3VFJA

The structure of monodechloro-teicoplanin in complex with its ligand, using mbp as a ligand carrier
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
375
structure length
374
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAAAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between teicoplanin and a bacterial cell-wall peptide: use of a carrier-protein approach.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein/antibiotic
molecule keywords Maltose-binding periplasmic protein, C-terminal fused by Cys
total genus 127
structure length 374
sequence length 375
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vfjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vfjA01
3DP6A 1NH7A 2DS9A 1JNFA 2DWAA 4GWOA 2HZKA 5CRYA 4ELOA 5I59A 1N0TA 4KYSA 2GHBA 3FJMA 3CI8A 3CG1A 3QSLA 4YZZA 2F5XA 1II5A 5TPAB 3I5OA 1FCKA 4U21A 4JB7A 3UA8A 3LSFB 3IORA 1B2HA 1RKMA 3D4CA 4FIMA 2ALUA 4YKPA 5IKBA 1FQEA 3HSTA 3UN6A 3C4MA 1I6BA 1IXHA 1MQHA 1PDAA 3IO6A 3IO4A 4RNSA 5EHMA 5ITPA 5HBCA 5H8NB 1IIWA 2XXHA 3R26A 4C0RA 1Z7ME 3RQTA 3R6UA 4AB5A 4LQ5A 4G4PA 5I2KB 3E13X 1Y1MA 5H8SA 3V83A 2ZYMA 2THIA 3IK6B 3MP1A 1FTLA 4ONYA 1TFDA 4F3SA 1MS7A 3KN3A 1USYE 3MUQA 3O9PA 2W7YA 4IO5A 4NF4A 1XT8A 1XHYA 4DCYA 4O3BA 3RN8A 1ANFA 2AL4A 3BBRA 3FXUA 4RK2A 4H67A 4TOZA 3IB2A 4U4XA 4H5GA 5DTBA 2AL5A 4OFJA 4ECFA 1SDXA 2H9BA 2VOZA 3DP4A 4Z0IA 4R9FA 2DWJA 1URDA 2FNCA 2RKMA 3ILUB 3JV9A 3OD7A 4P11A 5H8QA 2RC7A 4F2QA 2Q2AA 4RPOA 4F2OA 3TCGA 5CMKA 1XC1A 2DQVA 2HAVA 3O66A 4FECA 1R1NA 2O6AA 2VGQA 2B65A 3N6TA 4FEBA 2I0CA 1SI1A 1Y3NA 5AA1A 3RNNA 3V8XB 1B5HA 1I6QA 3ECRA 1NNTA 3ZSFA 2DXYA 1N04A 2Z23A 4H6DA 4DDDA 3BKIB 1MM7A 4QFLA 2F78A 1POTA 2I4CA 1IZ1A 1MXVA 3VV5A 2Y7WA 4BDMA 1BLFA 1FQDA 1RYXA 1SVXB 1ZLQA 3EHSA 3FZVA 3IL1B 4LUBA 5DVIA 5FTIA 4MFIA 2NVUB 3TTKA 5CC2A 1LCFA 4I62A 4JXIA 2XHDA 1R9LA 3TDJA 5H8FA 4RA1A 3HPIA 4E0XA 4NF5B 4R75A 2O84X 3KFMA 4U1ZA 2Q8JA 3B6WA 3IJXB 3QUJA 4YMAA 3C33A 5F1QA 5I56A 3FV2A 5BUUA 4X1BA 3ZS6A 1MPDA 1A99A 1MY0A 3LR1A 2NOOA 4N6PA 2FA7A 4KQPA 3FASA 3OELA 3TCFA 1PEBA 4JWOA 4JWXA 1NNFA 2PT2A 2QS4A 3IB0A 3M3FA 4WKMA 2F34A 1SQYA 2PBWA 1LAGE 3K0VA 3K6WA 3UK4A 4KD5A 3IX1A 4IGRA 4EXKA 3I3VA 3C36A 3GLBA 4JBZA 4YMBA 1N76A 3PV0E 2QS2A 5ISUA 3UORA 3K6UA 1VE4A 1Y9UA 3TEPA 3D4GA 4YAHX 3QXMA 4H65A 5AA2B 1UTHA 2REJA 3HV1A 5CMCA 4ZEKA 3T96B 2REGA 1FTJA 3OEMA 4IO4A 2R71A 3FVKA 3M3LA 5AA4A 4PE5B 1M5FA 4EDPA 4X48A 5CMMA 1ZBMA 2P2AA 1DPEA 2XXXA 3G3FA 2UVHA 3K1NA 3L6GA 2V25A 4FORA 2NUVA 1Y20A 1P1WA 3Q25A 2A5SA 2GH9A 2Q89A 3KEIA 1GV8A 1N7XA 4F39A 4ZZEA 2ZXTA 3O29A 1D3KA 4R6YA 1FTKA 3H6UA 5I57B 2ONSA 4PFUA 3MZ9A 4ELQA 1IITA 3FIRA 5KCJA 1TT1A 1YCJA 5H8FB 2ESNA 2V93A 4F1YA 2VD3A 3PUWE 2AYSA 5JTYA 1IXIA 1URSA 2Y7KA 3H6TA 3W9VA 2I58A 3HHFA 2I48A 4MLQA 1M5CA 3G3HA 3SETA 1UIUA 1UTBB 1LFHA 3G3JA 2XXIA 4DZ1A 5ITOA 1SW2A 2Y7RA 2OLBA 4OQOA 2V3UA 2V3QA 1FQCA 1QUKA 5CM6A 1Y4TA 3C31A 4PQJA 3Q27A 1B9JA 2Z22A 1R6ZA 4EF1A 1B5IA 4U1OA 3RTWB 1QUIA 3M8UA 2UYEA 3KG2A 3F11A 3O28A 1VFEA 1B40A 2F97A 2DE2A 2H99A 3BFTA 4G8NA 4I9DA 3FJ7A 5HM4B 1AOVA 3G3IA 2DYXA 2DVCA 4XIGQ 1YTVA 2R6GE 4ELRA 2UYFA 1MQJA 2F6PA 1GTKA 3M3KA 4H0WA 2V84A 4X9TA 5AA3A 4DXUA 3MW0A 3VVEA 3MWBA 3PD8A 3VLVA 3ILTB 3UP9A 4WEDA 1FQBA 3GBBA 3IB1A 4TLLB 3SDFA 4MBPA 1D9VA 3QAXA 2DP8A 1B0LA 5AA2D 4HW8A 3PMVA 1B7ZA 2ZYNA 2Q88A 3LSLA 3C32A 4PFWA 4RXLA 3U94A 4EQ7A 1PB9A 3O6HA 1LAFE 4F3PA 3KOSA 1R9QA 4NF6B 1GR2A 1B6HA 1DMBA 1SYIA 3MPLA 1A55A 1B0HA 1N3XA 2DSFA 1L5TA 3R7XA 3GBAA 3TQLA 1H45A 3T9XB 4R73A 1OQGA 1JW4A 1CB6A 2HXWA 5TPAA 3TPAA 4ESWA 1B32A 5I56B 3MJNA 4QSDA 3QUFA 4OTEA 3P7IA 2HEUA 1MXUA 4QFNA 3MAMA 1Y3PA 1QKBA 5LOMA 5B7DA 3FD3A 1Z7NE 3A3UA 1MDQA 2P0SA 5FHOA 5AA2A 2Z8EA 1ATGA 3KJ7A 3PU5A 4BDRA 2GFEA 1MY2A 4OERA 3LSWA 4NF8A 3KJTA 4ISUA 2UVGA 2XXRA 3FV1A 1B3HA 4EUOA 2CZLA 4LATA 4R2BA 4KR5A 1NL5A 5DVFA 5EYFA 3RY3A 3TQWA 3TTRA 3IAZA 3FXRA 3KOTA 2V3TA 1MQGA 4YKJA 1MXWA 1N7WA 3PPPA 4GXSB 2Q2CA 3C35A 2GRVA 2M8CA 2H98A 1T0KA 4XTCQ 2IEEA 3VDFA 2XXWA 3CG3A 4MF3A 4QFOA 4EXLA 1LCTA 4OHNA 2PMSA 4K3FA 1AH5A 1D9YA 1B05A 2ONRA 3G3GA 1JW5A 1M5BA 3MVYA 4OESA 4R6HA 1LAXA 4EQ9A 4JDFA 3RGYA 3FVNA 3MQ9A 1US5A 4O3CA 2UXAA 2I4BA 5DEXB 2ANJA 2HCAA 2OK2A 3FJGA 1SW5A 2I49A 3ODBA 1PBPA 4OVJA 4THIA 1XS5A 4WXJA 3SEYA 1S7YA 5I84A 3CVGA 3S9NC 4I1DA 3S2VA 2F8DA 3TCHA 4H5FA 3UGWA 4F1UA 2BJJX 5IAIA 5B70A 3C9HA 1ZKBA 4NE4A 3PGFA 5L9SA 4XXUA 2HZLA 4GL0A 4IGTA 2CMOA 4EQBA 2PT1A 3T22A 4NTLA 4POWA 2O1LA 2ZNSA 3N26A 3PPNA 4OMBA 3EHTA 3SKPA 3E3KA 3DLNA 1XVYA 1ZMGA 1B3GA 4NF5A 5I2NB 4NWCA 3U92A 1MPBA 1B3EA 1MRPA 4ZEIA 1USYH 3EPEA 3K01A 2HQ0A 4OYVA 3OENA 3H6WA 3FVOA 3LBSA 1EU8A 2UVIA 3T93B 5K2XA 3HCQA 2YPNA 1FW0A 3PMWA 2ZYOA 5DT6A 4KYEA 2Y84A 2F7BA 4LVQA 5CMBA 5L9MA 5F7VA 1IXGA 3PPRA 1LB8A 1SYHA 1H76A 2ONKE 2X26A 3C34A 4IO2A 1H43A 4HCYA 4M1VA 4PFTA 1HSJA 4YU0A 5L9OA 1FQFA 2ABHA 3TKDA 3RLFE 3L6HA 2QRYA 3K00A 5TP9B 1Y3QA 3B7DA 3DP8A 1DSNA 1LGBC 3E4RA 1O7TA 2D5WA 3T9HB 4X1DA 4IY6A 3G3KA 1MG1A 3GXAA 5FHMA 1S9TA 1ZIUA 4OZ9A 4LQ2A 1BIYA 1DPPA 4NMYA 3G7WA 4HTGA 1TWYA 3SESA 4POXA 3H06B 4TQUQ 2I3VA 4QRZA 4ZZAA 5JEIA 1XVXA 1I6AA 2IA4A 4R72A 3S9LC 2Y7IA 1HSLA 3VFJA 3WAFA 3OXNA 2RC9A 3PUVE 4ND9A 5I58A 3MZBA 4DE8A 5JTYB 3K4UA 2DE4A 4Q8RA 3CR9A 1F9BA 3MP8A 3PD9A 4YB7A 2RCAA 2DXRA 4G68C 3PMXA 1P1UA 1WODA 1QKAA 1B52A 2QJEA 4H8IA 4LZ7A 2QL3A 2XD2A 3LSXA 2HAUA 2UVJA 1B51A 1VR5A 4DIGA 1BTJA 1UIVA 3U93A 1WVJA 1MQDA 2QS1A 4FJPA 3DELB 4HCWA 2DE3A 1QULA 4LZ5A 3VE1B 3W15C 3O6IA 4U2RA 4GIZA 1KWHA 1SI0A 1A8EA 2OZZA 1PB8A 2PVUA 1B46A 1UQWA 3ZKKA 2XXPA 5A5XA 2OWSA 2LAOA 1O64A 2I6EA 4ZE9A 4XKQA 4QSEA 5KDTB 4NF4B 4BDOA 3PUYE 2F7CA 1MY4A 1SW1A 4RY1A 2B3FA 1N3WA 1VSOA 3KSJA 4IO7A 4ZS9A 3JZJA 4F3GA 2PX1A 2RF1A 1YPNA 4AQ4A 1EH3A 1AIVA 3T9VA 3TTNA 3CSGA 4N13A 3CIJA 1JW1A 2Z8DA 1EZOA 1OQHA 4R9GA 2G29A 4RK9A 4F3BA 1MY1A 3HHGA 3Q28A 4MH5A 2X7QA 2XX8A 4ZEBA 2O7UA 2NXOA 4KYDA 1LFIA 2HFBA 4IB2A 4OFLA 4MLVA 1B1HA 2A5TB 4ZE8A 3FATA 3THIA 3OEKA 2D3IA 2RCBA 4JWYA 4KFQA 3O6GA 5ICTA 2DOJA 4NF6A 1B5JA 4XKRA 4PFYA 1OLAA 3VXCA 3N94A 1Y1ZA 2QMXA 2QPQA 2ZMBA 3E9XA 3GZGA 4KCCA 2OJTA 3RT6B 3TTLA 1AMFA 1MPCA 2ZNTA 3Q29A 1LLSA 4ZEDA 1M5EA 2O1MA 1MH3A 1DTGA 3FXQA 2H25A 1JEUA 1GGGA 3OO6A 4G8MA 4DCXA 1EZ9A 2G93A 1NFTA 4G8HA 2O69A 4Q0CA 3EQ1A 2ZNUA 3OSRA 3RUMA 1LFGA 3OOAA 4GXAA 4XKNA 3QK6A 4YICA 1B3FA 1IXCA 5H8HA 4ESXA 1MY3A 3TYHA 1HSEA 4Q30B 3PPOA 2XXTA 2XX9A 3EHUA 4YKIA 2F7AA 4G2ZA 3PUZE 3I6VA 5K2YA 5TP9A 1SW4A 4GRKA 3VXBA 1MDP1 1GVCA 4UACA 4DLDA 5ICQA 3B6TA 1P99A 1NNKA 3CFXA 4IY5A 3KN8A 4FEDA 3K2DA 5TU0A 1B4HA 4UA8A 5H8HB 3N5LA 4BDQA 1NMUA 2ZYKA 1IEJA 3IOVA 1P1NA 1LBBA 4R2FA 4BDNA 4DXCA 5I59B 5I58B 1MM6A 2I0BA 2OWTA 2OCUA 3HN0A 3TELA 1WDNA 2X7PA 3A3CA 4E0WA 1AL3A 1UTBA 4M4GA 4F1VA 3OO8A 5H8QB 1TFAA 3OO7A 5DVJA 4OEVA 3JYRA 5BWJA 3PUXE 1ELJA 2F36A 1NKXA 4LONB 4NWDA 2RC8A 3W9WA 3IOTA 4NEDA 4OETA 1I69A 5H8NA 1OIBA 3HO7A 5EHSA 2I3WA 3CFLA 4G68A 4YB6A 2VHAA 1URGA 5I2KA 1PC3A 2O51A 3KBRA 4LP2B 2YLNA 3IOWA 3OSQA 3RTFB 1OVBA 1B7HA 3EN3A 4GVOA 4U22A 4C1TA 1A40A 2NWJA 2XXVA 1IUDA 5AA4B 1MXYA 1LBCA 3O2AA 2RINA 3TODA 3MPKA 3QIMA 3H03A 2O68A 3K6VA 4RYAA 4GF8A 3EF7A 3TMGA 2DWHA 3DM0A 3VVFA 5AE4A 4JSDA 4P0GA 4F29A 3U72A 2H5YA 1A7LA 4KCDA 5CBSA 3KGCA 3T9UA 3TAJA 4KHZE 3CRBA 2D21A 3MZ1A 3SEUA 3H7MA 4U23A 4FATA 1JETA 2OBGA 1Q35A 3OO9A 3UIFA 3WAEA 1D4NA 2VP1A 1OVTA 3K1MA 2F35A 4KPTA 4WEPA 4ELPA 1P1OA 4ZEFA 1Q1KA 3IOUA 1M5DA 2E1SA 3IR1A 2B3BA 3K1PA 3TUSA 1FTOA 3KN7A 3QYTA 3K02A 3KSXA 1B58A 4BDLA 4BLAA 3S9MC 1POY1 3O97A 4RJZA 4GL8A 4KI0E 1A8FA 1J1NA 1FQAA 4OXVA 3U1OA 4DXBA 1QW0A 3H3GA 1SD3A 3PPQA 4QHQA 4Q5TA 2Z8FA 1DOTA 1BP5A 4QSCA 3MC2A 2AIXA 1JEVA 3N6UA 1NH8A 4I8CA 5DYHA 4QFKA 4C1UA 4OENA 3SEVA 4F19A 2E0SA 5KCJB 1JVXA 3FVGA 4R6KA 4FAJA 4OEUA 4HS7A 3MVWA 5ELVA 5A5XB 5CBRA 2XXQA 4LZ8A 5KZTA 4IO6A 4N07A 3USDA 5I57A 1TXFA 3OMBA 3B6QA 1FTMA 4G68B 4IO3A 1ZJLA 2VD2A 1MXZA 1P1QA 1OLCA 1QJMA 2XXUA 3AXFA 2XX7A 3MVZA 1CE2A 2DVZA 1OMPA 3ZKLA 2QMWA 4AB6A 1MXXA 1MQIA 3MVXA 4ZECA 3TTMA 3RPWA 4PP0A 4QF9A 1LAHE 1N84A 1A54A 2YJPA 3CSBA 4H1XA 4GFRA 4O3AA 4PETA 4F18A 1UTHB 5FTHA 4Z7EA 1IQ7A 4EF2A 1SBPA 4QFPA 1YAEA 5FHNA 1B3LA 5JK4A 4GD5A 4NF8B 3LC8A 1Y4CA 3CFZA 3MBPA 4R74A 1US4A 1DTZA 2R9JA 2Q9TA 5HPQA 4P0IA 3SEWA 5M2VA 2A5TA 5I2NA 4F22A 4U4SA 3VLUA 1H3DA 2XD3A 4GOTA 4FE8A 2F6GA 4L17A 3FUZA 3RT8A 3SERA 4GLIA 3VVDA 3MP6A 2QSXA 2Y7PA 4OFOA 3U8QA 5L8DA 4H8JA 1RYOA 1LSTA 1S50A 3S4UA 3TZAA 3V89B 3H4ZA 3BFUA 2DWIA 3H6VA 4RPNA 4XKPA 3S9EA 1B4ZA 1LB9A 1JVYA 3IJOB 1QVSA 3ONMA 1B1XA 1XOCA 1B7UA 2FYIA 3K6XA 4G77A 5CI5A 2GHAA 1ZU0A 2O7IA 3LUYA 4GQOA 2P1SA 4LA9A 3SEXA 3V5AA 1EZPA 3Q26A 1BKAA 1ZTYA 1PB7A 2H4IA 1QUJA 2PYYA 2QS3A 3T66A 3TFLA 2WKYA 5J1DA 1MH4A 4ZDMA 1JQFA 1PBQA 4OWDA 4YKKA 5DEXA 5KDTA 1O63A 1H44A 4JSOA 4TLMB 4F31B 1VFDA 2KLFA 2XXYA 3FGSA 4YB5A 1NNPA 3A09A 3KZGA 3VLWA
chains in the Genus database with same CATH superfamily
3DP6A 2DS9A 2HZKA 4KYSA 5IZ3B 1II5A 3RPLA 1FCKA 4FIMA 1RKMA 4OVTA 4RNSA 4OANA 5EHMA 3LUZA 5H8NB 1IIWA 4G4PA 3E13X 3V83A 4PGNA 3MP1A 1IMAA 1FTLA 1TFDA 4F3SA 2W7YA 4DCYA 3RN8A 5DTBA 4OFJA 4ECFA 2RC7A 4RPOA 4F2OA 3O66A 2HAVA 2CEYA 3V8XB 1SI1A 1Y3NA 1B5HA 1NNTA 3ZSFA 1N04A 4QFLA 2I4CA 1POTA 1MXVA 1BLFA 1FQDA 1SVXB 3IL1B 1ZLQA 5DVIA 5H8FA 2XHDA 4RA1A 4N8YA 3B6WA 3C33A 5I56A 5BUUA 4X1BA 4N6PA 2FA7A 2QS4A 3M3FA 1SQYA 2PBWA 4KD5A 4EXKA 3GLBA 1N76A 5ISUA 1VE4A 3D4GA 2B4LA 1FPGA 2REJA 3HV1A 2VPOA 2REGA 1FTJA 2CZKA 4IO4A 5AA4A 4EDPA 4X48A 1ZBMA 3G3FA 3K1NA 3L6GA 4HXVA 4FORA 2V25A 3RTFB 2NUVA 1N7XA 4P3LA 1D3KA 1FTKA 3H6UA 1YCJA 2ESNA 1IXIA 3SETA 4MLQA 1LFHA 1UIUA 1UTBB 5ITOA 2OLBA 4OQOA 2V3UA 1FQCA 4LN5A 1B9JA 4U1OA 3RTWB 3M8UA 3KG2A 5HM4B 3FJ7A 3G3IA 4ELRA 1GTKA 3M3KA 2V84A 4DXUA 4HE0A 5IGAA 3IB1A 4TLLB 4MBPA 1D9VA 2ZYNA 3C32A 1PB9A 3O6HA 2FHYA 2HHMA 1NV4A 3KOSA 4NF6B 1IMCA 1DMBA 1A55A 1L5TA 3R7XA 1FBFA 2HXWA 5EYHA 5TPAA 3TPAA 2CZHA 3P7IA 2HEUA 1MXUA 1Y3PA 1QKBA 2GFEA 1MY2A 4ISUA 3FV1A 1FSAA 4LATA 1NL5A 3TTRA 2V3TA 4YKJA 4GXSB 2GRVA 1T0KA 3VDFA 2PMSA 4OESA 2ONRA 1US5A 4O3CA 4GWZA 2I4BA 2HCAA 1XS5A 4I1DA 3S2VA 4H5FA 3UGWA 3C9HA 4NE4A 2HZLA 1NV1A 4POWA 1EYJA 1LBYA 3PPNA 3EHTA 1XVYA 5I2NB 1B3GA 4GWUA 1B3EA 1MRPA 3OENA 2UVIA 2PFZA 4O7IA 2YPNA 2F7BA 1IXGA 3PPRA 4M1VA 4PFTA 2ABHA 2B4MA 3L6HA 3K00A 1Y3QA 1LGBC 4X1DA 5FHMA 4JVIA 1S9TA 3G7WA 4POXA 3S9LC 2ZZXA 4I3EA 4ND9A 3MZBA 5ET5A 4MHFA 2DXRA 4G68C 3KBZA 3RPLB 3KC0A 1BTJA 1WVJA 3DELB 3O6IA 1KWHA 2OZZA 5A5XA 2XXPA 4PF6A 4PBHA 1SW1A 1N3WA 1VSOA 3D1RA 2RF1A 1EH3A 3CSGA 2Z8DA 3E78A 1OQHA 4OA4A 1NV6A 1MY1A 4OFLA 2A5TB 3OEKA 2DOJA 1Y1ZA 2QPQA 1MPCA 1LLSA 4ZEDA 1M5EA 1MH3A 3FXQA 1JEUA 2GQ1A 3OSRA 3OOAA 4GXAA 3QK6A 1B3FA 3TYHA 2XXTA 4G2ZA 3VXBA 3I6VA 5K2YA 1SW4A 1IMFA 1MDP1 4FEDA 5TU0A 3K2DA 1B4HA 3N5LA 1NMUA 2ZYKA 1IEJA 3CHGA 5I59B 2OWTA 2OCUA 3HN0A 3A3CA 1AL3A 4F1VA 1FPIA 1LBZA 3OO7A 5BWJA 3PUXE 4LONB 4NWDA 3IOTA 1I69A 2I3WA 2XWOA 4YB6A 1PC3A 3KBRA 4I3YA 1LBWA 5IM2A 1B7HA 1FPLA 2Q8MA 2CEXA 1A40A 4MX6A 1IUDA 3LV0A 3TODA 3MPKA 2O68A 4RYAA 3TMGA 5AE4A 4JSDA 5EQ8A 3CRBA 3MZ1A 4U23A 2OBGA 3UIFA 1M5DA 4XF5A 3IR1A 3KN7A 3QYTA 1POY1 1A8FA 4OXVA 1DOTA 1BP5A 5DYHA 1XI6A 3N6UA 4C1UA 3PTYA 4NF0A 3B6QA 4G68B 4IO3A 1ZJLA 1P1QA 1OLCA 2XX7A 1OMPA 3MVXA 3RPWA 1LAHE 1UTHB 1IQ7A 5FHNA 1YAEA 4NF8B 1DTZA 2KR0A 3VLUA 4L17A 1FPFA 4H8JA 3BFUA 2DWIA 1IMDA 1B4ZA 4G77A 1B7UA 4JVDA 3V5AA 1BKAA 1ZTYA 4N17A 4OVRA 1SPIA 2WKYA 4HE2A 4TLMB 2KLFA 3A09A 3VLWA 4GWOA 5CRYA 3FJMA 3CI8A 5TPAB 2F5XA 4JB7A 3LSFB 3D4CA 2ALUA 3HSTA 5EQ9A 3C4MA 3UN6A 3R26A 1Z7ME 4AB5A 4LQ5A 2ZYMA 2BJIA 3KN3A 1USYE 1ANFA 3BBRA 4RK2A 3DP4A 4R9FA 1URDA 4P11A 5H8QA 4F2QA 2DQVA 4FECA 2VGQA 2B65A 3N6TA 4FEBA 3RNNA 4P8BA 1I6QA 3ECRA 4N81A 2Z23A 1MM7A 1IZ1A 3VV5A 2Y7WA 1DBZA 3TTKA 4MFIA 3MSTA 3HPIA 4E0XA 3KFMA 4U1ZA 2Q8JA 3QUJA 3FV2A 1LBXA 3FASA 4JWOA 4WKMA 3K0VA 3UK4A 3IX1A 4YMBA 3PV0E 3UORA 1Y9UA 4YAHX 3QXMA 5AA2B 4ZEKA 3OEMA 2R71A 4PE5B 1M5FA 2UVHA 2A5SA 2GH9A 2Q89A 4F39A 4ZZEA 1FBHA 4PFUA 3MZ9A 2V93A 2WYPA 1URSA 2Y7KA 3HHFA 3G3HA 1QUKA 5CM6A 3C31A 3Q27A 4EF1A 1QUIA 3ROJA 4I9DA 2DYXA 4XIGQ 4PFIA 2UYFA 2F6PA 4X9TA 5AA3A 3MWBA 3VLVA 3ILTB 4WEDA 4MCOA 5AA2D 4KXPA 3MPLA 1H45A 1KZ8A 4GWXA 3MAMA 5LOMA 5B7DA 1Z7NE 2P0SA 1ATGA 3KJ7A 3KJTA 3BIGA 4O7MA 4EUOA 3IAZA 3KOTA 1MQGA 3PPPA 2Q2CA 2XXWA 4QFOA 4MF3A 4EXLA 1FPDA 1D9YA 1B05A 1K9YA 1JW5A 1M5BA 3MVYA 4R6HA 3RGYA 3MQ9A 2UXAA 4OVJA 2OK2A 3SEYA 1SW5A 4F1UA 5B70A 1EYKA 4EQBA 3N26A 3E3KA 3DLNA 4MMPA 4ZEIA 3EPEA 4OYVA 1EU8A 5K2XA 2Y84A 5LTCA 1SYHA 2ONKE 2X26A 1H43A 4HCYA 5L9OA 1FQFA 3RLFE 2QRYA 3IFCA 3T9HB 3DP8A 3E4RA 3QMFA 2HPGA 1MG1A 4LQ2A 1BIYA 3SESA 4TQUQ 1FBCA 2IA4A 4GWYA 2JJKA 3VFJA 5FBPA 3WAFA 3OXNA 4N8GA 4DE8A 5I5PA 3K4UA 3CR9A 1F9BA 4O8MA 3MP8A 4YB7A 4NGUA 1P1UA 4GWSA 1B52A 2QJEA 2XD2A 2UVJA 1B51A 4DIGA 5I3SA 3U93A 4HCWA 3W15C 1NUZA 4LZ5A 1QULA 1SI0A 2PVUA 2OWSA 2LAOA 1IMEA 4QSEA 2B3FA 3KSJA 4AQ4A 3TTNA 4PDHA 3HHGA 1LFIA 4MLVA 5ET7A 3A29A 2D3IA 4P9KA 2F3BA 1OLAA 5DW8A 3N94A 2ZMBA 4KCCA 3B50A 1AMFA 3Q29A 1D9QA 1DTGA 1GGGA 2G93A 4G8HA 3RUMA 2ZNUA 4UABA 4GWWA 1IXCA 4ESXA 1MY3A 4Q30B 5TP9A 1GVCA 4UACA 1FPKA 3HFUA 1P99A 5H8HB 4P47A 1P1NA 4DXCA 1MM6A 4M4GA 1UTBA 1TFAA 4OEVA 2F36A 2RC8A 3W9WA 5LDZA 5H8NA 1OIBA 3HO7A 5IZ1A 5EHSA 3CFLA 2CZIA 2VHAA 4LP2B 3OSQA 3EN3A 4GVOA 4C1TA 2Y5LA 1LBCA 3QIMA 3H03A 3K6VA 3VVFA 1JP4A 4NG7A 4F29A 4KHZE 4N6DA 3SEUA 1Q35A 3WAEA 2VP1A 3K1MA 2F35A 1P1OA 3IOUA 2B3BA 3K1PA 1NV3A 4P1EA 2XWKA 3O97A 4RJZA 4PGPA 3H3GA 1SD3A 3PPQA 4QHQA 5A5LA 2Z8FA 4QSCA 4MNPA 1JEVA 1FBGA 4OENA 1JVXA 3FVGA 4R6KA 1IMBA 4OEUA 5CBRA 2XXQA 3USDA 1TXFA 1FTMA 3AXFA 1QJMA 3MVZA 1CE2A 2QMWA 4AB6A 1MQIA 1FTAA 4ZECA 4PP0A 4QF9A 1G0HA 1N84A 1A54A 2YJPA 4F18A 2WYKA 5FTHA 2FIEA 1B3LA 5JK4A 1US4A 3SEWA 2WBBA 4U4SA 5ET8A 2XD3A 4GOTA 3MP6A 1LSTA 4RPNA 3H6VA 1JVYA 5H8QB 4PC9A 1XOCA 1ZU0A 4GQOA 1QUJA 2PYYA 3TFLA 5J1DA 1JQFA 1PBQA 1H44A 1VFDA 4YB5A 1AWBA 3ISPA 1NH7A 1JNFA 5I59A 1N0TA 2GHBA 5EYGA 3CG1A 4U21A 4YKPA 1B2HA 1FQEA 1I6BA 3IO6A 1PDAA 3IO4A 5HBCA 5I2KB 5H8SA 4ONYA 2THIA 1FBEA 3B8BA 1FPJA 3MUQA 4NF4A 1XHYA 2AL4A 3FXUA 4TOZA 3IB2A 4U4XA 2AL5A 1SDXA 2H9BA 4Z0IA 1RDYA 2RKMA 2FNCA 3OD7A 2P3VA 5AA1A 4DDDA 4H6DA 2F78A 4N91A 4MAGA 4BDMA 3FZVA 1RYXA 5ITPA 4LUBA 5FTIA 4P1LA 5CC2A 1LCFA 4I62A 4JXIA 1R9LA 4NF5B 4R75A 2O84X 3IJXB 5F1QA 3ZS6A 1A99A 1MY0A 4KQPA 3TCFA 1PEBA 4JWXA 1NNFA 2PT2A 2F34A 1LAGE 4IGRA 4N15A 3K6UA 3TEPA 3FVKA 5CMMA 2XXXA 1P1WA 1GV8A 2ZXTA 4R6YA 4ELQA 4PDDA 1TT1A 2QVRA 4F1YA 3PUWE 2AYSA 3H6TA 3W9VA 1M5CA 2XXIA 1SW2A 2WX9A 5IZZA 4PQJA 1R6ZA 1NV5A 4XFEA 2UYEA 3MYUA 3F11A 4IR8A 1B40A 2F97A 2DE2A 3BFTA 1AOVA 2DVCA 1YTVA 1MQJA 4GX3A 3VVEA 3PD8A 2P3NA 3UP9A 1FQBA 3GBBA 3QAXA 2DP8A 1B0LA 4HW8A 3PMVA 1B7ZA 4PFWA 3U94A 1LAFE 4PCDA 1B0HA 3GBAA 3TQLA 1OQGA 2Y5KA 5EQAA 1KA1A 5I56B 3MJNA 4OTEA 1FPEA 3FD3A 1QGXA 3A3UA 1MDQA 5FHOA 2Z8EA 4BDRA 3PU5A 3LSWA 2UVGA 4X8RA 2XXRA 2CZLA 4DXBA 5DVFA 4KR5A 3RY3A 3FXRA 1RDZA 1N7WA 4XTCQ 3CG3A 3T0JA 1LCTA 4OHNA 4K3FA 1AH5A 4NAPA 1LAXA 5DEXB 2ANJA 3FJGA 5ET6A 3S9NC 2XWVA 5I84A 3CVGA 2F8DA 3TCHA 2BJJX 4GL0A 4IGTA 2PT1A 4NTLA 2O1LA 3SKPA 4NF5A 4N4UA 1USYH 2HQ0A 1NV0A 3LBSA 3T93B 3HCQA 2ZYOA 5DT6A 4KYEA 5L9MA 5F7VA 1LB8A 4YU0A 3C34A 4IO2A 1HSJA 3TKDA 1NI9A 2QFLA 1O7TA 2D5WA 2WEFA 1DPPA 4HTGA 1KA0A 2I3VA 4QRZA 1FJ9A 2Y7IA 1HSLA 4NHBA 5JTYB 2DE4A 3PD9A 2RCAA 1WODA 2QL3A 3LSXA 2HAUA 1MQDA 2FIXA 2QS1A 4FJPA 3VE1B 5CMKA 1NV2A 4GIZA 1B46A 1UQWA 3ZKKA 1O64A 2I6EA 4XKQA 4BDOA 1MY4A 4IO7A 3JZJA 2MKZA 1YPNA 3T9VA 4N13A 3CIJA 2XXKA 4OVPA 4R9GA 2G29A 4ZEBA 2XX8A 5KDTA 4KYDA 2NXOA 4IB2A 4ZE8A 3THIA 3FATA 4NX1A 4JWYA 2OWZA 2RCBA 4KFQA 3O6GA 4PFYA 3E9XA 4PTKA 2OJTA 3RT6B 2ZNTA 3EKIA 2H25A 4G8MA 1EZ9A 2O69A 3EQ1A 3T96B 5IAIA 4XKNA 4YICA 5H8HA 1HSEA 3PPOA 3PUZE 5ICQA 4DLDA 1NNKA 4IY5A 3T9XB 3KN8A 1G0IA 4UA8A 3IOVA 4R2FA 1LBBA 1EYIA 1FJ6A 4FBPA 5I58B 2I0BA 2ZZVA 5DVJA 3JYRA 1RDXA 1NKXA 4OETA 4G68A 4U22A 1FPBA 2NWJA 3EF7A 2DWHA 3DM0A 3FBPA 4PF8A 4P0GA 2H5YA 1A7LA 3KGCA 3H7MA 1JETA 3OO9A 1D4NA 1OVTA 4KPTA 4WEPA 2L5VA 1Q1KA 3TUSA 3K02A 4KI0E 1J1NA 1QW0A 4Q5TA 1FBPA 3MC2A 2AIXA 4QFKA 4HE1A 4FAJA 3MVWA 5A5XB 4LZ8A 5KZTA 4IO6A 5I57A 2F3DA 2VD2A 1MXZA 3ZKLA 4PAKA 2DVZA 3TTMA 5IKBA 3CSBA 4GFRA 4PETA 4XEQA 4Z7EA 1SBPA 4GD5A 3LC8A 1Y4CA 3MBPA 4R74A 2Q9TA 4H46A 1H3DA 3RT8A 4FE8A 2F6GA 1DK4A 4GLIA 2VPNA 3VVDA 2QSXA 2Y7PA 5L8DA 3V89B 3S4UA 1NUXA 3H4ZA 3IJOB 2FBPA 3ONMA 1QVSA 1B1XA 2QVUA 2GHAA 2O7IA 4LA9A 1EZPA 3Q26A 3T66A 1MH4A 4ZDMA 4YKKA 1O63A 4JSOA 3FGSA 3KZGA 2DWAA 5KDTB 4ELOA 1BK4A 4PAIA 3QSLA 4YZZA 3I5OA 3UA8A 3IORA 1IXHA 1MQHA 4NN3A 2XXHA 1K9ZA 4C0RA 3RQTA 3R6UA 1Y1MA 3IK6B 1MS7A 3O9PA 4IO5A 1XT8A 4O3BA 4H67A 2Q74A 4H5GA 4MJOA 2VOZA 2DWJA 3ILUB 3JV9A 4PFRA 2Q2AA 3TCGA 1XC1A 1R1NA 2O6AA 2I0CA 4PFBA 2DXYA 3BKIB 3EHSA 3TDJA 1Q9DA 4YMAA 1MPDA 3LR1A 2NOOA 2HXRA 3OELA 3IB0A 4O94A 3K6WA 3I3VA 3C36A 4JBZA 4MEVA 3GYYA 2QS2A 4GX6A 4H65A 1UTHA 5CMCA 3M3LA 2P2AA 1DPEA 4E0WA 2NVUB 5T3JA 4I8CA 1Y20A 3Q25A 3KEIA 3O29A 1DCUA 3T1BA 5I57B 2ONSA 2R8TA 4PAFA 1IITA 3FIRA 2KQZA 5KCJA 5H8FB 2VD3A 5JTYA 2I58A 2I48A 1FBDA 3G3JA 2Y7RA 5I7IA 2V3QA 1Y4TA 2Z22A 1B5IA 4AS5A 4PBQA 3O28A 4GBWA 1VFEA 2H99A 2ZZWA 4G8NA 3SZPA 2R6GE 2PCRA 3IFAA 4H0WA 3MW0A 3SDFA 5F24A 5I2KA 4RXLA 3LSLA 2Q88A 4EQ7A 4F3PA 1R9QA 4QBAA 1FRPA 1GR2A 1B6HA 1SYIA 2DSFA 1N3XA 4R73A 1JW4A 1CB6A 4ESWA 1B32A 4QSDA 3QUFA 4QFNA 5AA2A 4OERA 4NF8A 1B3HA 5EYFA 4R2BA 3TQWA 1MXWA 2QVVA 2XWIA 3C35A 2M8CA 2H98A 2IEEA 4AS4A 1LEVA 3KC1A 3G3GA 4EQ9A 4JDFA 3FVNA 5ESYA 3ODBA 2I49A 4WXJA 1PBPA 4THIA 1S7YA 4GBVA 1ZKBA 3PGFA 5L9SA 4XXUA 3BIHA 2CMOA 3T22A 2ZNSA 4OMBA 1ZMGA 4NWCA 3U92A 1MPBA 4MIJA 3K01A 3H6WA 3FVOA 4H45A 1FW0A 3PMWA 4LVQA 3U65A 5CMBA 1H76A 4OVSA 1INPA 5TP9B 5EQ7A 3B7DA 1DSNA 4IY6A 3G3KA 3GXAA 3E79A 1ZIUA 4OZ9A 4NMYA 1TWYA 3H06B 4ZZAA 5JEIA 1XVXA 1I6AA 3RYDA 4R72A 2RC9A 3PUVE 5I58A 4Q8RA 4OVQA 3NOHA 3PMXA 2OX3A 1QKAA 4LZ7A 4H8IA 1VR5A 1UIVA 4DI4B 2DE3A 4DZ1A 4U2RA 1A8EA 1PB8A 4JVCA 1LBVA 4ZE9A 4NF4B 3PUYE 2F7CA 4RY1A 1YZ0A 4F3GA 4ZS9A 2PX1A 1YYZA 1AIVA 1JW1A 1EZOA 4RK9A 4F3BA 3Q28A 4MH5A 2X7QA 2DDKA 2O7UA 1VDWA 5J16A 2HFBA 1B1HA 1NUYA 5ICTA 4NF6A 1B5JA 4XKRA 3VXCA 2QMXA 3GZGA 3TTLA 2O1MA 4DCXA 3OO6A 2PFYA 1NFTA 4Q0CA 1NV7A 1LFGA 2FVZA 4PE3A 4YKIA 2XX9A 3EHUA 2F7AA 4GRKA 4QXDA 2VT5A 2V4CA 3B6TA 3CFXA 4DI3D 4BDQA 4N6KA 4BDNA 3TELA 1WDNA 2X7PA 1YXIA 1CNQA 4NQ8A 3OO8A 1ELJA 4NEDA 1URGA 2O51A 2YLNA 3IOWA 1OVBA 2XXVA 5AA4B 1MXYA 3O2AA 2RINA 4GF8A 3U72A 4KCDA 5CBSA 3T9UA 3TAJA 2D21A 4MNIA 4FATA 4ELPA 4ZEFA 2E1SA 1FTOA 3KSXA 1B58A 4BDLA 4BLAA 3S9MC 4GL8A 1FQAA 3U1OA 1NH8A 4F19A 3SEVA 2E0SA 4MNCA 5KCJB 3FXBA 4HS7A 5ELVA 4I40A 4N07A 3OMBA 2XXUA 1NUWA 1MXXA 4H1XA 4O3AA 4EF2A 4QFPA 2WBDA 3CFZA 2R9JA 4P0IA 5M2VA 2A5TA 4F22A 3SERA 3FUZA 4G61A 4OFOA 3U8QA 1RYOA 1S50A 3TZAA 4XKPA 3S9EA 1LB9A 5HPQA 5I2NA 5CI5A 2FYIA 3K6XA 4X04A 3LUYA 4GX4A 3SEXA 2P1SA 2H4IA 1PB7A 2QS3A 5IZ3A 5DEXA 2XA5A 4OWDA 4F31B 2XXYA 1NNPA 4P56A
chains in the Genus database with same CATH topology
3DP6A 1NH7A 2DS9A 1JNFA 2DWAA 4GWOA 2HZKA 5CRYA 4ELOA 5I59A 1N0TA 4KYSA 2GHBA 3FJMA 3CI8A 3CG1A 3QSLA 4YZZA 2F5XA 1II5A 5TPAB 3I5OA 1FCKA 4U21A 4JB7A 3UA8A 3LSFB 3IORA 1B2HA 1RKMA 3D4CA 4FIMA 2ALUA 4YKPA 5IKBA 1FQEA 3HSTA 3UN6A 3C4MA 1I6BA 1IXHA 1MQHA 1PDAA 3IO6A 3IO4A 4RNSA 5EHMA 5ITPA 5HBCA 5H8NB 1IIWA 2XXHA 3R26A 4C0RA 1Z7ME 3RQTA 3R6UA 4AB5A 4LQ5A 4G4PA 5I2KB 3E13X 1Y1MA 5H8SA 3V83A 2ZYMA 2THIA 3IK6B 3MP1A 1FTLA 4ONYA 1TFDA 4F3SA 1MS7A 3KN3A 1USYE 3MUQA 3O9PA 2W7YA 4IO5A 4NF4A 1XT8A 1XHYA 4DCYA 4O3BA 3RN8A 1ANFA 2AL4A 3BBRA 3FXUA 4RK2A 4H67A 4TOZA 3IB2A 4U4XA 4H5GA 5DTBA 2AL5A 4OFJA 4ECFA 1SDXA 2H9BA 2VOZA 3DP4A 4Z0IA 4R9FA 2DWJA 1URDA 2FNCA 2RKMA 3ILUB 3JV9A 3OD7A 4P11A 5H8QA 2RC7A 4F2QA 2Q2AA 4RPOA 4F2OA 3TCGA 5CMKA 1XC1A 2DQVA 2HAVA 3O66A 4FECA 1R1NA 2O6AA 2VGQA 2B65A 3N6TA 4FEBA 2I0CA 1SI1A 1Y3NA 5AA1A 3RNNA 3V8XB 1B5HA 1I6QA 3ECRA 1NNTA 3ZSFA 2DXYA 1N04A 2Z23A 4H6DA 4DDDA 3BKIB 1MM7A 4QFLA 2F78A 1POTA 2I4CA 1IZ1A 1MXVA 3VV5A 2Y7WA 4BDMA 1BLFA 1FQDA 1RYXA 1SVXB 1ZLQA 3EHSA 3FZVA 3IL1B 4LUBA 5DVIA 5FTIA 4MFIA 2NVUB 3TTKA 5CC2A 1LCFA 4I62A 4JXIA 2XHDA 1R9LA 3TDJA 5H8FA 4RA1A 3HPIA 4E0XA 4NF5B 4R75A 2O84X 3KFMA 4U1ZA 2Q8JA 3B6WA 3IJXB 3QUJA 4YMAA 3C33A 5F1QA 5I56A 3FV2A 5BUUA 4X1BA 3ZS6A 1MPDA 1A99A 1MY0A 3LR1A 2NOOA 4N6PA 2FA7A 4KQPA 3FASA 3OELA 3TCFA 1PEBA 4JWOA 4JWXA 1NNFA 2PT2A 2QS4A 3IB0A 3M3FA 4WKMA 2F34A 1SQYA 2PBWA 1LAGE 3K0VA 3K6WA 3UK4A 4KD5A 3IX1A 4IGRA 4EXKA 3I3VA 3C36A 3GLBA 4JBZA 4YMBA 1N76A 3PV0E 2QS2A 5ISUA 3UORA 3K6UA 1VE4A 1Y9UA 3TEPA 3D4GA 4YAHX 3QXMA 4H65A 5AA2B 1UTHA 2REJA 3HV1A 5CMCA 4ZEKA 3T96B 2REGA 1FTJA 3OEMA 4IO4A 2R71A 3FVKA 3M3LA 5AA4A 4PE5B 1M5FA 4EDPA 4X48A 5CMMA 1ZBMA 2P2AA 1DPEA 2XXXA 3G3FA 2UVHA 3K1NA 3L6GA 2V25A 4FORA 2NUVA 1Y20A 1P1WA 3Q25A 2A5SA 2GH9A 2Q89A 3KEIA 1GV8A 1N7XA 4F39A 4ZZEA 2ZXTA 3O29A 1D3KA 4R6YA 1FTKA 3H6UA 5I57B 2ONSA 4PFUA 3MZ9A 4ELQA 1IITA 3FIRA 5KCJA 1TT1A 1YCJA 5H8FB 2ESNA 2V93A 4F1YA 2VD3A 3PUWE 2AYSA 5JTYA 1IXIA 1URSA 2Y7KA 3H6TA 3W9VA 2I58A 3HHFA 2I48A 4MLQA 1M5CA 3G3HA 3SETA 1UIUA 1UTBB 1LFHA 3G3JA 2XXIA 4DZ1A 5ITOA 1SW2A 2Y7RA 2OLBA 4OQOA 2V3UA 2V3QA 1FQCA 1QUKA 5CM6A 1Y4TA 3C31A 4PQJA 3Q27A 1B9JA 2Z22A 1R6ZA 4EF1A 1B5IA 4U1OA 3RTWB 1QUIA 3M8UA 2UYEA 3KG2A 3F11A 3O28A 1VFEA 1B40A 2F97A 2DE2A 2H99A 3BFTA 4G8NA 4I9DA 3FJ7A 5HM4B 1AOVA 3G3IA 2DYXA 2DVCA 4XIGQ 1YTVA 2R6GE 4ELRA 2UYFA 1MQJA 2F6PA 1GTKA 3M3KA 4H0WA 2V84A 4X9TA 5AA3A 4DXUA 3MW0A 3VVEA 3MWBA 3PD8A 3VLVA 3ILTB 3UP9A 4WEDA 1FQBA 3GBBA 3IB1A 4TLLB 3SDFA 4MBPA 1D9VA 3QAXA 2DP8A 1B0LA 5AA2D 4HW8A 3PMVA 1B7ZA 2ZYNA 2Q88A 3LSLA 3C32A 4PFWA 4RXLA 3U94A 4EQ7A 1PB9A 3O6HA 1LAFE 4F3PA 3KOSA 1R9QA 4NF6B 1GR2A 1B6HA 1DMBA 1SYIA 3MPLA 1A55A 1B0HA 1N3XA 2DSFA 1L5TA 3R7XA 3GBAA 3TQLA 1H45A 3T9XB 4R73A 1OQGA 1JW4A 1CB6A 2HXWA 5TPAA 3TPAA 4ESWA 1B32A 5I56B 3MJNA 4QSDA 3QUFA 4OTEA 3P7IA 2HEUA 1MXUA 4QFNA 3MAMA 1Y3PA 1QKBA 5LOMA 5B7DA 3FD3A 1Z7NE 3A3UA 1MDQA 2P0SA 5FHOA 5AA2A 2Z8EA 1ATGA 3KJ7A 3PU5A 4BDRA 2GFEA 1MY2A 4OERA 3LSWA 4NF8A 3KJTA 4ISUA 2UVGA 2XXRA 3FV1A 1B3HA 4EUOA 2CZLA 4LATA 4R2BA 4KR5A 1NL5A 5DVFA 5EYFA 3RY3A 3TQWA 3TTRA 3IAZA 3FXRA 3KOTA 2V3TA 1MQGA 4YKJA 1MXWA 1N7WA 3PPPA 4GXSB 2Q2CA 3C35A 2GRVA 2M8CA 2H98A 1T0KA 4XTCQ 2IEEA 3VDFA 2XXWA 3CG3A 4MF3A 4QFOA 4EXLA 1LCTA 4OHNA 2PMSA 4K3FA 1AH5A 1D9YA 1B05A 2ONRA 3G3GA 1JW5A 1M5BA 3MVYA 4OESA 4R6HA 1LAXA 4EQ9A 4JDFA 3RGYA 3FVNA 3MQ9A 1US5A 4O3CA 2UXAA 2I4BA 5DEXB 2ANJA 2HCAA 2OK2A 3FJGA 1SW5A 2I49A 3ODBA 1PBPA 4OVJA 4THIA 1XS5A 4WXJA 3SEYA 1S7YA 5I84A 3CVGA 3S9NC 4I1DA 3S2VA 2F8DA 3TCHA 4H5FA 3UGWA 4F1UA 2BJJX 5IAIA 5B70A 3C9HA 1ZKBA 4NE4A 3PGFA 5L9SA 4XXUA 2HZLA 4GL0A 4IGTA 2CMOA 4EQBA 2PT1A 3T22A 4NTLA 4POWA 2O1LA 2ZNSA 3N26A 3PPNA 4OMBA 3EHTA 3SKPA 3E3KA 3DLNA 1XVYA 1ZMGA 1B3GA 4NF5A 5I2NB 4NWCA 3U92A 1MPBA 1B3EA 1MRPA 4ZEIA 1USYH 3EPEA 3K01A 2HQ0A 4OYVA 3OENA 3H6WA 3FVOA 3LBSA 1EU8A 2UVIA 3T93B 5K2XA 3HCQA 2YPNA 1FW0A 3PMWA 2ZYOA 5DT6A 4KYEA 2Y84A 2F7BA 4LVQA 5CMBA 5L9MA 5F7VA 1IXGA 3PPRA 1LB8A 1SYHA 1H76A 2ONKE 2X26A 3C34A 4IO2A 1H43A 4HCYA 4M1VA 4PFTA 1HSJA 4YU0A 5L9OA 1FQFA 2ABHA 3TKDA 3RLFE 3L6HA 2QRYA 3K00A 5TP9B 1Y3QA 3B7DA 3DP8A 1DSNA 1LGBC 3E4RA 1O7TA 2D5WA 3T9HB 4X1DA 4IY6A 3G3KA 1MG1A 3GXAA 5FHMA 1S9TA 1ZIUA 4OZ9A 4LQ2A 1BIYA 1DPPA 4NMYA 3G7WA 4HTGA 1TWYA 3SESA 4POXA 3H06B 4TQUQ 2I3VA 4QRZA 4ZZAA 5JEIA 1XVXA 1I6AA 2IA4A 4R72A 3S9LC 2Y7IA 1HSLA 3VFJA 3WAFA 3OXNA 2RC9A 3PUVE 4ND9A 5I58A 3MZBA 4DE8A 5JTYB 3K4UA 2DE4A 4Q8RA 3CR9A 1F9BA 3MP8A 3PD9A 4YB7A 2RCAA 2DXRA 4G68C 3PMXA 1P1UA 1WODA 1QKAA 1B52A 2QJEA 4H8IA 4LZ7A 2QL3A 2XD2A 3LSXA 2HAUA 2UVJA 1B51A 1VR5A 4DIGA 1BTJA 1UIVA 3U93A 1WVJA 1MQDA 2QS1A 4FJPA 3DELB 4HCWA 2DE3A 1QULA 4LZ5A 3VE1B 3W15C 3O6IA 4U2RA 4GIZA 1KWHA 1SI0A 1A8EA 2OZZA 1PB8A 2PVUA 1B46A 1UQWA 3ZKKA 2XXPA 5A5XA 2OWSA 2LAOA 1O64A 2I6EA 4ZE9A 4XKQA 4QSEA 5KDTB 4NF4B 4BDOA 3PUYE 2F7CA 1MY4A 1SW1A 4RY1A 2B3FA 1N3WA 1VSOA 3KSJA 4IO7A 4ZS9A 3JZJA 4F3GA 2PX1A 2RF1A 1YPNA 4AQ4A 1EH3A 1AIVA 3T9VA 3TTNA 3CSGA 4N13A 3CIJA 1JW1A 2Z8DA 1EZOA 1OQHA 4R9GA 2G29A 4RK9A 4F3BA 1MY1A 3HHGA 3Q28A 4MH5A 2X7QA 2XX8A 4ZEBA 2O7UA 2NXOA 4KYDA 1LFIA 2HFBA 4IB2A 4OFLA 4MLVA 1B1HA 2A5TB 4ZE8A 3FATA 3THIA 3OEKA 2D3IA 2RCBA 4JWYA 4KFQA 3O6GA 5ICTA 2DOJA 4NF6A 1B5JA 4XKRA 4PFYA 1OLAA 3VXCA 3N94A 1Y1ZA 2QMXA 2QPQA 2ZMBA 3E9XA 3GZGA 4KCCA 2OJTA 3RT6B 3TTLA 1AMFA 1MPCA 2ZNTA 3Q29A 1LLSA 4ZEDA 1M5EA 2O1MA 1MH3A 1DTGA 3FXQA 2H25A 1JEUA 1GGGA 3OO6A 4G8MA 4DCXA 1EZ9A 2G93A 1NFTA 4G8HA 2O69A 4Q0CA 3EQ1A 2ZNUA 3OSRA 3RUMA 1LFGA 3OOAA 4GXAA 4XKNA 3QK6A 4YICA 1B3FA 1IXCA 5H8HA 4ESXA 1MY3A 3TYHA 1HSEA 4Q30B 3PPOA 2XXTA 2XX9A 3EHUA 4YKIA 2F7AA 4G2ZA 3PUZE 3I6VA 5K2YA 5TP9A 1SW4A 4GRKA 3VXBA 1MDP1 1GVCA 4UACA 4DLDA 5ICQA 3B6TA 1P99A 1NNKA 3CFXA 4IY5A 3KN8A 4FEDA 3K2DA 5TU0A 1B4HA 4UA8A 5H8HB 3N5LA 4BDQA 1NMUA 2ZYKA 1IEJA 3IOVA 1P1NA 1LBBA 4R2FA 4BDNA 4DXCA 5I59B 5I58B 1MM6A 2I0BA 2OWTA 2OCUA 3HN0A 3TELA 1WDNA 2X7PA 3A3CA 4E0WA 1AL3A 1UTBA 4M4GA 4F1VA 3OO8A 5H8QB 1TFAA 3OO7A 5DVJA 4OEVA 3JYRA 5BWJA 3PUXE 1ELJA 2F36A 1NKXA 4LONB 4NWDA 2RC8A 3W9WA 3IOTA 4NEDA 4OETA 1I69A 5H8NA 1OIBA 3HO7A 5EHSA 2I3WA 3CFLA 4G68A 4YB6A 2VHAA 1URGA 5I2KA 1PC3A 2O51A 3KBRA 4LP2B 2YLNA 3IOWA 3OSQA 3RTFB 1OVBA 1B7HA 3EN3A 4GVOA 4U22A 4C1TA 1A40A 2NWJA 2XXVA 1IUDA 5AA4B 1MXYA 1LBCA 3O2AA 2RINA 3TODA 3MPKA 3QIMA 3H03A 2O68A 3K6VA 4RYAA 4GF8A 3EF7A 3TMGA 2DWHA 3DM0A 3VVFA 5AE4A 4JSDA 4P0GA 4F29A 3U72A 2H5YA 1A7LA 4KCDA 5CBSA 3KGCA 3T9UA 3TAJA 4KHZE 3CRBA 2D21A 3MZ1A 3SEUA 3H7MA 4U23A 4FATA 1JETA 2OBGA 1Q35A 3OO9A 3UIFA 3WAEA 1D4NA 2VP1A 1OVTA 3K1MA 2F35A 4KPTA 4WEPA 4ELPA 1P1OA 4ZEFA 1Q1KA 3IOUA 1M5DA 2E1SA 3IR1A 2B3BA 3K1PA 3TUSA 1FTOA 3KN7A 3QYTA 3K02A 3KSXA 1B58A 4BDLA 4BLAA 3S9MC 1POY1 3O97A 4RJZA 4GL8A 4KI0E 1A8FA 1J1NA 1FQAA 4OXVA 3U1OA 4DXBA 1QW0A 3H3GA 1SD3A 3PPQA 4QHQA 4Q5TA 2Z8FA 1DOTA 1BP5A 4QSCA 3MC2A 2AIXA 1JEVA 3N6UA 1NH8A 4I8CA 5DYHA 4QFKA 4C1UA 4OENA 3SEVA 4F19A 2E0SA 5KCJB 1JVXA 3FVGA 4R6KA 4FAJA 4OEUA 4HS7A 3MVWA 5ELVA 5A5XB 5CBRA 2XXQA 4LZ8A 5KZTA 4IO6A 4N07A 3USDA 5I57A 1TXFA 3OMBA 3B6QA 1FTMA 4G68B 4IO3A 1ZJLA 2VD2A 1MXZA 1P1QA 1OLCA 1QJMA 2XXUA 3AXFA 2XX7A 3MVZA 1CE2A 2DVZA 1OMPA 3ZKLA 2QMWA 4AB6A 1MXXA 1MQIA 3MVXA 4ZECA 3TTMA 3RPWA 4PP0A 4QF9A 1LAHE 1N84A 1A54A 2YJPA 3CSBA 4H1XA 4GFRA 4O3AA 4PETA 4F18A 1UTHB 5FTHA 4Z7EA 1IQ7A 4EF2A 1SBPA 4QFPA 1YAEA 5FHNA 1B3LA 5JK4A 4GD5A 4NF8B 3LC8A 1Y4CA 3CFZA 3MBPA 4R74A 1US4A 1DTZA 2R9JA 2Q9TA 5HPQA 4P0IA 3SEWA 5M2VA 2A5TA 5I2NA 4F22A 4U4SA 3VLUA 1H3DA 2XD3A 4GOTA 4FE8A 2F6GA 4L17A 3FUZA 3RT8A 3SERA 4GLIA 3VVDA 3MP6A 2QSXA 2Y7PA 4OFOA 3U8QA 5L8DA 4H8JA 1RYOA 1LSTA 1S50A 3S4UA 3TZAA 3V89B 3H4ZA 3BFUA 2DWIA 3H6VA 4RPNA 4XKPA 3S9EA 1B4ZA 1LB9A 1JVYA 3IJOB 1QVSA 3ONMA 1B1XA 1XOCA 1B7UA 2FYIA 3K6XA 4G77A 5CI5A 2GHAA 1ZU0A 2O7IA 3LUYA 4GQOA 2P1SA 4LA9A 3SEXA 3V5AA 1EZPA 3Q26A 1BKAA 1ZTYA 1PB7A 2H4IA 1QUJA 2PYYA 2QS3A 3T66A 3TFLA 2WKYA 5J1DA 1MH4A 4ZDMA 1JQFA 1PBQA 4OWDA 4YKKA 5DEXA 5KDTA 1O63A 1H44A 4JSOA 4TLMB 4F31B 1VFDA 2KLFA 2XXYA 3FGSA 4YB5A 1NNPA 3A09A 3KZGA 3VLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP6 A;  1NH7 A;  2DS9 A;  1JNF A;  2DWA A;  4GWO A;  2HZK A;  5CRY A;  4ELO A;  5I59 A;  1N0T A;  4KYS A;  2GHB A;  3FJM A;  3CI8 A;  3CG1 A;  3QSL A;  4YZZ A;  2F5X A;  1II5 A;  5TPA B;  3I5O A;  1FCK A;  4U21 A;  4JB7 A;  3UA8 A;  3LSF B;  3IOR A;  1B2H A;  1RKM A;  3D4C A;  4FIM A;  2ALU A;  4YKP A;  5IKB A;  1FQE A;  3HST A;  3UN6 A;  3C4M A;  1I6B A;  1IXH A;  1MQH A;  1PDA A;  3IO6 A;  3IO4 A;  4RNS A;  5EHM A;  5ITP A;  5HBC A;  5H8N B;  1IIW A;  2XXH A;  3R26 A;  4C0R A;  1Z7M E;  3RQT A;  3R6U A;  4AB5 A;  4LQ5 A;  4G4P A;  5I2K B;  3E13 X;  1Y1M A;  5H8S A;  3V83 A;  2ZYM A;  2THI A;  3IK6 B;  3MP1 A;  1FTL A;  4ONY A;  1TFD A;  4F3S A;  1MS7 A;  3KN3 A;  1USY E;  3MUQ A;  3O9P A;  2W7Y A;  4IO5 A;  4NF4 A;  1XT8 A;  1XHY A;  4DCY A;  4O3B A;  3RN8 A;  1ANF A;  2AL4 A;  3BBR A;  3FXU A;  4RK2 A;  4H67 A;  4TOZ A;  3IB2 A;  4U4X A;  4H5G A;  5DTB A;  2AL5 A;  4OFJ A;  4ECF A;  1SDX A;  2H9B A;  2VOZ A;  3DP4 A;  4Z0I A;  4R9F A;  2DWJ A;  1URD A;  2FNC A;  2RKM A;  3ILU B;  3JV9 A;  3OD7 A;  4P11 A;  5H8Q A;  2RC7 A;  4F2Q A;  2Q2A A;  4RPO A;  4F2O A;  3TCG A;  5CMK A;  1XC1 A;  2DQV A;  2HAV A;  3O66 A;  4FEC A;  1R1N A;  2O6A A;  2VGQ A;  2B65 A;  3N6T A;  4FEB A;  2I0C A;  1SI1 A;  1Y3N A;  5AA1 A;  3RNN A;  3V8X B;  1B5H A;  1I6Q A;  3ECR A;  1NNT A;  3ZSF A;  2DXY A;  1N04 A;  2Z23 A;  4H6D A;  4DDD A;  3BKI B;  1MM7 A;  4QFL A;  2F78 A;  1POT A;  2I4C A;  1IZ1 A;  1MXV A;  3VV5 A;  2Y7W A;  4BDM A;  1BLF A;  1FQD A;  1RYX A;  1SVX B;  1ZLQ A;  3EHS A;  3FZV A;  3IL1 B;  4LUB A;  5DVI A;  5FTI A;  4MFI A;  2NVU B;  3TTK A;  5CC2 A;  1LCF A;  4I62 A;  4JXI A;  2XHD A;  1R9L A;  3TDJ A;  5H8F A;  4RA1 A;  3HPI A;  4E0X A;  4NF5 B;  4R75 A;  2O84 X;  3KFM A;  4U1Z A;  2Q8J A;  3B6W A;  3IJX B;  3QUJ A;  4YMA A;  3C33 A;  5F1Q A;  5I56 A;  3FV2 A;  5BUU A;  4X1B A;  3ZS6 A;  1MPD A;  1A99 A;  1MY0 A;  3LR1 A;  2NOO A;  4N6P A;  2FA7 A;  4KQP A;  3FAS A;  3OEL A;  3TCF A;  1PEB A;  4JWO A;  4JWX A;  1NNF A;  2PT2 A;  2QS4 A;  3IB0 A;  3M3F A;  4WKM A;  2F34 A;  1SQY A;  2PBW A;  1LAG E;  3K0V A;  3K6W A;  3UK4 A;  4KD5 A;  3IX1 A;  4IGR A;  4EXK A;  3I3V A;  3C36 A;  3GLB A;  4JBZ A;  4YMB A;  1N76 A;  3PV0 E;  2QS2 A;  5ISU A;  3UOR A;  3K6U A;  1VE4 A;  1Y9U A;  3TEP A;  3D4G A;  4YAH X;  3QXM A;  4H65 A;  5AA2 B;  1UTH A;  2REJ A;  3HV1 A;  5CMC A;  4ZEK A;  3T96 B;  2REG A;  1FTJ A;  3OEM A;  4IO4 A;  2R71 A;  3FVK A;  3M3L A;  5AA4 A;  4PE5 B;  1M5F A;  4EDP A;  4X48 A;  5CMM A;  1ZBM A;  2P2A A;  1DPE A;  2XXX A;  3G3F A;  2UVH A;  3K1N A;  3L6G A;  2V25 A;  4FOR A;  2NUV A;  1Y20 A;  1P1W A;  3Q25 A;  2A5S A;  2GH9 A;  2Q89 A;  3KEI A;  1GV8 A;  1N7X A;  4F39 A;  4ZZE A;  2ZXT A;  3O29 A;  1D3K A;  4R6Y A;  1FTK A;  3H6U A;  5I57 B;  2ONS A;  4PFU A;  3MZ9 A;  4ELQ A;  1IIT A;  3FIR A;  5KCJ A;  1TT1 A;  1YCJ A;  5H8F B;  2ESN A;  2V93 A;  4F1Y A;  2VD3 A;  3PUW E;  2AYS A;  5JTY A;  1IXI A;  1URS A;  2Y7K A;  3H6T A;  3W9V A;  2I58 A;  3HHF A;  2I48 A;  4MLQ A;  1M5C A;  3G3H A;  3SET A;  1UIU A;  1UTB B;  1LFH A;  3G3J A;  2XXI A;  4DZ1 A;  5ITO A;  1SW2 A;  2Y7R A;  2OLB A;  4OQO A;  2V3U A;  2V3Q A;  1FQC A;  1QUK A;  5CM6 A;  1Y4T A;  3C31 A;  4PQJ A;  3Q27 A;  1B9J A;  2Z22 A;  1R6Z A;  4EF1 A;  1B5I A;  4U1O A;  3RTW B;  1QUI A;  3M8U A;  2UYE A;  3KG2 A;  3F11 A;  3O28 A;  1VFE A;  1B40 A;  2F97 A;  2DE2 A;  2H99 A;  3BFT A;  4G8N A;  4I9D A;  3FJ7 A;  5HM4 B;  1AOV A;  3G3I A;  2DYX A;  2DVC A;  4XIG Q;  1YTV A;  2R6G E;  4ELR A;  2UYF A;  1MQJ A;  2F6P A;  1GTK A;  3M3K A;  4H0W A;  2V84 A;  4X9T A;  5AA3 A;  4DXU A;  3MW0 A;  3VVE A;  3MWB A;  3PD8 A;  3VLV A;  3ILT B;  3UP9 A;  4WED A;  1FQB A;  3GBB A;  3IB1 A;  4TLL B;  3SDF A;  4MBP A;  1D9V A;  3QAX A;  2DP8 A;  1B0L A;  5AA2 D;  4HW8 A;  3PMV A;  1B7Z A;  2ZYN A;  2Q88 A;  3LSL A;  3C32 A;  4PFW A;  4RXL A;  3U94 A;  4EQ7 A;  1PB9 A;  3O6H A;  1LAF E;  4F3P A;  3KOS A;  1R9Q A;  4NF6 B;  1GR2 A;  1B6H A;  1DMB A;  1SYI A;  3MPL A;  1A55 A;  1B0H A;  1N3X A;  2DSF A;  1L5T A;  3R7X A;  3GBA A;  3TQL A;  1H45 A;  3T9X B;  4R73 A;  1OQG A;  1JW4 A;  1CB6 A;  2HXW A;  5TPA A;  3TPA A;  4ESW A;  1B32 A;  5I56 B;  3MJN A;  4QSD A;  3QUF A;  4OTE A;  3P7I A;  2HEU A;  1MXU A;  4QFN A;  3MAM A;  1Y3P A;  1QKB A;  5LOM A;  5B7D A;  3FD3 A;  1Z7N E;  3A3U A;  1MDQ A;  2P0S A;  5FHO A;  5AA2 A;  2Z8E A;  1ATG A;  3KJ7 A;  3PU5 A;  4BDR A;  2GFE A;  1MY2 A;  4OER A;  3LSW A;  4NF8 A;  3KJT A;  4ISU A;  2UVG A;  2XXR A;  3FV1 A;  1B3H A;  4EUO A;  2CZL A;  4LAT A;  4R2B A;  4KR5 A;  1NL5 A;  5DVF A;  5EYF A;  3RY3 A;  3TQW A;  3TTR A;  3IAZ A;  3FXR A;  3KOT A;  2V3T A;  1MQG A;  4YKJ A;  1MXW A;  1N7W A;  3PPP A;  4GXS B;  2Q2C A;  3C35 A;  2GRV A;  2M8C A;  2H98 A;  1T0K A;  4XTC Q;  2IEE A;  3VDF A;  2XXW A;  3CG3 A;  4MF3 A;  4QFO A;  4EXL A;  1LCT A;  4OHN A;  2PMS A;  4K3F A;  1AH5 A;  1D9Y A;  1B05 A;  2ONR A;  3G3G A;  1JW5 A;  1M5B A;  3MVY A;  4OES A;  4R6H A;  1LAX A;  4EQ9 A;  4JDF A;  3RGY A;  3FVN A;  3MQ9 A;  1US5 A;  4O3C A;  2UXA A;  2I4B A;  5DEX B;  2ANJ A;  2HCA A;  2OK2 A;  3FJG A;  1SW5 A;  2I49 A;  3ODB A;  1PBP A;  4OVJ A;  4THI A;  1XS5 A;  4WXJ A;  3SEY A;  1S7Y A;  5I84 A;  3CVG A;  3S9N C;  4I1D A;  3S2V A;  2F8D A;  3TCH A;  4H5F A;  3UGW A;  4F1U A;  2BJJ X;  5IAI A;  5B70 A;  3C9H A;  1ZKB A;  4NE4 A;  3PGF A;  5L9S A;  4XXU A;  2HZL A;  4GL0 A;  4IGT A;  2CMO A;  4EQB A;  2PT1 A;  3T22 A;  4NTL A;  4POW A;  2O1L A;  2ZNS A;  3N26 A;  3PPN A;  4OMB A;  3EHT A;  3SKP A;  3E3K A;  3DLN A;  1XVY A;  1ZMG A;  1B3G A;  4NF5 A;  5I2N B;  4NWC A;  3U92 A;  1MPB A;  1B3E A;  1MRP A;  4ZEI A;  1USY H;  3EPE A;  3K01 A;  2HQ0 A;  4OYV A;  3OEN A;  3H6W A;  3FVO A;  3LBS A;  1EU8 A;  2UVI A;  3T93 B;  5K2X A;  3HCQ A;  2YPN A;  1FW0 A;  3PMW A;  2ZYO A;  5DT6 A;  4KYE A;  2Y84 A;  2F7B A;  4LVQ A;  5CMB A;  5L9M A;  5F7V A;  1IXG A;  3PPR A;  1LB8 A;  1SYH A;  1H76 A;  2ONK E;  2X26 A;  3C34 A;  4IO2 A;  1H43 A;  4HCY A;  4M1V A;  4PFT A;  1HSJ A;  4YU0 A;  5L9O A;  1FQF A;  2ABH A;  3TKD A;  3RLF E;  3L6H A;  2QRY A;  3K00 A;  5TP9 B;  1Y3Q A;  3B7D A;  3DP8 A;  1DSN A;  1LGB C;  3E4R A;  1O7T A;  2D5W A;  3T9H B;  4X1D A;  4IY6 A;  3G3K A;  1MG1 A;  3GXA A;  5FHM A;  1S9T A;  1ZIU A;  4OZ9 A;  4LQ2 A;  1BIY A;  1DPP A;  4NMY A;  3G7W A;  4HTG A;  1TWY A;  3SES A;  4POX A;  3H06 B;  4TQU Q;  2I3V A;  4QRZ A;  4ZZA A;  5JEI A;  1XVX A;  1I6A A;  2IA4 A;  4R72 A;  3S9L C;  2Y7I A;  1HSL A;  3VFJ A;  3WAF A;  3OXN A;  2RC9 A;  3PUV E;  4ND9 A;  5I58 A;  3MZB A;  4DE8 A;  5JTY B;  3K4U A;  2DE4 A;  4Q8R A;  3CR9 A;  1F9B A;  3MP8 A;  3PD9 A;  4YB7 A;  2RCA A;  2DXR A;  4G68 C;  3PMX A;  1P1U A;  1WOD A;  1QKA A;  1B52 A;  2QJE A;  4H8I A;  4LZ7 A;  2QL3 A;  2XD2 A;  3LSX A;  2HAU A;  2UVJ A;  1B51 A;  1VR5 A;  4DIG A;  1BTJ A;  1UIV A;  3U93 A;  1WVJ A;  1MQD A;  2QS1 A;  4FJP A;  3DEL B;  4HCW A;  2DE3 A;  1QUL A;  4LZ5 A;  3VE1 B;  3W15 C;  3O6I A;  4U2R A;  4GIZ A;  1KWH A;  1SI0 A;  1A8E A;  2OZZ A;  1PB8 A;  2PVU A;  1B46 A;  1UQW A;  3ZKK A;  2XXP A;  5A5X A;  2OWS A;  2LAO A;  1O64 A;  2I6E A;  4ZE9 A;  4XKQ A;  4QSE A;  5KDT B;  4NF4 B;  4BDO A;  3PUY E;  2F7C A;  1MY4 A;  1SW1 A;  4RY1 A;  2B3F A;  1N3W A;  1VSO A;  3KSJ A;  4IO7 A;  4ZS9 A;  3JZJ A;  4F3G A;  2PX1 A;  2RF1 A;  1YPN A;  4AQ4 A;  1EH3 A;  1AIV A;  3T9V A;  3TTN A;  3CSG A;  4N13 A;  3CIJ A;  1JW1 A;  2Z8D A;  1EZO A;  1OQH A;  4R9G A;  2G29 A;  4RK9 A;  4F3B A;  1MY1 A;  3HHG A;  3Q28 A;  4MH5 A;  2X7Q A;  2XX8 A;  4ZEB A;  2O7U A;  2NXO A;  4KYD A;  1LFI A;  2HFB A;  4IB2 A;  4OFL A;  4MLV A;  1B1H A;  2A5T B;  4ZE8 A;  3FAT A;  3THI A;  3OEK A;  2D3I A;  2RCB A;  4JWY A;  4KFQ A;  3O6G A;  5ICT A;  2DOJ A;  4NF6 A;  1B5J A;  4XKR A;  4PFY A;  1OLA A;  3VXC A;  3N94 A;  1Y1Z A;  2QMX A;  2QPQ A;  2ZMB A;  3E9X A;  3GZG A;  4KCC A;  2OJT A;  3RT6 B;  3TTL A;  1AMF A;  1MPC A;  2ZNT A;  3Q29 A;  1LLS A;  4ZED A;  1M5E A;  2O1M A;  1MH3 A;  1DTG A;  3FXQ A;  2H25 A;  1JEU A;  1GGG A;  3OO6 A;  4G8M A;  4DCX A;  1EZ9 A;  2G93 A;  1NFT A;  4G8H A;  2O69 A;  4Q0C A;  3EQ1 A;  2ZNU A;  3OSR A;  3RUM A;  1LFG A;  3OOA A;  4GXA A;  4XKN A;  3QK6 A;  4YIC A;  1B3F A;  1IXC A;  5H8H A;  4ESX A;  1MY3 A;  3TYH A;  1HSE A;  4Q30 B;  3PPO A;  2XXT A;  2XX9 A;  3EHU A;  4YKI A;  2F7A A;  4G2Z A;  3PUZ E;  3I6V A;  5K2Y A;  5TP9 A;  1SW4 A;  4GRK A;  3VXB A;  1MDP 1;  1GVC A;  4UAC A;  4DLD A;  5ICQ A;  3B6T A;  1P99 A;  1NNK A;  3CFX A;  4IY5 A;  3KN8 A;  4FED A;  3K2D A;  5TU0 A;  1B4H A;  4UA8 A;  5H8H B;  3N5L A;  4BDQ A;  1NMU A;  2ZYK A;  1IEJ A;  3IOV A;  1P1N A;  1LBB A;  4R2F A;  4BDN A;  4DXC A;  5I59 B;  5I58 B;  1MM6 A;  2I0B A;  2OWT A;  2OCU A;  3HN0 A;  3TEL A;  1WDN A;  2X7P A;  3A3C A;  4E0W A;  1AL3 A;  1UTB A;  4M4G A;  4F1V A;  3OO8 A;  5H8Q B;  1TFA A;  3OO7 A;  5DVJ A;  4OEV A;  3JYR A;  5BWJ A;  3PUX E;  1ELJ A;  2F36 A;  1NKX A;  4LON B;  4NWD A;  2RC8 A;  3W9W A;  3IOT A;  4NED A;  4OET A;  1I69 A;  5H8N A;  1OIB A;  3HO7 A;  5EHS A;  2I3W A;  3CFL A;  4G68 A;  4YB6 A;  2VHA A;  1URG A;  5I2K A;  1PC3 A;  2O51 A;  3KBR A;  4LP2 B;  2YLN A;  3IOW A;  3OSQ A;  3RTF B;  1OVB A;  1B7H A;  3EN3 A;  4GVO A;  4U22 A;  4C1T A;  1A40 A;  2NWJ A;  2XXV A;  1IUD A;  5AA4 B;  1MXY A;  1LBC A;  3O2A A;  2RIN A;  3TOD A;  3MPK A;  3QIM A;  3H03 A;  2O68 A;  3K6V A;  4RYA A;  4GF8 A;  3EF7 A;  3TMG A;  2DWH A;  3DM0 A;  3VVF A;  5AE4 A;  4JSD A;  4P0G A;  4F29 A;  3U72 A;  2H5Y A;  1A7L A;  4KCD A;  5CBS A;  3KGC A;  3T9U A;  3TAJ A;  4KHZ E;  3CRB A;  2D21 A;  3MZ1 A;  3SEU A;  3H7M A;  4U23 A;  4FAT A;  1JET A;  2OBG A;  1Q35 A;  3OO9 A;  3UIF A;  3WAE A;  1D4N A;  2VP1 A;  1OVT A;  3K1M A;  2F35 A;  4KPT A;  4WEP A;  4ELP A;  1P1O A;  4ZEF A;  1Q1K A;  3IOU A;  1M5D A;  2E1S A;  3IR1 A;  2B3B A;  3K1P A;  3TUS A;  1FTO A;  3KN7 A;  3QYT A;  3K02 A;  3KSX A;  1B58 A;  4BDL A;  4BLA A;  3S9M C;  1POY 1;  3O97 A;  4RJZ A;  4GL8 A;  4KI0 E;  1A8F A;  1J1N A;  1FQA A;  4OXV A;  3U1O A;  4DXB A;  1QW0 A;  3H3G A;  1SD3 A;  3PPQ A;  4QHQ A;  4Q5T A;  2Z8F A;  1DOT A;  1BP5 A;  4QSC A;  3MC2 A;  2AIX A;  1JEV A;  3N6U A;  1NH8 A;  4I8C A;  5DYH A;  4QFK A;  4C1U A;  4OEN A;  3SEV A;  4F19 A;  2E0S A;  5KCJ B;  1JVX A;  3FVG A;  4R6K A;  4FAJ A;  4OEU A;  4HS7 A;  3MVW A;  5ELV A;  5A5X B;  5CBR A;  2XXQ A;  4LZ8 A;  5KZT A;  4IO6 A;  4N07 A;  3USD A;  5I57 A;  1TXF A;  3OMB A;  3B6Q A;  1FTM A;  4G68 B;  4IO3 A;  1ZJL A;  2VD2 A;  1MXZ A;  1P1Q A;  1OLC A;  1QJM A;  2XXU A;  3AXF A;  2XX7 A;  3MVZ A;  1CE2 A;  2DVZ A;  1OMP A;  3ZKL A;  2QMW A;  4AB6 A;  1MXX A;  1MQI A;  3MVX A;  4ZEC A;  3TTM A;  3RPW A;  4PP0 A;  4QF9 A;  1LAH E;  1N84 A;  1A54 A;  2YJP A;  3CSB A;  4H1X A;  4GFR A;  4O3A A;  4PET A;  4F18 A;  1UTH B;  5FTH A;  4Z7E A;  1IQ7 A;  4EF2 A;  1SBP A;  4QFP A;  1YAE A;  5FHN A;  1B3L A;  5JK4 A;  4GD5 A;  4NF8 B;  3LC8 A;  1Y4C A;  3CFZ A;  3MBP A;  4R74 A;  1US4 A;  1DTZ A;  2R9J A;  2Q9T A;  5HPQ A;  4P0I A;  3SEW A;  5M2V A;  2A5T A;  5I2N A;  4F22 A;  4U4S A;  3VLU A;  1H3D A;  2XD3 A;  4GOT A;  4FE8 A;  2F6G A;  4L17 A;  3FUZ A;  3RT8 A;  3SER A;  4GLI A;  3VVD A;  3MP6 A;  2QSX A;  2Y7P A;  4OFO A;  3U8Q A;  5L8D A;  4H8J A;  1RYO A;  1LST A;  1S50 A;  3S4U A;  3TZA A;  3V89 B;  3H4Z A;  3BFU A;  2DWI A;  3H6V A;  4RPN A;  4XKP A;  3S9E A;  1B4Z A;  1LB9 A;  1JVY A;  3IJO B;  1QVS A;  3ONM A;  1B1X A;  1XOC A;  1B7U A;  2FYI A;  3K6X A;  4G77 A;  5CI5 A;  2GHA A;  1ZU0 A;  2O7I A;  3LUY A;  4GQO A;  2P1S A;  4LA9 A;  3SEX A;  3V5A A;  1EZP A;  3Q26 A;  1BKA A;  1ZTY A;  1PB7 A;  2H4I A;  1QUJ A;  2PYY A;  2QS3 A;  3T66 A;  3TFL A;  2WKY A;  5J1D A;  1MH4 A;  4ZDM A;  1JQF A;  1PBQ A;  4OWD A;  4YKK A;  5DEX A;  5KDT A;  1O63 A;  1H44 A;  4JSO A;  4TLM B;  4F31 B;  1VFD A;  2KLF A;  2XXY A;  3FGS A;  4YB5 A;  1NNP A;  3A09 A;  3KZG A;  3VLW A; 
#chains in the Genus database with same CATH topology
 3DP6 A;  2DS9 A;  2HZK A;  4KYS A;  5IZ3 B;  1II5 A;  3RPL A;  1FCK A;  4FIM A;  1RKM A;  4OVT A;  4RNS A;  4OAN A;  5EHM A;  3LUZ A;  5H8N B;  1IIW A;  4G4P A;  3E13 X;  3V83 A;  4PGN A;  3MP1 A;  1IMA A;  1FTL A;  1TFD A;  4F3S A;  2W7Y A;  4DCY A;  3RN8 A;  5DTB A;  4OFJ A;  4ECF A;  2RC7 A;  4RPO A;  4F2O A;  3O66 A;  2HAV A;  2CEY A;  3V8X B;  1SI1 A;  1Y3N A;  1B5H A;  1NNT A;  3ZSF A;  1N04 A;  4QFL A;  2I4C A;  1POT A;  1MXV A;  1BLF A;  1FQD A;  1SVX B;  3IL1 B;  1ZLQ A;  5DVI A;  5H8F A;  2XHD A;  4RA1 A;  4N8Y A;  3B6W A;  3C33 A;  5I56 A;  5BUU A;  4X1B A;  4N6P A;  2FA7 A;  2QS4 A;  3M3F A;  1SQY A;  2PBW A;  4KD5 A;  4EXK A;  3GLB A;  1N76 A;  5ISU A;  1VE4 A;  3D4G A;  2B4L A;  1FPG A;  2REJ A;  3HV1 A;  2VPO A;  2REG A;  1FTJ A;  2CZK A;  4IO4 A;  5AA4 A;  4EDP A;  4X48 A;  1ZBM A;  3G3F A;  3K1N A;  3L6G A;  4HXV A;  4FOR A;  2V25 A;  3RTF B;  2NUV A;  1N7X A;  4P3L A;  1D3K A;  1FTK A;  3H6U A;  1YCJ A;  2ESN A;  1IXI A;  3SET A;  4MLQ A;  1LFH A;  1UIU A;  1UTB B;  5ITO A;  2OLB A;  4OQO A;  2V3U A;  1FQC A;  4LN5 A;  1B9J A;  4U1O A;  3RTW B;  3M8U A;  3KG2 A;  5HM4 B;  3FJ7 A;  3G3I A;  4ELR A;  1GTK A;  3M3K A;  2V84 A;  4DXU A;  4HE0 A;  5IGA A;  3IB1 A;  4TLL B;  4MBP A;  1D9V A;  2ZYN A;  3C32 A;  1PB9 A;  3O6H A;  2FHY A;  2HHM A;  1NV4 A;  3KOS A;  4NF6 B;  1IMC A;  1DMB A;  1A55 A;  1L5T A;  3R7X A;  1FBF A;  2HXW A;  5EYH A;  5TPA A;  3TPA A;  2CZH A;  3P7I A;  2HEU A;  1MXU A;  1Y3P A;  1QKB A;  2GFE A;  1MY2 A;  4ISU A;  3FV1 A;  1FSA A;  4LAT A;  1NL5 A;  3TTR A;  2V3T A;  4YKJ A;  4GXS B;  2GRV A;  1T0K A;  3VDF A;  2PMS A;  4OES A;  2ONR A;  1US5 A;  4O3C A;  4GWZ A;  2I4B A;  2HCA A;  1XS5 A;  4I1D A;  3S2V A;  4H5F A;  3UGW A;  3C9H A;  4NE4 A;  2HZL A;  1NV1 A;  4POW A;  1EYJ A;  1LBY A;  3PPN A;  3EHT A;  1XVY A;  5I2N B;  1B3G A;  4GWU A;  1B3E A;  1MRP A;  3OEN A;  2UVI A;  2PFZ A;  4O7I A;  2YPN A;  2F7B A;  1IXG A;  3PPR A;  4M1V A;  4PFT A;  2ABH A;  2B4M A;  3L6H A;  3K00 A;  1Y3Q A;  1LGB C;  4X1D A;  5FHM A;  4JVI A;  1S9T A;  3G7W A;  4POX A;  3S9L C;  2ZZX A;  4I3E A;  4ND9 A;  3MZB A;  5ET5 A;  4MHF A;  2DXR A;  4G68 C;  3KBZ A;  3RPL B;  3KC0 A;  1BTJ A;  1WVJ A;  3DEL B;  3O6I A;  1KWH A;  2OZZ A;  5A5X A;  2XXP A;  4PF6 A;  4PBH A;  1SW1 A;  1N3W A;  1VSO A;  3D1R A;  2RF1 A;  1EH3 A;  3CSG A;  2Z8D A;  3E78 A;  1OQH A;  4OA4 A;  1NV6 A;  1MY1 A;  4OFL A;  2A5T B;  3OEK A;  2DOJ A;  1Y1Z A;  2QPQ A;  1MPC A;  1LLS A;  4ZED A;  1M5E A;  1MH3 A;  3FXQ A;  1JEU A;  2GQ1 A;  3OSR A;  3OOA A;  4GXA A;  3QK6 A;  1B3F A;  3TYH A;  2XXT A;  4G2Z A;  3VXB A;  3I6V A;  5K2Y A;  1SW4 A;  1IMF A;  1MDP 1;  4FED A;  5TU0 A;  3K2D A;  1B4H A;  3N5L A;  1NMU A;  2ZYK A;  1IEJ A;  3CHG A;  5I59 B;  2OWT A;  2OCU A;  3HN0 A;  3A3C A;  1AL3 A;  4F1V A;  1FPI A;  1LBZ A;  3OO7 A;  5BWJ A;  3PUX E;  4LON B;  4NWD A;  3IOT A;  1I69 A;  2I3W A;  2XWO A;  4YB6 A;  1PC3 A;  3KBR A;  4I3Y A;  1LBW A;  5IM2 A;  1B7H A;  1FPL A;  2Q8M A;  2CEX A;  1A40 A;  4MX6 A;  1IUD A;  3LV0 A;  3TOD A;  3MPK A;  2O68 A;  4RYA A;  3TMG A;  5AE4 A;  4JSD A;  5EQ8 A;  3CRB A;  3MZ1 A;  4U23 A;  2OBG A;  3UIF A;  1M5D A;  4XF5 A;  3IR1 A;  3KN7 A;  3QYT A;  1POY 1;  1A8F A;  4OXV A;  1DOT A;  1BP5 A;  5DYH A;  1XI6 A;  3N6U A;  4C1U A;  3PTY A;  4NF0 A;  3B6Q A;  4G68 B;  4IO3 A;  1ZJL A;  1P1Q A;  1OLC A;  2XX7 A;  1OMP A;  3MVX A;  3RPW A;  1LAH E;  1UTH B;  1IQ7 A;  5FHN A;  1YAE A;  4NF8 B;  1DTZ A;  2KR0 A;  3VLU A;  4L17 A;  1FPF A;  4H8J A;  3BFU A;  2DWI A;  1IMD A;  1B4Z A;  4G77 A;  1B7U A;  4JVD A;  3V5A A;  1BKA A;  1ZTY A;  4N17 A;  4OVR A;  1SPI A;  2WKY A;  4HE2 A;  4TLM B;  2KLF A;  3A09 A;  3VLW A;  4GWO A;  5CRY A;  3FJM A;  3CI8 A;  5TPA B;  2F5X A;  4JB7 A;  3LSF B;  3D4C A;  2ALU A;  3HST A;  5EQ9 A;  3C4M A;  3UN6 A;  3R26 A;  1Z7M E;  4AB5 A;  4LQ5 A;  2ZYM A;  2BJI A;  3KN3 A;  1USY E;  1ANF A;  3BBR A;  4RK2 A;  3DP4 A;  4R9F A;  1URD A;  4P11 A;  5H8Q A;  4F2Q A;  2DQV A;  4FEC A;  2VGQ A;  2B65 A;  3N6T A;  4FEB A;  3RNN A;  4P8B A;  1I6Q A;  3ECR A;  4N81 A;  2Z23 A;  1MM7 A;  1IZ1 A;  3VV5 A;  2Y7W A;  1DBZ A;  3TTK A;  4MFI A;  3MST A;  3HPI A;  4E0X A;  3KFM A;  4U1Z A;  2Q8J A;  3QUJ A;  3FV2 A;  1LBX A;  3FAS A;  4JWO A;  4WKM A;  3K0V A;  3UK4 A;  3IX1 A;  4YMB A;  3PV0 E;  3UOR A;  1Y9U A;  4YAH X;  3QXM A;  5AA2 B;  4ZEK A;  3OEM A;  2R71 A;  4PE5 B;  1M5F A;  2UVH A;  2A5S A;  2GH9 A;  2Q89 A;  4F39 A;  4ZZE A;  1FBH A;  4PFU A;  3MZ9 A;  2V93 A;  2WYP A;  1URS A;  2Y7K A;  3HHF A;  3G3H A;  1QUK A;  5CM6 A;  3C31 A;  3Q27 A;  4EF1 A;  1QUI A;  3ROJ A;  4I9D A;  2DYX A;  4XIG Q;  4PFI A;  2UYF A;  2F6P A;  4X9T A;  5AA3 A;  3MWB A;  3VLV A;  3ILT B;  4WED A;  4MCO A;  5AA2 D;  4KXP A;  3MPL A;  1H45 A;  1KZ8 A;  4GWX A;  3MAM A;  5LOM A;  5B7D A;  1Z7N E;  2P0S A;  1ATG A;  3KJ7 A;  3KJT A;  3BIG A;  4O7M A;  4EUO A;  3IAZ A;  3KOT A;  1MQG A;  3PPP A;  2Q2C A;  2XXW A;  4QFO A;  4MF3 A;  4EXL A;  1FPD A;  1D9Y A;  1B05 A;  1K9Y A;  1JW5 A;  1M5B A;  3MVY A;  4R6H A;  3RGY A;  3MQ9 A;  2UXA A;  4OVJ A;  2OK2 A;  3SEY A;  1SW5 A;  4F1U A;  5B70 A;  1EYK A;  4EQB A;  3N26 A;  3E3K A;  3DLN A;  4MMP A;  4ZEI A;  3EPE A;  4OYV A;  1EU8 A;  5K2X A;  2Y84 A;  5LTC A;  1SYH A;  2ONK E;  2X26 A;  1H43 A;  4HCY A;  5L9O A;  1FQF A;  3RLF E;  2QRY A;  3IFC A;  3T9H B;  3DP8 A;  3E4R A;  3QMF A;  2HPG A;  1MG1 A;  4LQ2 A;  1BIY A;  3SES A;  4TQU Q;  1FBC A;  2IA4 A;  4GWY A;  2JJK A;  3VFJ A;  5FBP A;  3WAF A;  3OXN A;  4N8G A;  4DE8 A;  5I5P A;  3K4U A;  3CR9 A;  1F9B A;  4O8M A;  3MP8 A;  4YB7 A;  4NGU A;  1P1U A;  4GWS A;  1B52 A;  2QJE A;  2XD2 A;  2UVJ A;  1B51 A;  4DIG A;  5I3S A;  3U93 A;  4HCW A;  3W15 C;  1NUZ A;  4LZ5 A;  1QUL A;  1SI0 A;  2PVU A;  2OWS A;  2LAO A;  1IME A;  4QSE A;  2B3F A;  3KSJ A;  4AQ4 A;  3TTN A;  4PDH A;  3HHG A;  1LFI A;  4MLV A;  5ET7 A;  3A29 A;  2D3I A;  4P9K A;  2F3B A;  1OLA A;  5DW8 A;  3N94 A;  2ZMB A;  4KCC A;  3B50 A;  1AMF A;  3Q29 A;  1D9Q A;  1DTG A;  1GGG A;  2G93 A;  4G8H A;  3RUM A;  2ZNU A;  4UAB A;  4GWW A;  1IXC A;  4ESX A;  1MY3 A;  4Q30 B;  5TP9 A;  1GVC A;  4UAC A;  1FPK A;  3HFU A;  1P99 A;  5H8H B;  4P47 A;  1P1N A;  4DXC A;  1MM6 A;  4M4G A;  1UTB A;  1TFA A;  4OEV A;  2F36 A;  2RC8 A;  3W9W A;  5LDZ A;  5H8N A;  1OIB A;  3HO7 A;  5IZ1 A;  5EHS A;  3CFL A;  2CZI A;  2VHA A;  4LP2 B;  3OSQ A;  3EN3 A;  4GVO A;  4C1T A;  2Y5L A;  1LBC A;  3QIM A;  3H03 A;  3K6V A;  3VVF A;  1JP4 A;  4NG7 A;  4F29 A;  4KHZ E;  4N6D A;  3SEU A;  1Q35 A;  3WAE A;  2VP1 A;  3K1M A;  2F35 A;  1P1O A;  3IOU A;  2B3B A;  3K1P A;  1NV3 A;  4P1E A;  2XWK A;  3O97 A;  4RJZ A;  4PGP A;  3H3G A;  1SD3 A;  3PPQ A;  4QHQ A;  5A5L A;  2Z8F A;  4QSC A;  4MNP A;  1JEV A;  1FBG A;  4OEN A;  1JVX A;  3FVG A;  4R6K A;  1IMB A;  4OEU A;  5CBR A;  2XXQ A;  3USD A;  1TXF A;  1FTM A;  3AXF A;  1QJM A;  3MVZ A;  1CE2 A;  2QMW A;  4AB6 A;  1MQI A;  1FTA A;  4ZEC A;  4PP0 A;  4QF9 A;  1G0H A;  1N84 A;  1A54 A;  2YJP A;  4F18 A;  2WYK A;  5FTH A;  2FIE A;  1B3L A;  5JK4 A;  1US4 A;  3SEW A;  2WBB A;  4U4S A;  5ET8 A;  2XD3 A;  4GOT A;  3MP6 A;  1LST A;  4RPN A;  3H6V A;  1JVY A;  5H8Q B;  4PC9 A;  1XOC A;  1ZU0 A;  4GQO A;  1QUJ A;  2PYY A;  3TFL A;  5J1D A;  1JQF A;  1PBQ A;  1H44 A;  1VFD A;  4YB5 A;  1AWB A;  3ISP A;  1NH7 A;  1JNF A;  5I59 A;  1N0T A;  2GHB A;  5EYG A;  3CG1 A;  4U21 A;  4YKP A;  1B2H A;  1FQE A;  1I6B A;  3IO6 A;  1PDA A;  3IO4 A;  5HBC A;  5I2K B;  5H8S A;  4ONY A;  2THI A;  1FBE A;  3B8B A;  1FPJ A;  3MUQ A;  4NF4 A;  1XHY A;  2AL4 A;  3FXU A;  4TOZ A;  3IB2 A;  4U4X A;  2AL5 A;  1SDX A;  2H9B A;  4Z0I A;  1RDY A;  2RKM A;  2FNC A;  3OD7 A;  2P3V A;  5AA1 A;  4DDD A;  4H6D A;  2F78 A;  4N91 A;  4MAG A;  4BDM A;  3FZV A;  1RYX A;  5ITP A;  4LUB A;  5FTI A;  4P1L A;  5CC2 A;  1LCF A;  4I62 A;  4JXI A;  1R9L A;  4NF5 B;  4R75 A;  2O84 X;  3IJX B;  5F1Q A;  3ZS6 A;  1A99 A;  1MY0 A;  4KQP A;  3TCF A;  1PEB A;  4JWX A;  1NNF A;  2PT2 A;  2F34 A;  1LAG E;  4IGR A;  4N15 A;  3K6U A;  3TEP A;  3FVK A;  5CMM A;  2XXX A;  1P1W A;  1GV8 A;  2ZXT A;  4R6Y A;  4ELQ A;  4PDD A;  1TT1 A;  2QVR A;  4F1Y A;  3PUW E;  2AYS A;  3H6T A;  3W9V A;  1M5C A;  2XXI A;  1SW2 A;  2WX9 A;  5IZZ A;  4PQJ A;  1R6Z A;  1NV5 A;  4XFE A;  2UYE A;  3MYU A;  3F11 A;  4IR8 A;  1B40 A;  2F97 A;  2DE2 A;  3BFT A;  1AOV A;  2DVC A;  1YTV A;  1MQJ A;  4GX3 A;  3VVE A;  3PD8 A;  2P3N A;  3UP9 A;  1FQB A;  3GBB A;  3QAX A;  2DP8 A;  1B0L A;  4HW8 A;  3PMV A;  1B7Z A;  4PFW A;  3U94 A;  1LAF E;  4PCD A;  1B0H A;  3GBA A;  3TQL A;  1OQG A;  2Y5K A;  5EQA A;  1KA1 A;  5I56 B;  3MJN A;  4OTE A;  1FPE A;  3FD3 A;  1QGX A;  3A3U A;  1MDQ A;  5FHO A;  2Z8E A;  4BDR A;  3PU5 A;  3LSW A;  2UVG A;  4X8R A;  2XXR A;  2CZL A;  4DXB A;  5DVF A;  4KR5 A;  3RY3 A;  3FXR A;  1RDZ A;  1N7W A;  4XTC Q;  3CG3 A;  3T0J A;  1LCT A;  4OHN A;  4K3F A;  1AH5 A;  4NAP A;  1LAX A;  5DEX B;  2ANJ A;  3FJG A;  5ET6 A;  3S9N C;  2XWV A;  5I84 A;  3CVG A;  2F8D A;  3TCH A;  2BJJ X;  4GL0 A;  4IGT A;  2PT1 A;  4NTL A;  2O1L A;  3SKP A;  4NF5 A;  4N4U A;  1USY H;  2HQ0 A;  1NV0 A;  3LBS A;  3T93 B;  3HCQ A;  2ZYO A;  5DT6 A;  4KYE A;  5L9M A;  5F7V A;  1LB8 A;  4YU0 A;  3C34 A;  4IO2 A;  1HSJ A;  3TKD A;  1NI9 A;  2QFL A;  1O7T A;  2D5W A;  2WEF A;  1DPP A;  4HTG A;  1KA0 A;  2I3V A;  4QRZ A;  1FJ9 A;  2Y7I A;  1HSL A;  4NHB A;  5JTY B;  2DE4 A;  3PD9 A;  2RCA A;  1WOD A;  2QL3 A;  3LSX A;  2HAU A;  1MQD A;  2FIX A;  2QS1 A;  4FJP A;  3VE1 B;  5CMK A;  1NV2 A;  4GIZ A;  1B46 A;  1UQW A;  3ZKK A;  1O64 A;  2I6E A;  4XKQ A;  4BDO A;  1MY4 A;  4IO7 A;  3JZJ A;  2MKZ A;  1YPN A;  3T9V A;  4N13 A;  3CIJ A;  2XXK A;  4OVP A;  4R9G A;  2G29 A;  4ZEB A;  2XX8 A;  5KDT A;  4KYD A;  2NXO A;  4IB2 A;  4ZE8 A;  3THI A;  3FAT A;  4NX1 A;  4JWY A;  2OWZ A;  2RCB A;  4KFQ A;  3O6G A;  4PFY A;  3E9X A;  4PTK A;  2OJT A;  3RT6 B;  2ZNT A;  3EKI A;  2H25 A;  4G8M A;  1EZ9 A;  2O69 A;  3EQ1 A;  3T96 B;  5IAI A;  4XKN A;  4YIC A;  5H8H A;  1HSE A;  3PPO A;  3PUZ E;  5ICQ A;  4DLD A;  1NNK A;  4IY5 A;  3T9X B;  3KN8 A;  1G0I A;  4UA8 A;  3IOV A;  4R2F A;  1LBB A;  1EYI A;  1FJ6 A;  4FBP A;  5I58 B;  2I0B A;  2ZZV A;  5DVJ A;  3JYR A;  1RDX A;  1NKX A;  4OET A;  4G68 A;  4U22 A;  1FPB A;  2NWJ A;  3EF7 A;  2DWH A;  3DM0 A;  3FBP A;  4PF8 A;  4P0G A;  2H5Y A;  1A7L A;  3KGC A;  3H7M A;  1JET A;  3OO9 A;  1D4N A;  1OVT A;  4KPT A;  4WEP A;  2L5V A;  1Q1K A;  3TUS A;  3K02 A;  4KI0 E;  1J1N A;  1QW0 A;  4Q5T A;  1FBP A;  3MC2 A;  2AIX A;  4QFK A;  4HE1 A;  4FAJ A;  3MVW A;  5A5X B;  4LZ8 A;  5KZT A;  4IO6 A;  5I57 A;  2F3D A;  2VD2 A;  1MXZ A;  3ZKL A;  4PAK A;  2DVZ A;  3TTM A;  5IKB A;  3CSB A;  4GFR A;  4PET A;  4XEQ A;  4Z7E A;  1SBP A;  4GD5 A;  3LC8 A;  1Y4C A;  3MBP A;  4R74 A;  2Q9T A;  4H46 A;  1H3D A;  3RT8 A;  4FE8 A;  2F6G A;  1DK4 A;  4GLI A;  2VPN A;  3VVD A;  2QSX A;  2Y7P A;  5L8D A;  3V89 B;  3S4U A;  1NUX A;  3H4Z A;  3IJO B;  2FBP A;  3ONM A;  1QVS A;  1B1X A;  2QVU A;  2GHA A;  2O7I A;  4LA9 A;  1EZP A;  3Q26 A;  3T66 A;  1MH4 A;  4ZDM A;  4YKK A;  1O63 A;  4JSO A;  3FGS A;  3KZG A;  2DWA A;  5KDT B;  4ELO A;  1BK4 A;  4PAI A;  3QSL A;  4YZZ A;  3I5O A;  3UA8 A;  3IOR A;  1IXH A;  1MQH A;  4NN3 A;  2XXH A;  1K9Z A;  4C0R A;  3RQT A;  3R6U A;  1Y1M A;  3IK6 B;  1MS7 A;  3O9P A;  4IO5 A;  1XT8 A;  4O3B A;  4H67 A;  2Q74 A;  4H5G A;  4MJO A;  2VOZ A;  2DWJ A;  3ILU B;  3JV9 A;  4PFR A;  2Q2A A;  3TCG A;  1XC1 A;  1R1N A;  2O6A A;  2I0C A;  4PFB A;  2DXY A;  3BKI B;  3EHS A;  3TDJ A;  1Q9D A;  4YMA A;  1MPD A;  3LR1 A;  2NOO A;  2HXR A;  3OEL A;  3IB0 A;  4O94 A;  3K6W A;  3I3V A;  3C36 A;  4JBZ A;  4MEV A;  3GYY A;  2QS2 A;  4GX6 A;  4H65 A;  1UTH A;  5CMC A;  3M3L A;  2P2A A;  1DPE A;  4E0W A;  2NVU B;  5T3J A;  4I8C A;  1Y20 A;  3Q25 A;  3KEI A;  3O29 A;  1DCU A;  3T1B A;  5I57 B;  2ONS A;  2R8T A;  4PAF A;  1IIT A;  3FIR A;  2KQZ A;  5KCJ A;  5H8F B;  2VD3 A;  5JTY A;  2I58 A;  2I48 A;  1FBD A;  3G3J A;  2Y7R A;  5I7I A;  2V3Q A;  1Y4T A;  2Z22 A;  1B5I A;  4AS5 A;  4PBQ A;  3O28 A;  4GBW A;  1VFE A;  2H99 A;  2ZZW A;  4G8N A;  3SZP A;  2R6G E;  2PCR A;  3IFA A;  4H0W A;  3MW0 A;  3SDF A;  5F24 A;  5I2K A;  4RXL A;  3LSL A;  2Q88 A;  4EQ7 A;  4F3P A;  1R9Q A;  4QBA A;  1FRP A;  1GR2 A;  1B6H A;  1SYI A;  2DSF A;  1N3X A;  4R73 A;  1JW4 A;  1CB6 A;  4ESW A;  1B32 A;  4QSD A;  3QUF A;  4QFN A;  5AA2 A;  4OER A;  4NF8 A;  1B3H A;  5EYF A;  4R2B A;  3TQW A;  1MXW A;  2QVV A;  2XWI A;  3C35 A;  2M8C A;  2H98 A;  2IEE A;  4AS4 A;  1LEV A;  3KC1 A;  3G3G A;  4EQ9 A;  4JDF A;  3FVN A;  5ESY A;  3ODB A;  2I49 A;  4WXJ A;  1PBP A;  4THI A;  1S7Y A;  4GBV A;  1ZKB A;  3PGF A;  5L9S A;  4XXU A;  3BIH A;  2CMO A;  3T22 A;  2ZNS A;  4OMB A;  1ZMG A;  4NWC A;  3U92 A;  1MPB A;  4MIJ A;  3K01 A;  3H6W A;  3FVO A;  4H45 A;  1FW0 A;  3PMW A;  4LVQ A;  3U65 A;  5CMB A;  1H76 A;  4OVS A;  1INP A;  5TP9 B;  5EQ7 A;  3B7D A;  1DSN A;  4IY6 A;  3G3K A;  3GXA A;  3E79 A;  1ZIU A;  4OZ9 A;  4NMY A;  1TWY A;  3H06 B;  4ZZA A;  5JEI A;  1XVX A;  1I6A A;  3RYD A;  4R72 A;  2RC9 A;  3PUV E;  5I58 A;  4Q8R A;  4OVQ A;  3NOH A;  3PMX A;  2OX3 A;  1QKA A;  4LZ7 A;  4H8I A;  1VR5 A;  1UIV A;  4DI4 B;  2DE3 A;  4DZ1 A;  4U2R A;  1A8E A;  1PB8 A;  4JVC A;  1LBV A;  4ZE9 A;  4NF4 B;  3PUY E;  2F7C A;  4RY1 A;  1YZ0 A;  4F3G A;  4ZS9 A;  2PX1 A;  1YYZ A;  1AIV A;  1JW1 A;  1EZO A;  4RK9 A;  4F3B A;  3Q28 A;  4MH5 A;  2X7Q A;  2DDK A;  2O7U A;  1VDW A;  5J16 A;  2HFB A;  1B1H A;  1NUY A;  5ICT A;  4NF6 A;  1B5J A;  4XKR A;  3VXC A;  2QMX A;  3GZG A;  3TTL A;  2O1M A;  4DCX A;  3OO6 A;  2PFY A;  1NFT A;  4Q0C A;  1NV7 A;  1LFG A;  2FVZ A;  4PE3 A;  4YKI A;  2XX9 A;  3EHU A;  2F7A A;  4GRK A;  4QXD A;  2VT5 A;  2V4C A;  3B6T A;  3CFX A;  4DI3 D;  4BDQ A;  4N6K A;  4BDN A;  3TEL A;  1WDN A;  2X7P A;  1YXI A;  1CNQ A;  4NQ8 A;  3OO8 A;  1ELJ A;  4NED A;  1URG A;  2O51 A;  2YLN A;  3IOW A;  1OVB A;  2XXV A;  5AA4 B;  1MXY A;  3O2A A;  2RIN A;  4GF8 A;  3U72 A;  4KCD A;  5CBS A;  3T9U A;  3TAJ A;  2D21 A;  4MNI A;  4FAT A;  4ELP A;  4ZEF A;  2E1S A;  1FTO A;  3KSX A;  1B58 A;  4BDL A;  4BLA A;  3S9M C;  4GL8 A;  1FQA A;  3U1O A;  1NH8 A;  4F19 A;  3SEV A;  2E0S A;  4MNC A;  5KCJ B;  3FXB A;  4HS7 A;  5ELV A;  4I40 A;  4N07 A;  3OMB A;  2XXU A;  1NUW A;  1MXX A;  4H1X A;  4O3A A;  4EF2 A;  4QFP A;  2WBD A;  3CFZ A;  2R9J A;  4P0I A;  5M2V A;  2A5T A;  4F22 A;  3SER A;  3FUZ A;  4G61 A;  4OFO A;  3U8Q A;  1RYO A;  1S50 A;  3TZA A;  4XKP A;  3S9E A;  1LB9 A;  5HPQ A;  5I2N A;  5CI5 A;  2FYI A;  3K6X A;  4X04 A;  3LUY A;  4GX4 A;  3SEX A;  2P1S A;  2H4I A;  1PB7 A;  2QS3 A;  5IZ3 A;  5DEX A;  2XA5 A;  4OWD A;  4F31 B;  2XXY A;  1NNP A;  4P56 A; 
#chains in the Genus database with same CATH homology
 3DP6 A;  1NH7 A;  2DS9 A;  1JNF A;  2DWA A;  4GWO A;  2HZK A;  5CRY A;  4ELO A;  5I59 A;  1N0T A;  4KYS A;  2GHB A;  3FJM A;  3CI8 A;  3CG1 A;  3QSL A;  4YZZ A;  2F5X A;  1II5 A;  5TPA B;  3I5O A;  1FCK A;  4U21 A;  4JB7 A;  3UA8 A;  3LSF B;  3IOR A;  1B2H A;  1RKM A;  3D4C A;  4FIM A;  2ALU A;  4YKP A;  5IKB A;  1FQE A;  3HST A;  3UN6 A;  3C4M A;  1I6B A;  1IXH A;  1MQH A;  1PDA A;  3IO6 A;  3IO4 A;  4RNS A;  5EHM A;  5ITP A;  5HBC A;  5H8N B;  1IIW A;  2XXH A;  3R26 A;  4C0R A;  1Z7M E;  3RQT A;  3R6U A;  4AB5 A;  4LQ5 A;  4G4P A;  5I2K B;  3E13 X;  1Y1M A;  5H8S A;  3V83 A;  2ZYM A;  2THI A;  3IK6 B;  3MP1 A;  1FTL A;  4ONY A;  1TFD A;  4F3S A;  1MS7 A;  3KN3 A;  1USY E;  3MUQ A;  3O9P A;  2W7Y A;  4IO5 A;  4NF4 A;  1XT8 A;  1XHY A;  4DCY A;  4O3B A;  3RN8 A;  1ANF A;  2AL4 A;  3BBR A;  3FXU A;  4RK2 A;  4H67 A;  4TOZ A;  3IB2 A;  4U4X A;  4H5G A;  5DTB A;  2AL5 A;  4OFJ A;  4ECF A;  1SDX A;  2H9B A;  2VOZ A;  3DP4 A;  4Z0I A;  4R9F A;  2DWJ A;  1URD A;  2FNC A;  2RKM A;  3ILU B;  3JV9 A;  3OD7 A;  4P11 A;  5H8Q A;  2RC7 A;  4F2Q A;  2Q2A A;  4RPO A;  4F2O A;  3TCG A;  5CMK A;  1XC1 A;  2DQV A;  2HAV A;  3O66 A;  4FEC A;  1R1N A;  2O6A A;  2VGQ A;  2B65 A;  3N6T A;  4FEB A;  2I0C A;  1SI1 A;  1Y3N A;  5AA1 A;  3RNN A;  3V8X B;  1B5H A;  1I6Q A;  3ECR A;  1NNT A;  3ZSF A;  2DXY A;  1N04 A;  2Z23 A;  4H6D A;  4DDD A;  3BKI B;  1MM7 A;  4QFL A;  2F78 A;  1POT A;  2I4C A;  1IZ1 A;  1MXV A;  3VV5 A;  2Y7W A;  4BDM A;  1BLF A;  1FQD A;  1RYX A;  1SVX B;  1ZLQ A;  3EHS A;  3FZV A;  3IL1 B;  4LUB A;  5DVI A;  5FTI A;  4MFI A;  2NVU B;  3TTK A;  5CC2 A;  1LCF A;  4I62 A;  4JXI A;  2XHD A;  1R9L A;  3TDJ A;  5H8F A;  4RA1 A;  3HPI A;  4E0X A;  4NF5 B;  4R75 A;  2O84 X;  3KFM A;  4U1Z A;  2Q8J A;  3B6W A;  3IJX B;  3QUJ A;  4YMA A;  3C33 A;  5F1Q A;  5I56 A;  3FV2 A;  5BUU A;  4X1B A;  3ZS6 A;  1MPD A;  1A99 A;  1MY0 A;  3LR1 A;  2NOO A;  4N6P A;  2FA7 A;  4KQP A;  3FAS A;  3OEL A;  3TCF A;  1PEB A;  4JWO A;  4JWX A;  1NNF A;  2PT2 A;  2QS4 A;  3IB0 A;  3M3F A;  4WKM A;  2F34 A;  1SQY A;  2PBW A;  1LAG E;  3K0V A;  3K6W A;  3UK4 A;  4KD5 A;  3IX1 A;  4IGR A;  4EXK A;  3I3V A;  3C36 A;  3GLB A;  4JBZ A;  4YMB A;  1N76 A;  3PV0 E;  2QS2 A;  5ISU A;  3UOR A;  3K6U A;  1VE4 A;  1Y9U A;  3TEP A;  3D4G A;  4YAH X;  3QXM A;  4H65 A;  5AA2 B;  1UTH A;  2REJ A;  3HV1 A;  5CMC A;  4ZEK A;  3T96 B;  2REG A;  1FTJ A;  3OEM A;  4IO4 A;  2R71 A;  3FVK A;  3M3L A;  5AA4 A;  4PE5 B;  1M5F A;  4EDP A;  4X48 A;  5CMM A;  1ZBM A;  2P2A A;  1DPE A;  2XXX A;  3G3F A;  2UVH A;  3K1N A;  3L6G A;  2V25 A;  4FOR A;  2NUV A;  1Y20 A;  1P1W A;  3Q25 A;  2A5S A;  2GH9 A;  2Q89 A;  3KEI A;  1GV8 A;  1N7X A;  4F39 A;  4ZZE A;  2ZXT A;  3O29 A;  1D3K A;  4R6Y A;  1FTK A;  3H6U A;  5I57 B;  2ONS A;  4PFU A;  3MZ9 A;  4ELQ A;  1IIT A;  3FIR A;  5KCJ A;  1TT1 A;  1YCJ A;  5H8F B;  2ESN A;  2V93 A;  4F1Y A;  2VD3 A;  3PUW E;  2AYS A;  5JTY A;  1IXI A;  1URS A;  2Y7K A;  3H6T A;  3W9V A;  2I58 A;  3HHF A;  2I48 A;  4MLQ A;  1M5C A;  3G3H A;  3SET A;  1UIU A;  1UTB B;  1LFH A;  3G3J A;  2XXI A;  4DZ1 A;  5ITO A;  1SW2 A;  2Y7R A;  2OLB A;  4OQO A;  2V3U A;  2V3Q A;  1FQC A;  1QUK A;  5CM6 A;  1Y4T A;  3C31 A;  4PQJ A;  3Q27 A;  1B9J A;  2Z22 A;  1R6Z A;  4EF1 A;  1B5I A;  4U1O A;  3RTW B;  1QUI A;  3M8U A;  2UYE A;  3KG2 A;  3F11 A;  3O28 A;  1VFE A;  1B40 A;  2F97 A;  2DE2 A;  2H99 A;  3BFT A;  4G8N A;  4I9D A;  3FJ7 A;  5HM4 B;  1AOV A;  3G3I A;  2DYX A;  2DVC A;  4XIG Q;  1YTV A;  2R6G E;  4ELR A;  2UYF A;  1MQJ A;  2F6P A;  1GTK A;  3M3K A;  4H0W A;  2V84 A;  4X9T A;  5AA3 A;  4DXU A;  3MW0 A;  3VVE A;  3MWB A;  3PD8 A;  3VLV A;  3ILT B;  3UP9 A;  4WED A;  1FQB A;  3GBB A;  3IB1 A;  4TLL B;  3SDF A;  4MBP A;  1D9V A;  3QAX A;  2DP8 A;  1B0L A;  5AA2 D;  4HW8 A;  3PMV A;  1B7Z A;  2ZYN A;  2Q88 A;  3LSL A;  3C32 A;  4PFW A;  4RXL A;  3U94 A;  4EQ7 A;  1PB9 A;  3O6H A;  1LAF E;  4F3P A;  3KOS A;  1R9Q A;  4NF6 B;  1GR2 A;  1B6H A;  1DMB A;  1SYI A;  3MPL A;  1A55 A;  1B0H A;  1N3X A;  2DSF A;  1L5T A;  3R7X A;  3GBA A;  3TQL A;  1H45 A;  3T9X B;  4R73 A;  1OQG A;  1JW4 A;  1CB6 A;  2HXW A;  5TPA A;  3TPA A;  4ESW A;  1B32 A;  5I56 B;  3MJN A;  4QSD A;  3QUF A;  4OTE A;  3P7I A;  2HEU A;  1MXU A;  4QFN A;  3MAM A;  1Y3P A;  1QKB A;  5LOM A;  5B7D A;  3FD3 A;  1Z7N E;  3A3U A;  1MDQ A;  2P0S A;  5FHO A;  5AA2 A;  2Z8E A;  1ATG A;  3KJ7 A;  3PU5 A;  4BDR A;  2GFE A;  1MY2 A;  4OER A;  3LSW A;  4NF8 A;  3KJT A;  4ISU A;  2UVG A;  2XXR A;  3FV1 A;  1B3H A;  4EUO A;  2CZL A;  4LAT A;  4R2B A;  4KR5 A;  1NL5 A;  5DVF A;  5EYF A;  3RY3 A;  3TQW A;  3TTR A;  3IAZ A;  3FXR A;  3KOT A;  2V3T A;  1MQG A;  4YKJ A;  1MXW A;  1N7W A;  3PPP A;  4GXS B;  2Q2C A;  3C35 A;  2GRV A;  2M8C A;  2H98 A;  1T0K A;  4XTC Q;  2IEE A;  3VDF A;  2XXW A;  3CG3 A;  4MF3 A;  4QFO A;  4EXL A;  1LCT A;  4OHN A;  2PMS A;  4K3F A;  1AH5 A;  1D9Y A;  1B05 A;  2ONR A;  3G3G A;  1JW5 A;  1M5B A;  3MVY A;  4OES A;  4R6H A;  1LAX A;  4EQ9 A;  4JDF A;  3RGY A;  3FVN A;  3MQ9 A;  1US5 A;  4O3C A;  2UXA A;  2I4B A;  5DEX B;  2ANJ A;  2HCA A;  2OK2 A;  3FJG A;  1SW5 A;  2I49 A;  3ODB A;  1PBP A;  4OVJ A;  4THI A;  1XS5 A;  4WXJ A;  3SEY A;  1S7Y A;  5I84 A;  3CVG A;  3S9N C;  4I1D A;  3S2V A;  2F8D A;  3TCH A;  4H5F A;  3UGW A;  4F1U A;  2BJJ X;  5IAI A;  5B70 A;  3C9H A;  1ZKB A;  4NE4 A;  3PGF A;  5L9S A;  4XXU A;  2HZL A;  4GL0 A;  4IGT A;  2CMO A;  4EQB A;  2PT1 A;  3T22 A;  4NTL A;  4POW A;  2O1L A;  2ZNS A;  3N26 A;  3PPN A;  4OMB A;  3EHT A;  3SKP A;  3E3K A;  3DLN A;  1XVY A;  1ZMG A;  1B3G A;  4NF5 A;  5I2N B;  4NWC A;  3U92 A;  1MPB A;  1B3E A;  1MRP A;  4ZEI A;  1USY H;  3EPE A;  3K01 A;  2HQ0 A;  4OYV A;  3OEN A;  3H6W A;  3FVO A;  3LBS A;  1EU8 A;  2UVI A;  3T93 B;  5K2X A;  3HCQ A;  2YPN A;  1FW0 A;  3PMW A;  2ZYO A;  5DT6 A;  4KYE A;  2Y84 A;  2F7B A;  4LVQ A;  5CMB A;  5L9M A;  5F7V A;  1IXG A;  3PPR A;  1LB8 A;  1SYH A;  1H76 A;  2ONK E;  2X26 A;  3C34 A;  4IO2 A;  1H43 A;  4HCY A;  4M1V A;  4PFT A;  1HSJ A;  4YU0 A;  5L9O A;  1FQF A;  2ABH A;  3TKD A;  3RLF E;  3L6H A;  2QRY A;  3K00 A;  5TP9 B;  1Y3Q A;  3B7D A;  3DP8 A;  1DSN A;  1LGB C;  3E4R A;  1O7T A;  2D5W A;  3T9H B;  4X1D A;  4IY6 A;  3G3K A;  1MG1 A;  3GXA A;  5FHM A;  1S9T A;  1ZIU A;  4OZ9 A;  4LQ2 A;  1BIY A;  1DPP A;  4NMY A;  3G7W A;  4HTG A;  1TWY A;  3SES A;  4POX A;  3H06 B;  4TQU Q;  2I3V A;  4QRZ A;  4ZZA A;  5JEI A;  1XVX A;  1I6A A;  2IA4 A;  4R72 A;  3S9L C;  2Y7I A;  1HSL A;  3VFJ A;  3WAF A;  3OXN A;  2RC9 A;  3PUV E;  4ND9 A;  5I58 A;  3MZB A;  4DE8 A;  5JTY B;  3K4U A;  2DE4 A;  4Q8R A;  3CR9 A;  1F9B A;  3MP8 A;  3PD9 A;  4YB7 A;  2RCA A;  2DXR A;  4G68 C;  3PMX A;  1P1U A;  1WOD A;  1QKA A;  1B52 A;  2QJE A;  4H8I A;  4LZ7 A;  2QL3 A;  2XD2 A;  3LSX A;  2HAU A;  2UVJ A;  1B51 A;  1VR5 A;  4DIG A;  1BTJ A;  1UIV A;  3U93 A;  1WVJ A;  1MQD A;  2QS1 A;  4FJP A;  3DEL B;  4HCW A;  2DE3 A;  1QUL A;  4LZ5 A;  3VE1 B;  3W15 C;  3O6I A;  4U2R A;  4GIZ A;  1KWH A;  1SI0 A;  1A8E A;  2OZZ A;  1PB8 A;  2PVU A;  1B46 A;  1UQW A;  3ZKK A;  2XXP A;  5A5X A;  2OWS A;  2LAO A;  1O64 A;  2I6E A;  4ZE9 A;  4XKQ A;  4QSE A;  5KDT B;  4NF4 B;  4BDO A;  3PUY E;  2F7C A;  1MY4 A;  1SW1 A;  4RY1 A;  2B3F A;  1N3W A;  1VSO A;  3KSJ A;  4IO7 A;  4ZS9 A;  3JZJ A;  4F3G A;  2PX1 A;  2RF1 A;  1YPN A;  4AQ4 A;  1EH3 A;  1AIV A;  3T9V A;  3TTN A;  3CSG A;  4N13 A;  3CIJ A;  1JW1 A;  2Z8D A;  1EZO A;  1OQH A;  4R9G A;  2G29 A;  4RK9 A;  4F3B A;  1MY1 A;  3HHG A;  3Q28 A;  4MH5 A;  2X7Q A;  2XX8 A;  4ZEB A;  2O7U A;  2NXO A;  4KYD A;  1LFI A;  2HFB A;  4IB2 A;  4OFL A;  4MLV A;  1B1H A;  2A5T B;  4ZE8 A;  3FAT A;  3THI A;  3OEK A;  2D3I A;  2RCB A;  4JWY A;  4KFQ A;  3O6G A;  5ICT A;  2DOJ A;  4NF6 A;  1B5J A;  4XKR A;  4PFY A;  1OLA A;  3VXC A;  3N94 A;  1Y1Z A;  2QMX A;  2QPQ A;  2ZMB A;  3E9X A;  3GZG A;  4KCC A;  2OJT A;  3RT6 B;  3TTL A;  1AMF A;  1MPC A;  2ZNT A;  3Q29 A;  1LLS A;  4ZED A;  1M5E A;  2O1M A;  1MH3 A;  1DTG A;  3FXQ A;  2H25 A;  1JEU A;  1GGG A;  3OO6 A;  4G8M A;  4DCX A;  1EZ9 A;  2G93 A;  1NFT A;  4G8H A;  2O69 A;  4Q0C A;  3EQ1 A;  2ZNU A;  3OSR A;  3RUM A;  1LFG A;  3OOA A;  4GXA A;  4XKN A;  3QK6 A;  4YIC A;  1B3F A;  1IXC A;  5H8H A;  4ESX A;  1MY3 A;  3TYH A;  1HSE A;  4Q30 B;  3PPO A;  2XXT A;  2XX9 A;  3EHU A;  4YKI A;  2F7A A;  4G2Z A;  3PUZ E;  3I6V A;  5K2Y A;  5TP9 A;  1SW4 A;  4GRK A;  3VXB A;  1MDP 1;  1GVC A;  4UAC A;  4DLD A;  5ICQ A;  3B6T A;  1P99 A;  1NNK A;  3CFX A;  4IY5 A;  3KN8 A;  4FED A;  3K2D A;  5TU0 A;  1B4H A;  4UA8 A;  5H8H B;  3N5L A;  4BDQ A;  1NMU A;  2ZYK A;  1IEJ A;  3IOV A;  1P1N A;  1LBB A;  4R2F A;  4BDN A;  4DXC A;  5I59 B;  5I58 B;  1MM6 A;  2I0B A;  2OWT A;  2OCU A;  3HN0 A;  3TEL A;  1WDN A;  2X7P A;  3A3C A;  4E0W A;  1AL3 A;  1UTB A;  4M4G A;  4F1V A;  3OO8 A;  5H8Q B;  1TFA A;  3OO7 A;  5DVJ A;  4OEV A;  3JYR A;  5BWJ A;  3PUX E;  1ELJ A;  2F36 A;  1NKX A;  4LON B;  4NWD A;  2RC8 A;  3W9W A;  3IOT A;  4NED A;  4OET A;  1I69 A;  5H8N A;  1OIB A;  3HO7 A;  5EHS A;  2I3W A;  3CFL A;  4G68 A;  4YB6 A;  2VHA A;  1URG A;  5I2K A;  1PC3 A;  2O51 A;  3KBR A;  4LP2 B;  2YLN A;  3IOW A;  3OSQ A;  3RTF B;  1OVB A;  1B7H A;  3EN3 A;  4GVO A;  4U22 A;  4C1T A;  1A40 A;  2NWJ A;  2XXV A;  1IUD A;  5AA4 B;  1MXY A;  1LBC A;  3O2A A;  2RIN A;  3TOD A;  3MPK A;  3QIM A;  3H03 A;  2O68 A;  3K6V A;  4RYA A;  4GF8 A;  3EF7 A;  3TMG A;  2DWH A;  3DM0 A;  3VVF A;  5AE4 A;  4JSD A;  4P0G A;  4F29 A;  3U72 A;  2H5Y A;  1A7L A;  4KCD A;  5CBS A;  3KGC A;  3T9U A;  3TAJ A;  4KHZ E;  3CRB A;  2D21 A;  3MZ1 A;  3SEU A;  3H7M A;  4U23 A;  4FAT A;  1JET A;  2OBG A;  1Q35 A;  3OO9 A;  3UIF A;  3WAE A;  1D4N A;  2VP1 A;  1OVT A;  3K1M A;  2F35 A;  4KPT A;  4WEP A;  4ELP A;  1P1O A;  4ZEF A;  1Q1K A;  3IOU A;  1M5D A;  2E1S A;  3IR1 A;  2B3B A;  3K1P A;  3TUS A;  1FTO A;  3KN7 A;  3QYT A;  3K02 A;  3KSX A;  1B58 A;  4BDL A;  4BLA A;  3S9M C;  1POY 1;  3O97 A;  4RJZ A;  4GL8 A;  4KI0 E;  1A8F A;  1J1N A;  1FQA A;  4OXV A;  3U1O A;  4DXB A;  1QW0 A;  3H3G A;  1SD3 A;  3PPQ A;  4QHQ A;  4Q5T A;  2Z8F A;  1DOT A;  1BP5 A;  4QSC A;  3MC2 A;  2AIX A;  1JEV A;  3N6U A;  1NH8 A;  4I8C A;  5DYH A;  4QFK A;  4C1U A;  4OEN A;  3SEV A;  4F19 A;  2E0S A;  5KCJ B;  1JVX A;  3FVG A;  4R6K A;  4FAJ A;  4OEU A;  4HS7 A;  3MVW A;  5ELV A;  5A5X B;  5CBR A;  2XXQ A;  4LZ8 A;  5KZT A;  4IO6 A;  4N07 A;  3USD A;  5I57 A;  1TXF A;  3OMB A;  3B6Q A;  1FTM A;  4G68 B;  4IO3 A;  1ZJL A;  2VD2 A;  1MXZ A;  1P1Q A;  1OLC A;  1QJM A;  2XXU A;  3AXF A;  2XX7 A;  3MVZ A;  1CE2 A;  2DVZ A;  1OMP A;  3ZKL A;  2QMW A;  4AB6 A;  1MXX A;  1MQI A;  3MVX A;  4ZEC A;  3TTM A;  3RPW A;  4PP0 A;  4QF9 A;  1LAH E;  1N84 A;  1A54 A;  2YJP A;  3CSB A;  4H1X A;  4GFR A;  4O3A A;  4PET A;  4F18 A;  1UTH B;  5FTH A;  4Z7E A;  1IQ7 A;  4EF2 A;  1SBP A;  4QFP A;  1YAE A;  5FHN A;  1B3L A;  5JK4 A;  4GD5 A;  4NF8 B;  3LC8 A;  1Y4C A;  3CFZ A;  3MBP A;  4R74 A;  1US4 A;  1DTZ A;  2R9J A;  2Q9T A;  5HPQ A;  4P0I A;  3SEW A;  5M2V A;  2A5T A;  5I2N A;  4F22 A;  4U4S A;  3VLU A;  1H3D A;  2XD3 A;  4GOT A;  4FE8 A;  2F6G A;  4L17 A;  3FUZ A;  3RT8 A;  3SER A;  4GLI A;  3VVD A;  3MP6 A;  2QSX A;  2Y7P A;  4OFO A;  3U8Q A;  5L8D A;  4H8J A;  1RYO A;  1LST A;  1S50 A;  3S4U A;  3TZA A;  3V89 B;  3H4Z A;  3BFU A;  2DWI A;  3H6V A;  4RPN A;  4XKP A;  3S9E A;  1B4Z A;  1LB9 A;  1JVY A;  3IJO B;  1QVS A;  3ONM A;  1B1X A;  1XOC A;  1B7U A;  2FYI A;  3K6X A;  4G77 A;  5CI5 A;  2GHA A;  1ZU0 A;  2O7I A;  3LUY A;  4GQO A;  2P1S A;  4LA9 A;  3SEX A;  3V5A A;  1EZP A;  3Q26 A;  1BKA A;  1ZTY A;  1PB7 A;  2H4I A;  1QUJ A;  2PYY A;  2QS3 A;  3T66 A;  3TFL A;  2WKY A;  5J1D A;  1MH4 A;  4ZDM A;  1JQF A;  1PBQ A;  4OWD A;  4YKK A;  5DEX A;  5KDT A;  1O63 A;  1H44 A;  4JSO A;  4TLM B;  4F31 B;  1VFD A;  2KLF A;  2XXY A;  3FGS A;  4YB5 A;  1NNP A;  3A09 A;  3KZG A;  3VLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...