3VFMA

Crystal structure of hla b*3508 lpep155a, hla mutant ala155
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEARRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title The Energetic Basis Underpinning T-cell Receptor Recognition of a Super-bulged Peptide Bound to a Major Histocompatibility Complex Class I Molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vfmA01
1JI2A 3O4LD 4HPOH 4O2FA 4P2RA 1OAQH 4XPHL 3UTTD 1DLFH 1DUYB 4YEEA 1ZLUH 3QQNA 2L0DA 2VL5A 5D7LE 5EOQL 4KAQL 4XRCA 1S8DB 3DETD 4JRYD 4M1CD 4BQ9A 5FYKD 3SDYL 5K33A 4IEFB 2WZPD 1IGTB 3DTXA 3QDAA 4S0TD 4Q58C 3O3DA 3ZHLA 4NBYB 4HIJB 1HSAB 4PTTA 2BDNH 4OZHF 5C0CA 2PNDA 2BY1A 1NGWB 3FQRA 5C7XH 2VQUA 1I7ZA 3DVGB 4GKSA 3PXHA 4WHYH 1QP1A 2Y9RT 4R4ND 3G6JF 5D1XA 1NEZG 1YMHA 1FZOA 3PNWB 1JUFB 1EX0A 2X6MA 4JPIA 4XPBL 3S37H 3REVB 2ZUQB 3IJSA 4P3CL 3O3EA 1FFQA 2NY2B 5D96B 1UH4A 2E5EA 2EDJA 2EYTA 4N90E 2N1KA 3QWOB 1NUGA 2DQGL 1HXYA 5IBUB 5DC0A 5EBGA 2V7NA 5JW5A 1U8NB 1IGJA 3OJMB 3FAWA 4PRPA 5DVKA 3BDYL 1MCKA 3PP3H 4CU7A 4WW1B 3BQUA 1ZVSB 1G9NH 4MNHA 1AHWA 2OM5A 5CMAB 2GW5A 3BYTA 2O26U 4YHLL 4RFOL 5BOZG 4P46A 1ZLWK 2HFFA 5J13B 5I73B 2X9XA 2WY3A 4TOYL 3KNBA 5C8JB 1AIFA 2JE8A 1AE6L 4ZOAA 1F3DH 5CSBA 1AO7D 2W60A 5EUOF 5J11B 1BOGA 4QO1A 3HRZB 2ENSA 3KDMA 3DV4A 3WIIL 5JDSA 1ADQL 3HI1B 4L4TA 1GGTA 4OQTA 1A6UH 2NXZB 1MJ7L 4QT5A 3HA0A 3DVIA 3UBXB 4KMLB 3UPRA 4LPTA 3VCLB 3EO1A 1LEGB 1QNZL 3L95A 4NKIL 5IW3A 5FOBB 3V79C 4OFVA 4JDTL 3TNMA 1FG2A 4I0KA 1F4WL 2QHRH 3GSVB 4NO2A 5LGHH 3W9DA 1QA9A 4P5TC 5JW4M 3KPSE 4QHKJ 3AS1A 5T33L 1GZQB 1H5BB 3WKMH 1Z3GH 2EO9A 1IFHH 2NTSP 2ZP0T 4PRAA 1PVHA 3ZE1E 4F80A 4JRXA 3RAJH 1X3DA 4KV5F 4TSCL 1XGUA 2YPKB 3HMXH 4R26L 2ZUSA 3LD8C 5BRZE 4OZIF 5ICYA 1OAZL 1WUNT 3NAAL 5KSBB 1CD8A 4L9DA 2VAJA 5DFWH 1U8PB 1TCMA 1FO0B 4XPHH 4HC1A 5F1SA 2MHAB 4J4PD 1A3LL 1NCBL 2IG2L 5I74B 4YR6A 4NO3B 4RGND 5EOQH 4KAQH 2EYRA 3O6FC 1CS6A 3MQIA 4WUUB 4WHTB 2BHUA 3MA7A 3MFGB 3P3YA 5ESAB 3VXMA 1JWUA 1IQDB 4L3ED 2D7MA 2V5YA 1UYWL 2AEQL 4APQD 2IPKA 2EZ0D 1RHHB 4AEIL 4MLSA 3LKNA 1NBYA 3V5KA 2Y5TB 1UM5H 4NIKB 2KH2B 3F5WB 5KSAD 4GG8A 1HOCA 3T0VA 4YDVB 5DHXB 1A7OL 1A47A 5EBWA 2ICWA 5C0JB 3TM6A 1FFNA 4CVZA 4HAGA 3SJVE 2BNUB 1OLLA 5T5NF 5A43C 3GHBL 4XPBH 1MLCB 4P3CH 3WNNA 1KN4L 4PREA 1MI5D 3VH8A 4MD5B 5I8EB 3IKKA 1YA5A 5F96L 2VIRA 4JO2H 3RWJA 4MD4A 3ELAT 3RIAK 1NH6A 2DQGH 3OKEB 1C7TA 4ZS6C 2I60L 4UUJB 3ZKMD 1U41A 1OM3H 4NNXA 3ETBF 2ADGB 1UM6L 2A9ML 3DX6B 2YOCA 3AU1B 3KHQA 3BDYH 2CLRB 5J12B 1I8KA 2A1WL 2R1YA 5JLZA 2XG4A 3FB6B 4LLAA 4HDIA 5CSGA 4PJ5B 2XYCA 4RFOH 2UZYB 4FXLA 1EFXD 5CD3B 5CD5D 3X13B 1DUZB 4TOYH 4NZTL 4YHOL 1AE6H 5KANG 1KJVB 1L0QA 1NL0H 1MFCL 1NDMA 5KVFL 4HUVA 4X6BA 3HZYB 4JB9L 1F90L 3WIIH 4C54A 3ULUD 1P9MA 3CPLA 5GPRA 1I8IA 1LO5B 2R2BA 4EN3B 2F53E 2XY1A 3B5GA 4A6YA 4TNVK 2IEPA 2FDBP 5D5MB 5DK0B 4YC2C 1NCCH 4Y7MA 1QNZH 1KSRA 1OSPL 4NKIH 5KVDL 1QLRB 5MERB 2QSCL 5EB9A 2IADB 2APBA 4JDTH 4NM8L 3ULVC 3ZTJG 2ZUUA 5EUKA 2OX5A 1F4WH 1UJ3B 4JFYB 1JPFA 4ONHB 1V3LA 2XQYG 2X89A 4A2LA 4CN6A 4JM2F 1I1FB 5A3ID 1BOYA 5T33H 2ATPB 3VRIB 3I9GL 1MFBL 4XNZB 4ZDHA 3C5ZB 4TSCH 4XP9L 4Y1AE 4R26H 1OAZH 5H37H 1F3JB 3B9AA 4GMTL 4EOWL 4G8GD 2EO1A 4P2OA 4PRNA 1NCBH 3IETB 5B3JF 4L8SB 2IG2H 1LE5A 3EYOB 4PJAF 1GGYA 4LOUD 3R8BB 4OBSA 4HF5L 4F7CA 5F9AC 3P4MB 1I9RL 4CN4A 3NACL 1T3FB 2VYRE 2IQ9H 4B5EA 1LK2A 2VAAB 1UYWH 2AEQH 4FZEH 2X1PA 1S5IL 3CSYB 4R6UA 5DJ0B 3UMTA 3E2HA 4Y89A 3OX8A 4ETYA 2YD7A 1CDHA 2Y23A 5FCSH 5B4MD 4E41E 3KYOA 5CLWA 2R9HD 4L8BB 2AK4B 5IFAL 1TZGL 5DJ8B 3MRFB 1A7OH 1KPUB 3D0VA 5DRWA 1JPSL 3QHTC 4LGPB 3KPRA 1OOAA 3S36L 5E0QA 4LCWB 2CPCA 1H3GA 32C2A 3TN0B 3GHBH 5E6ID 5I1JL 5TQ2L 4OCLC 1TVHB 1KN4H 4TTDD 4IS6B 3VFTB 2DWEA 1O5DT 5F96H 3OBAA 1P1ZA 4UQ3B 3PWPD 5J13C 4P59H 4JFOB 1A4JB 2I60H 3V0VA 3GSNA 4M61A 1UM6H 2A9MH 1IGYB 1X4ZA 5J11C 1FZJA 2Y6SC 2IANB 2VKWA 2A1WH 2CIIA 2KZWA 2VLLB 3ECBA 3LRSB 3O0RL 1Q94B 4KRPD 5HGDB 4RAUB 4LNVA 4O9HL 2NXZC 4ZO9A 5SWZD 2XKNB 1GC1C 4NZTH 4YHOH 5K93A 5ID0B 4G6ML 1KNOA 1HWGB 1MFCH 2XZAL 2DYPB 5KVFH 5HHNB 4C55A 3BIKA 4NUJA 3ZE2E 3GMPA 2ICWJ 5EO1A 1VA9A 2A6KA 5I6XB 1F90H 3GO1L 4QTIL 3IGAB 5EBMA 5C08A 5C09E 2YRZA 5C6PB 3I6GA 1JYXA 2P5ED 5E1HB 1A3RL 1S7WA 2EIZB 2J8UE 1H5BC 3N1PC 2HVKA 2VLRD 3AFLA 5I1IL 3O6LL 1F42A 3U4EB 5KVDH 5JHDB 3GJFB 3Q6FA 4TPRL 4P2RD 3QNXB 1A14L 4V1DE 5DTFA 1YC7A 4G7VL 3F58L 5HDBE 1DFBL 1S9YA 2WWKT 4HCRL 5AYUL 5H94A 5BV7B 1A64A 2CK0L 4GLRH 4HK0A 3H9SB 3S7GA 5IQ9A 4AMKL 1T1WB 5I74C 1LP9B 5FUOL 2E7LC 5T3XD 2YPLB 1MFBH 3OHXB 4NJ9L 4PJFB 4URTB 3MYJB 5C0CD 3QNYB 1GGBL 4HLZG 5ESVB 1C7SA 1H8NA 2ATKB 2GFBB 1M6OB 4NNYB 4GMTH 5D1XD 4I4WA 4TNWK 5M94B 3T8XB 3IJYA 4WTXA 4M03A 3N1MC 4MS8C 5MHSE 1KXVC 5ERWB 5B39A 3MRMB 3JTSB 3MGOA 4HF5H 5IJVB 1I9RH 3HR5A 3CVHB 4GQPH 3NACH 3QSKB 1E6OL 4XVSH 3TF7A 1KCKA 2D31A 3X3FL 5IB5A 2OS7A 4PJEB 1W8NA 5ISZA 4PRPD 1B9ZA 3FQWA 1Y0LA 3GMQB 1TZGH 3BQUD 4LLVA 4AM0B 1JPSH 5GGVY 3CLFL 3NPZB 1HE7A 2IFFL 1TJGL 3S36H 5I66A 4P46D 2J5LB 5TQ0L 5I1JH 5TQ2H 2IQAA 5K9KB 3FHQA 1WWBX 1JIBA 3DX7A 4QTHA 4ZUVB 3FKUS 1SY6A 5IOPA 1T21A 4FA8A 5CZKA 5DLML 5I71B 1IEAB 4DOHE 2ESVB 3MUHL 5HYJB 3WMSA 1OSZA 3ZL4L 4L4TD 5DO2C 5BS0B 1H15A 1I7RB 5EIVA 1FZMA 2BCKA 4UIKL 2W9EL 4EN3C 1XIWB 4WEUD 3V5DA 2I9TA 3WE6A 3S5LA 4G6MH 2XPGB 2XZAH 3BI9X 4P5TA 5CEXB 4PJ7F 4ZUUB 3K4AA 4N8VA 2W9DL 4RWHA 3RKPA 1YPZA 4U6YA 3GO1H 4C59B 1UJ3C 1J5OL 4QTIH 1MHHB 2XN9B 5DUBA 2UWEE 1GOGA 1A3RH 4JRXD 3AY4C 5HI5D 4KKBC 1MCJA 1A1NA 4CVUA 4AG4L 1UXSB 5CJ5A 4DUWA 4OF3A 5I1IH 3O6LH 4XNZC 2AJYL 4TPRH 4QRRB 3C5ZC 1A14H 5IWLC 2H8PB 4G7VH 3F58H 2OTUB 1DFBH 4HCRH 5AYUH 4O2CB 3O6FA 2CK0H 2PYEB 2EDWA 2WINA 4GKNA 4AMKH 1NC2B 1RPQA 3F7QA 4EVNA 1DQJA 3VXMD 5FUOH 3VFRA 2VR9A 3EOAA 4NJ9H 2RFXB 4PRIB 1HHGA 4LLQB 1GGBH 3Q5YA 3S96B 3DX9B 2DTSA 1UZ6E 5E2JA 1MY7A 3NABL 3K4DA 4BH8A 3C2AL 4HMDA 1WT5C 4XH2B 4M8QB 3B9KC 2X09A 4KQ4L 1XF2A 1SBSL 3LKQB 1HHHA 5DK2A 2GJ6A 1BZQK 3Q3GA 3QUXC 5EN2A 2VLKA 1DBBL 2FX8L 3DHJA 1E6OH 3TN0C 4U1NB 3X3FH 2WSKA 4KRLB 3FHAA 5TDPB 4KJQD 4UAOB 4EI6B 1MELA 1FN4A 5BMFL 4N0FA 2XOTA 3GSXB 3I3BA 4X4YB 4HS3A 5DJAB 1CGYA 3L5XL 3QXAA 2IMNA 2BC4B 3CLFH 2GSGB 2IFFH 3W5NA 1TJGH 5FO7B 4O2EA 1EGJA 2YD6A 3B4NA 1MLBA 3EHBC 5MI0B 3LH2L 4JFEB 5TQ0H 2D7OA 2OSLA 3C5JB 2H2SC 4QEGA 4B50A 3AS2A 5JUEL 3VFOB 4K3GA 2PW1B 2AI0L 1BZ7A 4KFZC 1JFMA 3RVVD 3JZ7A 4O4YH 5DLMH 3G9AB 3VGAB 3JV6B 2AK1L 3U0WH 3ZL4H 2CRYA 3BGFB 3O3BA 3TA3B 2H26B 1BZ9A 5TE6L 2K7QA 2QR0B 1II4E 4LP5A 5I6XC 1KG0A 2NX5B 2GYSA 4UIKH 1JGEA 1U6AL 2W9EH 4PP8C 5KAQF 4K55A 1YN6B 5GSVA 3NH7L 3FZUC 5DFTA 4OF5A 4X98A 2X89D 2HLFD 4PGEB 4CKVX 1DUYA 1MCRA 2X4RA 3MZTA 3ROOB 1ZGLP 2NY1B 1J5OH 1KPVB 2AQ3A 4ZPTA 4OGAD 4KTYA 1IZKA 4WFED 4YGVB 3FO1B 1QVOB 2EYSB 3FN9A 4MCYB 3D1MC 4AG4H 5CAYB 5CJ8A 1FL5B 2HT3D 4HHAA 1HSAA 2PTTA 4J8RB 1F11B 2AJYH 5DMIL 4FXGA 1NGWA 4OAWB 4P2OD 3DVGA 5J6GB 4QXWA 5FM4A 5JR1L 1E27B 1OVZA 4OCXL 4XB8A 5F7YC 1JUFA 2G5BA 2DLHA 4BSJA 4OCYL 1XGPA 3REVA 1YY8B 1T1ZA 5F72S 2NCMA 4S1RL 4X6DB 4HK3N 4JFPB 5E8NB 3HG1B 3NABH 1OP3K 4LSRL 3C2AH 1A8JH 5EO9B 5HI4C 2ERJB 2NLJB 3QJHB 1U8NA 2ZUXA 3KPRD 4U1GB 5LG1A 3RWHB 1EZVY 4Z76B 4Y19E 4WW1A 4KQ4H 4RWYL 1ZVSA 4GG6F 1SBSH 1CDGA 5CMAA 1EO5A 1ZT1B 1YQVH 1JK8B 1DBML 3C5SB 1OT1A 2Z0BA 3QEUA 1L7IH 2FX8H 2IH1B 2J5LC 2F5AL 3DYPA 2XZCH 4ONOA 1QZ1A 3EFDH 1PG7W 4XTRC 1FFRA 1BFVL 2APFA 3O2WL 3RWDA 1CT8A 5DVLA 1Z9MA 4FZ8L 3K81A 3LB6C 4OV6F 4DWHA 1A6TA 5BMFH 3LQZB 5DMYA 3HRZA 4HQQL 1HKFA 4NQDB 5I71C 3L5XH 5DURB 2I26N 2IMMA 4U33A 3C9NA 3HI1A 3F62A 5C0ND 3QXTA 5D2LF 3LSOB 4QRPA 2V2XB 3UBXA 3VFWA 3KJ4B 4U7MA 1G7JA 4M6ML 5DGRA 1DJSA 5JUEH 1F6FB 3LS4L 2VDML 2AI0H 3BPOB 4Z7VF 3GMMB 5FOBA 3SGDH 2AK1H 3TO4A 4PJIF 5HVHC 3SE3C 3CFCL 1CU4L 5C08D 4ACPA 4L9LA 3VXSE 1Q0XL 4WFFE 1GZQA 2W92A 1H5BA 3U0PB 4FFVD 3QFJB 4UDUA 2YPKA 1UZ8B 4V1DB 3VFMB 1JRHI 3QUZB 2H6PB 4YDIL 1YNKH 2G2RB 1FO0A 1MCFA 2YR3A 2YC1B 5T5FL 3KPPA 2E7LA 1NUDA 4UT6L 3DYMA 4WUUA 4WHTA 4S1QL 5TDNB 4GAGL 2IF7A 3H3PL 5ESAA 1ZLWH 2P43B 1J10A 4ZNEA 1RHHA 3V6BR 5DMIH 1HN1A 2GY7B 2Y5TA 5DR5L 1RJLB 3F5WA 4G43A 4KU1A 3MRBB 3L3JB 5JR1H 5CKGA 2FECI 4MS8A 4OCXH 3T65B 5C0JA 5F6IB 2BNUA 5INCB 4OCYH 5DI8A 3MRDB 1MLCA 3DUUB 3WDIA 1N2RA 3OR6B 1U91B 3LEYH 4Q97A 2N7BA 4MD5A 5I8EA 3D69A 5ISZD 1TZIB 3JWOL 4Z7WF 3BJ91 1ZT7B 3FQTB 4NHCL 4UUJA 1S78C 4H0IA 4LSRH 1HI6B 4UAOC 1MFAL 4YFEA 2FL5B 2ADGA 4PY8I 3LZFH 3AU1A 2NXYB 4O02L 4H1LG 3HN3A 3W0WE 3FB6A 1QFWM 1DBMH 4PJ5A 2WUCL 2X5PA 2F5AH 3NN8A 2OP4L 5MI0C 1WC7B 2QQLL 1WVZA 2VDKL 3X13A 4ZS7L 4R8WL 1DUZA 1BFVH 3O2WH 2BHZA 3QH3B 4FZ8H 1NAML 3HE6B 3QIUB 1KJVA 2E9BA 4OF0A 1N26A 1MRCL 1KB5L 1U36A 4IMLA 3EYSL 2Q3ZA 4HQQH 3VGAC 1GZPB 3KLDA 3HZYA 2D03L 2ADJA 5DJXB 5CGMA 5JOPD 3VG9B 3HNTL 1WIUA 1R24A 4XCEB 1LE9B 5DZNA 3K46A 2EE3A 1LO5A 2QQQA 4EN3A 4M6MH 3RJQB 1JHKH 2Z8VC 3LS4H 1S9XB 5D5MA 2VDMH 5DK0A 3OZ9L 5BVPL 1QLRA 1H3TA 4P5TD 4KI5E 3MO1B 2YZ8A 2LAGB 2IADA 4I2XB 2BRRL 3TBWB 5C9JA 4QHMB 5E2VL 3BAEL 1UJ3A 1ERNA 4JFYA 4LLYA 1J7VR 3CFCH 3G6JB 1CU4H 3FB7B 5I76B 2HRLA 1Q0XH 2ATPA 3AY4A 1VFBA 1X7QB 2AJUL 3RY5A 2NY1C 4P49A 4U6TA 1S9VA 25C8H 1F6LL 1PZ5A 2HG5A 3C5ZA 3IYLW 1N8ZB 3DSNA 2ORBL 5MENB 1A9EB 4YDIH 1BFOB 1F3JA 2AJSL 4FRWA 3A6CL 1TXKA 2NYYC 3O6FD 2E8YA 4Q6IB 5E9DE 3T2NL 1PDKA 4X7TA 4R7DB 3EYOA 4Z0BL 5AG9A 1G6RB 2FYYB 4ZSOE 5FYLE 1RZFL 4UT6H 5CINL 4S1QH 4GAGH 4Y5XB 3H3PH 1FIEA 3LQMA 4K94C 2VAAA 1IKFL 3GIVB 3ALXA 4R3SA 1IGML 5E24E 3CFKA 1WT5A 5DR5H 3NCEB 4M5YL 3DVFA 5EUOB 4L8BA 3B9KA 2AK4A 5DJ8A 5CEZE 3MRFA 1KPUA 2GJ6D 3K2MC 3QUXA 1CG9B 5HGGS 2VLKD 3A0OA 4U1GC 4LCWA 4GLRI 5CSZB 2HTLC 1YJDL 5DQ9A 3TIEB 2FR4A 4MNQA 2GHWB 4ZS6D 1TVHA 2JTDA 5M7QA 3VFTA 2UY7A 4UQ3A 3JWOH 4JFOA 5DJDB 5EU6B 4NHCH 1MCWW 4N9GB 1MFAH 3WBDA 4JKWA 4LNRB 1IGYA 4L8CA 4U6HB 5C0BE 5EIQA 4EEEA 4O02H 1SJXA 3NGBB 5LWYL 3PL6B 3QEQA 2VLLA 3LRSA 4YIQA 5C07B 2EE9A 2WUCH 3JSSA 3IS1X 1Q94A 5FYJL 4RAUA 4PY7A 2OP4H 2QQLH 4QOKB 2VDKH 4ZS7H 4R8WH 4F33B 4CUCA 2DBLL 5ID0A 1NAMH 4HEME 4OZIB 4U1SB 3BPOC 3TCLB 1MRCH 1DBAH 1KB5H 2DYPA 3EYSH 3OKMB 4FFVC 1D5MB 1JHTB 2Z8WC 2DOCA 3PHQB 1R3IL 5IB3B 3VGFA 3IGAA 4FQ2L 4KROC 3RY4A 5CGYC 4F7TB 1JGLL 2EIZA 4W6WB 4PUBL 2JKXA 3ULVD 4UNUA 3WN5B 3OZ9H 3PIQB 2Q86A 3QO0B 5BVPH 2R8SL 5EZJB 3U4EA 3GJFA 1LILA 5C0RL 4JFFB 1IC4L 2BRRH 2C1OB 3QNXA 4Y5YB 3D25B 4HS8H 5E2VH 3MRPB 3QUZC 2VDLH 2CKBA 5BW7C 2BMKB 3MV01 3KPLA 2CLVB 1T1WA 2DM4A 1EAPB 3VXPB 4NQSB 2YPLA 2F54E 3OHXA 3MYJA 4OGYH 5L8KB 2H41A 2OBGA 3WHE0 2HT2D 4KJWC 1S7RA 1YYLL 3ERYA 2GFBA 1M6OA 2ORBH 3F7YA 2WANA 2AJSH 2HP4A 3A6CH 4NNYA 1WSST 2AS5M 4Z0BH 3G5YB 3FT3B 4NOFA 5E5RB 4YDLB 1RZFH 5ERWA 4LDEB 1ZSDB 1Q9LB 3CDCA 3JTSA 3MRMA 4GS7C 3EYFB 3QBTB 1QQDB 1IKFH 1F45A 4U05A 3MV9E 1LVEA 4PJEA 5CGTA 1IGMH 3QCUL 1U8IA 1V3JA 4QY8A 2OR7A 4QRQB 4M5YH 3H8NA 3SCMC 4NQCB 4OKDA 3B9DA 1ZE3C 2X70B 4KDVA 4NFCA 4GRWE 2R56L 4WI3A 1NJ9A 2Z31B 2NXYC 4OCNC 5I19L 1YJDH 4LHQB 1ZGLM 1XZ0A 1C08B 5K9KA 3WO3B 5DVOA 2BVOB 2FLRT 2AXFB 4ZUVA 3V4VL 5E4EB 2Y36L 2OJEA 2Y6SD 3G08B 4K23L 5CP7B 1IEAA 2W9LA 5HYJA 1T1XB 3SDXF 3HE6C 3QIUC 2EDLA 4MA3A 5DJ2B 4PGZA 1NBVL 2NXZD 4JY4A 1CXKA 2HJKB 5LWYH 4JM2B 1MWAB 4QRPD 4I5BB 3VG9C 5FYJH 3NVQA 1INQA 4PJCE 2CQVA 4Y2DB 2DBLH 3EYVB 2ZPKL 4GW4B 2X4OB 1PEWA 3TO4D 3WL9A 2GK0B 4ODHL 3U48A 3IU4L 3SE3A 2Q6WB 5DSCB 2I9LB 5CEXA 4ZUUA 5D7IE 3KPSA 1FNHA 4JG0L 9CGTA 2W07A 3NA9L 3FCTB 1LK3L 2LE9A 4FQ2H 1MHHA 2XN9A 5C6WH 3DYOA 1E28A 1JGLH 4QHUB 4KVNL 1UXSA 3UTQB 2R8SH 5B39G 5J4MA 1XCTA 5SWSB 3TZVB 5C0RH 4QRRA 1IC4H 5IR1B 1IAIM 5ETUA 4FQCL 3GBML 1XEDA 1MH5B 4O2CA 3QUKB 3ROLB 4PDCE 2PYEA 4Q6IC 4NZJA 4WUUD 1KTDB 1MQKL 2YPVL 5IG7B 1C16A 1DBKL 2HKHL 2P8PB 1WV7T 3MFFB 1AR1C 2YA2A 4PRIA 4X9FA 1D6VL 4R4BB 3S96A 3DX9A 1YYLH 4LPXA 2AABL 1QRKA 3I75B 4XZUB 4MQXC 1IL1B 1S7TB 3OAYH 3BPCB 4YHNB 4MS8D 3S88L 2CUMA 4RFEB 2JLLA 2BVPB 4XH2A 3BZ4B 3I84A 3VXRB 3SJVA 4M8QA 3RL1B 1YEKL 2CK2A 2WP3O 3LKQA 1OGAE 2DI9A 2ICCA 1RFDL 5DRXB 4OB5L 2OR8A 1KXQE 1T04B 4MAYB 5D4QA 1ZK9A 3O4OB 2V2WB 1F8TL 3QCUH 5T3ZL 1OW0C 3H7BB 5IFHL 3MRGB 1FVDB 3GSXA 3HPLA 5DJAA 2DQIH 1RUQL 4DAGL 2BC4A 1MIEL 2GSGA 2HH0L 2R56H 4UOW0 4PJ5D 5FO7A 3SE8L 1WITA 5I19H 3PL6C 5DVNA 1GH7A 2H32H 1P4IH 3VFOA 2PW1A 1ZEAL 3KYMA 3V4VH 2Y36H 5DO2D 2P49B 6FABL 3JV6A 4XXDB 2WWMC 3TBYB 1UENA 2OXGA 1NBVH 5L8JB 1FRGL 2H26A 3FOMA 3ZTJH 1DSFH 2EE6A 3DWTA 1W72B 3JBG7 4YXKL 2QR0A 1FVEA 3FQUA 4YHKH 4EN3D 2F53A 1HXMB 4HUWB 2H3NB 5FHAL 5EOTB 3SBWC 2NX5A 4HG4J 1BVKB 3T0DA 2UVEA 4QXGL 5FV2A 4U0RC 1U8LB 3TJHC 1AJ7L 2ZPKH 3WN5C 1YN6A 1QBAA 4U3HA 4XBPB 3IU4H 3QO1A 3HC0B 4DKEL 4RMWA 2FGZA 1S7XB 2E6PA 2KBGA 4Y5YC 4JG0H 4HWZA 4M00A 5C0AD 3NA9H 4YXLL 4KKBD 1D5XB 1LK3H 1AQDB 4NC0B 1S5HA 3OXRB 1QRNB 5K59E 1KPVA 1FCGA 1KIPB 3FN0L 4XAKD 5I17B 1EK3A 4YGVA 1I7UB 3CZFA 3FO1A 1WFOA 3PGCA 4FABL 2EYSA 3HMWL 3C5ZD 4XT1C 2XRAL 2C3VA 5EFIB 3WNKA 2CRZA 1SEBB 4J8RA 4OAWA 2MOVA 1BAFL 1QO3B 3GBMH 4FQCH 3SGDI 2ITDB 3T1FB 4GBXC 4M9OA 1S3KH 4JQIH 2EC9U 1MQKH 1MCLA 2CR6A 2YPVH 1DBKH 2HKHH 4I77L 5F89B 1J87A 1QSEB 2AJZB 1YY8A 4NKOA 4YDLC 3KPTA 3M8OH 1JNLL 5JNYA 2R1XB 2BVEA 3H0TB 1D6VH 1PKQE 4X6DA 4LRIC 1K3ZA 5E8NA 4JFPA 3HG1A 3HPJB 3B9KD 2AK4D 2AEPL 2ITCB 2XZQL 1IC7L 3S88H 1Z5LB 3QUXD 4GW5B 2VXTL 5ADOH 3RWHA 4CN1A 4LCWD 4P9HC 1YEKH 5EC1A 2H9GB 3R0MA 4MNQD 3MLPA 1JK8A 1RFDH 3I2CL 4OB5H 3U6RA 3SE9L 2OZ4L 1BIIB 1XGYL 1OT2A 1F8TH 1HKLL 2Y4SA 3BGMB 5T3ZH 5IFHH 3LQZA 5F3BA 5HY9A 5C0BB 4PJ7B 5FYJU 2PR4L 4WNQB 3LVEA 3EHBD 4NQDA 4OCSH 1RUQH 3QEQD 1PQZB 1MIEH 1I3VA 2H2SD 1W0VA 2HH0H 1KGCD 4LPYA 3SE8H 1L9NA 3OAZK 3H9HB 2V2XA 35C8L 2ZOKB 2NMSA 1ETZB 3PXJA 1HHIB 3FMGL 4Y2DC 3GMMA 2DYPD 3D0LB 6FABH 4G59A 4UT9L 5E5UB 3L3IB 3S35X 4Z7OF 1U92B 4NFDA 4X80L 1MCHA 1FRGH 3QAZB 3KLHC 4M6AA 4YXKH 4P5KB 3X14B 2QQKL 3FONB 5FHAH 3U0PA 3ARBB 3WFHB 1TTFA 3FZUD 4KJYB 4QXGH 3HLAB 1NGYB 1UZ8A 4V1DA 2JB6B 1GC1H 2Y72A 3QUZA 4PBVC 2H6PA 1J8KA 4DKEH 4B0MM 4HLZH 3TZVC 5BW7A 2G2RA 3L1OL 3WDJA 4K71C 4KTDL 2YC1A 2VL4A 4YXLH 5EA0L 5EOCJ 3ZKXB 3FN0H 3MSPA 1M1SA 2DL2A 2YPLD 3SGEI 5F8RC 1G9EA 5A2IH 4Q7DA 4FABH 4YNYB 1G7IB 2XRAH 15C8L 1CFNB 4JHWL 4GXUM 3MRCB 5IHLB 4AQOA 4OIAA 4RGNE 1BAFH 4NSKB 3LKOB 3L3JA 3KVQA 5H8DA 5HI3C 1CF8L 4H26B 3RIAF 4R4FL 5TPWL 4DCQA 2KUTA 3IVKA 2C3XA 2EH7L 3RX8A 3V9FA 1AY1L 2C4FU 4L3EE 2VXSL 5EU4B 4I77H 2A6JB 4N90D 3C8KA 1E6JL 5DWUL 3DUUA 1JNLH 1U91A 4M3JA 1DEEA 5HI4D 4MAYC 1TZIA 5DJYA 5F7UA 3SCMA 1ZT7A 4XMLL 1EHXA 5CBAB 4POZC 2AEPH 3O4OC 2XZQH 4JCMA 2C3WA 4JCLA 1BBDL 4N5UA 2FSEA 3CX2A 1RIUL 2VXTH 4OGXL 3WSQL 5IMLA 2A6IA 1C5DA 4MSWB 4LKCB 4XTRD 3BO8A 4OCRL 1HYSC 3I2CH 3LB6D 3SE9H 1NLDL 2OZ4H 1WC7A 4WI5A 3RWGA 1XGYH 4HZLB 4YBHA 2M26A 5F21B 3QH3A 1EJ6A 4TNVF 1L4IA 1JF1B 1D5BA 3HE6A 3QIUA 5HYJD 3RZCA 2PR4H 4P4KB 3GDBA 2NY4B 4YAQB 1GZPA 4G8EA 1DBJL 5DJXA 2F19L 4MA8L 2UZXB 4P57B 2DLIA 4W6YB 1LE9A 3DX8B 35C8H 1CGWA 3U1SL 3NCMA 3AAZB 2E7BA 3FMGH 3VDBA 1KJ3L 5I1KL 3FN3A 3MO1A 1AGEB 5HDQL 1EZVX 3KPSD 4GW1B 2CRIA 3E6HB 4QHMA 3ULUE 2WNGA 2C4FT 4J1UB 4CDHA 3G6JA 5L88L 3P9LB 5HYIA 1GRWA 3TESA 2XN9D 2VLMD 5I76A 4N0CA 5FAAA 3HNVL 1X7QA 2C5DC 2QQKH 1HQRA 5EBLA 5D1QB 1G7MB 1ZWIB 4LCIL 1P2CB 2B5IB 4R96B 4WJ5B 3ZTNL 4QRRD 3AUVA 1JGDA 4FQ1L 1NC4A 1N8ZA 2FB4L 5FK9B 1A9EA 1BFOA 4Y4KB 2W59A 1CFQB 3RU8H 3L1OH 2PYED 3QDMB 5E95B 3EAKA 4KTDH 4R7DA 5LQBL 1U3YA 3BYYA 2X10A 5EA0H 1U93A 3SDCA 5BV7L 1FLRL 1N3NA 4PLKC 4PRID 5JW4N 2JELL 4FP8L 4KGJA 4N0UE 1F6AB 2NNAB 3P2TA 4NNPL 1U0QA 2DLEA 3GIVA 4JHWH 3LOWA 4G8GE 3P0VL 1OLZA 1XF3B 1K5NB 4F9PC 1IMHC 1UCBH 2PF6A 4NQUA 3IFNL 3SJVD 2F5BL 3GSUB 4R4FH 4NT6B 4ZYKB 3UTPD 2APVA 3KGRA 1T0MB 3C60B 4JFXB 1CG9A 4NKMB 1AY1H 2IBBA 2VXSH 4PJXF 4PLOB 5CSZA 1DVFB 5D2LB 1I3GL 3MGTB 12E8L 5DWUH 3TIEA 1S78D 4JVWA 4U7KA 1OW0A 2VDQH 4WGWB 2OI9B 4OIIL 4Z7VB 3BRDA 4XMLH 1NUFA 3UEZA 5DJDA 3V4PL 3RUGF 4GRMB 3RA7L 5GS1B 4UIMB 1BBDH 2B4CL 1BPVA 2DD8L 1WBYB 4N9GA 5I75B 5IV2B 5MEQB 1DDHA 3SKMB 4PJIB 1RIUH 4OGXH 3WSQH 4R0LB 5FEBA 3BUTA 5T3XL 2ARWA 1I4FB 3PL6A 4PBXA 3FB8B 1S7UB 4G3YL 1NLDH 1VGKB 4TULL 2OR9H 3BP5B 3U4BL 4LCYA 4QHLA 4F33A 1A6PA 3N1FC 5K9QG 4I3RL 4N1CA 1X5FA 5D7SH 4U1SA 3VXUE 3TCLA 2Y25A 5LVEA 4DJMA 2WIIB 4GXVH 5D7JC 2GJZB 2Q8AL 1D5MA 1JHTA 1K8IB 4H5SB 2O5YL 4CU8A 1DBJH 3WNLA 2F19H 2F53D 1WWAX 4MA8H 5SWZE 5IB3A 3RVTC 1TETL 3SBWA 5EPMB 2NX5D 4H8WL 1Q0YH 2P46B 4OI9A 3QAZC 2R29H 4L3CB 2FGWL 3TJHA 3C8DA 3SEPA 3WN5A 1SHMA 3ARBC 1GIGL 5I1EL 3PIQA 4EIGB 2WQ8A 5GZNC 1EHAA 5EZJA 3VD5A 5I1KH 4JFFA 5HDQH 4Y5YA 4K7PY 3P77B 5JIPA 3D25A 2D7QA 3BZFB 4YO0B 4MJ5B 2FBJL 4WEBH 3QZWB 5D7KE 1JMZA 2NY1D 1J12A 5F8QC 5L88H 1FZKB 3FO9B 2BMKA 3QJFB 4ISVB 5CZXC 3T2QA 3HNVH 2A9NL 2VLRE 2CMRL 1ZA3A 2Q8BL 1IARB 1EAPA 2FX9L 3UX9B 1G9MC 4Y8DC 4NQSA 3ZKXC 5CWSA 3S4SB 3TPKA 2NYYD 3ZTNH 2ZUTA 3O2DL 1DTUA 4FQ1H 2B2XL 4Z7WB 2FB4H 1DEDA 5B21A 4GBXA 4BSWA 5I1GL 1UWXK 5LQBH 3G5YA 4LIQL 3GK8H 3MJ8B 4JN1L 2RCSL 2FRGP 3V4UL 1AXSB 5HD8C 5C0CE 5DHVB 5BV7H 1FLRH 4ZD3H 1U8QB 3QRGL 3TFKC 2CDEA 3MREB 2JELH 3EYFA 3HI6L 4XPTL 3MUZ1 4FP8H 4PJDE 4LRIA 3GGWB 1G9NC 3NPSB 4NNPH 1OPGL 3HG1D 2GCYB 5GXBB 1LO0L 3P0VH 1NBZB 3V52H 1IAOA 4QRQA 1YEDB 5HHXL 4U1HB 4PJBF 1VEMA 2BOCB 3IFNH 4NQCA 4Z8FL 2X70A 2HTLD 2BOBB 1EERB 1Y6NR 2VC2L 2QSVA 4WWID 5C0FA 4LHJB 1I3GH 4MQ7A 5IF0B 5E2WH 12E8H 2DB8A 4ZPVB 5KSVA 3NZ8B 1IAIL 1DZBA 4PRPE 5FA4B 1FE8L 2AXFA 4G8IB 4OIIH 3CVHH 1T80A 3V4PH 3O6ML 3L5HA 5CP7A 5I2IB 2B4CH 4NQDD 2DD8H 3DV6B 4LVOB 5DURD 1T1XA 4E0RB 4ONGL 4ZFOA 2HJKA 3Q5TA 4P4KC 2NY4C 2R39A 1MWAA 5DEZA 1T1YB 3I6LE 3KYNA 1TPXB 4FQXB 3ZT6A 2P5WE 3DMMA 4G3YH 4TULH 5CHNB 4Y2DA 4FMKA 2DDQL 3CU7A 3U4BH 4I3RH 3KLAB 4GW4A 4AIZB 2GK0A 4PJGF 4OD1L 5GGQL 5DSCA 2I9LA 4KROD 2XXMB 3NFSL 2Q8AH 1JYVA 3P9MB 1DN2A 2O5YH 3UJTL 3VXSA 5IMKB 4MX7B 1D6EA 2AJ3B 2DJSA 3MNWB 1TETH 3PWJB 5KANI 4J6RL 4H8WH 3FTGB 4X6CF 4FS0A 4QHUA 1EHLL 2FGWH 2FIKB 4V1DD 1VSCA 1GIGH 4JFDB 5D1QC 3QUZD 3MROB 5KAQG 3TPUB 5L9DL 3RVXC 3TZVA 3U79A 2B5IC 1MCEA 2WLZA 1VERA 2FBJH 1CVSC 3QXDB 4FOMA 1MH5A 1HNFA 1UCTA 4L8DB 4G6AC 3QUKA 4NRZB 4Y4KC 4KWUA 3ROLA 5KS9E 1UXWB 5FCUL 1XF4B 2A9NH 2CMRH 2Q8BH 5IG7A 4KJWD 2FX9H 2AGJL 3VFNA 2P8PA 4KKAC 4NZRL 4PRHB 2YEZB 3O2DH 2B2XH 3NFNB 5HVGB 4X4XA 3P4LA 4XAWL 3QQ9C 1IL1A 1S7TA 2X4PB 3PJSB 3MCKA 1IAKA 4RFEA 5MHSD 1GGIL 2BVPA 4K7FA 5I1GH 4G5ZL 1FNAA 1TVDA 4LIQH 4JN1H 3L7EA 2J6EL 3CGTA 2R2HB 3QRGH 3C60C 2VH5L 2R2EB 5DRXA 4H1LH 1T04A 4XPTH 1OHQA 4MAYA 3SCMD 2V5RA 1OPGH 3L3OB 5ANME 2ZUYA 3NZHL 3EZJB 2V2WA 5FA3B 1LO0H 3BHBA 1W2KT 5GJSL 3H7BA 3O41B 2EDHA 4IIQB 1EVTC 2O5ZL 2OI9C 5HHXH 5F9OL 4JR9L 1FVDA 1RMFL 2ZOLB 4Z8FH 2NXYD 5DJZA 4JJ5A 5D1ZB 2D7NA 2VC2H 1U3HB 2HFEB 2KKQA 4OFPA 1SJVA 3CZJA 2Z9TA 2AQ2A 3DSFL 1Z0NA 3T0WA 1IAIH 3PDOA 1CFVL 5DD5H 4S11A 1QEWA 3HE6D 3QIUD 2RJMA 1ED3A 1R5VB 3O6MH 3RZCD 4LEOB 4XXDA 3TBYA 4ONGH 4AEEA 5J89A 1VKXB 4V2CB 5HHOE 1W72A 5E03A 1X5KA 4MGXA 1B0WA 3H7LA 3ORJA 1CDCA 3CU1A 5EOTA 1BVKA 3RNKB 2DDQH 3TNNB 1RUML 2ZZUT 1YZZA 1N59A 4JDZA 4YFDB 4LHUG 4OD1H 3HC0A 3LEXA 5GGQH 1EVUA 4U49A 1R5WB 3NFSH 4N0CD 3UJTH 1L9MA 2EDDA 2Z93A 3OXRA 2WLYA 1KIPA 5LAXA 4KK5D 5I17A 4EZMA 1I3RB 1I7UA 4BFIB 1EHLH 3BRGC 1MHPL 1NC4D 2G9HB 5EFIA 1SEBA 3VG0L 4WO4C 1M05A 3DUSB 5L9DH 2IALB 1JWMB 3G04B 2BERA 5E9DA 3BOVA 3K1KC 2W0LA 2ITDA 3O45B 4ZSOA 5JTWA 4S10A 3JV5A 2X42A 3SDCD 3MBXL 1UB6B 5FCUH 1AR1D 3STLA 3TBVB 5HYEA 3L3DB 5HGHB 2AGJH 5F89A 1QSEA 2AJZA 2R1XA 5IGXL 4MQXD 4F9PA 1ZMYA 1RIVL 5BZDB 1CLZL 2NTFA 4P0DA 3NPSC 5KTEL 3UBXI 4XAWH 3Q1SL 1GGIH 2XNAB 2BNQB 3QZWG 4G5ZH 1JNHB 3SDXB 1KIQA 1WTGT 4ZXBB 3RKDC 4DW2H 4S0UC 4F3FB 2J6EH 2VH5H 3WFZA 1T7YA 1XFPA 4HIEB 3S4SG 5F7EL 2EICA 3SO3B 3NZHH 4X9BA 2YSSB 3BGMA 5GJSH 1R3JA 2O5ZH 4XNXL 5F9OH 4DVBB 4JR9H 4OZFB 1RMFH 5C0BA 1MHCB 4PJ7A 2A73A 4WNQA 3PL6D 3BEVB 4LVOC 4P2QB 3P73B 3H9HA 1U2HA 3DSFH 2O61B 3SGKA 3MOQA 5D2NE 3MLTA 4ELME 3ARZA 3DXAB 1TPXC 1OL0A 2ZOKA 4FQXC 4S0SD 4QHNA 1YNTB 2WWMD 4BQCA 1ETZA 3F6LA 1IEBB 4XWOD 1HHIA 3K4ZA 1UJTA 2VB5A 4M5ZL 4IRZL 1XGRB 5D7JA 4PYHA 3W39B 1QSFB 5IVXF 3MRRA 3VD9A 1U92A 1EEZB 4FQJL 4FN0A 1CFSB 3BKYL 5ABDE 4P5KA 3X14A 2VITB 3M1BB 3WHE1 1AGDA 3TJHD 3ARBA 2LQRA 1FYHB 2DWDA 5DGQA 3WFHA 2H45A 3NCYS 4WHCA 3L6FB 1BVLB 4P48A 2FHBA 3T77A 3HLAA 7CGTA 1NGYA 1RUMH 1WF5A 4JFFD 4L29B 2JB6A 4UINL 3O11B 1BFTA 1OP9A 4MYWB 3RHWK 4AT6A 3Q5OA 1U8JB 3QDGE 4XC3L 2DIBA 5AZ2H 4P5MB 1KIRB 1JNNL 4BM7A 4MCZA 3N1GC 3WS6C 2F54A 1DL7H 1MHPH 4EQ3A 4B53A 1G7IA 2LABA 7FABL 1MQ8A 5DMJB 2KQMA 3VG0H 3MRCA 1KENL 4GBXD 5C0DB 5CP3H 3RTQB 1NFIA 5KVEL 4KZDL 4NSKA 3LKOA 2VABA 1YMME 1ND0A 4H26A 3VWJB 3SDDB 1WZKA 3MBXH 1QBML 3QUML 3TFKA 1SQ2N 3LN9A 2JCCF 2QL1A 3TVMB 2VKXA 4XP6L 4XP4L 4LL9A 5IGXH 1HDMB 3MV9A 2JK5B 1QKZL 1RIVH 4G6JL 1MJJA 1JP5A 5JO5B 5KTEH 3GB7B 4NQCD 4O00A 4YDKH 2VR5A 5T1LB 1T89C 4IIQC 1T2JA 1NANI 1NMCB 4GJTB 1QFWI 2D0GA 1F58L 1MIML 4MSWA 5D1ZC 2YRPA 4LBEB 5ISZE 3EDKA 3HI5H 1NCTA 5TDOA 5BO1L 1SYSB 3N1QC 5FYJE 3SE4C 2UYLB 3A6OA 4R7NB 4XWGH 1JF1A 4XP5L 1J8HB 2X4UB 1VB9A 4XNXH 2H1PH 1BEYL 4WV1B 1CXEA 1P7QA 4P4KA 4Y16B 1ZLSL 1FQ9C 4YAQA 1RZ7L 3OKNA 3I02B 1XR9A 4LGSB 3FT2B 3CLEL 3DMMD 2ENYA 5KG9A 4HEPG 2DRUA 5KJRL 5I16A 3DX8A 2AV7B 2YS4A 4Y2DD 2ZG1A 1WAAE 3QUYB 3T09A 2ARJQ 4KHXL 1J0KA 1AD9B 4TTGA 4K3JL 4XMKL 4M5ZH 4IRZH 3MRNB 1KIUA 1AGEA 3X17A 1CN4A 1KCRH 3HMXA 4GW1A 3E6HA 3KLHD 1LWRA 1KJ2A 3VXSD 4WFFD 4JHAL 2XWBA 4I9WD 5DUPL 5D6CA 4LFHD 3LKSA 3GSOA 1Y6KR 4FQJH 1X5JA 4WRLA 3BKYH 5L8LB 1HQ4B 3KS0J 5AZEL 2VQ1A 5D1QA 2J2ZA 1P2CA 4R96A 4WJ5A 2JIXB 4Z7QF 3TZVD 3BPLB 1BQHB 1YPZE 1INDL 3PV6B 4JPKL 3D87B 2RHEA 4XMPH 4UINH 3T0EE 2MQCA 3BDBA 2VLJE 3S35L 1CFQA 1X5HA 1A9BB 4XC3H 2XT1B 2EDQA 5LKNA 3V7MA 4KUCD 4LPUA 2L7JA 1G7PA 1RJYA 1JNNH 2ZNWA 3JXAA 4NO0B 1TITA 4AEHL 5DRZB 1KCGC 1A5FL 2P1YA 3N85L 1F6AA 2NNAA 3T2OA 5GQBA 7FABH 1DP0A 4LSVL 5HI3D 1A22B 4J3WA 3CXHJ 1KENH 3VFGL 3K74B 4EXPX 1PEZA 4UOW1 4KZDH 8FABB 1CK0H 5CIPH 3FQXA 3GSUA 1E4XL 3RWIB 4NT6A 4ZYKA 3EGSB 2HLAB 2VJXA 1OGAA 1QBMH 1T0MA 4X9IA 3C60A 4JFXA 2DJUA 1AQKH 3QUMH 4NKMA 4FFEX 3BD3A 4ZXBC 3D2UB 3JVGC 1NFDF 4LRNL 4MAYD 2Q76B 2M2DA 1P53A 4POZD 4XP4H 3WUWB 1F4XL 1XF5B 1QKZH 4G6JH 4PG2C 2OI9A 4MXVE 5E56A 4GRMA 2GJ6E 5I8OH 6CGTA 5IV2A 5E2UL 2XWTA 3CUPB 1EBAA 1HYSD 4H20H 2YD8A 1F58H 1MIMH 5TJWK 1I4FA 4U2ZA 1Z2KA 5F7DB 5JQHC 3ZSTA 4LMQI 4FQLL 3FB8A 3WXVL 2ZG3A 3ES6B 1L0YA 1HWHB 5BO1H 3PDDA 1GHFL 2IGFL 5IIEB 3F7RA 5JDJA 5ITFB 3BP5A 1JNJA 5HBBA 3CFEB 1WEJH 1BEYH 3MLZL 4F37K 1ZLSH 2B0SH 2GJZA 3BX7C 1RZ7H 4H5SA 4ZFFB 5FUZL 3EOYG 4F9LC 1R0AL 2VXVL 4P23A 4P3DB 4Y5VB 4YPJA 5B8CC 3CLEH 1CBVL 5KJRH 1FAIL 1B0GA 2XTJB 4L3CA 4AY0A 3R06B 4KI5D 5GRVL 1FNSL 4HKZB 4KHXH 3RNQB 4K3JH 3KXFB 4XMKH 2W65A 3I6KA 5I8CA 1Y18A 2CSPA 4OZFG 1SJEB 3P77A 4HUXB 4CL7A 1F3DJ 3BZFA 2R15A 4MJ5A 2NY0B 1DN0A 4JHAH 4YO0A 1BD2B 5GZOC 5DUPH 2IJ0C 1FZKA 1PLGH 3FO9A 4EQ2A 3CIQA 3T3MF 2LU4A 4K3HA 5AZEH 3KPMB 4W4NA 3L5JA 1ZV5A 1QLFB 1X9QA 2EDFA 4WO4A 1SM3L 4RRPA 1P7HL 4JPKH 1INDH 3T4YB 3TBSB 3IAPA 5E9DD 1CFBA 1GXEA 4RIRB 3BP7B 3S35H 3CFBB 5MEPB 1CGTA 4YHYB 1A1MB 5DS8B 3RTQC 3M07A 4PLKD 5A2LH 1UT9A 5D72H 5IMOB 2PTVA 3PHOB 3MJ8A 1HCFX 1AXSA 3SDDC 1QSED 3KG5A 1U8QA 3HAEG 4O5LL 3MREA 1A5FH 4OZGF 3N85H 1N6QL 4HKBB 3TVMC 1PKQA 3GGWA 2GCYA 2F8XC 3VFGH 1O0VA 5M95B 4D0CA 2VOTA 4U1HA 1RURL 1FFPB 2Z92B 2BOCA 1T20A 1E4XH 1T6WA 3QFDB 3GSQB 3IU3A 5IT2L 2HAZA 2VDOL 1A7RH 1NMCC 2PETA 1MEXL 4TUKH 3RI5K 5L7XL 4MB4A 4LRNH 4PG9B 1JPGB 5IF0A 1OAXH 3DUHA 4ZPVA 4XCFL 3NZ8A 1F4XH 4U1KB 3S3JA 3HZMA 2J4WL 5FA4A 4JPVH 1A1OA 3QYCA 1CLOL 5ALBL 4DQOL 3MXWL 5C0BD 5I2IA 1NAMB 3DV6A 3KHOA 5L2JB 5E2UH 4HXAL 1R5IB 4E0RA 1KB5B 5FECB 4WV1C 5EO0B 4I18B 5T1MB 2YZ1A 1IJ9A 4FQLH 3WXVH 4FQXA 3PQYB 3WFDH 5DRNA 5C70A 1NDGA 2OCFD 4K9EL 1TENA 2IGFH 3T3PF 4RBPH 5CHNA 4AZ8A 3QUYC 5GS0L 5D7JD 2CLZB 4LU5L 1LD9B 3KLAA 1BJ1H 4AIZA 1BHGA 3UYRL 4GKZB 5E08H 2QSTA 3MLZH 2RR3A 5F97E 5D70L 2AJVL 3MRIB 4K8RL 5FUZH 4RMTA 5IMKA 1R0AH 1T2XA 2VXVH 3UJIL 4LASL 3MNWA 5BJTB 2DIJA 3ARBD 1CBVH 1FAIH 3FTGA 5GZND 4CVWA 2WIMA 3DO7A 3DOSA 4HUUA 4RQQB 4C58B 1A6WL 2FIKA 5FOJA 1FNSH 1VFOA 4JFDA 3R8QA 3MROA 1ORSB 5ENWB 3TPUA 1IAII 4PGBB 4WFGE 2ADFL 3BPLC 3SOBH 5CZXD 5F1OB 1H3WM 4CADB 5B38G 2GT9A 3QXDA 4ENED 1DQTA 1TNNA 5BZWB 2BSSB 1K4CA 1KTLB 3WS6A 1UXWA 2F54D 4CU6A 3HS0B 2J8HA 5KSBE 1OQOA 3ZDYE 2FH6A 4AENA 4EI5B 2DLTA 1KCSL 5IVZB 1SM3H 4WTZA 3CFDB 4PRHA 3MOBH 3NFNA 1AR2A 2E7LE 1T2QL 1P4BL 3RUGB 3LY6A 4Z9KB 1I1CA 4WUUE 3PJSA 5GGTL 5HD8D 3LHPL 3TFKD 3RRQA 4PV9B 2VXUL 1NBQA 3G5XA 4U6XB 1B90A 2R2HA 5INDB 3MV9D 2VDRH 2R2EA 4MVBC 4O5LH 2I27N 2X4TA 3IDNB 4Z6AT 4OLUL 5FHBL 4LARL 3L3OA 3MGAA 1IT9L 1PY4A 3P11L 4CMHB 2QKIB 2E6QA 2IAMB 1T89A 1U8KB 4FG6C 1RURH 1RD6A 3MXVH 4I48B 2ZOLA 3E6FB 1U95A 5IT2H 1MNUL 4L4VB 5D1ZA 3FO2A 1E0OB 3MBEA 2HFEA 2VDOH 5BOPA 1MEXH 3EDJA 5F88B 5L7XH 5DXWA 3MODL 1NCDL 4XCFH 4UB0H 3MLWL 5EU7C 2CRMA 2J4WH 4LSUL 4NOBA 2BSTB 4XVUC 1CLOH 4FQIH 5ALBH 4DQOH 3MXWH 5JOFA 1P7QD 4P4KD 4QXUL 1RZGA 2NY4D 4PJ5E 2AW2A 1AC0A 2HYMA 4HXAH 4EUPG 3VGHA 4MJ4A 2AXHA 1Q72L 1FORL 3NIGF 2O93L 1M71A 3LV3A 1BX2B 5E8EB 4Y5VC 4M7LL 5I1AB 3OQ3B 4K9EH 2XTJC 4MZ3A 5FGCB 3RNKA 3SKNA 5GS0H 3TNNA 4XC1L 3MJ7B 4LU5H 2EIEA 1FPTH 3UYRH 4AEFA 1FV1A 3PWLB 3MRJB 1U9KA 1RK1B 5D70H 3SKJL 1R5WA 2AJVH 5KW9L 4K8RH 4LEXL 4XCCL 5D5ME 4HCRA 4I0PB 5DJ6B 3UJIH 4LASH 3VRJB 2MCG1 3L7FB 1W0WB 5D1QD 4G9FB 4YJZL 1I3RA 4J3SA 4XI5C 2FJFB 3QQ3B 3RVXD 4BFIA 4S1SL 1A6AB 1JGVL 2H2PC 4PS4L 5E7FA 3BUYB 5I1DA 3MV7B 4G6AD 2NZ9C 2IALA 3RWEB 3G04A 2GEEA 5JIKA 1QSZA 4PJBB 2DQDL 3KJ6L 1CCZA 1MUJB 4GAYB 4JGJA 1CICB 3HC3L 4XAKE 3O45A 4M6OL 5IB1B 1LNUB 4KKAD 1FYTB 1UB6A 3CJJA 4QCIB 1HILB 2APWA 4YHIA 4WUKL 3L3DA 4N0UA 4HGWB 3VXNB 2Y7QB 4H88L 1KCSH 5BZDA 1N5YL 1SEQL 3GM0A 3OB0K 2FWOB 2WM0A 2V2TB 5GGTH 3LHPH 1OGAD 2YUZA 4JFHD 3B43A 1PY9A 2PUQT 1KLFA 3C60D 3JWOC 4GAJL 3THMH 1C8PA 2VXUH 4ZXBA 5GS2H 3JVGA 4F3FA 5SX4I 4HPYL 1REIA 3OJDB 1DQML 5MP6L 1BREA 3CFJB 4PG2A 3IDIB 5EH1A 2AK4E 5E5MB 4OLUH 4HIEA 4LARH 2H32B 1PBYA 4MHHG 5C6TL 1IT9H 2DQUL 3P11H 2YSSA 2CKBL 1OF2B 1H0DB 3GSWB 3VI3E 3CH1A 1ZKAA 3AS3A 4LCWE 1FP5A 4DVBA 2Y07L 4HFUL 4PJGB 1RUPL 3D39B 1MHCA 4EDXB 3WCYA 3ZHKA 1NCAL 1MNUH 1ZT4B 5HPOA 4X5WA 4P2QA 1KTKE 1NGZB 4LQFL 3MODH 4I18C 4X6CB 3D3VB 3PE9A 2O61A 5D2NC 4PJ8B 3WNOA 3MLWH 4GRLB 4LSUH 5LGJB 3U0TA 2IANE 3VXUA 5F7FA 3UXFA 3RDTB 4M7JL 1KGCE 4QXUH 4FQQB 4F9LA 3W39A 4G42A 4FTVB 4X0KB 4P23D 4X5LA 5B8CA 3P0YL 1IEHA 1EEZA 2BVQA 1FORH 2FLBT 1CFSA 4X99B 3QISA 1EA9C 4Q2ZA 4M7LH 4BFEA 3LQAL 4WDIB 4QNPF 4HH9B 3L6FA 1BVLA 3HE7B 3REWB 2R1WB 4XC1H 3DROB 5TFSH 4L29A 3O11A 4MMXC 2J88L 5E99L 3BH9B 5GIRB 4U4BA 3SKJH 1U8JA 1HSBA 4XCCH 1S9WA 3MLVL 1KIRA 1MREL 2L7UA 4RISL 5JHDE 1JZ5A 4DUVA 4ODXB 4WO4D 5J1AA 1T0NB 4XGZA 3ARUA 3CSGA 4LMQE 4S1SH 5H35B 4KKCC 3BESR 1JGVH 1T83C 4Z78B 4PS4H 1YEIL 4C83A 3H9SE 4EI5C 2APTA 2C7UA 1ES0B 3RTQA 4BQBA 1KEML 1LP9E 3SGJC 3KJ6H 2DQDH 3K0WA 1V7NL 3HC3H 2YPLE 4IHOB 3SDDA 4PJFE 5IK3B 4HZAA 1KOAA 3TVMA 1T66C 1V7ML 4PJDA 5FF6B 4Q9QL 1G9MH 1FJ1B 5DYOB 4H88H 1HDMA 1VFMA 3HR6A 3QG6B 4Z7UF 1N5YH 1YJDC 2ZCKL 1SEQH 3KPOA 5JO5A 3GB7A 3DURB 1YEHH 3B5HA 3O4LB 3RKDD 5IQ7L 1TMCB 3UTTB 4CMHC 5T1LA 1LHZA 2IAMC 1K4DB 4B7LA 2IFGA 4OZ4A 3VI4F 4JRYB 5IW1B 3I50L 4PJEE 3W11C 4U1LB 1CR9L 4HPYH 2IC2A 5JOEA 1CXIA 4PR5B 4LBEA 3BP4A 5MP6H 4PTUA 2A83B 4ZQKB 4OT1L 5A2JH 2AEIT 2YXFA 2AKRB 3RGVB 3UZQA 1WCBB 5C6TH 2DQUH 1B2WL 1XAUA 1CDYA 2OQJB 2UYLA 4EBQL 4R7NA 1I9JL 3FOLB 1J8HA 2X4UA 3H9ZA 2Y07H 4HFUH 1RUPH 4WV1A 1EEYA 3NIFE 3IDYB 4DEPC 3WHXB 3MYZA 1JN6A 3WIHH 2UUDH 3JTTB 4IOSD 4FQXD 3C09B 3ZT7A 3FT2A 2P5WA 4LQFH 3CVIH 5IW6B 4NYLA 1HH6B 3TYFB 3BW9B 4WHYG 2ESVE 5HYJE 4XNQB 2HT4C 4NPYA 2BFVL 3OKOB 5JA8B 5JORA 1AD9A 5BS0E 3QULB 4MQTB 3QI9C 4DZ8B 2P47B 1P4LB 1QUNA 3TO2A 3GMOA 3GZKA 4E42B 4YBLB 2Z91B 2GQHA 4NN7B 3WEXB 5HGAA 1ZS8A 4I0PC 1OCWL 1HQ4A 4UDTB 3EOBA 4JFDD 1JPTL 3B3IB 5GGRB 5C3LD 4D3CL 2RQ8A 2JIXA 1M7IB 1BQHA 3PV6A 3MJ9L 1AO7B 4JKLA 3T0EC 2J88H 2W0PA 4HXBH 2XN9E 2VLME 5JXAL 2RIKA 1A9BA 5KS9A 5DEGA 1RQ5A 3A67L 2JJSA 3MLVH 4PJ9C 3RGHA 4Z77B 1J1OH 1MREH 4N8CL 4NO0A 4QRRE 1VADB 5DRZA 4BFGA 4PRHD 1N6VA 3ARVA 3DLQR 2R23B 1Z6JT 1L6ZA 4P4RB 1YEIH 4PV8B 2PYEE 4HWBL 3SDYH 3AC0A 1KEMH 1EIBA 2WBKA 8FABA 1T5WB 1J88A 2D0HA 3EYUL 1E4WL 2B20A 3RWIA 4PRIE 3EGSA 2VNCA 2P44B 5IUSA 1GYAA 1UGNA 1FBIL 3S9DB 4MVBA 5E94A 2X2YA 3CSPA 1V7MH 5HYFA 4HWUA 4QWWC 4YLQT 4Q9QH 3MRHB 4CJ1A 3WUWA 2YUWA 5ANMA 2PW2B 3BMVA 3MLRL 3QIBC 5J3HC 4QRSB 2ZCKH 4W6XB 5IQ7H 4U1JA 4ZTPL 3U36B 3UTPE 1G7LB 5FM5M 3QT2A 4GXUN 5D1ZD 1JV5B 2VZOA 3MBED 5IVXB 3CUPA 1MVFA 1S7SB 4QYOB 5FV1L 4UTBL 1QHOA 3I50H 4HULB 2G75B 1CR9H 1A4KB 5F7DA 3WLBB 2YN5A 1PKOA 3OJVC 1NCUA 3ES6A 1OTUC 4DN3L 5J7CC 3ULVF 4POUB 1XCQA 4OT1H 2VSDA 5IIEA 3GUTA 4APQB 4JGMA 5HJ3B 2ID5A 5BCAA 3DBXB 4PJ8C 1B2WH 3S8WA 5C86A 3CFEA 4YHLH 1HK6A 4GRLC 2DICA 4PJHF 5E7BA 4U2YA 4JFEE 2HN7B 2X9YA 5SV4A 3RDTC 2C1PB 5HHOA 2EEBA 3BJLA 4ZFFA 4P3DA 3G5VA 4Y5VA 1E4XI 4HS6A 4CMMB 4LQ1A 3IDMB 1MI5B 5DHYA 3R06A 4WEMB 4LSSL 1J0YA 2AERT 2IBZY 3BVNA 5FGSA 1ADQH 2BFVH 3RNQA 3HUJF 4WW2F 5TE7L 3KXFA 1MJ7H 4YPGA 5H2BA 3IDGB 3HE7C 5BQ7B 1SJEA 5JA9A 2QBWA 4ODSL 1HHJB 1BD2A 3UP1A 2NX5E 2HJLA 4OD2B 4OIBA 2JCCB 1OCWH 1TQBB 5IM7A 3KPMA 1NPUA 1JPTH 4D3CH 5C1MB 3MACL 2BX5A 2MPAL 3T4YA 2DQCL 3MJ9H 4RIRA 4YK4B 3CFBA 5JXAH 1BJ8A 3BPNB 5MEPA 3FFCB 2DAVA 1GJIA 1A1MA 1D5ZA 5DS8A 4JHBA 3A67H 1U3ZA 1ZA6B 3C6LB 3EO0B 5F6HI 3VRLF 3NAAH 4N8CH 2WP3T 4ZUWB 4Z5RA 2YRLA 2E9JA 3VXTA 1EXUB 2QQNL 1A3LH 1JWSA 4EDWL 4X7FC 5FM8A 4HWBH 4M7LT 5SX5K 3GM8A 1K2DA 3TH3T 2Z92A 3VGEA 4ZXBD 4HD9A 3EYUH 1E4WH 1PG7X 2ZUQC 5HYSA 4I1NB 3GSQA 2NY2C 5D96C 4AEIH 4BA8A 1FBIH 1NSNL 4X6DE 4ZOBA 1Q38A 3HG1E 4PG9A 1JPGA 3TBTA 4JN2B 4N5EC 3LN5A 3MR9B 5DHVH 1BLNB 4U1KA 1IKNC 1SYVB 5E8OB 4JVUA 4XXCA 3RGVC 2PYFB 2AJXL 4ZTPH 3LCYA 4JZNB 2X4SB 1NAMA 1R5IA 1KB5A 4P2QD 4MXQC 5FECA 5EO0A 5I73C 1DANU 4I18A 4UTBH 3IDYC 3P4NB 4OLEA 3CXHK 5D2NA 4ELMA 3KYAA 4DN3H 3C09C 4DK3A 3IFPA 3IDUA 3BN3B 4TVPE 3VXUD 2XY2A 4Y8AA 3FRUB 4NQDE 4RDQG 2NY3D 2CLZA 5BVJA 3T2PA 1ZLUK 1RZJL 4NDMA 4ZUSB 4GKZA 4X5XB 1EV2E 4F7MB 2HWZL 3MRIA 3U2SB 1EBPA 3SKUD 5BJTA 2D0FA 3QA3B 1UEYA 3OF6A 3FB5B 4TN9A 3O3AB 1UG9A 2E9WA 5ICXB 2QSQA 4NN7C 3K8KA 4DGVL 4LSSH 4JB9H 4HIIA 3PWPB 5ILTL 1NEZA 4QRUB 2I24N 5GZOD 4ORGA 1LDPL 5TE7H 3CMOL 4PGBA 4JFQB 5D7KD 5FO8B 4CADA 4PB0L 3QDGA 4ODSH 4RAVB 4X6FA 1TVBB 5IHUL 1CTNA 3QFJE 4MDJA 3LN4B 1OSPH 4JREB 2QSCH 4NM8H 4KRPB 1CDBA 1NFDB 1T83A 3JTCA 3ARXA 3DGGB 2BRQA 3MRKA 1CL7L 3Q6GL 2DKSA 4EI5A 3BXNA 3X3GL 3MACH 3CFDA 2MPAH 5ICZB 3RTQD 2DQCH 3SGJA 4V3EB 3F7VB 3PP3K 3I9GH 4M8VA 4QKXB 2CUIA 1DANT 1YMMA 2A6DB 3SDDD 2G5RA 3VFUB 4ODWA 4XP9H 3IS0X 3MRQB 3DRTB 3TVMD 2VWEE 2P5EB 5INDA 2QQNH 4EOWH 3K80A 5EWIL 4EDWH 1X4YA 1M7DB 2EXYD 5MEOA 1PD6A 3CH8A 4OM1L 4P2RB 1FSKB 2QKIA 4RGOL 2IAMA 5T1LD 3NCYP 2J7LA 3ZE0F 4C56B 3E6FA 4XRCB 2B7DT 1S5IH 4J4PC 4L4VA 1NSNH 3HC4L 4FQPA 5F88A 5D5MF 4BH7A 5CUSL 5IFAH 5SWQB 2Q87A 4PTTB 3V8OA 4NBZB 1LDSA 3FQRB 2BSTA 1I7ZB 4GKSB 1MRDL 1J8HD 5J12C 2YWYA 1OTTD 4W70A 2FO1A 2AJXH 1YMHB 1FZOB 3I6LD 3ZDZF 2P5WD 5J9PA 1D9KB 1WAAA 1BX2A 1FNGB 3BP6B 5I1AA 3QI9A 1B6DA 2XWJB 3E1F1 3MJ7A 4U3XA 3O0RH 5JW5B 1RZJH 1IBGL 5FXCH 3BZDA 4O9HH 4F7EA 3MRJA 1MCIA 2N56A 2HWZH 3ARTA 2VSCA 4NKDB 4I0PA 5DJ6A 5K9QI 1ZGLB 1ZANL 2HFFB 4OZHE 3L7FA 1W0WA 5IESL 4G9FA 1KCLA 4I2XE 2FJFA 3QQ3A 3KNBB 1AIFB 2JIXD 1A6AA 4GUPB 4OZGB 1TQBC 5ILTH 2EIDA 1YDPA 3G6JE 3T0EA 1WK0A 1V05A 3BUYA 2VLJA 3MV7A 1BP3B 3RWEA 1RY7B 4X4ME 4PJBA 4PJ9A 1NGXA 5JDSB 1MUJA 4GAYA 5IHUH 1KCVL 2W0FB 3LEVL 3PABB 1X44A 1LNUA 3BPNC 4NO0D 3TV3L 1FYTA 2EEAA 3UPRB 1Q9OB 4QCIA 3C6LC 2GAZB 3KPNB 2A38A 5MENE 1CL7H 2Y7QA 4Q6YA 4H0GA 3X3GH 4H1LB 3TNMB 1E4KC 1FG2B 4L8SC 4IOIA 2W0KA 3IRZA 4DN4L 1B0RA 1QA9B 5CEYA 2FWOA 1KLUB 2V2TA 1F4YL 4MVBD 4HJGB 1ZHBB 1BFSA 1MCNA 1NCNA 4PRAB 5EORL 3OJDA 4JRXB 3QIBA 1XGUB 5EWIH 3CFJA 5KBNC 5EUOE 3IDIA 4KMTL 1FFOA 5E5MA 4YHML 1XR8B 4OM1H 4PGJA 1OF2A 4RGOH 1H0DA 5HGBB 4D0DB 4YE4L 3HFML 4PJGA 4HJ0C 1CWVA 2Q3AA 3H2WA 3D39A 1YEFL 4JY6B 2EYRB 4EDXA 4KC3B 5KZCD 5CJQL 1ZT4A 3MA7B 3HC4H 4YFLF 4M1DL 5DJCA 1JWUB 3EDDA 1NGZA 3VXMB 4EXKA 4LOUC 4J7RA 4MDIB 5EU6E 2EKJA 4DTGL 4QRTB 4YBQD 3TT3L 5I1HL 4D9LL 2J1KA 3QDJB 3EJJX 4GRLA 3RX5A 1KCUL 1HOCB 1MRDH 5EIIB 3ARPA 5C07E 3RDTA 4IRJB 2ICWB 5HHOD 3SO5A 4X0KA 4U1MA 4EIZC 4OZFH 4QOKE 4UV7L 4OV5B 4KV5E 2XTJD 2CJUL 1FL6B 4OCWL 4PREB 4YFLI 3LRHA 4OZIE 3QCTL 4MD4B 4ESKA 3R1GL 4F15B 4WDIA 1ZAGA 4HH9A 3KXFD 3W5MA 3HE7A 3PV7A 3REWA 5IVNA 3DROA 4X83A 3VA2C 5I1CL 5EC2B 1X5XA 1IBGH 5EG6C 2V5SA 1BD2D 5ACLA 1I8KB 3EYQC 3MOAL 2R1YB 3PWNA 5GIRA 5JLZB 4NWUL 4XI5D 1JYNA 3FQNB 5DA4A 1ZANH 2H2PD 2XI9A 2GSIA 5IESH 3B9VA 4JREC 4ODXA 4JFFE 1RVFL 4X9GA 3BWAB 2W9DH 2NZ9D 1R3KB 4Z78A 3HAEH 1S8DA 5BV7C 1NDMB 3TYGL 4ZFOL 4HUVB 1IGTA 4X6BB 1FNLA 4WI9A 4HIJA 1UB5B 2EDNA 2P7TB 1KCVH 3LEVH 4IHOA 3CPLB 5J56B 5IK3A 2R2BB 4X7SL 4PLJC 4A6YB 1MFEL 5FF6A 3X12B 1FJ1A 5DYOA 3PNWA 3QG6A 1K8DB 4XNMB 1MFDL 1CI5A 4M62L 5GHWL 4DN4H 1TMCA 1VCAA 3QR2A 1FSKC 3PGDB 5A2KH 1K4DA 4IOFC 5DDHB 1QSVA 1MPAL 3QWOA 1OP5K 4HX1B 4P3WA 2B4CC 5IB2B 4N5EA 1YEEL 4PR5A 4ZDHB 1I7TB 1CQKA 4J3UA 4AYFA 2IPUK 2A83A 1QBBA 1IKNA 4NQCE 2YHGA 4KMTH 1LO4L 3UO1L 3WIFB 2AKRA 3RGVA 4YHMH 5CBEB 2OQJA 2NPLX 4PRNB 2NY5L 1DBBH 4YE4H 3HFMH 5DC9B 4MXQA 1T4KB 1YEFH 3LDBB 4KHTL 5CJQH 3ZE1F 2BVUA 5C8JA 1UKQA 1ACYL 3JTTA 1CVRA 4M1DH 1LK2B 2EEDA 4DTGH 3TYFA 3BW9A 4D0BB 5I1HH 1D9KC 4D9LH 5IKCB 3OX8B 2FEDC 3OKOA 5JQ6L 4H8WC 4DVRL 1YNLL 3QULA 3LH2H 5E6ZA 2Z35B 3D0VB 4HV8B 5DRWB 3VCLA 3KPRB 4DZ8A 2W91A 3QPXL 1LEGA 4FFZL 1A21A 32C2B 3OF6D 4E42A 5T1KB 2CJUH 4OCWH 1XIWC 3IT8D 2DWEB 4UDTA 3QCTH 3GSVA 3SHSA 3R1GH 4Q9CA 5DFVC 1D3CA 3V0VB 1A7NL 4BFBD 5TE6H 5J06A 1M7IA 5B3JE 5I1CH 4I9WE 3FAXA 3QEHB 3QDGD 4IMKC 4KKNA 3TJEL 2B39A 5JPMB 3MOAH 1ZVHA 3QQ4B 2CIIB 1U6AH 5A16B 5GRYA 2YA0A 4NWUH 3F8UB 4KKCD 4Z77A 1WWWX 5KSBA 3NH7H 4MXWL 5SWSE 1VADA 3LPWA 1U8PA 4EI5D 5L6YL 3KLSA 2MHAA 2OLDA 4G80B 1IGCL 3DIFB 4NO3A 1EHNA 2QADB 4PV8A 1MCWM 3ZYOA 3TYGH 5ID1B 2FCBA 1YMMD 2X9WA 1CGXA 3GMPB 3MV8B 1LO3L 2A6KB 3GSRB 1T5WA 1IQDA 1UC6A 5F7MC 1T66D 1RZIB 5EBMB 5C08B 3U7YL 5GRWA 3B9EA 2DM3A 1MFEH 2KQNA 4F2MB 4CVXB 2WMPA 4KDWA 4YDVA 3LKRB 2PW2A 3Q6FB 5DTFB 2IAMD 3VXRE 3NOIA 3LKPB 1MFDH 4QRSA 1S9YB 3JV0A 2E27L 4M62H 5KOVC 5JZ7C 2XA3A 4HT1L 5GHWH 5A2FA 3U36A 2VZ3A 3W11D 5IQ9B 4L4VD 3GMLB 4HWEL 2DQHL 3VMOA 4S1RH 5IVXA 1W8OA 1MPAH 3OKEA 2G75A 4F37F 4EUPH 3WLBA 1YEEH 5FYJD 4LLUB 3DX6A 1X5YA 3U7AA 3OKLB 2CLRA 1LO4H 3UO1H 3IAGC 3HB3C 4RWYH 5HJ3A 4XBGB 2D7PA 5FYLL 2NY5H 5CD3A 3J7HA 5HHME 4O51B 2HN7A 5E8DL 4KHTH 3VFVB 4IRJC 2C1PA 5B39B 1ACYH 3MGOB 5IEKB 4OLXL 2ICES 2HT4D 4CMMA 2FATL 3IDMA 1UQSB 1J0JA 5IB5B 1PX3A 3RQ3A 3QI9D 4KVCL 5CEZL 2FBOJ 1IM9B 4IM8A 3BGFC 5F44A 4F15C 5JQ6H 3TA3C 1Y0LB 1YNLH 4U31A 1YYML 3WS3B 4LLVB 5BQ7A 4KK8C 3KYKL 4NQEB 3AB0B 3QPXH 1HHJA 4I0PD 4FFZH 4L3AA 4OZHB 2COQA 4OLZL 5MERA 4G9FD 4KTEL 2DJ4A 2JCCA 3DX7B 3E8UL 3ULSB 4G8FB 4ONHA 3T0ED 5IOPB 3GKZA 1XGQB 3CNKA 2VLJD 3MV7D 3BIBX 1I1FA 3ZKNC 2XA8L 4Z7UB 4C57C 3VRIA 3WJJC 1OSZB 4PJ9D 1QRNE 3TJEH 4MJIB 3VGDA 3FFCA 1FYTD 5GRUL 1FZMB 1WICA 5IWLA 5CIPB 1ZA6A 2BCKB 3C6LA 3EO0A 3VMNA 5I9QB 1I8LC 3Q2CA 2Q7NA 3HHRB 4MXWH 4BQ6A 3VH8G 3EO9L 5E8PB 3QUMB 5L6YH 2I9TB 1E4KA 3IETA 4L8SA 4WI8A 5T5FH 3S5LB 3RL2B 3RVWC 1UKSA 4MAUL 1DLFL 1H3UA 1LO3H 3P4MA 4NFBA 1MAML 4U6YB 1XGTB 1T3FA 4N0RA 1QSEE 1ZHKB 2HLFC 3U7YH 4QWWD 1SJHB 3CSYA 4YUEL 5DJ0A 3MX0A 5DUBB 4Z7NE 3GBLA 5D93B 3BSZL 3QIBD 4TSBL 4AH2B 1A1NB 3DGCR 5J3HD 5EU3B 4ZUTB 4JN2A 5JW3L 1BLNA 2ERJC 43CAB 3ZE2F 3EUUA 5E8OA 2E27H 1Q9WB 3TN0A 4HT1H 3D39D 3O6FB 3WO4B 2X4SA 4IS6A 2DQHH 2IBGA 1OTUD 2CH8A 2J8UF 2NR6C 2YD2A 4EVNB 4XHJC 2R4RL 3LDBC 3SQOL 1A4JA 4JQVC 3PGFL 1WJ3A 2XG5A 1MCPL 4GRLD 3NCJL 4O58L 1QBLL 4PJ7E 5HDBF 3KR3L 2IANA 3I3DA 3FRUA 3P40A 4NQXB 1NLBL 5FYLH 3LPFA 3WKNA 5HGDA 1FC2D 4ZUSA 1KJMB 4X5XA 4NRXB 4A2MA 4RX4A 4HMCA 1GAFL 2AEWA 2XKNA 5E8DH 3KJ4C 1WBXB 1HHHB 3U2SA 3IF1B 1IRAY 5EN2B 4CAGA 2VLKB 4OLXH 3ILPB 4I3SL 3QA3A 3RP1A 2FATH 4RMVA 3O3AA 5HHNA 5ICXA 3QXUA 3HE7D 4KVCH 5CEZH 2D03H 4ODTL 2ZNXA 2F8OA 3OMZA 1FN4B 2LV4A 3HNTH 4QRUA 2GITB 4JFQA 1WQVT 1YYMH 5FO8A 1WZLA 3KYKH 4AL8L 2I25N 4RAVA 4O2EB 1BWMA 3KS0H 1JVKA 5LGKA 2BK8A 1IGIL 3LN4A 4ZFGL 5JHDA 2OSLB 4Q74A 3G6AB 4KTEH 5C3TA 1OAYL 3BAEH 1NFDA 5HYSG 3E8UH 1BZ7B 3DGGA 1JZ8A 2MTPA 4OM0L 2HTKC 3H9SA 1G1CA 2XA8H 4HBCL 5ICZA 2AJUH 1LP9A 3F7VA 2YN3A 2QADC 4M3KB 4LVNB 2A6DA 4L4JA 3D85B 4PJFA 1BQSA 5GRUH 3VFUA 3QNYA 5ESVA 3MRQA 1Z3GL 3U7WL 2ATKA 4M7KL 4YC2B 3HZKB 1IFHL 3EO9H 1JGEB 2VWEC 3P9WB 4NCDA 3WFBL 3T2NH 2Q7YB 4K07A 4NHUB 1MSPA 1KJ2L 5GSVB 3T8XA 3MLSL 4X98B 4BZ1L 4MAUH 2EDEA 5CINH 4ZMAT 1FNFA 2NY2D 2DM2A 5F6IC 5T3ZD 3DPBA 5IJVA 4PJHB 1MAMH 4C56A 2X4RB 3CVHA 2C4XA 4LKXB 1MCOL 1CYGA 4ZPTB 2DTML 4YUEH 4N5ED 3HKFA 3BSZH 4TSBH 5SWQA 3GMQA 4HHAB 4P2CG 2PTTB 3RGVD 4AM0A 1YUHB 5JW3H 4FXGB 1UM5L 1CL7I 2KZ1B 3MV11 3HUJB 4WW2B 1QG3A 5E1AB 4MXQD 3QIWB 1PG7L 5IVOA 1AGFB 2UWEF 2G5BB 4NM4L 1XGPB 2R4RH 1U3JA 1T1ZB 3SQOH 3BIAX 1D9KA 3PGFH 1U8OB 2VRAA 3V5HB 1AXIB 2ESVA 3W2DL 1MCPH 1FNGA 2CGRL 3T0XA 3BP6A 4JO2L 2E8ZA 3NCJH 4O58H 3TF7C 1QBLH 3KR3H 5BS0A 1DR9A 1HH9B 2XWJA 1I7RA 1NLBH 1VEPA 2E9IA 3MUGB 1GAFH 2CXKA 1Z9OA 1TTUA 1XIWA 1OAUL 2R0ZL 4NKDA 5DQJB 3AB0C 3QEUB 1ZGLA 1EO8L 3H3KA 4I3SH 2XPGA 1JRHL 1DLHB 2E6JA 3ARFB 1UZ6F 1NGPL 4F57L 1YN7B 3RWDB 1CT8B 4GUPA 4OZGA 4WFGD 4ELKB 4ODTH 4PJAB 1AGCB 4IMKA 3VJ6B 1UKTA 1A6TB 1NL0L 4GRWH 1R3IH 2WBJB 2YD3A 1N5AB 4P9ML 2PO6B 3NMEA 4QXTB 4OUUB 3O2DA 2V7HB 5ADPL 1JF5A 4AL8H 4PUBH 1DQLL 1V3MA 3C9NB 2W0FA 3UTSB 3PABA 1IGIH 4ZFGH 2OL3L 4QRPB 3VFWB 1A2YB 2MKWA 3BDXA 1G7JB 1Q9OA 2H8PA 1I1YB 2GAZA 1OAYH 2OTUA 5I9QC 3KPNA 2VDNL 4HGKC 5I18L 1NCCL 5FB8B 3I85A 2PXYB 4EKXA 4OM0H 3QDME 2FECL 2VZUA 4H1LA 4HBCH 4NN6B 1NC2A 3TO4B 5DZLA 4GG6E 1R3LB 3ALPA 3OKKB 3NIDE 3QPQC 1KLUA 2RFXA 4L9LB 4LLQA 4Y5XC 1P84J 4HJGA 1URLA 4OLVL 5SV3A 3U7WH 1ZHBA 4M7KH 4JHZA 5GGSB 3WFBH 2C9AA 4UDUB 5D93C 3TWCL 2K3TA 1DCLA 1KJ2H 3VWKB 3D6GA 3MLSH 1XR8A 4BZ1H 4JFHE 5HGBA 4D0DA 3DRQB 2AXGB 3RX7A 5JIHA 5D2LE 3IRPX 3KPPB 4U1NA 4JY6A 1MCOH 3O8XB 4FHBD 2DTMH 1AKJB 3WO4C 5TDPA 2YKLL 4EI6A 4NQVB 4Z7VE 2JF1A 2IQ9L 4MDIA 2G60L 4QRTA 4X4YA 1PW3A 4FZEL 5FYKL 3S5LG 3OGOE 3QDJA 4PJIE 5J57B 4G43B 3UTZB 4MNGB 3NGBC 1INEL 1F97A 5HHMB 5EIIA 4JFEA 4N8VG 5CCKL 3C5JA 4IRJA 1PG7H 1RI8A 4NM4H 5HYQB 5DI8B 4OV5A 4K23H 4KY1L 1N2RB 1FL6A 3QHZL 2YXMA 1R6VA 4HKXB 4ETQB 3W2DH 3D69B 2CGRH 3TP4A 1FHGA 1IAMA 4P59L 3TA3A 3KPQB 2E7MA 2R4SL 3ESVF 5D6DC 2R0LL 5EC2A 3P4OB 2V5TA 1QD0A 3NA4A 1J1PL 4PPTA 5DK3A 1QTYT 4XCNB 4OFYA 1OAUH 2R0ZH 3FQNA 3T0BA 1EO8H 3NN8B 3OGCB 4ODHH 3EJZC 1JRHH 4PGEA 1NGPH 3BWAA 4F57H 1R3KA 2EH8L 3WJJA 3ROOA 5L2KE 4CW1B 4IMLB 4P9MH 3FFCD 1O7VA 3Q48A 5ADPH 1QVOA 2ADJB 4KVNH 1DQLH 3NCCB 4MCYA 1UB5A 3C6LD 4UU9B 5CLTA 1I8LA 2P7TA 1R24B 1FL5A 4LVNC 2OL3H 3KWWB 3GRWL 1F11A 3OL2A 4Z7WE 3V7AE 3HTLX 3OG6B 5J6GA 2NZIA 2VDNH 5I18H 3X12A 1DE4B 2J6EA 1E27A 5TF1L 2EDKA 1EUUA 4KPHL 1K8DA 5C9JB 4XNMA 5F70A 3HRPA 5GISL 1TLKA 1KF9B 4LLYB 2GK2A 2VQTA 1WCQA 3QP3A 3PGDA 1RUAL 4IRSB 5DDHA 1VFBB 5C0AB 2DQFB 4GKOA 4OLVH 4HX1A 2AABH 4KZEL 1S9VB 5IB2A 3CSBA 4FFWC 1XT5A 3U9PL 1I7TA 1PZ5B 2HG5B 4KDTC 2EKSB 5EO9A 2NLJA 4RCAA 3QJHA 5ACMA 1GGCL 3TWCH 2N4IA 3WYRA 3FFDB 4Z76A 3WJLC 3WIFA 3V6OC 4HJ0D 3TN0D 1F00I 1ZT1A 5CBEA 3ZHDA 3C5SA 2HT2C 4X7TB 3QB7C 4WW2C 2IH1A 2Z31C 1ZLVK 1T4KA 3QIWC 2F9BT 2NY6B 4HUKB 4JQVA 4QGTA 4RMSA 3STZB 2YKLH 1WBZB 4BKLB 4NKQB 4XVSL 4ALAL 4F8QA 5E4EC 2R2CA 4RGMB 2G60H 2IAND 2DQEL 4PGCB 4D0BA 4R3SB 5FYKH 4DAGH 5IKCA 3CFKB 1BGXL 4TUOB 1FAKT 4PYGA 3MMEB 4N0YL 3SY0B 3VXQB 4Z0XB 3B9KB 4RX4D 4YX2L 3VDAA 1INEH 3LSOA 4JM2C 1XMWA 2Z35A 4HV8A 5CCKH 1FVCB 1FDLL 3QUXB 1VGEL 4KUCF 1ZEAH 1CFTB 4W4OC 5DQ9B 5T1KA 2FR4B 4MNQB 2DN7A 4KY1H 3QHZH 3ARRA 3JWDL 4UNTA 1A6ZB 1G0XA 5FUCC 3ARFC 3EYQD 2R4SH 2EDXA 2R0LH 3QEHA 5F7LB 4L8CB 1RUKL 2X1OA 5JPMA 1L8JA 1J1PH 2WBJC 3QFJA 2E7CA 2PO6C 3QQ4A 5CP3A 4PBWD 2CIKB 3QEQB 5JHDD 5A16A 4YIQB 3X11B 1AJ7H 4JFDE 3VFMA 2EDTA 4Z18A 4PY7B 3TPUE 3CDYA 4UBDC 1OP5H 5FDYA 2X41A 1OP3H 3H9SD 3WUZA 2EH8H 4G80A 5IBUG 5IROC 3DIFA 2PXYC 2DKMA 5ID1A 3P0GB 3MLXL 3MV8A 4NN6C 1CLYL 5TDNA 4PLJD 3TO4C 3HMWH 3GSRA 1RZIA 1U58B 3GRWH 4L9LC 4PD4J 5KN5B 4PRHE 3HNSL 1RJLA 4F2MA 4CVXA 3MRBA 3ARSA 3ULUL 4U1IB 2Q86B 3BZEB 3H9YA 3LKRA 5TF1H 2OTPA 3T65A 4KPHH 2IWGA 3LKPA 4IOFD 5GISH 4C56D 1Q8MA 5INCA 1TJIL 1X5LA 3VWKC 5D7LB 3MRDA 3UPCA 2CKBB 3OR6A 4TSAL 1RUAH 1G7QB 3S98A 3EKCA 3KPLB 3GMLA 1RZ8B 2VE6B 1JZ2A 4N1HB 3UBXG 4XVJL 2J8OA 3O8XC 3FQTA 4KZEH 1RAMA 3GBNL 1IC7H 2HMIC 1HI6A 3U9PH 4PB9L 2FL5A 4KI5F 3T4AB 4LLUA 1GGCH 1S7RB 2EDRA 2GUOB 3OKLA 1CD1B 3F7YB 4XBGA 4NZUL 3IDXL 3ZDXE 5K9OB 4YEFA 2V9TA 5JIIA 4K9EC 4JO3L 2VZVA 2X7LB 4O51A 5GS0C