9H 2ODYB 4BTUB 1CO7E 1F2SE 2VIWA 2WYJA 1ELAA 1NRSH 1D3DB 2XNIA 3F0PA 4CR5A 3CNRA 3M61U 5A8XA 3N99A 3SHAH 3ZVAA 2GZ7A 4K1EA 4H6TA 4WXVA 2AH4X 3LJOA 1GJ9B 2UUKB 3RXCA 3HPTB 4D7FA 1LDTT 2BD3A 2EC9H 3SNDA 1VITF 4GHTA 1QRZA 3FZZA 2GV6A 2BM2A 2FDAA 2BX3A 3A7YA 3T28A 4A7IB 2PHBA 2VIDA 3NUMA 1GI2A 4FETA 4PROA 4IBLH 4Q80A 1XXDA 2FOMB 2ZGBH 3KIDU 3ZZ4A 3MU0A 4UEHH 1EATA 3MQKC 3LOXA 4JYUH 4YLUA 1O5DH 4AYVB 1T31A 2PSYA 1MCTA 2FLRH 3PV5A 4D8NA 1S5SA 1XKAC 1SG8B 3VPKA 2F4LA 4KTUA 3ZYDA 3T26A 2PKAA 3QO6A 3RMNH 1TWXB 2G4TA 4ESTE 1RTKA 1AY6H 4JYVH 1P9SA 4WY3A 5FAHA 2OP9A 1GI1A 1O2NA 2GV7A 3F9HA 5I46H 1K1JA 4Q7XA 1Q31A 4OS2A 2FIRH 1C4U2 2ODQA 1AE8H 2A5AA 5HGGA 1YPKH 2BDGA 4THNH 1NT1A 1QHRB 2BXUH 4OM9A 1IQLA 2FOEA 4TWWA 1TONA 1A5IA 4DT7B 3M35A 3SUEA 4F4OC 7KMEH 1AVXA 1ZR0A 3A8AA 1VR1H 4OGYA 6CHAB 2OCVB 2R3YA 1F0UA 5A09A 1HAVA 1C2FA 5L2ZH 1GBEA 2GT7A 4FUEA 1TMBH 3LGVA 4Q63A 1TNHA 1O2UA 2QCYA 2BY7X 3F0OA 4Y10E 1O3MA 2BMGB 2ZU5A 1HUTH 2BLOA 2QYIA 3BG4C 1QQUA 4WVPE 4YOIA 1FPHH 3TGIE 1K2I1 1LKBA 2J98B 4DG4A 1C5LH 5ABWA 1EJAA 2AIQA 1GG6B 2WPKS 1KSNA 3U28C 3NCLA 4XFQA 1O2VA 1D3PB 4ISIH 1F92A 1QL9A 4DJZB 4TY6A 2AHME 4Y8ZA 4AB9A 3OAAD 3MFJA 2ZP0H 2Q6FA 3DFLA 2Z94A 4X8SH 1L2EA 2XNDD 4B2CA 3ITIA 1ZRKA 2CN0H 3MNCA 1TX6A 2PUQH 3BIVH 1ZJDA 1B5GH 1BMFD 3SNBA 3EA8A 2GCTB 2OBOA 4XRNA 1ZTLA 2W3IA 2VNTA 2BVSH 1NM6A 3MH5A 4FU7A 3B23B 1O2QA 2PW8H 2BD4A 3A84A 1TRMA 1QL8A 4AFSA 4BOHA 1O2MA 4NSVA 2J95A 1GMDG 3MNXA 1WV7H 2BVXH 3SYJA 1WYKA 1ESBA 4ISLA 2CGAA 5GDSH 1W7XH 1YM0A 1O5BB 2PKSB 3D49H 3TK9A 1TNJA 2A4RA 5CHAB 3MWIU 1OOKB 3A7WA 2A4GA 2CF8H 1LKAA 2W26A 1O5AB 2BY6X 3SGAE 1ELEE 1GHYH 1HGTH 3M5MA 1EPTB 2TRMA 1GVZA 1W11U 3RU4D 4P00A 3UFAA 1V2ST 2JDID 2VH6A 4FUJA 3PRBA 3QZQA 4O9VA 1GWAA 1Y3XA 3EA9A 1FPCH 2ZGCA 3QX5H 1W0JD 1P01A 1UTOA 1HCGA 1KIGH 2M2AA 3IITA 1KTSB 3ZVEA 3UIRA 1IQMA 1CHGA 4ZH8A 1L1NA 2SGFE 1XX9A 2BOKA 3AAUA 1TOCB 2W7SA 2G55A 5GWZA 2HLCA 1A46H 2Y7XA 5F53A 4Y6DA 2D1JA 1AO5A 3E1XB 2UWOA 4MTBA 1SGPE 2ZCLP 1UVPA 3P6ZB 2ZI2H 1P8VC 2Y5HA 1W0ZU 2DUCA 1VCWA 1IQNA 1SMFE 2QF0A 3LGYA 5EXMA 1FAXA 1BCUH 1O2XA 2BQ7B 1F0TA 3ELAH 2BYAX 1C1RA 4TPYA 1O2JA 1C2JA 2OC1A 4WH8A 1S83A 1GHZA 2A32A 1ACBE 3LJJA 1FY5A 1UVUH 1OWKA 5F6MA 3SV2H 3UWJH 1ZOMA 4KTSA 2O8UA 1C2EA 1WOFA 1MTNB 4X2VA 4ZHMU 3LKWA 3TLOA 2DE9A 3KYFA 1GHWH 1CVWH 2WUCA 1UCYE 1F5LA 2TGTA 3UB0A 4CREA 2K0QA 3BTGE 1IQJA 4F55A 2SNWA 5EIYA 1YPMH 1O3LA 5EOKA 3RXVA 3RMOH 1ZYOA 3M7UA 1C5PA 1N8OB 4Y7AA 2XC5A 1GI9B 3PLKA 1EJNA 5IYTA 1GMDF 1SLUB 5CE1A 4AGJA 1ESTA 1G2MA 1W3CA 3SUGA 2YMSD 1S82A 3SU0A 4Y76A 1C9PA 1H8DH 1P09A 4Y0YE 1Z8IB 3FANA 1OPHB 9ESTA 3F9GA 3Q76A 3QDZB 4D9QA 1GJ7B 1SBWA 2F43B 2SNVA 3HK6B 1N6XA 3GY3A 1KXDA 1DX5M 2R2MB 4Q2KA 5DP7A 4K8BA 1EZXC 1FIZA 1ZMLA 4CR9A 2OTVA 1O5EH 2F9VA 3T2NA 1QRXA 1SGFG 2RDLA 4D9RA 2STAE 1FI8A 1ELGA 1TOMH 1AVGH 1PYTC 1HJ8A 1MH0A 1HJAC 3PMBB 1EXFA 2EI7A 2PFEA 4KKDA 1B7XB 3RXSA 1UTKA 3MH7A 1GHXH 4JCNA 2JH0D 1TRYA 2VGCB 5FX5A 1HAZB 2OC8A 2GX4A 2GJGA 4YESB 3U69H 1RD3B 1PYTD 2FYRA 1AFQC 1EAIA 1OWIA 3E0PB 1DY9A 2FPZA 1UVTH 3RXPA 1A3BH 4ABJA 1V6DA 2A4OA 5E0HA 1G2LA 2EI6A 3T29A 2ZNKH 1CBWC 1YF4A 2WPIS 3PO1C 1SQTA 4U2WA 1A1RA 2H5CA 2D8WA 1KY9A 3P17H 4B6FA 1Y5AT 1FJSA 3PTBA 4FOUC 4CRFA 1WUNH 1W10U 4X6MA 1V3XA 4RT0A 1DWEH 4I8LA 1BRBE 1SGFA 1TA2A 3MU4A 5A8ZA 2O9QA 3TK5A 1NS3A 1DWCH 3U98H 2QGRA 2FOGA 1A7SA 4X1PU 1GDNA 2Y5FA 2WV5A 4OS6A 3FN8A 4ABAA 4AOQA 1ZMNA 1LHDH 1LPZB 2XCFA 2FTLE 2ZGXH 4Y79A 2ZCKP 4E7RG 1GBTA 1BBRH 4HI3A 1BTWA 5EW2H 3K6YA 3ZZ5A 1C1OA 1GMHF 2NU0E 1HXEH 2GTBA 5DP6A 3RC4A 4AFUA 3O8BA 1L4ZA 1LHFH 1O2IA 2PSXA 4UFFH 4DURA 2ZDAH 5F03A 1SB1H 2V3MA 1O3KA 5BRRE 3BEIB 2QAAA 3RXUA 2WYGA 5L30H 3NZIA 1DITH 2B7DH 3GYMA 1O2RA 1OXGA 3Q3XA 1UTPA 5T6GA 1C1QA 1GJ4H 4OGXA 1XUHA 3SW2B 4CRGA 1S0RA 4ASHA 2PTNA 2BVRH 3ZV8A 2R2WU 3UR9A 2VU8E 4YLQH 1YLDA 1ZPZA 5AVDA 2ANYA 3P8OA 3PMHB 2WINI 3KQEA 1X7AC 4AFZA 1VCPA 3DT0H 1H8HD 1MKXH 1MUEB 2Z9JA 1P2MA 2AGEX 4OS4A 3A86A 1BITA 4ZMAH 4NIWA 1C5YB 4DIHH 1F0RA 1T8OA 1NFXA 3WW7A 3A8BA 1C2GA 1N6YA 3BG8A 4AYYB 2YMSB 3STIA 1Q2WA 3EAJA 4UE7H 5JB8S 1WXRA 1BZXE 3KN2A 2FWWA 1F5KU 3UWIA 4A5TS 3TGJE 4XBCA 3PLBA 3GYLB 2L74A 4O3UA 1T8LA 1SSXA 1G3DA 5C94A 3FOAA 4H6SB 3F2HA 2EY4C 1GCDA 1FN6A 2ZHEH 1DWBH 2FM2A 8KME2 2BDCA 2OD3B 1ZZZA 3LONA 4NA7A 5HM9A 5JYIA 2W7UA 1RJXB 1FIWA 1LVMA 3MOCA 5EGMA 2GMTC 2TIOA 1AB9C 3RXIA 1T32A 3AK5A 3K6ZA 1C1MA 4FUFA 2F91A 2IN2A 3S9BA 3QWCH 4HTCH 2AIPA 4NZLA 3LGWA 3ZVFA 1NZQH 1FNIA 2FZZA 1KYNA 1Z8GA 1NO9H 1O2SA 2A1DB 1YWUA 3GCOA 2ZKSA 3BTQE 4KTCA 5SGAE 3KGPA 2G51A 2KAIB 4P02A 3RP2A 2H9TH 1TMUH 4X2XA 1GMCF 2P93A 4ABGA 4IMQA 3TNSA 4UFDH 1TGBA 1AZZA 1XUFA 1S84A 1C5VA 1BHXF 2BY9X 1AMHA 2FS9A 2JH5D 2ZHDA 3Q00A 4YZUA 5J4QA 2YNAA 2ASUB 5J4SA 3ATMA 3VB5A 2PKAB 3MH6A 3M3SA 1Z1JA 1VGCB 1SGQE 3VXEH 4AZ2B 2YMSC 1AIXH 1MBMA 1A4WH 4IN1A 2VVVA 1W14U 1YPHE 1V2LT 2CK3D 4H42U 3SNCA 1SC8U 1MQ5A 4ZUHA 2G5VA 2XCNA 1P2JA 1A61H 4I32A 1PQ7A 2K8IA 2QIQA 3EDXB 2BD5A 2PV9B 1BDAA 1BJVA 1KMHB 2Z3DA 3SUDA 3A85A 2XYAA 4BNRA 1J14A 4MPXA 2IOTA 2BD9A 4AB8A 2NU2E 4Z6AH 3ATWA 3WY8A 1KXEA 3SNAA 1GHAF 1AHTH 2CHAB 3ZZDA 3FP7E 2QA9E 3BTEE 1ELTA 2ILNA 4M7GA 1FAKH 4ZKRU 3KF2A 2GT8A 5EU8A 2RA0A 3SU2A 1P03A 4WH6A 2BXTH 2NU4E 1FZZA 3F68H 1DM4B 1HAVB 1KXBA 1ELCA 3D65E 3RXOA 2A45B 1P3EA 4FVBA 4ZROA 4B73A 1HV7A 3HK3B 3P8GA 5EXLA 1TYNA 3EGKH 1O2YA 4GHQA 1O5GH 1AE5A 2ZPSA 3HGNA 1O0DH 4A6LA 1D3QB 1THPB 5C5NA 1Z1IA 2YNBA 1BJUA 2BB4A 3EYDA 2P95A 5GCHF 3W1EA 3T27A 5E0JA 1O2WA 3DUXH 2NU3E 4KP0A 3PV4A 2Y80A 3DCLA 4X8VH 3ZZ7A 1GJBB 3GISB 2ZGJA 3I78A 1C5UA 3UQOA 3OYPA 3SU4A 3UOUA 4TY7A 4KELA 4CBOA 5I25A 1Z6JH 1Z7KA 2P3TB 2QXGA 1JXPA 3E16B 5ETXA 5T3HA 1TAWA 8GCHG 1O2HA 1ZLRA 4E06H 1O3PB 1CGIE 3SI4H 3MNSA 5HIZA 1DSTA 3GCTF 2M5TA 4BAOB 1BBRE 3ODFA 1HRTH 1PPFE 2ZFQH 1E36B 5E2PA 2ZFPH 3NXPA 1JIRA 3PLPA 3UREA 1IQGA 1KXAA 3RXLA 1SGEE 4NIVA 2ANWA 2D26C 4RKJB 1IHTH 2F9NA 1IQEA 4U32A 1DXWA 2OXSA 1EKBB 3PO1B 2W3KA 1YCPH 5CHAC 1CBWB 1TPAE 2Z3EA 3LDXH 2RA3A 1CGHA 2Z9IA 1O31A 5EJLA 4XDEA 2HOBA 1GGDB 1EB1H 3VB4A 3A88A 3BEUA 4ASUD 1FY3A 3DA9B 1G37A 1OKXA 3DD2H 4QT8C 1P2NA 1C5MD 3SJOA 2FEQH 3RXKA 3U1JB 1NRQH 2ESTE 1GCTB 3LGIA 2CHAC 4NGAH 4NG9H 1ZSJA 3V13A 1DLKB 1QB1A 3GDSA 4A1XA 1C5ZB 1HJAB 5ESBA 4R8TB 3FVFB 1FY1A 4RSPA 2KFWA 4Y8XA 1QA7A 3ATLA 2KCOA 3RLWH 5C5OA 2ZFRH 1GBJA 3ZV9A 2VWMA 1J17T 1TGNA 3M3VA 2PLXA 1FQ3A 3STJA 1P10A 2Y82A 1SLVB 3GY5A 1T4VH 1GBHA 1IQFA 1PQ5A 2UUYA 2Y81A 3IWMA 2CF9H 1C1TA 1P2IA 4MG3A 1NC6A 4ZKSU 3GOVB 3KYGA 5B6LA 1O39A 1Z8JB 4U01A 5DP3A 4A1VA 3LH1A 3DSGA 1ELBA 1FX0B 1WAYB 4FXGH 2A7JA 2I6QA 3RC6A 2ZWLH 4NIYA 1EQ9A 4X1RU 7ESTE 1CT2E 2OBQA 8GCHF 5C1UA 5JBTA 2YOLA 5DP8A 3EA7A 3SGQE 1T8MA 1KLIH 3F6UH 3TNTA 3SJIA 3KQ5A 1WBGB 5C0UA 2EI8A 1TNGA 1HJ9A 2QN5T 1ID5H 1P02A 1A3EH 2ANMH 1YYY1 2C4FH 2ZU1A 3QGNB 1EAUA 2J9NA 1F7ZA 4X1NU 5EJ1A 2XTTB 2BLWA 3UNSA 1THRH 3H09A 3KQCA 1ZPBA 3AW0A 3KEEA 4ABDA 1S0QA 1E0FD 4NWLA 2Z6BD 3RXRA 3URCA 1HAXB 4MQAA 3VGCB 1IQIA 3Q3YA 5F8XA 2W6ID 1RXPA 3RDZA 4I8JA 1UVOA 1AFEH 3F9FA 1XM1A 4J1YA 1GBFA 1NESE 2R0KA 3A7VA 1NFYA 3P8NA 1JOUB 4Q7YA 3M3TA 2RDEA 3LH3A 1V2TT 1MABB 4MVNA 1EB2A 2CMYA 5EG4A 4F49A 1QR3E 1LO6A 4ZCNA 4U30A 1Z8RA 2ZO3H 5AFZH 1YLCA 2B8OH 4FUCA 1AB9B 2LNCA 2R9PA 1PPGE 1D4PB 2GMTB 4O03A 3S0NA 1P12E 1NRPH 3NWUA 1LHCH 1MCVA 2BD2A 2BDHA 4I8GA 1SFIA 4MNWA 2WPHS 1NU9A 2W6JD 4E05H 4OS1A 4CRCA 2Q1JA 4X6OA 2Z3CA 4GLYA 2QXIA 4IMZA 4E7NA 2ZTXA 3P95A 5LPFA 2J97A 4ZXXH 1DS2E 1GBIA 1KXFA 1QQ4A 3SO3A 2PGQB 2VWLA 3UQVA 3H7OA 1S6FA 4IC5A 1V2MT 1MKWH 2FTMA 1BTZA 1UK4A 3ZVDA 1GBDA 2IPQX 1ZGIA 2C8WB 4WWYA 1HNEE 4MPVA 1C5NH 3TU7H 1IQHA 3MU5A 3L6PA 1E1QD 1SGRE 1GBKA 4GAWA 1OP2A 4B76A 1QL7A 1RIWB 3SBKA 3BTTE 2V0BA 2JH6D 3F2FA 3DSPA 4NFEA 1ABJH 2SGQE 1DOJA 2A4QA 2VB0A 1ZPCA 1O3OA 4NSYA 2PTCE 5G4BA 1VITG 3KL6A 1HBTH 2KAIA 1ANEA 3AVZA 4I31A 3SJKA 1RIWC 3OEHD 1TRNA 5B6OA 2QF3A 5LPEA 1BTYA 1GL1A 2WPJS 3A81A 2UWPA 4MNXA 3TJOA 1C5WB 3AW1A 3RU4E 1QFKH 1VJAU 2VIVA 2V7QD 2ZDKA 1MTVA 1HLTH 2WZQA 2ZTYA 4MNVA 4ABFA 1SHHB 3FFGA 2H6MA 1O32A 1BB0B 1GJAB 1LCYA 1EASA 2ZF0H 4ABHA 1HYLA 3BG4B 3DFJA 3U1IB 1SGDE 4IN2A 2F9UA 4AN7A 4TPIZ 1Y3UA 2RFKC 2BX4A 1H9LB 1T4UH 2P8OC 1GBLA 4HZHA 1ELFA 2FX4A 2P94A 2VIQA 2HVYB 3VEQB 1LPGB 3MI4A 1TIOA 2GP9B 1AUJA 4LZ4B 3EQ0H 5CHBA 3LU9B 1HFDA 2VVCA 1V2RT 1HAHH 3M36A 2VGCC 4X8UH 1OS8A 1CT0E 1C1VH 1LHEH 4B6EA 1E37B 1A5HA 5DO4H 4IS5A 3K2UA 5F8TA 2BOHB 1GBMA 4FUDA 1TQ0B 7GCHG 3B8JA 4ABIA 3DSOA 1C2HA 4D7GA 4DY7B 3MTYA 3SUFA 4YOJA 5GNDA 1UK2A 1O2ZA 3SJ8A 2BHGA 1EJMA 1V2KT 5EW1H 4FU8A 3UR6A 2J5UA 5DK1A 1GBAA 1BTUA 3TH2H 3OEED 1V2QT 1GMCG 3TJNA 4A92A 1S6HA 3NRLA 3LGTA 3A7ZA 1LHGH 3VGCC 3FZDA 1Y8TA 4B71A 2SGEE 2AGGX 5TCCA 4B2AA 3D62A 3S9CA 2CXVA 3FP8E 2A7CA 3SU6A 3FAOA 2GKVE 2ZFSA 3CP7A 1O38A 1C1UH 1GMHG 1PFXC 1JRSA 1IOEA 1BT7A 3QUMP 4YM9A 3RXDA 3B9FH 2OUAA 5T1VA 3V12A 4DGJA 1QCPA 1SOTA 3N7DA 2NU1E 3W95A 1A0HB 2ZPQA 4YOGA 2ZGHA 4JZDH 2OC0A 4RI0A 1P2OA 1NROH 1VCQA 1SGCA 1IHSH 1C2KA 5KECA 5C17A 3M7TA 2C8XB 2P3UB 4JYTA 1O37A 5H4IB 1SGIB 1DVAH 4MPWA 2ZU2A 2KR7A 1QRWA 1ZHRA 3A83A 5HIYA 2EA3A 3GY7A 1HAPH 1CQQA 4BAQB 1MBQA 1A5GH 3ATKA 3SU1A 1HB0B 1QNJA 1OYTH 1QTFA 2ZQ1A 5EODA 4CH2B 3S9AA 3BTDE 5JPMH 3ZZ9A 1TALA 4NA8A 1HIAA 3LC3A 2PP6A 2WPDD 3QN7A 3PWCA 5KGOA 1U6QA 1YP9A 1TNLA 4YXWD 3RMMH 4AC9A 1N8OC 1QJ1B 2FOHA 3E0NB 4XBBA 3UTUH 1GI5A 2Q6GA 3BEFB 1GCTC 3R0FA 1TBRH 1CGJE 1K1PA 1SQAA 4GUXA 2TGDA 4Q7ZA 1CHOG 3KCGH 1GI6A 2HNTC 5DJ7A 1Y5UT 3PV2A 1PPCE 1COWD 4UD9H 1YGCH 4NIXA 4AFQA 2LPRA 3BTWE 1H8IH 2HLDD 1GGDC 1O3FA 1E34B 5C3NA 3SJ9A 3UOPA 1WU1A 3RC5A 1MZDA 1Y3WA 5JBCS 2H9HA 4BTIB 4CRBA 2HPPH 1C4V2 2SGAA 1XUIA 2P3FH 3UY9A 2BDIA 1ZSKA 3CS0A 2KM0A 1P06A 1OYQA 1ZRBA 4NZQA 4HG6A 1DUEA 2G81E 3SHCH 1KTTB 3GY8A 2HPQH 4IGDA 1C1WH 3ZZ8A 2FOFA 2ULLA 1VZQH 2BZAA 1LTOA 2UUJB 1SLWB 1CA8B 1SQOA 3LT3A 3QGJA 4K5ZA 5PTPA 2F83A 3SU3A 2PWXA 1TPSA 5FCRA 3OFND 9LPRA 1H9IE 1UCYK 2ZU3A 4ISHH 1FMGA 1WTHD 2Z9GA 5GIBA 1YPHC 4LXBH 1SGTA 5EPNA 1S85A 4Y7BA 1P04A 4WMFA 1UHBA 3U8RH 4MNYA 2OC7A 3OY6U 4Y71A 1UO6A 2QE7D 1W12U 4LK4A 1GJ8B 4CRDA 1GVLA 2FODA 4CBNA 2GD4B 2PR3A 1TGSZ 2KCPA 4K1TA 4GSOA 2A7HA 2FOBA 4WJG2 1W13U 4ISNA 3N7OA 1OWHA 2ZFTA 1FUJA 1XUKA 3BTME 1NFUA 1BRUP 2XXLA 3I29A 3OTPA 2H2ZA 3V7TA 3K65B 5CDFE 1C9TA 4B1TA 1GHBF 1P11E 1NFWA 2STBE 4AORA 4FUBA 5DP5A 3KHVA 5DG6A 1K1MA 3TJVA 1W8BH 1MU8B 2V35A 3A87A 4GPGA 1EP5A 2GDDA 1TNKA 2HWLB 1JBUH 2AEIH 2HGTH 5A0BA 1WTGH 5A2MH 4JZFH 1IQKA 3F3BA 1B0EA 1S81A 4ISOA 2ZTZA 3RM2H 1UTJA 1BRCE 1K1IA 4DT4A 3E91A 1E1RD 2FI3E 5FBIA 3PM3A 3M5LA 1AN1E 1T7CA 1E79D 1QJ6B 5EPYA 4Y8YA 3H5CB 3UNRA 4I8KA 6LPRA 5CMXH 1RFNA 5HMAA 2J94A 1ELDE 5EQSA 2GCHF 4XOJA 1C1PA 3RXBA 1P2QA 2OQUA 5FXLA 4HGCA 3VG8A 1MD8A 5FL7D 1YCPK 1BQYA 3TVJB 2XOKD 1VKYA 3O8RA 1FN8A 4XSKU 1CHOF 3LGUA 2VJ1A 3MHWU 3WWBA 3MNBA 3C27B 2FI4E 3SU5A 1ANCA 1BTPA 1XUGA 5HKKD 3M5NA 1XVOA 1YC0A 2XBVA 1UTQA 3C1KA 1DDJA 3L33A 1E35B 1TGTA 4WMDA 5JB9S 3PMJA 4X6PA 5DPAA 3ZVBA 2G00A 1NRRH 1YKTA 5A0CA 4NA9H 1UVSH 1WSSH 6ESTA 4YTAA 1V2NT 3MO6A 1MTNC 2J34A 5GPIB 1OSSA 2V6NA 1EP6A 3LPRA 3RXFA 1DXPA 1BA8B 4ZKNU 3UAIC 1YPEH 2AFQB 4MDSA 1TGCA 4B74A 1G36A 3E3TA 1GDQA 1OWDA 4JMYA 2WSSD 1PPZA 1W7GH 1AGJA 3E8LA 1WDIA 2LP6A 3U9AH 3ZZ3A 1LVYA 1G3BA 4JZIA 4Q4LA 3F9EA 1TMTH 5FPYA 1GI0A 3TPIZ 1YCPM 1SQRA 2GGVB 3GCTG 1O5CB 2DE8A 2G4UA 2ZDMA 4DIIH 1DT2A 2ANKH 2HVXA 5GXPA 1ETRH 1O2TA 1GPZA 1OWJA 2ZDVH 2QXJA 2ZEBA 3OU0A 4LOYH 1GJ5H 1O2LA 2R3UA 3GDVA 1HDTH 2FESH 3HKIB 1J16A 1C2DA 4NCYA 1SLXB 3GY6A 1INCA 3PMAB 2WV4A 4INLA 2A5IA 5HM2A 1THSH 4MPUA 1LPKB 2OLGA 3EE0B 3RXQA 2VWNA 2G5NA 1GJCB 4K60A 3BTHE 4RN6A 1O3JA 2ZG0H 2C8YB 4XBDA 4ZXYH 5EQRA 4TWYA 5A8YA 1G30B 1EUFA 3ZZAA 5K0HA 3RXGA 3SV9A 1QBOA 2A31A 1DSUA 4IC6A 3F2GA 4K8YA 1AKSB 1Y5BT 3K9XB 3VXFH 1O3HA 3SOSA 3VB6A 1NPMA 1TX8A 2B9LA 1NRNH 4AG2A 2PKSC 4TYDA 1Y3VA 1SI5H 1O3NA 1H9HE 3NKKA 3QTVH 3T5FH 1XMNB 4I7YH 4LZ1H 1UJ1A 3PROA 2FP7B 1AZ8A 5LH8A 5C20A 2QY0B 4BAKB 1FONA 2AMDA 4X2WA 1MTWA 3SN8A 2H1UA 4TT3D 4YT6H 2ZFFH 3CS7A 2BY8X 2SGDE 5DKMA 1UTNA 1RGQA 4CRAA 4TSFD 5C1XA 1V2UT 2O8MA 2FS8A 1BHXB 3ENSB 1SOZA 1O2GH 1BMMH 1AQ7A 2BZ6H 4I33A 3SQHE 2WHXA 4FVDA 2AERH 3AAVA 3HGPA 3M7QA 1O36A 1C5SA 1QIXB 1PPHE 1ZGVA 2HRVA 1D6RA 4X1SU 3MO9A 2WUBA 1SR5C 1C5RA 1VJ9U 5GJ4B 7LPRA 2TGAA 2FMJA 1AD8H 1PPBH 1DFPA 2BY5X 1VGCC 2WV9A 1O3GA 2G8TA 4BTTB 1MZAA 1P9UA 4DVAU 1Y59T 1TQ7B 1HXFH 1BUIA 1DUAA 1GG6C 1C2LA 1JIMA 2V3HH 4JZ1A 1FY8E 1Y3YA 5C2ZA 1BRAA 2Y6TA 2H9EH 3SV8A 2A2QH 1JWTA 2J2UA 1B0FA 2GDEH 3ZYEA 1AVWA 3BN9A 1K1NA 4A1TA 2ALVA 4VGCB 1XKBC 3I77A 2LELA 3RXAA 2FLBH 1DPOA 3O8DA 1P0SH 3GICB 5C1YA 1LMWB 3SZEA 4B2BA 1OP8A 5K7RA 2F9PA 5C67A 2QF5A 4NFFA 1RTLA 1EAXA 1W0KD 1Z71A 3BTKE 4K3JA 1ZHPA 1C5TA 2XC4A 5IDKA 4X0WU 1UMAH 4BXSA 3SQEE 2F3CE 1DICA 4UFGH 2A5KA 5F8ZA 2XBWA 4SGBE 4X1QU 1ORFA 4FUIA 2Z7FE 2P16A 4K2YA 1GI3A 2TBSA 1K1OA 2TGPZ 1C5OH 1GI8B 1MAYA 3P92A 1EZUC 4FUHA 1D9IA 2GZ8A 1ZMJA 1A0JA 1K22H 1RRKA 2C3SA 2R0LA 4CHAB 1RS0A 4OS5A 5T6FA 4GCHF 3ZZCA 5GCHG 3GCHB 1SPJA 3M37A 1XVMA 2A0QB 1O3BA 1TX7A 2OQ5A 2FOCA 1FY4A 2OK5A 1QBVH 1BBRK 3LIWA 1ZHMA 2OINA 1TFXA 1EOJA 1O3EA 5FCKA 4CHAC 1SVPA 1UHBB 1O2KA 2BDBA 1CSOE 3IG6B 5TJXA 4F48B 4K69A 1AU8A 3U8OH 1UTMA 3DHKH 1J9CH 3NK8A 3T25A 2JETB 1YPJH 4YT7H 3QLPH
chains in the Genus database with same CATH topology
2XWAA 2PUXB 3D23A 1SGYE 2VIPA 5FPSA 1MU6B 4SGAE 1FV9A 3ATIA 6GCHG 3L3TA 1BTHH 3P8FA 1HAGE 3MU1A 3GCNA 1ZTJA 1JMOH 2ZZUH 1ETTH 4AG1A 3ZVGA 1QB9A 1H4WA 5HXFA 2O8WA 2ZHWH 1UK3A 4JK5A 2Z9KA 2FOAA 4VGCC 1MTSA 2VINA 2I6SA 1QY6A 1HPGA 3SGBE 3QZRA 2C8ZB 2ZU4A 4BAHB 1GVKB 3OX7U 1GDUA 4Y11E 1TE0A 3TH3H 5TCAA 1F0SA 5DGJA 2K1QA 3UNQA 3W94A 1G3CA 4IW4E 2FX6A 3M5OA 3ESTA 3MH4A 1L1JA 1C5XB 1ESAA 2J4IA 3TH4H 1E38B 1FXYA 2XBYA 1P3CA 1ZTKA 3LC5A 1DLEA 3JZ2B 3UPEA 5HYOA 4ZKOU 1F5RA 1MMJN 1RTFB 5DP4A 1C5QA 3FP6E 1KXCA 3HKJB 1HIAB 2ZA5A 5JDUB 1HAOH 2HNTF 3E6PH 3SZNA 2AGIX 1EAWA 1V2OT 2QXHA 2BD7A 1MKWK 3MU8A 2ALPA 2UUFB 5EQQA 4OS7A 1EPTA 1WCZA 1TB6H 3RXTA 1TLDA 1UTLM 1L1GA 1QURH 4GVUA 1CA0C 5ESTE 3SORA 2O8TA 4I8HA 1CU1A 1KLTA 2BDAA 2CJIA 4ABEA 1G3EA 1EZSC 5AFYH 1GJ6A 2V3OH 3SNEA 1FDPA 1LQDB 1P05A 1AFQB 2C90B 1ANBA 1PJPA 3URDA 3HATH 1V2VT 2C93B 3TJUA 3U8TH 4GCHG 2FXRA 4INHA 1CA0B 1HAYB 3OTJE 4CH8B 1ETSH 1Q3XA 2J38A 3PYHA 3RXJA 2GCTC 2IJOB 1ABIH 1DANH 3MMGA 3PWBA 2H5DA 1O34A 1NTPA 5DP9A 1V2PT 3RMLH 2WPMS 1LVOA 3KQDA 5FBEA 2BDYA 2FYQA 3H7TA 3GY4A 1CT4E 2QC2A 2HNTE 3T62A 1V2JT 3E90B 3A89A 4ZHLU 1OWEA 1GHBG 3BV9B 1TABE 2W5EA 3OY5U 4RKOB 1BMAA 1AWHB 4Z0KA 2A2XH 3NPSA 1TA6A 5EXNA 1MKXK 1WQSA 2ZDNA 1J8AA 2UWLA 3TITA 2GCHG 5L6NH 2ZDLA 6GCHF 3KQBA 4H4FA 5BPEA 1P2KA 1GJDB 1K21H 2AYWA 1H1BA 3RXHA 3S7KB 8ESTE 2ZIQH 2JKHA 7GCHF 4X8TH 3RXMA 1O3DA 2ZHFH 2IPHA 3RLYH 1ELVA 1SHYA 1O5FH 3AASA 2VVUA 3JZ1B 1L4DA 1PQAA 3RU4T 4FUGA 1K28D 4J2YB 1KDQA 1TNIA 4B75A 1IAUA 1N1LA 3TK6A 2BLVA 4XE4A 5FX6A 4ABBA 1YPLH 1OP0A 2Y5GA 2VH0A 1QB6A 1MD7A 3SV6A 2P59A 4WF8A 4D76A 3SV7A 4JZEH 3CENA 2VIOA 3S7HB 1G9IE 3TIUA 3OSYA 5A0AE 1M9UA 5E0GA 1O2PA 4X2YA 1SFQB 3R3GB 4JK6A 2RG3A 2AS9A 1PPEE 1K9OE 4NWKA 5E8EH 4YO9A 1GBBA 3O8CA 1KLJH 2G52A 3QK1A 4KGAA 1VITH 2ZQ2A 1QJ7B 1O35A 3A82A 1OX1A 4ZHAA 3ODDA 1GHVH 1AUTC 1AWFH 1EOLA 4BANB 3VB3A 3PB1E 1EX3A 2F9BH 1D6WA 2ODPA 1G32B 1ARCA 1TBQH 2QV1A 2XBXA 2SFAA 3V0XA 1A0LA 2JETC 5FPTA 2HALA 1GI4A 4Y0ZE 2XW9A 3RUOA 3ZZ6A 4R0IA 1EPTC 4HFPB 1LVBA 2O8LA 1WQVH 2GZ9A 1C4Y2 2Q6DA 5AF9H 4UONA 1GHAG 2XRCA 1XUJA 3A8DA 1O2OA 2F9OA 1GI7B 3Q3KA 1W0YH 1LQEA 3GCHC 3ZVCA 2THFB 2ZHQH 3A8CA 1TPPA 1NN6A 2ZC9H 3GDUA 1ANDA 1MQ6A 2NWNA 5JBAS 1ZSLA 2PGBB 3BF6H 4WXIA 1QGFA 1BOQA 2ZCHP 3Q77A 2AMPA 1W2KH 3A7TA 1GL0E 2TPIZ 4O3TA 1FLEE 5E2OA 3BTFE 1QBNA 3KNXA 1JRTA 1MAXA 1TBZH 1C2MA 1K1LA 2D2DA 3A80A 1AI8H 2ZPRA 4UDWH 2XC0A 2BTCE 3G01A 2FO9A 2Y7ZA 1Z6EA 2SGPE 4DCDA 1SGNE 2GVFA 3BIUH 1BTXA 1ARBA 3QTOH 1DY8A 1P57B 2BQ6B 2WPLS 2EEKA 2BLQA 4O97A 3BSQA 4UFEH 3S69A 2B0FA 4AGKA 1YBWA 1O3IA 1NY22 4MLFB 2FI5E 1O33A 1O3CA 3VFEA 2P8OB 4WMEA 1D3TB 4BAMB 1UCYH 1GBCA 1QA0A 4DOQA 1C1NA 1C1SA 8LPRA 1AKSA 3A7XA 2ZECA 3GY2A 3RXEA 1CE5A 2B5TB 3RM0H 4DW2U 1J15A 1C2IA 1TPOA 1V2WT 2VWOA 2XWBI 3PTNA 1MTUA 4K1SA 1EZQA 3MO3A 1PQ8A 3VB7A 6CHAC 3MYWA 1YPGH 2BD8A 2BQWB 1ZJKA 1XXFA 2AMQA 1O3AA 3P70B 2RCEA 5L2YH 4BXWA 1A2CH 3SI3H 5LGOA 3UUZA 3ZZBA 1NU7B 3F1SB 4X6NA 4ZAEA 2J92A 1BMNH 4INKA 1BIOA 5JBBS 1DE7H 5LPRA 5FHTA 5T6DA 5AHGH 1SL3A 1L0ZA 1T8NA 1KDQB 1BMLA 2CV3A 3TGKE 2Z9LA 1DWDH 4FU9A 1O30A 1HAIH 3V3MA 4AX9H 2ODYB 4BTUB 1CO7E 1F2SE 2VIWA 2WYJA 1ELAA 1NRSH 1D3DB 2XNIA 4CR5A 3M61U 5A8XA 3SHAH 3ZVAA 2GZ7A 4K1EA 4H6TA 4WXVA 2AH4X 3LJOA 1GJ9B 2UUKB 3RXCA 3HPTB 4D7FA 1LDTT 2BD3A 2EC9H 3SNDA 1VITF 4GHTA 1QRZA 3FZZA 2GV6A 2BM2A 2FDAA 2BX3A 3A7YA 3T28A 4A7IB 2PHBA 2VIDA 3NUMA 1GI2A 4PROA 4Q80A 4IBLH 1XXDA 2FOMB 2ZGBH 3KIDU 3ZZ4A 3MU0A 4UEHH 1EATA 3LOXA 4JYUH 4YLUA 1O5DH 4AYVB 1T31A 2PSYA 1MCTA 2FLRH 4D8NA 1S5SA 1XKAC 1SG8B 3VPKA 4KTUA 3ZYDA 3T26A 2PKAA 3QO6A 3RMNH 1TWXB 2G4TA 4ESTE 1RTKA 1AY6H 4JYVH 1P9SA 4WY3A 5FAHA 2OP9A 1GI1A 1O2NA 2GV7A 3F9HA 5I46H 1K1JA 4Q7XA 1Q31A 4OS2A 2FIRH 1C4U2 2ODQA 1AE8H 2A5AA 5HGGA 1YPKH 2BDGA 4THNH 1NT1A 1QHRB 2BXUH 1IQLA 2FOEA 4TWWA 1TONA 1A5IA 4DT7B 3M35A 3SUEA 4F4OC 7KMEH 1AVXA 1ZR0A 3A8AA 1VR1H 4OGYA 6CHAB 2OCVB 2R3YA 1F0UA 5A09A 1HAVA 1C2FA 5L2ZH 1GBEA 2GT7A 4FUEA 1TMBH 3LGVA 1TNHA 1O2UA 2QCYA 2BY7X 4Y10E 1O3MA 2BMGB 2ZU5A 1HUTH 2BLOA 2QYIA 3BG4C 1QQUA 4WVPE 4YOIA 1FPHH 3TGIE 1K2I1 1LKBA 4DG4A 1C5LH 5ABWA 1EJAA 2AIQA 1GG6B 2WPKS 1KSNA 3NCLA 4XFQA 1O2VA 1D3PB 4ISIH 1F92A 1QL9A 4DJZB 4TY6A 4Y8ZA 4AB9A 3MFJA 2ZP0H 2Q6FA 3DFLA 2Z94A 4X8SH 1L2EA 4B2CA 3ITIA 1ZRKA 2CN0H 3MNCA 1TX6A 2PUQH 3BIVH 1ZJDA 1B5GH 3SNBA 3EA8A 2GCTB 2OBOA 1ZTLA 2W3IA 2VNTA 2BVSH 1NM6A 3MH5A 4FU7A 3B23B 1O2QA 2PW8H 2BD4A 3A84A 1TRMA 1QL8A 4AFSA 4BOHA 1O2MA 4NSVA 2J95A 1GMDG 3MNXA 1WV7H 2BVXH 1WYKA 1ESBA 4ISLA 2CGAA 5GDSH 1W7XH 1YM0A 1O5BB 2PKSB 3D49H 3TK9A 1TNJA 2A4RA 5CHAB 3MWIU 1OOKB 3A7WA 2A4GA 2CF8H 1LKAA 2W26A 1O5AB 2BY6X 3SGAE 1ELEE 1GHYH 1HGTH 3M5MA 1EPTB 2TRMA 1GVZA 1W11U 3RU4D 3UFAA 1V2ST 4FUJA 2VH6A 3QZQA 4O9VA 1GWAA 1Y3XA 3EA9A 1FPCH 2ZGCA 3QX5H 1P01A 1UTOA 1HCGA 1KIGH 3IITA 1KTSB 3ZVEA 3UIRA 1IQMA 1CHGA 4ZH8A 1L1NA 2SGFE 1XX9A 2BOKA 3AAUA 1TOCB 2W7SA 2G55A 5GWZA 2HLCA 1A46H 2Y7XA 4Y6DA 2D1JA 1AO5A 3E1XB 2UWOA 4MTBA 1SGPE 2ZCLP 1UVPA 3P6ZB 2ZI2H 1P8VC 2Y5HA 1W0ZU 2DUCA 1VCWA 1IQNA 1SMFE 2QF0A 3LGYA 5EXMA 1FAXA 1BCUH 1O2XA 2BQ7B 1F0TA 3ELAH 2BYAX 1C1RA 4TPYA 1O2JA 1C2JA 2OC1A 4WH8A 1S83A 1GHZA 2A32A 1ACBE 3LJJA 1FY5A 1UVUH 1OWKA 5F6MA 3SV2H 3UWJH 1ZOMA 4KTSA 2O8UA 1C2EA 1WOFA 1MTNB 4X2VA 4ZHMU 3LKWA 3TLOA 2DE9A 1GHWH 1CVWH 2WUCA 1UCYE 1F5LA 2TGTA 4CREA 3BTGE 1IQJA 2SNWA 1YPMH 1O3LA 5EOKA 3RXVA 3RMOH 1ZYOA 3M7UA 1C5PA 1N8OB 4Y7AA 2XC5A 1GI9B 3PLKA 1EJNA 5IYTA 1GMDF 1SLUB 5CE1A 4AGJA 1ESTA 1G2MA 1W3CA 3SUGA 3SU0A 1S82A 4Y76A 1C9PA 1H8DH 1P09A 4Y0YE 1Z8IB 3FANA 1OPHB 9ESTA 3F9GA 3Q76A 3QDZB 4D9QA 1GJ7B 1SBWA 2SNVA 3HK6B 1N6XA 3GY3A 1KXDA 1DX5M 2R2MB 4Q2KA 5DP7A 4K8BA 1EZXC 1FIZA 1ZMLA 4CR9A 2OTVA 1O5EH 2F9VA 3T2NA 1QRXA 1SGFG 2RDLA 4D9RA 2STAE 1FI8A 1ELGA 1TOMH 1AVGH 1PYTC 1HJ8A 1MH0A 1HJAC 3PMBB 1EXFA 2EI7A 2PFEA 4KKDA 1B7XB 3RXSA 1UTKA 3MH7A 1GHXH 4JCNA 2JH0D 1TRYA 2VGCB 5FX5A 1HAZB 2OC8A 2GX4A 3U69H 4YESB 1RD3B 1PYTD 2FYRA 1AFQC 1EAIA 1OWIA 3E0PB 1DY9A 2FPZA 1UVTH 3RXPA 1A3BH 4ABJA 1V6DA 2A4OA 5E0HA 1G2LA 2EI6A 3T29A 2ZNKH 1CBWC 1YF4A 2WPIS 3PO1C 1SQTA 4U2WA 1A1RA 2H5CA 2D8WA 1KY9A 3P17H 1Y5AT 1FJSA 3PTBA 4CRFA 1WUNH 1W10U 4X6MA 1V3XA 1DWEH 4I8LA 1BRBE 1SGFA 1TA2A 3MU4A 5A8ZA 2O9QA 3TK5A 1NS3A 1DWCH 3U98H 2QGRA 2FOGA 1A7SA 4X1PU 1GDNA 2Y5FA 2WV5A 4OS6A 4ABAA 4AOQA 1ZMNA 1LHDH 1LPZB 2XCFA 2FTLE 2ZGXH 4Y79A 2ZCKP 4E7RG 1GBTA 1BBRH 4HI3A 1BTWA 5EW2H 3K6YA 3ZZ5A 1C1OA 1GMHF 2NU0E 1HXEH 2GTBA 5DP6A 3RC4A 4AFUA 3O8BA 1L4ZA 1LHFH 1O2IA 2PSXA 4UFFH 4DURA 2ZDAH 5F03A 1SB1H 1O3KA 5BRRE 3BEIB 2QAAA 3RXUA 2WYGA 5L30H 3NZIA 1DITH 2B7DH 3GYMA 1O2RA 1OXGA 3Q3XA 1UTPA 5T6GA 1C1QA 1GJ4H 4OGXA 1XUHA 3SW2B 4CRGA 1S0RA 4ASHA 2PTNA 2BVRH 3ZV8A 2R2WU 3UR9A 2VU8E 4YLQH 1YLDA 1ZPZA 5AVDA 2ANYA 3P8OA 3PMHB 2WINI 3KQEA 1X7AC 4AFZA 1VCPA 3DT0H 1MKXH 1MUEB 2Z9JA 1P2MA 2AGEX 4OS4A 3A86A 1BITA 4ZMAH 4NIWA 1C5YB 4DIHH 1F0RA 1T8OA 1NFXA 3A8BA 1C2GA 1N6YA 3BG8A 4AYYB 3STIA 1Q2WA 3EAJA 4UE7H 5JB8S 1BZXE 3KN2A 2FWWA 1F5KU 3UWIA 4A5TS 3TGJE 4XBCA 3PLBA 3GYLB 4O3UA 1T8LA 1SSXA 1G3DA 4H6SB 1GCDA 1FN6A 2ZHEH 1DWBH 2FM2A 8KME2 2BDCA 2OD3B 1ZZZA 3LONA 4NA7A 5HM9A 5JYIA 2W7UA 1RJXB 1FIWA 1LVMA 3MOCA 5EGMA 2GMTC 2TIOA 1AB9C 3RXIA 1T32A 3K6ZA 1C1MA 4FUFA 2F91A 2IN2A 3S9BA 3QWCH 4HTCH 2AIPA 4NZLA 3LGWA 3ZVFA 1NZQH 1FNIA 2FZZA 1KYNA 1Z8GA 1NO9H 1O2SA 2A1DB 3GCOA 2ZKSA 3BTQE 4KTCA 5SGAE 3KGPA 2G51A 2KAIB 3RP2A 2H9TH 1TMUH 4X2XA 1GMCF 2P93A 4ABGA 4IMQA 3TNSA 4UFDH 1TGBA 1AZZA 1XUFA 1S84A 1C5VA 1BHXF 2BY9X 1AMHA 2FS9A 2JH5D 2ZHDA 3Q00A 4YZUA 5J4QA 2YNAA 2ASUB 5J4SA 3ATMA 3VB5A 2PKAB 3MH6A 3M3SA 1Z1JA 1VGCB 1SGQE 3VXEH 4AZ2B 1AIXH 1MBMA 1A4WH 4IN1A 2VVVA 1W14U 1YPHE 1V2LT 4H42U 3SNCA 1SC8U 1MQ5A 4ZUHA 2G5VA 2XCNA 1P2JA 1A61H 4I32A 1PQ7A 2QIQA 3EDXB 2BD5A 2PV9B 1BDAA 1BJVA 2Z3DA 3SUDA 3A85A 2XYAA 4BNRA 1J14A 4MPXA 2IOTA 2BD9A 4AB8A 2NU2E 4Z6AH 3ATWA 3WY8A 1KXEA 3SNAA 1GHAF 1AHT<