3VFGH

Crystal structure of monoclonal antibody 3f8 fab fragment that binds to gd2 ganglioside
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
217
Chain Sequence
b'QVQLKESGPGLVAPSQSLSITCTVSGFSVTNYGVHWVRQPPGKGLEWLGVIWAGGITNYNSAFMSRLSISKDNSKSQVFLKMNSLQIDDTAMYYCASRGGHYGYALDYWGQGTSVTVSSASTKGPSVYPLVPGCTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In silico Driven Redesign of a Clinically Relevant Antibody for the Treatment of GD2 Positive Tumors.
pubmed doi rcsb
molecule keywords 3F8 Light Chain
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2012-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgH01
3ZHLA 2C3VB 2EDTA 4CADA 2FGWH 2NZ9C 3K0WA 4IHOA 4JY5L 5IHZB 1Y18B 4F15C 3X11B 1GXEA 4KTDL 1LE9A 3OR7A 2ESVE 1DQLH 2QADD 4LSQL 4WFED 4K2UL 5C8JA 5DRWA 1G6VK 2GJZB 4YR6B 4G8FA 4ZFGL 2KQNA 4U2YA 5DQJA 3BPLB 1FGVH 3K46A 4M6AA 1H8SA 3KYKH 3B2VH 3NIGE 1P7KB 1YNLL 4FZEL 2D3VA 1OSZA 5D9SA 4UDUA 2P24B 3FB6B 4AEEA 4PJ8C 4QTHB 3TP4A 3U2SB 5HHPB 1F58H 4TULL 2IPTH 2APWA 4O51B 2X44D 3GK8H 4PJDF 3TIEA 3O11B 1FSKC 4D9LH 3UYPA 5ITBL 1EJOH 5CSZB 5EULV 5J13C 4XMPH 1DE4B 2IH3B 1QZ1A 3QEUA 3FQRA 1QOKA 2FJHB 2XOTA 2CXKA 4PGJA 1DSFL 5CJQL 3S37H 2AJVL 5ID1B 3QAZC 4Z77A 3H0TB 3QULB 5ANMA 3U30B 3HPLB 1DR9A 4WI3A 1P53A 3RUGB 3TJHD 2QSTA 4ODWA 5I19L 2BNRE 3M17B 2XV6B 4OFYA 4LHUG 1DLFH 1HH9A 3MV9B 1DUZB 4EVNB 2EKSA 5TQ2H 4Y4HD 4WHCA 4P46C 4OD1H 3DGCR 1BIIB 1NCNA 3IDIA 4XPHH 1MHPH 3RX7A 5JW3L 4Z7OE 5C0AE 4EBQL 1R5WA 1QHOA 2H2PC 4JQIH 3HC4H 5I1IL 4M7LL 1SBSH 2AJZA 1EBPA 1G7IA 1BQHG 4PB0H 2XA8L 4NO0B 1KXVC 2R1YB 4OLZH 5CILL 1PLGL 3L95A 5GHWH 2Q7YA 2WM0A 4WO4B 1W8NA 1A4JB 2CLRA 4NNYA 2IQAB 3NABL 1H3GA 4QOKB 1U58B 2HVJA 4YHIA 3GI9H 4X8JB 4P5TD 1OTUD 5GRWA 1JPSL 5K9OA 3I3DA 1S7TB 4H5SA 1GOFA 3OF6D 1OAZL 1K3IA 5FV1L 5BZWA 1EUTA 4ZUSA 3GMMB 3QO0B 2PUQT 5KZCB 4ZFOA 4XC1H 2XQYK 4U1MB 3FQTA 5E24E 3RWDB 4OIAA 5JPMA 3U7WH 1DDHB 3EOBA 2QV2A 1QUNA 1KNOB 3O6FB 1XR8B 4YX2H 2Y36H 4F7CA 1IKFL 2QR0B 3TBYB 3TV3L 1ZT4A 3ZE2F 5FEBA 1DFBH 1X9QA 5SWZD 1F90H 1Z9SA 3SGDH 3GJFK 5FM5M 4MXQC 1ZA3B 2BNRA 1TCRB 3CDYA 3EOAA 3MRPB 3LY6A 4WHYG 5FA4A 5FYKH 5CGYC 1PEWA 4YHKL 5BQ7B 4KUCF 3RZCA 2DLFL 5D70L 3E3QE 4OV5B 3C5ZA 3Q6FB 1F4XL 4Y1AB 4XVJH 2JIXD 2O26U 5L9DH 4GG6F 3A6CL 1UZ8A 4JZNB 4X7TA 1SM3L 5L88L 5F7HA 2IPUK 2NTSP 4Z0XA 1F8TL 3WKNA 4PRAB 4LPCA 3BGMB 1R3KA 4QWWC 5HGGS 2HJFA 5IV2A 2OP4L 1SY6H 4BSVB 3C2SA 3I2CL 1LEKA 3ARGC 3H3KA 4XP9L 2FZ3B 2YK1L 4AT6A 4PJXA 4BK4A 4EQ3A 1U8HA 1I1AD 1ZTXL 1KIRA 3QR2A 1WWAX 4GRLB 4OF3A 4JHZA 3ZDYF 3PWVA 4JFOB 3ARFA 2X9YA 1G6RA 4KDWA 3S36L 1CF8L 2VLRD 4YXHH 3WXWH 4F2MB 3HS0A 1MCEA 4JRXD 1IAOB 1RULH 4JDVB 3DV6A 1AGCB 1WFNA 1MRCH 4G9DB 3UAJD 5DI8A 5EOTB 1S5IH 1KT2A 1B2WH 4JVWA 4OFPA 1R3LA 2DYPD 3UBXG 1A6UH 3QZWG 2X89D 3RBSA 4OLVH 2B4CC 1OD9A 3M07A 2W0KA 3RWCB 4NQVA 4QRQA 1MF2H 1CL7H 1J9CT 4L5FL 1X5YA 1TVBB 4L9LA 2VE6A 2OLDA 4B7IA 2YOCA 3MV9E 4L9DA 4XBGB 3LPFA 3LQAH 4PV8B 1LD9B 2FL5B 4JVPA 2BXZA 1S7SA 3TH4T 2A6IB 2J6EL 4HCRH 5FYKD 2ARWA 1KPRA 3C8KB 4XP6H 3WL9B 1C7TA 4KHXL 2NLJA 3ARBA 4LHJB 3VXUB 5J6GA 2EDEA 4NC0B 3O2VL 2C3VA 5I73C 3RWHA 1KSRA 1JRHI 4OT1L 1J7VR 5IHZA 5GSRB 3X11A 1Z3GL 3FT2B 1LP9E 4YDKL 1HXMB 1TTGA 1D9KD 5JTWA 4QOKE 4YR6A 1FRGH 1EK3A 3W0WD 2ICES 3LD8C 1P7KA 1R3IH 2IFFH 4XNUL 3S8WA 3MJ9L 2V5SA 3DX6A 4RAHA 1UFUA 3FB6A 4PJ7B 3O3DB 5F72S 2PYED 4QTHA 2RHEA 4OFKA 2AABL 3U2SA 5HHPA 1J5OH 3SE8L 5BV7H 4FHBD 2FX8H 4O51A 1KF9B 4PJGF 5AYUL 3O11A 4JG1L 4I3GA 5CSZA 2WBKA 1N2RB 1DE4A 2IH3A 2FJHA 1JZ5A 5BW7A 3QDMD 1HSAB 2JIXB 5ID1A 5CZXD 4X83A 4Y5YB 2AXJA 4I1NB 2AJYH 3H0TA 3QULA 5BRZE 3HPLA 4NHCH 2FYYB 4KU1A 3RUGA 3SY0B 5DHVH 1ZVHA 3M17A 4JREC 4KVCL 4L29B 4S1SL 5J3HD 4FABL 3MV9A 1IQWL 1DUZA 1K4DB 4EVNA 5EWIH 1NUGA 1BIIA 4P23C 5EB9A 3GMNB 4GAJH 4Y1AE 3UTTB 1DZBA 1CFTB 1YEKH 5GRZA 1I85A 1JNLL 1CN4A 1NBQA 4NO0A 2QEJA 5DHXB 2R1YA 1J1PL 4KI5F 2QHRH 4UV4L 1CICB 3RL1B 5A2KH 2VZ3A 4WO4A 2DKMA 3NPSC 1H5BB 1HINH 1A4JA 2IQAA 1WV7T 4XNXL 1VGEH 4QOKA 1CGSH 1U58A 1HIMH 4X8JA 2FJGB 2CJUH 3ROOB 5HHMD 1CLOL 2NR6D 2VDKH 3U7YL 1S7TA 4MGXA 5F9DC 3NFSL 4KKAD 1LNUB 4NWUH 3VD9A 4BQ9A 4RX4D 1P9MA 5EU7C 2Q6WB 1P4LB 4CMHC 1S3KH 3GMMA 3QO0A 4HBQA 3WDIA 4JY4B 5DD0H 2X4RB 5HXMA 4U1MA 1C5BL 5KSUA 4JFFD 3RWDA 1WEJL 1SJHB 1E27A 1QRND 2WAHA 4LL9A 2C1PB 2X1QA 1KOAA 1NEZB 1DDHA 1AHWA 4AZ8A 1CE1H 3O6FA 2GTWB 1XR8A 2WQRA 4S10A 2OSLA 2QR0A 3TBYA 2EDJA 4KV5F 1BLNA 4OM1L 5DA0B 4FQ2H 1KC5H 5C70A 3LMJL 3W0WB 1VB9A 4HUUB 2N4IA 1ZA3A 3MRPA 1TCRA 4G6KL 2D7TL 5BQ7A 3BIKA 1YN7B 2BVPB 5DD3L 2DF3A 4FQCL 3RJDA 2Q7NA 4J3OC 4JR9H 1MIMH 3BGFB 3KPPB 3QUZC 4HPYH 4JZJC 4OV5A 3VXUE 3Q6FA 4DGIL 3PQYE 3QIBB 3HMXH 4Y1AA 4JFZL 3S97C 1OAYH 1NAMB 1RZGB 5E6ZA 4JZNA 4K3EL 3QNXB 2CXGA 4NZUL 4EOWH 4PRAA 4LCWB 3BGMA 5ERWB 2VSCA 1NAKH 3PIQB 4BSVA 3EJYD 5MHSD 1A1NB 4QXGH 4DZ8B 4JQVA 2FZ3A 3B5HA 4PJ7E 1UCBH 3QJFB 3RHWK 3BKJL 4PRDB 4HGMA 1ZMYA 4GRLA 3RVXC 3STBA 4JFOA 2DOCA 5DC9B 2EDRA 1XGRB 2GITB 3RTQD 4HZAA 2R1XA 4IRZH 5TFSL 2H1PL 1ZHBA 4F2MA 4XBPB 3WFCL 1IAOA 1U8QB 3ARUA 1DVFB 4JDVA 4PRPD 3VWJB 1AGCA 1RUAL 5EOTA 1I8MB 1UWXH 3QEGH 3D9AL 3EO0B 1YEIH 4OCYH 3RWCA 2F8XC 3T0EE 3RU8H 2A0LD 3MODH 1U41A 1TVBA 3WFZA 1Z9MA 4XNYH 5E2WH 4RFNC 1OW0A 4G3YL 4PV8A 2EE9A 4F9LC 1LD9A 1T1XB 3EAKA 3V5HB 1AC0A 1VEMA 5JHDD 5HHMB 5A40E 2A6IA 3DUHA 2ENSA 3QQ3B 3UTTE 4CU7A 3B9KD 1MFAH 3DOSA 3C8KA 4HPOL 2DTML 3WL9A 4WI9A 1J87A 3QISA 5CP3A 4CDGC 3TIDB 5ACZB 1IZJA 3VXUA 3BO8B 3PQYA 5GSRA 3RIAF 1OM3L 3FT2A 3UZVB 4MJ4A 1HXMA 3ZT7A 4XRCA 4D9RE 1JJUA 3EFFB 4DGYL 1AI1L 2HRPH 3DPBA 3U36B 2RB8A 3TWCH 4YUEL 5GGSB 2VDPH 3QDGD 1F00I 3D69B 5E94B 5FGCB 4Z7WB 2YUWA 5EUKB 3BQUD 3VI3E 1BBJB 4PJ7A 3O3DA 4GAYB 4NZTL 1ND0B 3D18B 2HT3D 4Q58C 3SDCD 3LKNB 3EDDA 4X0KB 4ENED 1XF3B 4Y16C 5HYSB 2ZUQB 1N2RA 4AMKL 4XP4H 2DI7A 4W4OC 3DO7B 2AXGA 2F19L 5FUCE 1MFBL 1QFUH 3FN0H 5E2TH 3ILQC 3KXFB 4C56D 3S9DB 1HSAA 1EDQA 2VN4A 4Y5YA 5B8CC 1IFHL 3F12B 3K80A 1Q9WB 2FYYA 4ZAKC 4JN1L 3ZKXC 4CKVX 3SY0A 2PNDA 4R8WH 1KEGL 2AVGA 1KJ2L 1MFDH 2PETA 4NRZB 3ULVL 4L29A 3VDBA 1IGFL 1ZANH 2I9TA 4WWID 1K4DA 4J4PC 4HGKC 4XTRD 5I17B 3GMNA 4MJID 1OPGL 3UTTA 2YKLL 1CFTA 5IMOB 2J5LC 4JHAH 2NZ9D 3QRFM 4OD2B 3IU3B 4LCWE 2Y4SA 1RIUH 3QA3B 4ZODA 4J7RA 4IJ3B 2H26B 1CICA 3RGHA 3RL1A 2FR4A 2BFVL 4UIMB 1CS6A 1UB6B 3GKZA 4ZOCA 1UM5L 3GDBA 5F89B 2FJGA 3ROOA 3UTSD 4PJ8D 3I50L 1PY4A 4NUGL 4B0MM 2BMKB 5FCUH 3BSZH 4UT7H 1XCQB 1LNUA 1Z9OA 1RURH 3C9NB 3MRFB 4IOSD 2Q6WA 3P3YA 3CFBB 4X7EC 4Y7MA 2NXZB 3B9KB 4HIXL 4XCFH 2YWYA 2B0SL 2QKIB 1SJHA 1Q1JH 4QTIH 4OZFB 2C1PA 1NEZA 4PUBH 1MCQA 4N0YH 4LP5A 4LU5L 4L8SC 5FYJH 2GAZB 2GTWA 3EOTH 3K2UH 2X4TB 5EC1A 4YHYC 2A1WL 1ROWA 4GBXB 4GAFB 2ATKB 1EHAA 4BH7B 1RIVL 2BX5A 4UT6L 3W0WA 2F54E 2ITDB 4HUUA 3C6LC 3OB0H 5C2BH 1YN7A 1VFOA 2BVPA 4LQ1A 2N1KA 1N5YH 4P2YA 4YBLC 4OQ1A 2DQGL 3SDCB 2H2PD 1T7WA 3QIBA 5DYOB 3WIHL 1IKNC 2O5XH 1NAMA 2OXHA 1YY8B 5CHNB 1G7HB 1DQML 1GAFH 1RPQA 3IRZA 4Y19D 3ZYOA 3MA7B 2CRYA 4LCWA 5ERWA 4BQ8A 1Q9KB 3BIBX 1I9RL 2EIBA 4A2LA 5HGAB 3WIFB 5FGCE 3LS5L 2AERT 4NQDB 4Z7WE 4R4BB 4ZS6D 5FGBC 4HG4K 1BOYA 1A1NA 4DZ8A 3FTGB 4PY8I 4R26L 4PG9B 3ES6B 3QJFA 4PRDA 2BY3A 4UTAL 3HNVH 2WUCH 3NN8A 2GITA 3V4PH 1DEDA 5MEND 2VXQL 3ZL4L 3L5WB 4XBPA 2CDEB 5EOQL 1U8QA 2Q8BH 3FRPA 3QHFL 1CXKA 1DVFA 3SKMB 3VWJA 2AJUL 3KXFE 4EI5B 3NIGF 5GGTH 4WDIB 1A22B 3VFGL 3T0XA 3G04B 5E08L 2B4CH 2O5ZH 4R4FH 1KCLA 3MOBH 3RI5F 3S35X 1RJYB 1VPOH 3EO0A 3T8XB 5AWNH 5KTEH 4XCCL 5AG8A 4WRLA 1IEBB 2DLHA 5T3ZL 4JGUA 3ZTNL 5I6XB 5FYJD 3P4OB 2VR5A 1FLTX 3PL6C 5HDBE 5JIIA 4NKQB 3GNMH 1T5WB 1K6QL 2F53B 4FQLH 1T1XA 2MMXA 3V5HA 3GHBH 3MV11 4L4TD 1NGQH 2F54A 3LEVH 1KN4H 5IFAL 2UUDH 3QQ3A 4FQJH 2CIIB 5DMJB 1BGXH 1BJ1J 5CS7A 1PAMA 5E5RB 2HN7B 9CGTA 4ONGL 4BFEA 1UB5B 5ACZA 4RX4A 5DQ9B 3BO8A 3T2NL 2CRZA 1JVKA 3T1FB 3QUMH 5LVEA 3EDEA 2DL9A 1PG7L 2ATPA 3EFFA 4QWWD 3QPQC 1MCIA 2H41A 3V6OE 3U36A 2YRZA 2A6DB 4U4BA 4XNMB 4DJMA 2YN3A 5CJXC 5GGSA 3VFVB 3BWAB 5HD8D 4TPRL 2IFGA 2W59A 2D7OA 5F8QC 3D69A 5E94A 1XH3B 3AS0A 4JY5H 5EO9B 4Z7WA 4Z7OF 5EUKA 4KTDH 5C0CE 5IBUG 1BBJA 4LSQH 1JBJA 1PKOA 4GAYA 5B39G 4K2UH 3D18A 2YA2A 4ZFGH 3OJ2C 4Y89A 3LKNA 4D0DB 1GJIA 1U8KB 3BDBA 4X0KA 3FFDB 1XF3A 1YNLH 5EZJB 5HYSA 5JUEL 5TF0A 5IW3A 2DTSA 3DO7A 1TIUA 4U6TA 1XZ0B 3KXFA 4X4ME 1IL1B 2NY7L 3GO1L 3HE7D 5GRVK 1MVUB 4TSAL 5ITBH 1ZHKB 2IJ0C 2Z93A 3F12A 4Y19B 3CZFB 4U3XA 1MJ8L 1VFBB 2F8OA 4NRZA 1A64A 4FXGB 3TEUA 2AJVH 2BJML 2B5IB 1KV3A 4N90E 2VLJD 3FAWA 5CIPH 5CP7B 3GMRB 3VD3A 2BVOB 1L7TL 4TQEL 1QFWI 1MLCA 3Q5YA 1N3NB 3QG7L 1HHHB 3CX5K 5I17A 1HYSC 3RWGA 5BVJB 2YPKB 5I19H 1FG2B 5IHUH 4XPAL 3KLDA 5IMOA 2BC4B 1JGEB 3BPCB 1VFMA 1NDGB 4W70A 4OD2A 3ULVC 3GSVB 3CDGB 3IU3A 2OX5A 5JO5B 1TQCB 3QA3A 2VRAA 5D93B 3VD7A 2H26A 5JW3H 1FYTD 4PV9B 4NQDE 2E8YA 5CMAB 5IB3B 4UIMA 1UB6A 1ODAA 4M7LH 5IQ7L 4LSUL 2W9DL 5F89A 5FHAL 5EPMB 3QFJB 3WJJA 1QBBA 1S7WB 1PLGH 5CILH 4OSUL 5C0CA 2BMKA 1XCQA 4PGEB 3C9NA 3MRFA 4X9HA 4OI7A 2G5RA 1P1ZA 1I1FA 3B9DA 1QP1A 3NIFE 2C4FT 5EZIL 1GSMA 3CFBA 3S98A 2WUBL 4N9GB 5EZOL 3RX8A 1MQ8A 2QKIA 1MHCB 1G1CA 4OZFA 1OAZH 5DLML 3CK0L 1HQRB 4X4MA 4S1QL 1ZHNB 2Z9TA 4JEGB 4TUJA 4LVNB 2VLLB 2X4TA 4EJ1C 2IG2L 5DJYA 3ULUH 3RX5A 4GBXA 2F53E 2ATKA 4RFOL 5ELIA 1CDYA 4BH7A 3VFMB 4MD0B 2ITDA 3HR5B 2ERJB 3RVVC 1X5KA 3D5OF 3O2DL 2W38A 1RJCA 5C0ND 1IKFH 3TV3H 5IHLB 3RUGF 1UWEH 5DYOA 3C8HA 3MZGB 4YHKH 1EFXD 4QNPE 1YY8A 3UJJL 5CHNA 1G7HA 4AG4L 1XR9B 2DLFH 1EGJL 3MA7A 5D70H 1Q9KA 3HKFA 3PWPD 4U33A 3HE6C 1MELA 1NDMB 1F4XH 5HGAA 4DZBB 3CFDB 4NQDA 4R4BA 3HC3L 2ADGB 3FTGA 3A6CH 4HX1B 4PG9A 5L0QB 5L88H 1YEEL 2WW8A 3ES6A 1DN0B 1F8TH 1X5HA 4L8BB 4RGOL 4GG8B 5DXWA 1CCZA 1XGQB 1LO4L 1LP9F 5C08B 4Y4KA 2VLJB 4ZTPL 3I2CH 3ZKMC 2XACC 4XP9H 3L5WA 2UZIL 2YK1H 1MNUL 5LCVL 2CDEA 3RGVC 3VXPB 3SKMA 3MOQA 4EI5A 3B8SA 5HI4C 1CTNA 1ZTXH 2O61B 3G04A 2XWBB 1RJYA 3C8DA 3S36H 1UJ3C 3KPRB 1BX2B 1IEBA 3QUMB 2HTKD 4KQ4L 2YC1B 5GIRB 3DYMA 3P4OA 4P3DB 1DBJL 5F9WC 3G9VA 3ULUD 2QQNL 2F53A 3AB0B 3M8OH 3P11H 4OGZA 1JZ6A 4QHKI 5I71B 2CIIA 4L5FH 2X4OB 1MRDL 5D7IB 2HN7A 3W11D 3MLRH 2YSSB 2OXGA 2CR6A 1UB5A 3BXNB 5DQ9A 2Z35B 3BN3B 1OTSD 3T1FA 3CFEB 4H0GA 2QQQA 1YPZB 2J6EH 2YD9A 4XZUB 3LN5B 2PXYB 3QUXD 1UT9A 2LTQB 2A6DA 4HV8A 4RMQA 3BWAA 1XH3A 1FAIL 5EO9A 5DTFB 2DQFB 4YDKH 4PJ5B 1M4KA 2X4PB 4K07A 4WWKC 4NT6B 1JTPA 4U2ZA 1ETZB 4PGBB 5HSFA 1N64L 3S37X 5C0RH 5DFWH 4D0DA 1U8KA 3FFDA 4HWBL 5EZJA 4R7DB 4LRIC 4XNUH 3MJ9H 4GKNB 5GRXG 2WV3A 2ZUYA 1MRFH 1I1CA 4MS8C 2AABH 4TVPE 1XZ0A 1YC7A 4JFHD 3U9PL 1IARB 1MVUA 1I9JL 1QR1B 4LEOB 1ZHKA 4JG1H 1EFXB 1EERB 2DM4A 2XTJC 3W39B 5J9PB 4LARH 4U3HA 5DMGC 4G43B 3BN9C 4G8GD 4Y19A 5IVNA 3F7RA 4GXUM 2HTLD 3OKDB 3CZFA 3PWPB 1TQBB 1VFBA 4FXGA 5A2JH 4PJAB 4OCMC 1OCWH 5CP7A 4QRUB 5LG1A 3EW3B 5LWYL 2BVOA 1UM6L 5L2JB 2VMFA 2EE2A 5J57B 1N3NA 1HHHA 5BVJA 2DQEL 2YPKA 2X6MA 3R06B 1FG2A 3QP3A 4FRWA 4KVCH 3P9LB 2YUZA 4WEMB 2R23B 4FABH 3N85L 4I4WB 1IQWH 1DUYB 1JGEA 2BC4A 3BPCA 5JA9A 1NDGA 2VDNL 4K71B 3GSVA 5D1XC 1JMXA 3CDGA 5JO5A 1W0WB 1MCWM 4AM0B 1ZA6B 5CMAA 5IB3A 3O6KL 4JFED 2R0ZL 1XF2B 1CDUA 4GOSA 1JZ4A 3NFPB 3MO1B 3MRRB 4XPTL 1JNLH 1QSFD 3HTLX 4MVBD 4QRPD 5JW5B 5EPMA 1BEYH 4M02A 4U0RB 3QFJA 1FFPB 1J1PH 3FONB 4UV4H 5C08E 1SJVA 3JXAA 1YEHH 1N6UA 4XMLL 4FFVD 1U9KA 5MERB 4PGEA 4XNXH 2MQ3A 4H1LB 3QQ9D 1CLOH 4NDMB 4PJFB 3X14B 2C3HA 1AE6H 3ILQD 3W2DL 1MHCA 4PJ7F 1S5HB 3NFSH 4O02H 4F58H 3KPRE 3AY4C 1T22B 1C5DB 1HQRA 1JRHL 2Z0BA 2XICA 1ZHNA 5DHYB 3CFCL 1UWXK 3EOYG 1UVQB 4KDTC 4PY8J 5DFTA 3QUXB 2VLLA 1AGDA 3KJ4C 1C5BH 4WW2B 4ZNCD 1WEJH 1G9ML 2ICCA 2KKQA 4MD0A 1TFHA 5GGQH 3HR5A 1YECH 3UTPD 4GSDL 5C0BE 1A6WL 4UIKL 3NMEA 1X5JA 2DQTL 4DFIA 3CXHK 2CMRL 43CAA 2DIAA 3LMJH 5INDA 4PB9H 1G9NL 4LLMA 4G6KH 2D7TH 4TRPH 4FQCH 3TN0A 3TM6A 1WFTA 1XR9A 3BHBA 5CFHA 1CFVL 2Z8RA 5GGTA 1NDMA 2DS4A 2C3WA 4DZBA 2DBLL 3CFDA 5IEKB 4HZLB 2ADGA 2ZOLB 4JFZH 4PJ5E 3MLXH 2MKLC 4WHDA 3V7MA 3X3GH 1OWRM 4P2RD 1ED3B 2VZOA 1DN0A 1ZVYA 2DQDL 2ZKHL 4L8BA 4YDIH 1Z6JT 4GG8A 4LLYB 1J12A 1U92B 4HULB 4HS8L 4XB8A 5C08A 2VLJA 4PLKC 3PDGA 4XAWL 1IGTB 4IOIB 3MBXL 4ZD3L 1X5FA 3VXPA 3MR9B 4MJ5B 3JVGC 1SEQL 4Q6IC 1FORH 1T1ZB 3H9YA 3L3IB 2PN5A 1FFRA 2O61A 3EZ8A 4BKLB 3VI3F 2XWBA 5TFSH 5HDQL 1PJ9A 3V8CA 3ILPB 3KPRA 1BX2A 2PW1B 3WFCH 4NQSB 5E8EB 3L3JB 2HT4D 2EH7L 2LAGB 2YC1A 4KK8C 5GIRA 3IDUA 4P3DA 1EZVX 4PJAE 4E42B 3L3OB 4JFEB 4KK9C 1RUAH 4NOFA 3TA3B 3ARDC 3C6LD 2BHYA 3D9AH 3MLUL 5C6PB 4TUOA 5IMKB 4QRPB 4XMKL 5IVZB 3DURA 2KQMA 1LILA 2V5MA 2AJ3B 2X4OA 1EVTC 1A7OL 3L3KB 2DQUL 4BQ6A 2CDGB 2YSSA 3BXNA 4WV1B 2Z35A 3TJEH 2BERA 1HQ4B 3MCKB 3CFEA 5DJXA 7FABL 5E8DL 3T4YB 5DZLA 1TNNA 5E56A 1YPZA 1W72L 4XZUA 3LN5A 2PXYA 4HPOH 4M7ZC 2DTMH 4FP8L 4B7LA 4FMFA 1NGPH 4LSVH 2GY7B 5E1HB 1Q9LB 1I3VA 4MXWL 3SOBL 5DTFA 2DQFA 2B39A 1DBKL 3BKCL 3FMGL 5A43C 4FTVB 4LCUB 4PJ5A 2X4PA 4CVXA 1LHZA 3OJVC 4NT6A 1ETZA 4DGYH 1AI1H 2R2CA 3HNSH 3VXNB 1C1EL 1E4KC 1DQDL 3EGSB 3L5IA 1CZ8L 2J8OA 4R7DA 1RJZB 4HK0B 4GKNA 3VMNA 1FNAA 4NOBA 2DMKA 5J8OA 2CKBH 4NZTH 3QRGL 2EDQA 5IB5B 3KPSB 1QR1A 4LEOA 1CFNB 3E2HC 4UMGA 4HT1H 3W39A 5F3BA 5J9PA 1F3JB 5GGRA 2LU3A 1RHHB 1MCLA 3WE6B 5E2VL 3OTTA 4HC1H 3OKDA 4LCIL 2F19H 3NZ8B 2EO1A 1H8NA 2YUXA 2K3TA 4PJAA 1VACB 1IFHH 4X9BA 5L2JA 4KMQA 4JN1H 35C8L 2XZAL 4GMTL 5ITFB 3QIWD 3OB0K 1SJEB 1T0NB 2FEEI 3R06A 1KJ2H 3P9LA 1IGFH 2R23A 1DUYA 1JGUL 3IXTB 3GZKA 1HH6B 3LPGA 3S5LG 1W0WA 4IRJD 3H3BC 4Z8FH 4AM0A 1OPGH 1ZA6A 3RY6C 3DI3B 1XF2A 4J3WA 3ZHDA 4NBZB 1CGYA 3NFPA 3MO1A 3MRRA 5GSVB 3SDAD 4N5UA 5JW5A 3T4AB 2ZP0T 4N8VG 1NBYB 1P84J 3SDXB 3WS6C 5CEZE 4QXUL 3TZVD 5I30L 1A5FH 5I0DA 1NL0H 5MERA 2BFVH 3MUZ1 1UM5H 2NY2C 3WMSA 3QPXL 3DXAB 4H1LA 4JO4L 2MNUA 4NDMA 5IFHH 4PJFA 3X14A 5GZOC 3I50H 4Z7WF 4ZYKB 1EH9A 3LB6C 2KUTA 1S5HA 4K7PY 4YBHA 1UEMA 2IBGA 4JCMA 2E9IA 3MUY1 1C5DA 1T1YB 3FJTA 4JM2A 1MAML 4ODVL 2HFTA 5DHYA 1TENA 3G6JE 3NBNA 2AEPL 4J2XA 3QUXA 2MKWA 5FO9B 2B0SH 4WW2A 1CDBA 4PJHB 3NVQA 2ZNXA 2ZCLH 3HZYB 1IILE 4LLDB 4KUZL 4X80L 1U91B 1MCRA 5FM5O 4LU5H 3HB3C 1RUQH 1HYSD 3I6LD 3K81A 5T3XL 5JXAL 2A1WH 3QIUC 2UUDK 3ROLB 5GS1B 4UT6H 2V2TB 2W9LA 2V7HB 2FH8A 4YBQC 3EYFB 3LV3A 1G9MC 2QSCL 1WFUA 3DECA 3O4LD 5T1LB 5DF0A 5TE4H 4GLRI 2DQGH 5C6WH 5I75B 1EEZB 3PG2A 3UMTA 3WIHH 5IEKA 4HZLA 5JOEA 1HHGA 2ZOLA 4YGAB 4ZPVA 4FTVE 4EXKA 1S9XB 1KACB 3DX8B 4CN4A 4HIHB 1ED3A 1BBDL 5T1KB 4AL8L 1HWGB 5C07D 2VAAB 1QKZL 1I9RH 3FZUC 1NFIA 1JHLL 3LS5H 5F7FA 4HKJB 4RIRB 5HI5D 1IGTA 2Y6SD 4IOIA 4JB9H 1MIEL 1PQZB 4MJ5A 5F7LB 3QIWB 4F7PA 5EOCL 1DLHB 3KPSE 1T1ZA 4XH2B 5F88B 4YHLL 4FXKB 3L3IA 4UTAH 4DAGH 4NBXB 3ZZ1A 4BKLA 5AYQA 1NCBL 3QFDA 5FYLE 4XPFH 2VXQH 3ZL4H 3ILPA 5HYJE 2PW1A 4NQSA 5E8EA 3L3JA 3QHFH 1RUPL 2IBZX 1BJ8A 3WO4C 4W68A 4E42A 1AXSB 3L3OA 3VFGH 3BP6B 3TA3A 4M6NL 4M4RA 1RZFH 5IMKA 4QRPA 1Q72L 2PYFB 5IVZA 3DBXB 2AJ3A 2DL2A 1MWAB 2IPKB 3F58L 3L3KA 5BZDB 2CDGA 1CXEA 4L4VD 1LDPL 4WV1A 3D85D 3QEQB 4W81A 1ULVA 2WLZA 3MCKA 3T4YA 1T5XB 5IFAH 4QRRD 1D6EB 4LNVA 5JOPD 1YMMB 4P2OC 5I18L 1W8OA 3EBAA 2I07A 2FEDC 3QCTL 4OAWB 5T5FH 2CKBB 3DMMC 4PJCE 4OLYL 3T2NH 1FPTL 1MCDA 1Q9LA 2J7LA 5DWUL 5EUOE 1KTLB 4ONFH 4U1JA 2XYCA 3HUJB 4RAVB 1DBML 2RR3A 4FTVA 1X5IA 4LCUA 4BZ2L 1NKRA 3AVEA 4FFYL 1I7UB 3DXAE 3VI4E 3VXNA 2H8PA 5DT1L 2EDBA 4OF0A 5I1KL 4Q9CA 3RGVD 5C2UB 3V4UL 4HK0A 3QQ4B 5FAAA 4RZCB 2VLRE 3UPRB 5TPWL 3VFSB 5IB5A 3KPSA 2MQCA 4KRLB 5JW4Q 4OCSL 4ZFOL 2GQHA 1CFNA 4OCNC 1F3JA 4WHYH 1RHHA 3WE6A 4PJHE 4EN3C 4LHUD 4HKBB 3GIZL 1M05B 3NZ8A 3NIFF 5IIEB 2GW5A 2Y5TB 3IDGB 3F65A 2YPVL 2NY7H 3GO1H 2OK0L 3TBWB 4LVHC 2BRRH 4HUWB 3S6CA 1KEML 1FFOB 3GBMH 3OMZA 1QD0A 4YXKL 4R96B 1EMTL 2VZSA 4LPYA 1VENA 2VTFA 5C07B 5ITFA 1MJ8H 1SJEA 1JI2A 2HKFL 1HZHL 1KLFA 3LDBB 1FVCB 2BJMH 4RMSA 2MCPL 3VGAB 3IXTA 3JV6B 4JFXB 2XZQH 5FB8B 3MXVL 4BZ1L 5A1AA 1HH6A 4LF3B 3S4SB 1L7TH 4WEBL 1N0XL 2APBA 2PO6A 4XWOC 1GH7A 4KROC 3OZ9L 3MRGB 3OKYA 4XPAH 1KELH 1EX0A 2DLEA 4YIQB 5I1GH 3U79A 4KK6C 1UKQA 3T4AA 5F9OL 4GJTB 2VKWA 1AGFB 1HKLL 4GH7B 1NBYA 4WWKD 1FZOB 1YEGL 4RGNB 1T04A 3SDXA 5DSCB 4AJ0A 4EEEA 1FNEB 4WU5A 1KPUB 5GXBB 4QNPF 2K9UA 3DARA 3WNKA 1X6LA 4LSUH 3E6FB 3DXAA 5JDSB 3FT4B 2H6PB 5FHAH 4JG0L 5LQBL 1S9YB 4K8RL 4LIQE 3P0GB 4MS8D 4ZYKA 4WGWB 5CSBA 1G6RL 5ALCL 5A2FA 4L4VB 3H8NA 1MCWW 4MAYC 4XBEH 3V6BR 1A21A 1MFCL 3VXMD 3JUZA 5D7KD 2P5EE 4LHQB 1T1YA 3EFDL 2XTJD 4NPYB 4ZTOL 5EZIH 2ZNWA 4C57C 3QDME 2WUBH 4DUVA 4M1DH 5DUMH 5MI0C 5FO9A 4PJHA 4KGJA 3HZYA 4E0RB 5DLMH 4LLDA 3CK0H 1CVRA 3IDYB 1P6AB 4QXTB 3TGXA 3QQNA 5CWSB 3IETB 3TLRA 4S1RL 3ROLA 5GS1A 4A6YB 1OWWA 2V2TA 2IAMB 5DEFB 2V7HA 5IB4B 2HH0L 1CLZL 3EYFA 5D1XD 1NMCC 5CZVH 5BS0B 1WCBB 3O2DH 1W2KT 3W9DB 3MREB 3U9UB 3E0GA 5T1LA 1JZ3A 4KHTL 2ZCHL 1KCVH 1EEZA 3AREC 4HDIB 1J10A 2PTVA 1S9XA 4NKOB 4LHUB 1NC4B 4HIHA 1UGNA 4PRID 5T1KA 5KJRL 1EGJH 5DC4B 1C8PA 5B22A 3HI1B 4FFZL 2VAAA 1MI5B 4NN7B 4P2QD 3UDWC 3HC3H 1KLGA 4KY1H 5D1QB 2NY6C 5HHOD 5A2IH 3I9GL 1YEEH 5C0FB 1QFWL 4TOYL 3DVGB 3QIWA 1DLHA 3UEZA 5F88A 4FXKA 2ZUVA 5KVDL 1BQHB 4NN6C 1LO4H 1H8OA 3KJ6L 4ZTPH 4I0CC 2NQCA 4YFEA 2HLFC 2UZIH 1CR9L 5LCVH 1MNUH 4UILL 3FHQA 2P5EA 1JWUB 2NY1C 5HHVL 1MCHA 1PX4A 2A9NH 4MNQD 3BP6A 3BIAX 4ZFZA 3RFZC 3RZWA 2FO4B 3G5VB 2HMIC 4M1GL 4KAQL 5C6TL 3MGTB 1PFCA 4KQ4H 2AS5M 5D7LB 1MWAA 2IPKA 4V2CB 1X3DA 5BZDA 1DBJH 1NJ9A 2OI9B 4ONOA 2VLKE 4M93B 2QQNH 3QEQA 1XIWD 4D9QD 1SYVB 3RWIB 2GEEA 3ALWA 1T5XA 1L0YA 1D6EA 2RAMA 1IQDB 1YMMA 3T09A 1KGCE 1CLCA 4J3XA 4WFGE 1MRDH 3D39B 4POZC 4OAWA 5ESAB 3G08B 4K23H 1YQ2A 1MY5A 5HY9B 4RGNE 1KTLA 4GKSB 1V3MA 3MRIB 4RAVA 1AO7E 3P0VL 3BZEB 1LEIB 1V3KA 5MHSE 5D1ZD 2NY4B 1I7UA 4HC1A 2Y7QB 5GGRY 2AEWA 1KJVB 4RGMB 4LFHD 4ZPTA 3QQ4A 3PF2A 4JRWA 4OKDA 4RZCA 5I1LB 3UPRA 1RUKH 3MZTA 1FSKB 3VFSA 1N64H 2AJXH 2OL3H 3O6ML 4TN9A 3LH2L 4LLWB 3TBTB 1U3HB 4ZDHA 3D1MC 2F58L 1T2QL 4HWBH 4LSDA 2OJEB 4RDQF 4PRHD 4JY6B 4KK8D 4HKBA 1F45A 4HUKB 1DTUA 1M05A 3SO3C 4PD4K 5IIEA 1IMHC 2Y5TA 3IDGA 4KK9D 3AUVA 3I02B 4X99B 1M7IB 4X6CB 3TBWA 1G7PB 3HZVB 2EC9T 1FFOA 1MEXH 4Y4FB 4S2SA 1H0DA 2FDBP 4Y5VB 4P9HL 5C07A 1UACH 5F7KC 5JHDE 5FGSA 3ARPA 3Q6GL 1OAUL 1FVCA 3BRDA 4KUCD 5GS3A 3JV6A 4JFXA 4E41E 5KW9L 5FB8A 5LWYH 2VLKA 3PV7A 1NUFA 4LF3A 3S4SA 2YD3A 4PJDB 1MPAH 4M5ZL 1RJLB 3UBXB 2D0FA 4F37F 4FZ8H 2XN9E 2DQEH 5E2JA 2CKNA 1A7NL 3C5SB 1IAII 5CJ8A 3N85H 1X5AA 2QJDA 2JE8A 1FL3B 2W0FB 1AGFA 1H3UA 1YEJH 1FZOA 2E7MA 3RZCC 5DSCA 3QDGE 1MI5E 3V6FB 1AO7A 1FNEA 3C5ZC 2GFBB 3O6KH 2R0ZH 1JPTL 3E6FA 5JDSA 3FT4A 4GKOA 2H6PA 3HG1E 1WLHA 1V5JA 4JVUA 4XVTL 1SBBA 1JF1B 4CU6A 4JO1H 4XMLH 5F21B 1AR1C 1A7QL 1ZE3C 4XXCA 5EIQA 1F4HA 2CRIA 1XIWB 4JRYB 4NPYA 3S96A 4OLUL 3TBSB 4LVOB 5LGJB 1OAQL 4QXWA 2WP3O 2JB5H 5D2NB 3OXSB 3W2DH 1FYHB 4K8RC 1OB1A 3MLYH 3ARFC 3PNWB 4E0RA 4KJWC 5ICXB 1JRHH 1HCVA 4QXTA 2VAJA 3CSGA 2BVQA 5D7LE 1M1SA 3CLEH 1FGNL 3IETA 3EJZD 4K3DL 1FGVL 1T83A 3P4LA 3B2VL 1G9MH 2FSEB 4A6YA 1FO0B 4HUVB 3PGCB 2IAMA 5IB4A 3SQOL 1CYGA 2J3SA 4PJAF 5BS0A 1WCBA 2R0LL 4GSDH 3D39E 3W9DA 4UIKH 3MREA 4L9LC 1KLUA 3U9UA 1F58L 2XXCB 2CMRH 1UJTA 4D9LL 3IJHB 2WQ8A 2G2RB 4NZRL 2XN9A 2AAVA 4HDIA 1G9NH 5JOFB 2B1HH 4XMPL 3QXUA 1BJ1H 1WT5A 4LHUA 4AEHH 1NC4A 3WSQL 4KMLB 2DICA 1FN4B 2VQ1B 2OYPA 5E5MB 3AC0A 3SGKC 4F7MA 3T0WA 1CFVH 3HI1A 2ZJSH 3ARGB 1MI5A 1G0DA 2OS7A 3KPQB 1OL0A 3E3QC 3ARBC 3WN5C 1Y6MR 2Y07H 1WK0A 4N1CA 3S36X 4HMDA 5DRXB 5D1QA 2G5BA 5A16B 3RDTD 5GRJL 4XHJC 1KN2L 1PG7W 5GZOD 5IBLC 3DVGA 2DQDH 1MY7A 4HAGA 2Z91B 3VG9C 4Y2DD 4MWFB 3BPLC 4HS8H 5EG6C 3RBGA 1HI6B 5TQ2L 1B6DA 2NXYB 4OD1L 3F7QA 2FRGP 4XPHL 1I8IB 2ZOKB 4XAWH 1JWUA 3MBXH 3BYTA 4ZD3H 3B8YA 1SEQH 4JJ5B 5IJVB 4NM8L 2OZ4A 2BNQD 4X6CE 4GG6B 4CUCA 3HC4L 1SBSL 5IFJB 5F7UA 1Z5LB 4D0CB 3WHXB 4OCWL 5KVFH 2FO4A 5HDQH 3HB3D 3TH2T 3ZDZE 3MGTA 4NRYB 4JM2F 5I1DB 2GCYB 2EH7H 4BELD 4RDQG 1Q9OA 5D7LA 3QIUD 5BW7C 5HPOA 1GGIL 3KS0J 4WW2F 1J8HD 5TQ0L 3IFLL 3MLUH 1SYVA 3RWIA 4JO2L 3NOIA 3U30C 4OM0L 3PWUA 3ARQA 4R4ND 2EDLA 5F7DB 3WFHB 2W0LA 1IQDA 3IGAA 5DURD 2ZG1A 4X98B 4UTBH 1A7OH 3VGBA 3D39A 5EIVA 5ESAA 5JMOC 2HKHH 2V17L 3G08A 4YO0B 3L5HA 3NCYS 3VFNB 1I9EA 4HIEB 2OL3B 5HY9A 2WBJC 7FABH 4GKSA 1CGUA 3MRIA 4OGXH 3BZEA 4U0QB 1FIEA 1TMCB 2EICA 1LEIA 3FZUD 5IR1B 2Y7QA 3O8XD 5E4IA 4GAGH 4X7FC 2N56A 1I85C 1KJVA 5TF1L 1YUHB 1U8IA 3GMLB 4LK4A 4MXWH 3SOBH 2JJUA 3MA9L 2IANB 1DBKH 3BKCH 3FMGH 1OAXH 2HAZA 5EZLB 4M1CC 5MENE 2HFGL 2VZ1A 4WO4C 3LN4B 5F96L 3TBTA 1C1EH 1A9EA 4WEUD 1U3HA 5T1MA 1XGPB 3ALPA 1DQDH 5SX5H 4DKDC 1CZ8H 4G9FD 1TNMA 2OJEA 8FABB 4JY6A 1XGUB 3QWQB 4PJBE 3G6DL 3QRGH 4XVJL 3I02A 4X99A 3AAZA 4X6CA 1JGLH 1NC2D 1G7PA 1P9MC 1QR4A 1YY9D 3HZVA 4Y4FA 2RFXB 2UY6A 3DYPA 3I3EA 5E2VH 4Y5VA 3WLWC 3CLFL 1KULA 1CXIA 2UY7A 4L4TE 5E9DD 4S11A 5HJ3B 4V1DD 3NFNB 1TVHB 3G6JF 1WQVT 3MX0A 1U3YA 5I66A 4P46A 4LPVA 2NX5E 1N8ZA 3O6FC 3RDTB 4PJDA 1IM9B 5L8KB 3MV8E 4PJGB 1RJLA 35C8H 3M1BB 1IZKA 2XZAH 4MD4B 2JB6B 1NAML 5ILTL 3DMMD 4AQ1B 3C5SA 4P9HC 5C09B 2W07A 1JGUH 4CU8A 1RULL 1FL3A 4U31A 4M62L 2EDWA 3BVNB 5DD6B 1DQTA 2W0FA 2Q8AH 3FQUB 3BZ4B 1QBML 3V6FA 2X1WL 1S5IL 4LSPL 4W6YB 5K9JL 2EEBA 2GFBA 2ITCB 1N6VA 2VNCA 4OLVL 3BE1L 5DO2C 4OF5A 1MF2L 1LDSA 2ZUXA 3LKQB 3KYNB 3IKKA 2Z8SA 1TZHA 3VWKB 4QXUH 3LQAL 1JF1A 5I30H 3EKCA 3MUJA 1J8HB 1JHKL 4KDVA 2X9WA 2JJTA 5EN2B 5EU6E 4JRYA 3QPXH 4JQVC 3O6LH 3FN9A 3V0WH 3TBSA 4JO4H 5DQDL 3GSWB 5DURB 3TJHC 1SEBB 1BFOB 1BIHA 3C09B 3OXSA 1ZGLP 1P7QB 5FXCH 5JNYA 5H2BB 5I8KH 2P45B 4HMEA 1HHIB 4PJBA 1JZ8A 3PNWA 5ICXA 4OKVB 4ODVH 1ZLWH 5EC2B 3IRPX 2W92A 2D03L 1OGAD 2AEPH 4N5EC 1CVSC 1ZWIB 2OMNA 4M6OH 1UZ6E 1IGCL 2IMNA 3O8XB 2FSEA 1FO0A 4HUVA 4WHTB 4YJZL 2IFFL 4KUZH 4X80H 3QEHB 3T3PE 2AK4D 4BZ2H 4JZJB 2CGRL 1BVLB 3BDXA 2BOCB 3GBLA 5T3XH 3K8LA 1AH1A 5JXAH 2EDXA 3UZEA 3MV8A 2XNAB 3IJHA 1OW0C 2G2RA 3LKPB 5TJWK 4MDJB 1R5VB 2VXTH 3AFLA 3HI6H 4Z78B 1A02N 4K9EL 3F7VB 2D0HA 2QSCH 2LVCA 5GS2H 1FN4A 2VQ1A 1QLRB 5D5ME 1FNHA 4M6MH 2CRMA 3ARGA 1AP2B 1YYML 5GS0L 3KPQA 5SWSB 2AJYL 4DGVL 4NQXB 4N0RA 2IANE 5DRXA 4OD3L 3BJ91 5A16A 2FHFA 4NYLB 1U3ZA 1GZPB 4PJCF 4AL8H 3KPMB 1CFBA 5E9DB 2Z91A 4MAYD 2FEEL 5EUOF 1N7ML 5JZ7C 2P8PB 1QKZH 4MWFA 3J7HA 1HI6A 3OKEB 1JHLH 1FG9C 3JSSA 5JA8B 3O41B 4U6YB 2ZOKA 3GGWB 5GJSL 3VI4F 1MIEH 1TPXB 3IDMB 3LN9A 4JJ5A 5IJVA 4YHLH 5EBLA 4C58B 4GG6A 2FGZA 4WI7A 4JZOB 3EHBC 5IFJA 1E28B 3WNOA 1R0AL 4D0CA 3WHXA 1NCBH 2H32B 4G6FD 1A0QL 1II4E 4F80A 4NJ9H 3O0RL 4XB7A 2OTWA 4NRYA 2QHRL 2GCYA 2FECL 4TNWF 1A14H 1RUPH 3MCG1 1LO2H 4N0FB 1B9ZA 1VGEL 2KZWA 4KKBD 4PJHF 4M6NH 4Y5YC 5HHNB 1VKXB 1P4BL 3BZFB 5F7DA 1KB5H 3WFHA 3ZLQC 4U7SA 4MQ7B 4X98A 5CUSL 3HZKB 5TDNB 4NWUL 2YMXL 3RNQB 4XP5L 4XCYB 3N9GH 5T3XD 4YO0A 3ARED 2P42B 1LDPH 2FIKB 3FAXA 3VFNA 4HIEA 1GVIA 5JLZB 2OL3A 4JDZA 3U1SH 4Z5RB 3DSFL 3SN6N 4LASL 4XNQB 5CKGA 1DL7L 5ISZD 5I18H 4OV6F 4YHPB 5ICYB 5GS2D 5IR1A 3QCTH 3OKMB 3U6RB 5J11C 1OARH 4N8CL 5E03A 4OLYH 1EO7A 2NY6D 4AH2B 1YUHA 4MLSA 3GMLA 2OQJA 3CSYB 4U7KA 3SKOA 2IANA 1DBMH 3N1MC 4NKIL 1KC5L 2AI0H 1CICC 4FFYH 1V7NH 4UUJA 5DFVD 5EU7E 1OY3B 3GM8A 3FHAA 3LN4A 1KCKA 1H5BC 2Y25A 3JWNC 1CXFA 3BOVA 3KYOB 5DT1H 2J8HA 1XGPA 4HLZG 4KWUA 4PTUB 5I1KH 4Q0XL 1MIML 3MPCA 4CN1A 1IM3B 1XGUA 4X6BB 1R3HB 2HG5B 4ODBD 4X9IA 3OAYH 3AS3A 3HMXL 1ONQB 4DN4L 5CJ5A 5B8CB 4OCSH 1OAYL 2FB4L 2HMID 3PDDA 4YC2B 5FGRA 5C9KA 3NPZB 5BJTB 5KSVB 3ARVA 4EOWL 7CGTA 3A6BH 3GIZH 4U1KB 3HFMH 2ZUUA 4U6HB 3C60B 4DOHB 5HJ3A 3NFNA 3NTCH 4K7PL 1TVHA 1MCOL 4OI8A 2OK0H 1UCBL 1KEMH 1CIUA 1D9KC 1BFTA 1IM9A 4PJGA 1EMTH 1MUJB 3M1BA 3MJ7B 3F7PC 3GBNL 2BNUA 4MD4A 2R0WL 1N0LA 4POZD 5L2KB 2JB6A 4OFYD 2HKFH 4JDTL 4HFUH 1HZHH 2MCPH 5C09A 1SHMA 4HGWB 3MXVH 2EDYA 3D0VA 5DD6A 1GHFL 1TITA 1N0XH 3V0AC 3BZ4A 2KH2B 3BGFC 3EYSH 3QEGL 3OZ9H 4P4RB 2ITCA 3ZT5A 2R15A 5TDOB 5FO8B 5K9QI 1YEIL 4Q2ZB 2GIYA 4G6FB 1QFWM 3IDJB 5EIIA 4U1HB 3LKQA 3KYNA 2BK8A 1I75A 1YEGH 4XNYL 5JW4R 3VWKA 2ESVD 1BZQK 3P4NB 5HHXL 3GSXB 1X6NA 5CZXC 3H2WA 5EN2A 1FL5B 2NY5L 3VGEA 1MFAL 3TO4B 4JG0H 3GSWA 4PJIB 4K8RH 1SEBA 1BFOA 2Q87A 4EIGB 1G6RH 1P7QA 5H2BA 4RWYH 1S9WB 1MFCH 1HHIA 5IBUB 4L8SB 3LQAC 5B39B 3EFDH 4OKVA 4X7CC 4QGTA 4H8WH 5EC2A 1DVFC 1D7FA 3VWJC 5ISZB 3H7LA 2YR3A 1ZWIA 5L8JB 3TWCL 4WENB 3O8XA 2VDPL 4HIJB 3SCMD 1F2XK 2X41A 4WHTA 4IHOB 3UPAA 3QEHA 2P47B 5HI3D 5EBGA 1KG0A 4JZJA 3QUZA 1BVLA 1U2CA 2Q86B 2FD6L 3LEXA 3J8F7 2KPNA 2XNAA 4O58L 3RPIB 3GHEL 3LKPA 5F9JB 2JKXA 4MDJA 1R5VA 2F5BH 2BNRD 2X1PA 4Z78A 4OTXH 2HH0H 3F7VA 1MQKL 2C4XA 2BCKA 3AXLB 4C83A 3RZCD 2WMPA 2YN5A 4G8IB 1QLRA 4M8VA 4CJ0A 3C5ZD 4KHTH 5EU3B 2NNAB 1NCAL 2ZCHH 3OGCB 3QXTA 3I85A 4JAMB 1FNGB 5BV7C 5SWSA 5C0AD 4NQXA 5DUBB 2D4FA 1N4XH 3CXDH 3MNZB 1Z9LA 4OF7A 4NYLA 1F6FB 4RSVA 3QXVA 5A3IC 1GZPA 4FA8A 4K9EC 1VDGA 3KPMA 5KJRH 3ETBF 1AR1D 2P8PA 4FFZH 4BJLA 4ZUTB 3OKEA 2BVTA 5FOJA 4UZGA 1Q38A 5GS0C 3O41A 4U6YA 3GGWA 3VXSB 3V4VL 4S0TD 1NUDA 1SQ2N 3I9GH 1QFWH 3IDMA 4TOYH 3BT2L 1KB5B 1UM4L 1TJIH 3O9WB 4K8RD 3ARFD 4JZOA 1I1RA 1E28A 2XFXB 3KJ6H 4OLEA 2H32A 1FCCA 3QDAA 2ZUQC 2IBZY 4UILH 3PL6B 3VA6A 4DOHE 3EJJX 4F9LA 5HHVH 4N0FA 3Q5TA 3PUCA 3GUTA 5DD5L 5HHNA 4M1GH 3FL7A 1WFOA 4KAQH 2GSIA 1VKXA 3BZFA 3UPCA 5C6TH 4DK6A 3RKDC 3L95B 2O93L 2ESVB 3RVTD 5FCUL 1CK0H 3BSZL 3HZKA 3RNQA 4XCYA 2LE9A 1JV5A 2FIKA 1MHEA 3EJYC 4OF8A 5JLZA 2L0DA 4KI1A 4Z5RA 1IJ9A 5C0BD 5IKCB 5K9OB 4QF1B 4M00A 4XNQA 4URTB 3KDMB 1CT8B 3MGOB 3BRGC 5J1TC 4YHPA 3TVMD 5ICYA 4PUBL 3OKMA 3U6RA 3C87A 4ZUSB 5FYJL 1KB9J 4MYWB 4AH2A 3CSYA 2LAAA 4IJ3C 4PPTA 3SCMB 1FE8H 1NMAL 3KYOA 4Y16A 4TVSa 4HJJH 5C2BL 1I8LA 4PTUA 3ESUF 2PW2B 4PJIE 2FHBA 1OT2A 3L5JA 1C5CL 5DGRA 2A0LC 1N5YL 4U1SB 1IM3A 3WJJC 1R3HA 2HG5A 3Q5OA 3VRJB 1ONQA 3O6MH 5IGXL 4HXBL 5B8CA 2YA1A 4DKEL 3G9AB 1NFDE 2F58H 5HPMA 1CU4L 5EFIB 1T2QH 1WZKA 4ZAKA 5BJTA 5KSVA 1GAFL 2GT9B 1QA9A 2NXZC 2C1OB 3B9KC 5AEAA 4RRPG 1T21B 5DJAB 4WIQA 4U1KA 4U49A 3SDDD 3F6LA 4U6HA 1F4YL 3C60A 1T2XA 3K4DA 4WJ5A 4JHBA 5C0AB 3LQZB 5KVGL 5D2LE 5FFLA 5KS9B 5FOBB 5JDJA 4QRSB 1MUJA 3CGTA 2OR7A 3IFPB 3MJ7A 3HNVL 2HJFB 4GBXC 4BFIB 1BPVA 3JWOH 3STLB 2HFFB 5L2KA 5IOPB 3MV9D 5BXFB 1OAUH 1ZXQA 5HVHB 1FVEB 4HGWA 1NCWH 3BQUC 4F33A 2X2YA 3AU1B 1B90A 1DANU 5GGTL 5CJBA 1ZS8B 4GQ9H 4M5ZH 2AV1A 2YPLB 5K9QG 4HJ0C 3BW9B 4P4RA 3SDCC 4GRMB 4YEEA 5TDOA 1A7NH 3QG6B 5FO8A 5AWNL 4Q2ZA 2V9TA 4ENEC 1U8LA 2X4UB 3IDJA 4U1HA 4NO0D 4FQHB 3EDFA 3GMOB 4WO4D 1WTLA 5HGBA 5LBSH 3P4NA 4FQLL 3GSXA 4F7EB 4QOKD 2CDFA 1JPTH 1NGQL 2DQCH 4KC3B 1KN4L 2JJVA 1FL5A 2AXFB 1R24B 1BGXL 2Y23A 1A2YA 3TO4A 4DN3L 2R39A 4PJIA 5J12B 4XVTH 5E8PB 1DQJB 2X4QB 3RNKB 1S9WA 1A7QH 4KK5C 3QUML 4L8SA 3SE9H 5B39A 2X42A 3ZTJG 5C0BB 1F11B 1JWMB 1NFDA 5KZCD 1I9IH 1D3CA 3G6AA 4LAJH 3VFTB 3SKJL 5ISZA 1OAQH 3N0PB 3TVMB 4EI5C 2NY5C 3EYUL 1AR2A 1WCQA 4QHLB 1SYSB 1K4CB 3ZDXE 2OR9H 3RWHB 1S9VB 2W9EL 3O6FD 2R2HB 4X6CF 1E4XI 4XX1E 2P7TB 1U6AL 5BRZD 1FGNH 2EEAA 4HEME 2Q86A 2X10A 3DSNA 4MQTB 5I6XC 5KSAB 5I1HL 4K3DH 3ZDZF 3RPIA 1A1MB 5F9JA 3MRHA 4YAQB 3SQOH 3DX6B 3AXLA 2R0LH 5CP3H 4ODUB 4G8IA 3HE6B 3WNPA 1FJ1B 5EU5B 5FGBA 5EU3A 2NNAA 3OGCA 4JAMA 4Y1AD 1JF6A 4NZRH 1FNGA 4ZO6A 5DO2D 5DUBA 3MLVL 4GKZA 2CR3A 3MNZA 3WSQH 3SDDB 2VDQL 4R9HA 1PZ5B 4OBRA 4WGVB 2JCCE 3OWEA 5GJTL 4ZUTA 1J88A 2AP2A 3VXSA 3T08A 5GRJH 4BFGA 1KN2H 1KB5A 2ICWI 4GRLD 5SX5K 5IHUL 4KZEL 3O9WA 3WLBB 3K1KC 3L1OL 3B2UD 2XFXA 4P99A 2PKDA 4M3KB 5H94B 1LEGB 4M9OA 2P43B 4KRNA 4UU9B 5IEHB 4N5ED 3PL6A 2A6JB 1OT1A 3FO1A 4NM8H 2Y06H 4DW2L 4L8DB 4NZJA 4HLJA 4OZIE 4AQOA 2Y9RT 4OCWH 1YNTA 4I9WE 5KS9E 1ADQH 4PJBF 4QEGA 4M03A 3LRGA 5D72L 4G80B 1LP9B 2ESVA 3LZFL 3QWOA 3ULVE 5TE7L 1X5LA 5C0EB 1GGIH 4ZS6C 2B5IC 3PV6A 5TQ0H 3ZSSA 3IFLH 3RIAK 4PS4L 1J1XL 4JO2H 3U4EA 1QACA 4OM0H 2YPLE 5IKCA 4QF1A 2HJLB 4BH8B 3I3BA 1F3RB 2X7LB 3MGOA 1CT8A 3KDMA 2ZUTA 2IQ9L 1P7HL 1WBYB 1T2JA 2DKUA 4KXZI 1B0RB 3VXUD 1T7YA 2V17H 1F42A 1FAKT 3PQYD 1B88A 3B9VA 1TQCC 1F6LL 3ULUL 1SVZA 5KSUB 1WIPA 5D93C 5EORL 3SGJA 1E27B 3NCJL 5JZ7D 3SCMA 1UKTA 1AD0B 1QPPA 5E6IB 1VADA 4MCYB 2JCCA 1AHWB 2DQJL 2FH6A 1V7ML 2ADJB 2PW2A 4OGYL 5TF1H 5BRZB 2OSLB 3MA9H 4OGAD 2R1WB 4U1SA 1BLNB 3BUYB 1A7RL 4LSSL 1UWEL 4I2XE 1BQUA 2HFGH 3CVIL 3VRJA 1XMWA 3EHBD 2MWCA 5F96H 4FN0A 4MCZB 3BIKB 3ZSTA 1PVHA 4NJAL 5EFIA 3PDOB 2GT9A 4GRWB 2C1OA 4Y88A 1BD2B 4MB4A 1T21A 5DJAA 3ZYIA 3G6DH 5F6HI 5JQ6L 4HBCL 1ZLWK 5C0AA 3QDJE 4DTGH 4GUPB 2OJZL 1CD9B 3LQZA 2CQVA 2DDQL 3DVNA 4OZIA 5KS9A 5FOBA 1DBAL 4QRSA 3IFPA 3CLFH 4LGRB 4BFIA 3STLA 4OCXL 2HFFA 3BD4A 3DRQB 4JGJA 5IOPA 3EYOB 2DM2A 5HD8C 4QRRE 5BXFA 3MRNB 2ERJC 1FVEA 1UZ6F 2GK0A 2UVEA 3AU1A 1CDIA 1ZS8A 4XCNB 1RD6A 2YPLA 3UTTD 1L6ZA 3BW9A 3T3PF 2R1XB 4GRMA 1NAMH 3IU4L 5ILTH 1B3JA 3QG6A 1ZHBB 2X4UA 1M6OB 4OFIA 2DJUA 4M62H 3QJHB 2ICEB 1CICD 1QBMH 4FQHA 3GMOA 3LKRB 3WJLA 4LSPH 1AGBB 5K9JH 3HE7C 2VC2L 4F7EA 3FKUS 3R0NA 3M8OL 1FDLH 3P11L 3BISA 3PP3H 3BE1H 5D5MF 1ES0B 2AXFA 4LKXB 5H37G 1R24A 4XPGL 5C3TA 1I7RB 1UQSB 4MNGE 5E8PA 3MLRL 1DQJA 1K8DA 2X4QA 1GCFA 3U0TB 3RNKA 3ZE1E 1JHKH 3U46B 4LEXL 3U48A 4CW1B 5C0BA 2E6JA 3VXRE 3WO3B 1F11A 1JWMA 3BPNB 5DQDH 3VFTA 4MXVE 1OHQA 2EKJA 4CRPA 3TVMA 2FHCA 1D6VL 4LMQE 2DM3A 1O7VA 1BVZA 4QHLA 1SYSA 1K4CA 4XHQA 1S9VA 3MLZL 3PQYB 3VU2A 2R2HA 5T3ZE 4P3CH 1LGVA 1A3LL 2P7TA 4XRCB 1JUFB 2D03H 1T0MB 5KSAA 5C0RL 1IGCH 1A1MA 3QB7C 3AB0C 4JFDE 3S34H 3CVHB 4UB0L 4YAQA 1BFVH 1D5IH 3HRZB 1MRFL 4OZGE 5I71C 2CGRH 3P40A 4ODUA 3WXVL 3HE6A 1XGTB 2YHGA 1FJ1A 5EU5A 3P77B 3PXJA 3QIBD 1G84A 1TTUA 4LARL 3V95A 4K9EH 1MJJB 2VWEC 4M4PA 2AXGB 4F57L 1U93B 2HA1A 4LCWD 3SDDA 2PXYC 3MV01 1PZ5A 1FHGA 2LTQC 1OCWL 1YYMH 5GS0H 1B4JL 3S5LB 3MRMA 4DGVH 4RMVA 5FV2A 2E6PA 1E0OB 1OSPL 4BA8A 4OD3H 4OF6A 2VL5B 5E2UL 4PYGA 4FQ1L 4MAUL 3T0EB 1A6VL 4P49A 4MNGA 2XTJE 3FRUB 3WLBA 2I9TB 1N7MH 1BQLH 5JMRA 1QSEB 4N8VB 1CTOA 5FYLL 4GRWE 1S78C 3VXOB 1BD2E 3SJVE 3ME0A 5H94A 1LEGA 3OAYK 4R97B 1DVFD 1ORSB 5IEHA 4UU9A 5GJSH 3VWJD 5C0NC 5BO1L 4WTZA 3VXRA 2A6JA 4WU7A 3ARDB 4UNUA 4TYUA 4O4YH 4XC3L 4L8DA 5B38B 5I8EB 1R0AH 1N5AB 1BEYL 1A0QH 4R6UA 3O0RH 2OBGA 4G80A 1LP9A 2FR4B 1YEHL 1OQOA 3QUKA 3GSNB 4PP1D 1TQBC 5C0EA 5B3NA 2APFA 3D2UB 4Z7UE 5B21A 2F54D 1AIFB 1P4BH 3T1WA 4PRBB 2HJLA 4BH8A 1AE6L 2X7LA 1INDL 4O02L 5CUSH 1WBYA 4F58L 3DX9A 2YMXH 2P44B 4XP5H 4M48L 1B0RA 2DQHL 2UWEE 5GRUL 2QSVA 4YH6A 5ALBL 5HGDB 4M61B 3DSFH 3FO9B 1JPGB 5A3ID 4LASH 5IW6B 2JJWA 1DL7H 4RAUB 4HS3B 3JWDL 3IJYB 5GGQL 4WI2A 1AD0A 4JHWL 1YECL 4WI8A 5E6IA 5J89A 4MCYA 3ARTA 4N8CH 2ADJA 5GS0D 1I8KB 2HTKC 1MAJA 5BRZA 5EC1B 5K33A 2R1WA 4U0RC 3BUYA 4NKIH 4ZOEA 4OLWH 4PB9L 4G7YL 3ULUC 4MCZA 4HF5L 4TRPL 4PIRF 1KJ3L 3MV7E 1GGCH 1JPFB 4CGTA 3PDOA 4MNQE 4Q0XH 5DJ8B 5A2LH 1BD2A 2CH8A 4OZFH 2GSGA 4MZ2A 5H8DA 3W11C 3KXFD 4GLRH 4MSWB 4DN4H 2QQKL 1OTSC 4GUPA 2FB4H 3MLXL 3X3GL 4EDWL 4NQUA 3RKDD 4YDIL 3NCEB 1KXQE 3QUXC 4UAOB 2N7AA 3MFGB 2PTTB 1WZLA 3DRQA 5CEXB 3EYOA 4K7PH 2MQ0A 1MCOH 3KVQA 3MRNA 1JGVL 2XZCH 1LWRA 4LAQH 4Z7UA 4O2CA 1FORL 4AEFA 4XCNA 3GBNH 3NN8B 3MLSL 2NW3A 2R0WH 4HW6A 4NCC1 5IWLA 5BOZG 4PY7B 4JDTH 3P30H 3QYCA 1M6OA 1DEEB 3TT1L 2N7BA 3QJHA 1GHFH 3NGBB 2I27N 2ICEA 4OQTA 2DQIL 1T7VA 3UYOD 3LKRA 1O7SA 1AGBA 3GFUA 2YD8A 2OMBA 4G8EB 3B3IB 1UENA 2XG5A 1ES0A 3ZHKA 4LKXA 2I5YL 3ARXA 1I7RA 4GT7A 1UQSA 5KG9A 1UXSA 2HTLC 4GW1B 1QSEE 5DRNB 1M71A 5C0CD 1J05B 4H25B 3U0TA 3TJEL 5HHXH 3U46A 4ERSL 4G6AD 2F54B 4CW1A 2NY5H 4KDTA 2V7NB 2NXZD 3NH7L 3Q3GB 4NCDA 1J0IA 3VFRB 2H9GB 1OLZA 1NGPL 4LSVL 5IHBA 3INUL 2NCMA 4OZHE 1ZLSL 3UXFA 1ACYH 2EH8L 3GSQB 4F7TB 1MWAL 4XT1C 4B5EA 3WFDH 1ZHLA 1MAKA 2XWJB 3MYJB 1JUFA 2ATPB 1FBIH 1AY1L 1IT9L 3TNNB 1MCPL 1XT5A 3UTOA 4U1GB 4GBXD 3HNSL 3FB7B 1T0MA 4MA8L 3DRTB 1JL8A 4KRPD 1HHKB 2HT2C 2ICWJ 3TA3C 2E3VA 3VMOA 2NLJB 1T80A 3WNNA 3CVHA 4MVBC 5BVPL 4U6XB 5GISH 3HC0A 2UZXB 2VXUL 3HRZA 4P5MB 3HR6A 2CKBL 5JIPA 4HJ0D 2AQ1A 1XGTA 2FD6H 4Q9RL 3KS0H 4FFVC 3VG0L 4M3JA 3P77A 4O58H 3GHEH 1CBVL 1P5UA 4J3TA 1CFSB 3ABZA 4WV1C 4YLQT 4HT1L 5F97E 2GHWB 4NQEE 1ZKAA 1RMFH 1MJJA 3QQ9C 1MQKH 3N1GC 4CDHA 3BP4A 4HC1L 3UYRH 2VXSL 4WCYL 1U93A 3VGGA 1B6UA 1NCAH 4NQDD 4FQQB 3S5LA 2Z93B 3RVWC 5TDPB 2VL5A 4Q6IA 1ADQA 1B0GB 3T0EA 3CAFA 2UYLB 5I1EL 4P5KB 4WVRA 3X12B 3TESA 3FRUA 3UX9B 1P84K 4KK5D 2COQA 4Y4KD 1QSEA 4N8VA 1EPFA 4UQ2B 3VXOA 1EBAA 2Z31B 1ORSA 1MLCB 3WO4B 4Z8FL 3V4VH 4EI5D 3RWGB 3X17A 5F7NC 3BT2H 3W82A 1IGIL 3IF1B 1UM4H 4PJIF 5DJZB 3ARDA 2L4OA 5B38A 1A1OB 5I8EA 2MPAH 3LAFA 4OZHA 5T33L 1N5AA 4LPUA 2CUMA 5CBAB 4KKNA 3PWLB 2KDGA 2ORBL 1JGDB 1NFDF 1A5FL 4ORZC 3RAJH 1NL0L 3GSNA 2F53D 3D2UA 5IVOA 4L1HA 3CH8A 4X4XB 1BAFH 5DD5H 3TPUA 3OSKA 5IFHL 1AIFA 1EJ6A 4PRBA 4DUWA 5C0CB 3DV4B 4NRXB 5IMMB 1D5XB 3F7YB 5F6HJ 4KPHL 1P1ZB 1I1FB 5CLWA 2XRAL 1Z0NA 2ED7A 2R9HC 5HGDA 2ID5A 4M61A 3HLAB 3FO9A 1JPGA 4CNIA 1VERA 5FYKU 4NQEA 3HPJB 5IW6A 4RAUA 4MA1C 2ZCLL 4HS3A 4QCIB 1QLEL 1E4KA 3IJYA 4LPWA 3LQMA 5GPRA 4ZUVB 4TUJB 1I8KA 1RUQL 2HT4C 1DP0A 4ZOBA 3TPKA 4KFZC 5DJYB 4FQIL 4HH8A 3BDYH 4R3SB 2E7CA 2Q3ZA 4KRPB 5KANI 1NMAH 25C8H 2CO6B 3JWDC 4ONHA 1G7JB 1JPFA 3DTXB 4EN3B 1C5CH 1ZLUH 5DJ8A 4TVPH 1LO5B 5TE4L 1K85A 1UXWB 3HAEB 1VEPA 2YD4A 2V6HA 3H9SE 4MSWA 1BP3B 5IGXH 4HXBH 4DKEH 2NMSA 1CU4H 3CJJA 3S3SA 2FATH 3JV5A 4A6YL 4JPKL 1W0VB 4FG6D 2R29L 1JP5A 2PTTA 1F4YH 3GI8H 4NO3B 5CEXA 4RA0C 4K3JH 1RZIB 5KVGH 4JB9L 5HYFA 3ZDXF 3RY6A 4DAGL 1MHHB 5J4MA 4Y4KB 4U05A 4J3VA 5GS1C 4PY7A 3SGEH 4XPFL 4X7DC 3PGDB 1DEEA 2FIRT 4Z7NE 1R5IB 4RMWA 4MA3B 3L5XL 2GUOB 3QDHA 4IIQC 1XF1A 5I75C 1RZFL 1XGYL 4G8EA 1PKQB 3B3IA 3PHOB 3CFKB 3F5WA 3EO9L 4X5XB 4P2CG 3QFJD 4R90L 4GW1A 1Y0LB 3NIDE 5CD3A 5DRNA 3WV0A 4FOMA 4X6DE 1J05A 4H25A 4G9FE 3MYZA 3BP5B 3DETD 1ITBB 4JFQB 2NY0B 3P73B 2V7NA 2JCCF 2OZ4L 5D8JL 3RY5A 4WUUE 3GJFB 3Q3GA 3KPOB 4DN3H 3VFRA 3QIWC 2H9GA 5K9KB 5T5FL 4NIKB 4OUUB 3BKMH 3AMKA 1LK3L 4TVPD 5DZNA 4CMMB 4IEFB 4ONFL 5MEPA 3H9SA 3GSQA 4F7TA 1J86A 2HFEB 2XWJA 3MYJA 4IRJC 3SKJH 3TNNA 3T0AA 32C2A 3EYUH 3FB7A 1XFPA 3DRTA 1D5BB 4HV8B 4KQ3L 2XKUA 1HHKA 1MCFA 2W9EH 4YDLB 3SDAC 3K8MA 5IK3A 4U6XA 4FQXB 1T89A 1U6AH 4P5MA 4TTGA 4OZIF 3TZVC 5KS9F 4LSRL 5I1HH 2YUVA 4IOFD 5CD5D 1KPVB 1CFSA 3WEXB 3RL2B 3ULVF 3MRJA 3TN0D 1NCDL 3SE4A 1FP5A 4TNVF 5C0DB 3HCVB 2BRRL 4JLRB 4XNZB 5B3JE 2AQ3A 4FQQA 3GBML 4ZXBB 3MLVH 2I26N 2WINB 5C1MB 2M2DA 3LOWA 5TDPA 2EXYC 4G6JL 5C86A 1B0GA 4TSCL 5ESVB 2G75B 1F2QA 2VDQH 2UYLA 4PLJC 4BQBA 4P5KA 3X12A 4YDJB 2Q76B 5C08D 4X9GA 4MNHA 5GJTH 4ZUUB 2XZQL 4X6DA 3LHPL 4UQ2A 4WW1B 1A7PL 5IF0B 4NM4H 4WNQA 2Z31A 4R0LB 4RISL 2EIZB 3MLTA 3NCFB 3MFFA 4MQSB 1FVDB 5T5NF 4ODHL 4MZ3A 1JNHB 4PGZA 4WUUA 5ADPL 1IC4L 3HHRB 1KELL 4HAFA 3IF1A 5DJZA 4KZEH 3VW3L 5I1GL 4XAKE 3L1OH 1A1OA 1IAIH 4MX7B 3MNWB 1OGAE 3WDJA 3KPRD 4L3EE 4QT5B 1YNKL 3HA0A 5CBAA 4WFFE 3PWLA 1JGDA 3SEPA 3I6KB 5D7JB 5FKAA 1JN6B 4EI6B 5LGKA 3OAZH 2VABB 4DW2H 3V6OA 2CPCA 5HDOA 4X4XA 4HXAL 3CMGA 4P2OA 3D3VB 4AEIH 4UBDC 5SWQB 5D72H 1F6AB 3EYQD 4XBEL 3DV4A 3GMQB 3LZFH 4NRXA 5IMMA 4NWTL 2P5WB 2V5YA 5TE7H 3W5NA 1NGWB 3OB8A 4HWUA 1D5XA 1H3WM 3F7YA 3VGAC 5HI5C 1IRAY 1B4RA 2VZTA 4PS4H 1J1XH 4Q97A 1AXIB 2Y6SC 4M1DL 4UQ3B 3DJ9A 3HLAA 1GOGA 4P4KD 2BZDA 5DUML 3VFWB 5KSBE 1AGEB 2PXYD 3HPJA 4LMQI 1ZLVH 2IQ9H 4QCIA 1M7XA 2OTPA 1PKQE 2IADB 5D71L 4UNTA 3U4BH 4DUXA 3BEWB 4XX1G 3LS4L 4ZUVA 5BMFL 4EDXB 1A6AB 1JWSA 3U4AA 1AGDB 4PJ5D 4I18B 4RGNC 1VA9A 3EUUA 4PRNB 5KANG 1TZGL 3PP3K 4R3SA 5EORH 2DLGA 3NCJH 1TJGH 1X4ZA 3QUYB 1AJ7L 3VFPB 1CG9B 4H1LH 2E27L 1ZAGA 1S78D 1L0XA 5CZVL 2DQJH 4CVWA 5ICZB 1V7MH 1G7JA 3DTXA 4EN3A 4OGYH 4KVNL 3AMLA 5DDHB 1LO5A 5EU4B 43CAB 1A7RH 1UXWA 3HAEA 1KCVL 4LSSH 3CPLB 5INDB 5FUOL 3CVIH 4LLMB 4XXCC 3MCLH 4F8QA 4ZO9A 4NJAH 5LXGL 3TN0B 1JK8B 4U1LB 2IBBA 4ZSOB 2NZIA 3BHBB 4L3EA 5I1CL 1FO0L 4C55A 1QBLL 1W0VA 1LO0H 5JQ6H 4DEPC 1FH5L 4NO3A 1CDCA 4HBCH 4MXVF 4KY1L 5D96C 2OJZH 1RZIA 3IDYC 4IDLA 2DDQH 5F1NB 1DBAH 4F9PA 5DVLA 1NGYB 4P48A 1MHHA 3B9EA 4OCXH 1IGJB 3VD4A 4YK4B 2IAMC 2YWZA 3PGDA 2P8LB 3GKWH 3ORJA 1KXTB 1R5IA 1N6QL 4APQD 4K55A 2APXA 3L6FB 1CQYA 2A9NL 4MA3A 4I13B 3QI9D 5DS8B 2GUOA 3IU4H 4OZGF 1HN1A 1PKQA 2FBJH 3PHOA 3CFKA 4EUPA 1S7UA 1WT5C 4M5YL 4X5XA 3CDFA 1YMHB 1Z0MA 1ZGLB 5CEZH 5GGVY 1NANH 1Y0LA 4PG2A 1X4YA 2QL1A 2VC2H 4OFVA 2A77H 3BP5A 4TUOB 5IM7B 4NN7C 2EYRB 3AM8A 4JFQA 3P73A 3DURB 5D1QC 4B41A 4LDEB 4I77H 4XPGH 3GJFA 1MFEH 3C2AL 2EO9A 3KPOA 3BX7C 5K9KA 1JFQH 3LRSB 4OUUA 5DA4A 3WCYA 3ZKNC 4K23L 6FABL 4WUKL 2J88L 4CMMA 4NUJB 4WTWA 4LEXH 4LCYB 5DJXB 4JM2D 1GZQB 4P0DA 4WI4A 3V79C 2ZSWB 1MJ7H 4P4KB 4NN5B 2A2QT 3KYAA 2HFEA 5DMIH 4YNYB 5T5NG 3PJSB 4YWGL 3FCTB 4GRWF 1D6VH 3ZKQD 1D5BA 4GFTB 4KGLA 1PX3A 4YE4H 1IAMA 5DVMA 4DKAA 3D3VE 2ADIB 3MLZH 1WBZB 1K8IA 4CVXB 3R4DA 1A3LH 4FQXA 1CGTA 2P5WE 4HEPG 1Q8MA 1RUKL 5DK2A 2AJXL 2XKNB 4IDJH 2OL3L 1KIQB 2DIJA 2OI9C 1KPVA 5I1JL 4M93C 5DMKB 3WEXA 1ORQB 4UB0H 3RL2A 4JM4L 4HLZH 1EO8L 2XG4A 1E4WL 3MUGA 3QHZH 4Z7UF 3WXVH 2L7JA 5C0DA 3WN5B 4NQCE 3UDWA 2EYTB 3HCVA 4JLRA 3U83A 4R2GB 1MEXL 4ZXBA 5F3BB 2WINA 5GGRB 3SE3A 3H7BB 3FOLB 1QTYT 4F57H 2UWEF 3MOAL 1UACL 5ESVA 3VG9B 5F44A 1PYWB 2G75A 1OD7A 1JPST 4YDJA 2NY4C 5CEZD 2Q76A 1B4JH 4ZUUA 4LLVB 5I9QB 5AAMA 4WW1A 3BJLA 2I24N 3MBEB 4RGMC 5IF0A 1OSPH 1MPAL 4H0IA 4R0LA 5E2UH 5IP4A 4FQ1H 2EIZA 4MAUH 1FVDA 4FZ8L 5C9JA 1JNHA 5C7XL 3VGHA 4L4JA 2YA0A 4I5BB 3ZYJA 4YQXL 4PJ9B 1A6VH 3CUPB 5EO0A 3T65A 4JN2A 2BXYA 4MX7A 1U3HC 1HILB 5FYLH 3MNWA 4ZSOE 2CUHA 4JQXA 4QT5A 4YHML 1YEJL 1BWMA 4NHUB 4APQB 5BO1H 3QI9B 1A9BB 3I6KA 5D7JA 1IBGH 2AK1L 4KJYB 1JN6A 2HT2D 4EI6A 2DMBA 3S7GA 4QRTB 1JMZA 2VABA 4YPGA 3IXAB 4XC3H 3TA3D 3WBDA 2XPGB 3KGRA 4ZO8A 3BESR 2YZ8A 4Y4FC 4HWEH 3D3VA 4FFWC 4BUGA 5SWQA 1F6AA 1RU9L 3BEVA 1E6JL 4Y5VC 4HUMB 3OR6B 3GMQA 4JO1L 5FYJU 5JXEA 5CEYA 2P5WA 3MROB 1NGWA 2VOTA 4WTZG 3FFCE 5L7XL 1IC7L 2WBJB 5JIKA 2WSKA 1J0ZA 3Q0HA 2X4SA 2GJ6B 4GS7B 3VH8B 3P0YL 1WBXA 4UQ3A 3VFWA 3WD5L 2JB5L 1FZMB 4M7KL 4UOW0 1AGEA 4LGSB 1INDH 3DYOA 3MLYL 2IADA 1INQA 4M48H 3BEWA 2DQHH 2GJJA 4JM2B 5GRUH 4NQCA 3RVWD 3CLEL 5ALBH 1I3UA 4K3GA 1H3TA 4EDXA 3P4MB 1A6AA 1WZMA 4FTVD 2D7PA 4I18A 4PRNA 4K3HA 2F9BT 3JWDH 1BF8A 3QUYA 1MSPA 2XQBL 4PJXE 3VFPA 3MLPA 1CG9A 4JHWH 5ICZA 1I3RA 5F71A 3ARSA 3M45A 1GIGH 1EA9C 1F02I 1UYWL 4E9LA 5DDHA 5EU4A 1H3VA 1DQQA 3LIZH 3CPLA 4XWGH 3U82B 1GGYA 3KPSD 4G7YH 3B83A 2B1HL 4HF5H 3LV3B 3N06B 1XIWC 2JJTC 1KJ3H 5E95B 1T6VN 2YD5A 4AEHL 1JZ7A 1JK8A 4U1LA 5FYLD 4LVOC 4ZSOA 5HYJD 4I3SH 3MLWL 2ZJSL 4LLUB 5D2NC 1TJHL 1F5WA 2Y07L 1HHGB 1I1YB 3GB7B 2QQKH 4ZPVB 2QADB 4XI5D 4O5LH 4AY0A 3O3AA 5F1NA 4EDWH 4OZHF 3VE0B 2J8UE 3PWNB 5D1ZC 1NGYA 4X6EB 1NFIB 1IGJA 3QBTB 3HZMB 2R9HD 1JGVH 2NYYD 3ARYA 1QYGH 2P8LA 3FFCA 3PXHA 3G5XB 4F7PB 2PO6D 3CIQA 1DJSA 3L6FA 2C7UA 5F7EL 3MLSH 3R8QA 4JE4B 3S3JA 3B5GA 5DS8A 1UC6A 1HOCA 4KJQD 5LAXB 5KVFL 3QFDB 5ESQA 3TT1H 3CMOL 1YYLL 1PZUB 1U2HA 1YMHA 3UJTH 1ZGLA 1FC2D 1QLFB 2DQIH 3G6JB 1CI5A 4LRNH 5I74B 5IM7A 3P9MA 2EYRA 2DBJA 3DXAD 5I76B 4RMUA 3TT3L 4GW5B 2J12B 2I5YH 4WI6A 4LIQH 1BREA 1WAAE 4UTBL 1IGYA 5DJ0B 3B6SB 3LRSA 2HKHL 4X8XA 4Y4HB 4NUJA 2W0PA 4KJPD 4ERSH 4LCYA 4G5ZL 2NXYC 1GZQA 4ISVA 4OGXL 4WFHE 5ACLA 2ZSWA 4PTTB 4P4KA 1PSKL 5AZEH 4HKXB 3NH7H 2D9QB 4YNYA 5F1IB 2I07B 3PJSA 3FCTA 3RIFF 4GAGL 3INUH 1ZLSH 4U1JB 2ADIA 3RUGE 1WBZA 2EH8H 1MWAH 3DUUB 5KAQF 1NCCH 1OAXL 1IE5A 1AY1H 1IT9H 1MCPH 3E8UL 4POYA 2XKNA 2D31B 4MA8H 1KIQA 1S8DB 2H8PB 2J8UA 5CGTA 4P5TB 2GJ6E 4OB5H 2R0KL 2MSPA 4QY8B 5DMKA 2AGJL 1EHLL 1ORQA 5BVPH 3GRWA 3V0VB 3SGKA 2VXUH 3HMWH 4NKMB 5HYIA 1G0XA 3PWJB 5T1LD 1BFSA 4Q9RH 3VG0H 1UH2A 1OAKL 3WN5A 1L0QA 1JGLL 2EYTA 4L3CB 1CBVH 2VJXA 1GPOL 5KOMC 1Y18A 4JKLA 3SQBA 2J4WH 3N1FC 3H7BA 3FOLA 1HE7A 4X7SH 5J1SC 5BCAA 5HYJB 5T1KD 2GJZA 2VXSH 4WCYH 4UINH 1PYWA 4ZO7A 4OIIL 3PHQB 2PR4L 4EIZC 5J7CC 1GC1H 4LLVA 3MBEA 2P24A 5SWZB 3EJZC 3K74B 3VD5A 4I5BA 4PJ9A 5I1EH 4YHOL 1WAAA 3CUPA 3DNKA 3UJIL 1ZLUK 4HKZB 3GSRB 2EZ0D 1HILA 4KKLC 2Q8AL 2P5ED 2PO6B 4NHUA 4LFHG 4H26B 4APQA 2WWKT 2G60L 3QI9A 3SO5A 1A9BA 4KJYA 1IGIH 1CDHA 3U0WL 4Q74A 1XF5B 1X7QB 4QRTA 4XVUD 3IXAA 4FNLL 2XPGA 4WFEE 4PJCB 5T33H 2BDNH 2XWTB 5EUOB 1NUNB 1T04B 3HRPA 3LKOB 2IEPA 2ORBH 4WU5B 3OR6A 5D7SL 4I0PD 3OKOB 1MOEA 5K59E 3MROA 5C92A 2WBJA 5IUSA 3O6LL 3QEQD 4ODSL 3V0WL 4Z95L 2GJ6A 3VH8A 1C7SA 3RDTC 5B38G 1I1AB 1FZMA 3R1GH 1YMMD 2FX9H 2WNGA 4P59L 3QWRA 5I8KL 1JNNL 4Y2DC 4E5XB 2YXFA 5J11B 3MRQB 3RVUC 2VLRB 4JRXB 4KPHH 2XRAH 4Z0BL 2RGSA 2EXYD 3DLQR 5KBNC 2XXMB 3P4MA 3ZTJH 4M6OL 2NPLX 2Z8VC 4PLJD 2DYPB 4ODXB 3P2TA 3IS0X 1QLEH 2HVKB 1Y6NR 1KYOJ 4Z7NF 2HLAB 3PP4L 3FN3A 2IMMA 4FQIH 3VWKC 5IG7B 2VXTL 3HI6L 5E4EB 1YEFL 2DMCA 3QXDB 4K7PX 5HDBF 1GRWA 3NIDF 4R4NC 4X6DF 3P9WB 4DKFH 3KLAB 3LVEA 4M6ML 1BECA 4LLUA 3C09C 4HJGB 4LDLB 1HXYB 3ARZA 5CINL 1AXTH 2ARJQ 4D2NA 1BHGA 1I1YA 3H6JA 3GB7A 5D6CB 1KNOA 1RK1B 1D9KB 3WKMH 4KI5C 3KG5A 1G9NC 4W4NA 2VIRB 4UBDD 5CGMA 2E7LA 4QHKJ 1RK0B 4F37K 3VE0A 4JPKH 3PWNA 4A6YH 3QNZB 4OZ4B 1INEL 1X5XA 2R29H 4X6EA 1A6TB 3O8XC 3U0PB 5IMLB 1LQSR 1KLGB 1RFDL 3HZMA 2VLKD 2WWMD 2E8ZA 3TYGH 5CBEB 3G5XA 2PYEB 5ADOL 1KENL 5KAQG 2DB8A 3MSPA 2Y72A 3FQWB 1KGCD 1O5DT 1RY7B 4WFGD 1EXUB 5LAXA 3OX8B 2BY1A 4NJ9L 2P5EB 2W1NA 1PW3A 1A14L 4RGND 4Z7VB 1LO2L 1QLFA 3QDMB 4UDTB 4NGHL 3G6JA 1AO7D 4LPXA 3L5XH 2DWEB 4ZFZB 3KLSA 8CGTA 1XGYH 1YY9C 2M8XA 1S7RB 1QO3B 4CJ1A 3MJ8B 5I76A 5DEGB 5SWZE 4GW5A 4AIOA 1KB5L 3DIFB