3VFPA

Crystal structure of hla b*3508 lpep158g, hla mutant gly158
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRGYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Energetic Basis Underpinning T-cell Receptor Recognition of a Super-bulged Peptide Bound to a Major Histocompatibility Complex Class I Molecule.
pubmed doi rcsb
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Homo sapiens
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vfpA01
4KI5D 4JFYA 3SDAB 2YKLH 1AO7B 4JO3L 4DAGH 5IHZB 5K59E 4P4RB 3K8LA 3MA7B 5ID0A 2NTSP 3JWNC 1IZKA 2VISB 1JFQH 3WXVH 3EDFA 1N0XH 3UYPA 2DJSA 2ED9A 3SDCB 1MIMH 5F88A 3U0PA 5IK3B 3LH2L 3WHXA 5CBEB 1CIDA 3PWPD 1JI2A 4KJPC 3CSYB 2HJKA 3VGDA 4OFYA 4XBGA 4DN4L 3WFZA 1H3XA 4LBEB 5CJ5A 5B38B 4M7JH 3BD5A 2AKRB 3BZ4B 3PV6A 1AGFA 5GS1C 2R56H 5DMYA 5L2KE 2NY0B 3QNXB 3O41A 4M7ZB 5LCVH 2F53D 3FQTB 4I0KA 5L6YL 4R4ND 2J6EA 3I02A 5J8OA 4CVZB 1PKQB 4J2XA 3F7QA 4ODSH 2P4AB 1RJLB 4ZUUB 1Q38A 5T5NF 1BIHA 3STLB 3HFMH 5HDBF 2E9IA 1U41A 3DIFA 1EFXB 4HW6A 2P5EB 3ZYIA 2AW2A 3HC4L 3MJGX 2HT3C 2QSTA 3O8XD 2GITB 1K8DB 5I8CB 3WS6A 4U6HA 5DFVD 5D71H 5HDQL 4ELMB 3HLAA 3F7RA 1R5VA 3IJHA 3LQAC 3W9EB 3D0LB 3PWLA 5MEPA 1A1OB 5I1EL 3TPUA 5AZEL 2OTPA 4NC0B 2NY6D 3CFBB 4J8RB 3JBG7 4GAYA 3L7EB 4KK9C 1MAML 3NZ8B 5SWSB 1D5ZA 1CD1B 2E7MA 2R1XB 2B2XL 3L3HA 1PG7X 5ISZE 4XPAL 4PRHB 2VQUA 1OSZA 1DBAL 3C60D 3FRPA 4X6CB 4JM4L 4L9DA 4OM0L 1D5BA 2BNUB 4ZUWA 3QHZH 2BNRA 2VXVH 2BOBB 1EDQA 4V1DA 3GBNL 3RVXC 4NGHL 5L8JB 4IRSA 4QHMA 4YR6A 2QQLL 3DVNA 5GGRY 1A6UL 4MQTB 1EVTC 3X11A 4PJ9C 4QHNA 3TIDA 3DBXB 4NRZB 1IM3A 2J8UF 5CEZH 1KLUB 1P5VA 4QOKB 4ZFZA 1CTNA 2CMRL 2V9TA 3JXAA 2OR9L 3OTTA 1OP3H 3RUGB 4GW1B 4ORZC 1WBYB 4JQIL 5JA8B 5J0BA 4LU5L 1HOCA 4YFLI 3D3VB 3KXFE 2HT4C 3VFMB 3GIZH 5ACZB 3FQXB 5IVXF 5JO5B 3QDJD 3MNWB 4I5BB 3OAUL 3VXMA 4GKSA 3EYVA 4JKPH 5FO9B 1U8MB 4H26B 5CKGA 1AXIB 1UJ3A 3SE8H 3SOBL 3I9GL 4NZRL 1B3JA 1ED3B 4I0PD 3E6FA 3BP5A 1QBLH 5CCKL 4JFYB 1LQSR 3D39D 3GSXA 4MD4B 3MYJA 4S1QL 4X7SH 2XZAH 4XX1G 5ID0B 1GGTA 3B9DA 1GCFA 2FJHA 1EHXA 4PJHF 3HB3D 4I9WE 1UADC 1YY8B 2PW1A 2DMCA 4H8WL 2PW2A 1IEBA 5F88B 3U0PB 1NGQL 4UINH 4Z5RA 4QRRA 1XMWA 1G9EA 3WHXB 3WS3A 5SWZE 2W60B 1X5IA 2A6JA 2HJKB 4XBGB 3I50L 3VMOA 1NGPL 5EUOF 4KZDH 2B4CL 3ZE1F 3PV6B 1AGFB 4FZEH 2NZ9C 1U42A 4XVSH 2VC2L 1NMCB 3O41B 4W4NA 3GSOA 2NMSA 4J4PA 4GAGL 2EH8L 3I02B 1O0VA 2H9GB 2IBZX 3UX9B 4HX1A 2OLDA 2D0FA 1WFOA 3RWIB 1WEJH 2N7BA 1I1FA 2AK1H 4KJYA 2Q1EA 3N85L 1FE8L 3DIFB 5GRVL 1RURL 3WXWH 4PB0L 4X4XB 4K3JH 4EQ3A 4YX2L 1T7WA 4U6HB 4YDVA 4YFLF 4GQ9L 2YR3A 2O5XL 2CDEA 2WV3A 2ATPA 4G8GA 3WL9A 4KVCL 3HLAB 4PBVC 2CLVA 2AJXL 4LSTH 1VEOA 3PWLB 2DLHA 5MEPB 3QUYB 4XX1E 3TPUB 3GMPA 3G5ZA 5GJTL 1Z9SA 3PG2A 3U9PH 1KG0A 4XPGH 1S7TA 3ABZA 4ZSOE 1L0XA 3FN0H 4GAYB 1RZIA 3K4AA 1D5ZB 3RNQA 4PJ7F 4Y16A 2XWTA 3TO2A 1OSZB 5JXEA 3NN8A 4XNQA 1N64L 3BPNB 5HHMA 4IHOA 3X3GL 1D5BB 3EFFB 4TSBL 1KIPA 4XBEH 2BNRB 5CILL 3C6LC 4YGVA 4ZG1A 2PO6C 4V1DB 4R4FH 5HDLA 1YQVH 4LSQH 2ZNWA 4NHCH 4QHUA 4MLSA 4IRSB 2VRAA 4GBXD 4OD3H 4QHMB 3DVNB 1Q9KA 2NLJA 4PJDA 3WN5C 4D9LH 3BKYH 3VXPA 4MB3A 3X11B 3TIDB 1J8HE 4M6OL 3RTQD 1YEJH 1IM3B 1KELH 5FGBC 3MNVA 3QWQB 3BJ91 4ZFZB 5T3ZL 3UJJL 2DQGL 1I1AC 5CEZE 3EJYC 1UZ6F 2R1WA 1P4LA 4PJ8A 1EZVY 1HOCB 5EN2A 1LO2H 1AGBB 1WZLA 4CNIA 4H88H 4AY0A 2HTLD 3VXMB 4GKSB 3EYVB 1MCCA 3WFHA 5KSAC 4Z76A 5BW7A 5DFTA 5HVHC 3Q3GA 3P0VL 4KDVA 1UJ3B 3NTCH 2VWEC 1ZVSA 4RX4A 2ZOKA 2DOCA 5CKAA 5CIPH 43C9A 3E6FB 4HF5H 3BP5B 4F7TA 4GRLA 2PXYA 5FDWA 3GSXB 2BHYA 1FNLA 2ICWJ 3A6OA 5CBAA 5DUMH 1FRGH 3CLEL 1PEWA 5DVKA 2FJHB 2DTSA 4Y19E 3VG9B 1T0NA 2ORBL 2PW1B 2X4QA 4U6YA 4N0CA 2PW2B 1IEBB 2YRZA 1TXKA 5D72L 1FZKA 5BOZG 4QRRB 4Z5RB 2BVTA 3T0EE 3WS3B 5BCAA 4KI5F 1R3KA 3B8YA 2A6JB 1QBAA 2X10A 3DWTA 4XTRC 1Q9OA 3MOBL 3MBEA 1E6JH 3AS0A 1K2DA 3CVHL 4D0DA 5DRWB 3E2HC 3FO1A 3AB0C 3GJFH 4NM8H 5C71A 5EIIA 1UM6L 2VITA 2BVOB 4KVNL 4PLJD 1BVZA 1F45A 3MLWL 4J23A 4ZAKA 5IEKA 4M6NL 3GSOB 4DKAA 1WTGT 4JFDD 2NR6C 4PJAA 1HWHB 1T1WA 2CR6A 1X5LA 5C07D 1U92A 2J1KA 3UO1H 3C09B 5KVEH 4JZJA 2VDNL 1GGCH 4FQPA 4W6YB 4KKBC 3G6JF 4HX1B 2NY5C 2FWOA 2CRIA 1SM3H 2EDNA 3U0WL 5ICZA 4YEEA 3OKOB 1OAZH 1OOAA 4YZFF 1AR2A 2HFEA 5DJAA 4KJYB 3FQWA 2P47B 4UQ3A 4ODTL 5MHSE 3BKML 4DQOL 2EYRA 5E8OB 1B9ZA 2I27N 2J4WH 1I8MA 5F9DC 2ADGA 4NBXB 4YXLH 1UCBL 2EE9A 3S9DB 4BZYA 4YDVB 2CDEB 2EXWC 1L9MA 4P23A 2R2EA 5EZLA 4AEFA 2XKNA 2ATPB 1F4WH 4G8GB 2F5BH 3WL9B 1E4WH 2ICWA 2CLVB 2R4RL 5E8EA 4PRDA 5E0QA 4KV5F 1YECL 3ULVH 2ARWA 3GMPB 1Z5LA 4WV1A 5HYSG 3G5ZB 3NCMA 4NPYA 3QHFL 4LVNB 3X3FH 1KG0B 1I85C 1S7TB 2LAAA 4C4KT 2LVCA 4G43B 1RZIB 1DBKH 2AJYH 2F5AH 3ZKQD 3QDMD 3RNQB 4Y16B 1YEHH 2XWTB 4UV7H 3TO2B 4YUEH 3NN8B 1JGEA 3BXNB 1FDLL 4IHOB 5HHMB 4F37K 5IMKA 4XC1H 2OL3A 2XTJC 1J05A 1KIPB 1ZLWH 1WCQA 3DMMC 3VXTA 3BRFA 5KOVC 5J4MA 4YGVB 3QQ3B 1YEGH 4OLZL 4JO1H 4K94C 4LAQL 1XGQB 5K9OA 3QUXC 4RMSA 4QHUB 3VRLE 4G5ZH 2BJML 2FJGB 4NOFA 4EOWL 4PJBF 1LP9A 2NLJB 4PJDB 4HIIA 1Q1JH 3BDBA 2ICES 4MJIE 5IQ7H 1CXIA 1GSMA 3MNVB 1MI5D 3VGBA 1MFBL 3BP6A 5BVJA 2KBGA 1KB5H 3BQUC 2QADB 2R1WB 1P4LB 4P3WA 1IKFL 4Y8DC 4P5TD 1MCBA 4PJ8B 3T4AA 3FQUA 5EN2B 1ZT1B 4DEPB 2VAJA 3OB8A 1NFIA 5JZ7D 4CNIB 4M5ZL 2G60L 3RNKA 1CVRA 5C0CD 3JTTA 1XGRA 2QQNH 2CH8A 3WFHB 2FRGP 4Z76B 1T1ZA 5GGUA 4MJ2A 3V7MA 4JKLA 4POYA 3Q3GB 4PJCA 4U1SA 3DGCR 4RMRA 1URLA 2LE9A 2DWDA 1ZVSB 4LP5A 4A2MA 2ZOKB 2O5ZH 1R0AH 3O4LD 43C9B 5GZND 1CLOH 3S8WA 1RHFA 5INCA 1CXHA 4GH7B 5BO1H 1OARH 4GRLB 2W0KA 2PXYB 1RZKL 2P5WE 3KAAA 1MVUA 2ZUQB 5DT1L 5CBAB 2L4OA 2XA3A 1IBGL 1ZEAH 3K4DA 3R0MA 1J5OH 1VA9A 2OYPA 2HRLA 4PD4J 1T0NB 4HQQL 3MCKA 2UWEF 5D96B 2H1PH 2X4QB 4U6YB 4UT9H 5DYOA 1IGIH 5DURD 4F7PA 3HE6C 3MTRA 1FZKB 1PZUB 2DQJH 4JM2F 4MSWA 5EOTA 3QUZC 4HGMA 3LB6D 2DBLL 1GRWA 3BO8A 1R3KB 4C54A 2EC9U 1Q9OB 3WIHA 1FORL 2XFXA 3GJEA 1K2DB 4OI9A 4PJGF 5IHUH 4EBQH 3FO1B 5EIIB 3NAAL 4QXGL 5J1TC 4OGXL 5FHBL 2VITB 2HWZH 2OX5A 4ZAKB 4JEGB 5IEKB 3WHE1 3MLXH 4PJAB 1JVKA 1T1WB 3TWCL 4Q9RL 4JZJB 4HPOH 1KXVC 4AK1A 5L7XL 2FX8H 2P44B 2FWOB 1JF6A 3ARVA 1UYWL 1KIRB 4XVJH 2BSSA 1FYHB 3RWHA 1TVBA 5ICZB 3ZKSD 1QRNB 5F89A 3S97C 5EFIA 4TTGA 2HFEB 5DJAB 3FQWB 4I3RL 3SDAD 5D7IF 1AO7D 2BRRH 4QXUH 4UQ3B 5DF0A 5DO2D 2H2PC 1NEZB 2EYRB 3OAYH 4JZOA 1QR1A 4XVUD 1I8MB 4RGND 4YBLB 3PGFH 4HBCL 3HI1A 4L3CA 2ADGB 4RISH 3QEHA 1NFDA 2NY7L 2XICA 4R90H 1WQVT 2R2EB 3ARSA 5EZLB 2XKNB 3ZZ1A 2ICWB 4NN7C 3O2WL 5E8EB 1OPGL 3BEWA 4PRDB 4R0LC 3ETBF 4XAKE 4BFGA 2C3XA 5CFHA 1Z5LB 4WV1B 1NBZA 4NPYB 3QIBC 3ULVE 1IGMH 3S37L 1JZ8A 4NIKB 2NY0D 3EZJB 4CVWA 6CGTA 5DHVA 1DJSA 1K3IA 1MWAA 3MJ9L 1W0YT 1Q72H 1CICA 3UPAA 2IADA 1JGEB 5AG8A 2W59A 5IMKB 2OL3B 4ZTOL 1J05B 4RCAA 1NLBL 3LKRB 3VXTB 3U6RB 4XNMA 3GDBA 5TE6H 4ENEC 4KI1A 1ZVHA 5DVOA 3PV7A 5K9OB 1INEH 3IDIA 2K1MA 4HZAA 4OM1L 3E8UL 1LP9B 1EFXD 3MV01 5D93C 5C92A 1DUYA 1HKFA 3CJJA 4HIIB 4K7FA 4UBDC 2B1AL 2IQAA 5LGKA 2Y5TA 3B83A 2DQHH 3BZFB 3SQBA 3U4BL 1JTOA 3R8BB 4LSSL 5DLMH 3BP6B 3I6KA 4P2RD 1OP5H 3H3KA 5BVJB 2V7NA 5D7LE 4YHMH 3T4AB 1KCGC 2LU7A 3FQUB 1WZKA 1MFNA 1NFIB 4X6FA 1Q9LA 1BBDL 1XT5A 4ERSH 4H8WC 5C9JA 1RUAL 3JTTB 1DQDH 1D3CA 5HBBA 5HYQA 1HSAA 1NBQA 3HZVA 5JW3L 2N7AA 1Q94A 5GGUB 4MS8A 4PJCB 4U1SB 4XGZB 2DWDB 1ZA3A 5I1HH 1N4XH 1DEDA 2B4CC 4PFEA 4MNHA 5INCB 5SWQA 5HYJE 3ZKXB 4MQSB 1MVUB 2ICEA 4TSCL 4EUPA 3IDNA 3T08A 1UWXK 2OZ4H 3W5MA 2H32H 5DGRA 3WDJA 3H3PL 1IGJA 3MCKB 4KKAC 1AFVH 5FUCC 2PYEE 1U3HD 4XP6H 5DYOB 4DAGL 2B20A 3WJLC 1HH9A 1W8OA 4MSWB 4LQFL 2AEPH 5EOTB 5KSBF 1BD2A 3NIGF 4XMLL 4IMKA 3BO8B 3QEQD 5L0QB 5LXGH 1A7RH 4OQTH 1JZ5A 3D3VD 1KBGL 4WCYH 3RVVD 1MJ8H 3GJEB 4LSPL 2DJUA 1YNKH 4MA7H 3O6FC 5CZXD 4IOFD 1K4CA 4JDVB 3GI9L 3TA3A 1ERNA 1SYVA 1WFTA 2D7PA 1S7XA 5T5NG 1P4IL 4MWFA 1WBZA 3RWHB 1TVBB 3V4VL 3MJ8A 5F89B 2JIXD 5EFIB 3VI3E 1G7QA 2YPLE 2EKSA 2WM0A 3BKJH 4JZOB 1QR1B 2EECA 1W0WA 2H6PA 5IFJA 3NCJL 5L9DL 4PJ5A 4NO0A 4OKDA 1N2RA 3HI1B 4L3CB 3QEHB 4JN2A 1NFDB 2H8PB 5EO1A 3S4SA 1J87A 2VZSA 3B2VH 5IQ9A 3KPRA 4DGYL 3LEXA 3FHQA 3BEWB 5I73C 4EIZC 2W9LA 5GRJL 1NBZB 2EH7L 2VDKL 3QXAA 4OFYD 4Y0GA 3RIFF 5JW4R 3F6LA 5HGBA 2R2HA 1IC7L 4OIIH 3ZE2F 3QUML 4H1LH 4ODHL 4LCWA 3MBXH 4HS8L 5DHVB 3RBGA 4QWWD 3D5OF 4ZFGL 1CICB 3O0RH 2IADB 4MA1B 3TO4A 3DV6A 2VZUA 1TCRA 2XQYG 4PJEF 4XNZB 4F7CA 4N0YL 4LCYB 5J1SC 1ZMYA 1P5UA 3VE0B 4XNMB 4M6MH 3S7GA 2B5IC 4ZXBC 5MEQA 3IDIB 1HXYA 3OKYA 3LQMA 4M43H 4W6WB 4FG6D 5LBSL 1DUYB 2DM2A 5TQ2H 4K7FB 3CDFA 2RCSL 2OR7A 1G6RH 2IQAB 4KTDL 2Y5TB 4M62H 4LSVH 5HDBE 2I24N 5F7KC 1G0XA 1MJUL 2R39A 3VFVA 5ITFA 3I6KB 3DVGA 4U2ZA 5HTSA 3L95A 3RPIA 3QCTH 1J0IA 2P24A 4U3HA 5CEZL 1LO0L 3BRGC 2EE2A 3J8F7 1Q9LB 4X6FB 3LAFA 1WFNA 5C9JB 4DK6A 3VXOA 5HYQB 5I15H 1HSAB 3HZVB 3QI9C 1M1SA 2XA8H 3IDYC 1Q94B 2VDPH 4JG0L 1TETH 2C3VA 5H37H 4WUKL 1ZA3B 5IT2L 2BNRD 2I5YL 2APFA 4MNHB 1NCAL 4P3DA 4V1DD 2HH0L 4EUPB 4KC3B 3SE8L 4IRSD 4MQ7A 5GZOC 2VXQH 1A02N 5EWIH 5I18L 2GI7A 1IGJB 3VFUA 1CXKA 4R8WH 4PJ9A 4MXWL 4W81A 3C5ZC 2XZAL 4H1LG 3S88H 5I19H 4UT6L 5C0NC 4DKFH 4M7KH 1VHPA 1XR9A 2P45B 5LKNA 4MNQA 2X9WA 1QFWM 1M05A 2X70A 4FFWC 1HYSC 1OTUD 3WUWA 5I1GL 4YE4H 5DDHA 4YQXH 5JOFA 4G9FE 3WNNA 3VXMD 3S3JA 3FZUD 2IANE 3TA3B 4DTGH 3UTPD 3RWJA 4AEIH 2NX5D 2GCYA 4YC2B 1SYVB 5B21A 5IVXE 5E4EC 1S7XB 4YO0B 3JUZA 1WBZB 5KVGH 2HMIC 3MJ8B 1GGIL 5EZIH 4XCFL 5F1OB 4WWID 1EO5A 4NWUH 1G7QB 3DVIA 2FLBT 2ED8A 2EKSB 4U1GC 1F13A 1W0WB 4L4TD 2H6PB 5IFJB 9CGTA 1XCQA 4PJ5B 5I9QB 5JPNB 1H5BA 4NO0B 3H42H 3SKJL 1N2RB 1PX3A 1SJXA 4Z7WF 3RI5F 4JN2B 3S4SB 5EO1B 2XT1B 4R2GB 5ALBL 3KPRB 3PIQA 5IQ9B 1BZ7A 4G6AC 3DXAE 3LEXB 3TBYA 4PJHE 4FFZH 4QRRD 3T3ME 1U91A 4K9EH 2Z8SA 2Z31C 4YHLH 2DLFH 3B2UD 2NXYD 1ETZA 1R3IL 2WQ8A 2XN9E 3QXAB 3IDMB 4BKLA 3UBXA 5HGBB 3MLZH 5DJ0A 1DLHA 5ICXA 3STZA 2VQ1A 4I77H 3WE6A 2WSKA 4I18A 1AD0A 3T1FA 4M9OA 1ZSDA 2IGFH 1FLRH 1VPOH 4UAOC 2QL1A 3D2UA 3DV6B 3MV8A 3TO4B 3ZE1E 1TCRB 3HNSL 1G7HA 3LKSA 3PE9A 4JFHE 4OZ4A 3ARWA 1WZ1H 1T89C 4OGYH 3PXJA 4FQHA 5MENE 5JUEH 1SYSA 5MEQB 1L7IH 2ZJSH 5DMJB 3V52H 1MCNA 4QGYA 3MXWL 2JK5B 1KN4H 4K23L 3RWEA 3MGTA 1A5FL 3BN9D 3PWJA 4L5FH 1LHZA 3SDDC 5KBNC 5EBLA 3UPCA 3FMGL 4FTVA 3RVTD 3P0YH 1MVFA 1YQVL 2VLRE 4LSQL 1RZKC 4JGJA 5ITFB 3VFVB 3GI8L 3DVGB 4LPXA 3L95B 3N1MC 4G8GD 4PTUA 3BKYL 4XB8A 4CN1A 1N6QH 3TCXA 1N26A 4H25A 5IW1A 2P24B 3BHBA 1F3DH 5ESAA 2MQ0A 3HUJA 1JPST 3FB6A 2R0WH 2WWMD 5E00A 3VFWA 3VXOB 4XCCL 4GLRH 5FYLD 3NABH 1NBVL 1LO2L 1QNZH 5JR1L 2C3VB 4ELMF 4L4VE 3BWAA 5GISH 4H88L 4LLDA 4JHAH 2K3TA 3T3PF 1JGUH 4PJ7E 1QSFE 3O6KL 2VABB 2OP4L 1PZ5A 2R0LL 4P3DB 2UZIL 4NKDA 3C6LA 4XP4H 2PO6A 2VDLL 3CLFH 3NTCL 5DQJA 4HWEH 4MQ7B 3TC9A 2Q6WA 3VXSE 4BJLA 3QPQC 3HE7C 3VFUB 3RBSA 4PUBH 4X6CF 1T21A 4PJ9B 3ARQA 5FGBA 5TE4L 1FYTA 4X5XA 2G5BA 3VW3H 4UNUA 3DLQR 1I1AA 5L8KB 4N90E 2VUYA 4MNQB 5LG1A 1M05B 1UWGL 3U30C 2X70B 2AI0L 2ARJQ 3MLUL 3WUWB 1WC7A 1UZ6E 3U7WH 5DDHB 2R0KH 5JOFB 2LQRA 3RWJB 5DD3L 2GCYB 1U3ZA 5ESQB 1GOFA 1GYAA 4DFHA 4U1KA 5KSAA 2YN5A 2D03L 3FB7A 3DURA 3RUGF 1KJ2L 1BLNA 3HC3L 4RX4D 3SQOH 1F90L 1VADA 2E6PA 1H8SA 1AE6L 4IRJD 4HCRH 2PXYD 5B8CC 1BFVL 3NFPB 5EO0A 1FGNH 2I07A 4ZFOL 4JVUA 5EU7E 5AD0A 1XCQB 3T77B 1H5BB 2P43B 5I1DA 1OAZL 4X4MA 5JMOC 2AJZA 5FOBA 4CJ1A 4Y4FB 3QEGH 4KHXH 3KPLA 3PIQB 4N0CD 4BH7A 1BZ7B 1U6AL 2ENSA 3TBYB 2CLZA 4TVPE 4WEBH 1BQLL 1OHQA 3NCEB 1U91B 2ESVE 5SX5H 1RZJL 3LS4L 1JNNH 3FT4A 4P2QE 5JTWA 1ETZB 5I1AA 3H0TA 5GPRA 2VXSH 4WTZA 1KPRA 2V2TA 4BKLB 3UBXB 3MBED 1Z6JT 3QDGE 3BJLA 4FQLL 5DJ0B 1DLHB 5E8PA 3V6OE 3ZTNL 1P7KA 3S37X 5ICXB 2BSED 3STZB 3I6GA 5GS3A 2VQ1B 1UB5A 2HFFA 3NH7L 3E2HA 3WE6B 4I18B 4ZAKD 1AD0B 3T1FB 2R23A 6FABL 4CVXA 1DTUA 1ZSDB 4K3EL 3D2UB 3MV8B 2A6IA 5E70A 4ZDHA 3SCMC 4OB5L 3TESA 1G7HB 3LKSB 3IXAA 4OZ4B 1FNSL 2AXJA 4HWZA 3LQZA 2MJWA 3UAJC 2EDWA 4FQHB 4PB9H 2VLME 3MLYL 1YEHL 1SYSB 1UWEH 5TE7L 4OZIA 2BVPA 2GK0A 4HWBH 1NCWH 1P53A 3WUZA 1C08A 4X98A 2DYPD 1OVZA 1AXTH 4XMKH 4OF7A 3MGTB 2AERT 3RWEB 3PWJB 1NAML 5DJ2B 4YZFE 3WFCH 2NNAA 1U8NA 4PY7A 4MJ5A 3ULUL 4FTVB 5TDNA 1BZ9A 5DMGD 1EJOH 4LKXA 2V2WA 3Q2CA 1AI1L 2W65A 4G5ZL 4P23D 2IJ0C 4POUB 4PTUB 1T1YA 3HAEG 4H25B 4RGMC 4UTBL 5C0BE 3BHBB 5E1AA 3QWRD 5LJYH 3HUJB 3VJ6A 3FB6B 2XV6B 5E00B 3V0AC 3OKNA 3VFWB 4C83A 2ZUSA 2ZUTA 1I85A 4KV5E 2ZSWA 2JJSC 1BQHA 5DJZA 4WENB 1T3FA 2HT2D 3QJHA 1JK8A 5ITBH 5JIHA 2NZIA 1DQMH 4PDCE 3B9VA 1PSKL 3BWAB 4Q9QL 1J10A 4LLDB 1OAXH 2CGRH 3MOQA 4RAUA 5E4IA 2EXYC 4P57A 4Y2OA 1PZ5B 1EERB 1X5YA 1I9IH 1TZIA 3DMMA 4NKDB 2C1OA 3HR5A 3C6LB 2PO6B 3F8UB 3RZCC 2UV3A 4LARL 4DVBA 5F8RC 1CCZA 1GJIA 3L3KA 5DQJB 2Q6WB 3QUXA 5CP3H 2EE3A 3HS0A 1F3JA 4NN5B 5KG9A 3JV6A 4L3ED 4YHPA 1I8LA 4PBWD 4TULH 3T4YA 5LGJA 4KK8C 1FYTB 2EC8A 2CK0H 3BDXA 3GUTA 3VD4A 4X5XB 2G5BB 1DSFL 4ODVL 1I1AB 4YXKH 4K7PH 5HHVL 2VLJE 3EOAA 3I6LD 5I0ZA 4KHTH 1H8OA 2VXUH 4HT1L 3NIFF 4WI2A 1K8IA 1TTFA 4K55A 4LRIC 1IKNC 1ZGLA 4S10A 4FQXC 4YHIB 2GIYA 4OFPA 4QXTA 5DR5L 4U1KB 5KSAB 3EOBA 3ZKMC 5EA0H 3FB7B 3FAWA 1IC4L 3DURB 5DVNA 5GHWL 5IHUL 1KYOK 3QPXH 1BLNB 3LS5L 3U36A 15C8H 2WBKA 1VADB 3W0WA 1KLGB 2YK1H 2HG5A 3IFLL 1S9KC 2Y72A 2AQ2A 2Q76A 4HPOL 3IRPX 4GQPH 1RZFL 3SY0B 2I07B 4JFOA 1F8TL 4KROC 5E5UB 5C0IA 5C2BH 4OZGF 3RIAK 5AD0B 2AS5M 3EHBD 2DQFA 1Y6KR 3T2QA 5I8OH 2JELH 5I1DB 4FRWA 2AJZB 4PRIA 3WSQH 4C55A 5FOBB 5EORL 4EXPX 3QDJE 4KTEL 1UH4A 2X4PA 3KPLB 3FQNA 4BH7B 4JZNA 4PJIA 4P48A 2CLZB 3HCVB 3SGJC 3WEXA 3HE6A 1FH5L 1R5IA 3FT4B 2Y6SC 3QUZA 1C16A 3DO3A 1FBIL 2P1YA 5HI5D 5I1AB 2W9DL 3H0TB 4L8SC 3VCLA 4JR9L 1KPRB 2APXA 4RSVA 4IBLT 1NSNL 4FP8H 5IBTH 4R26H 1P7KB 4XHJD 2YZ1A 4G59A 3I6GB 5TDPA 4NQCA 3G6AB 1LEGA 1EUTA 2CDFA 1UB5B 4JJHA 3SDYL 4LMQE 1IGFH 2R23B 4CVXB 3OMZA 5CUSL 5FK9A 3O2VH 2A6IB 4PJGE 4ZDHB 4OF8A 4P59L 3IXAB 2IMNA 5IFHH 4KMQA 3MRGB 4HWZB 3LQZB 1WITA 2MQ3A 5DJ6A 2IH1A 2M2DA 2E9JA 2XZCL 4OZIB 3BAEH 2BVPB 2GK0B 4TPRH 1RZ7L 3REWA 2VDQL 1C08B 4X98B 3N1GC 3SEPA 2VDMH 4I2XA 1RMFH 4OLVL 4GKNB 2NNAB 1U8NB 5M95B 1RUMH 1UXWA 1IGCL 5TDNB 4L8DA 2YC1B 3HPJA 3KHQA 1KJ3H 4RFNC 3U7YL 4ONFH 4LKXB 2V2WB 3DSFL 3WFEH 2W65B 1CGXA 3OZ9H 5FUOH 4LLWA 1BZQK 3V5KA 3W82A 1T1YB 2FLRT 5IBUG 1PEZA 5T3XD 3V4UL 4YBQD 3TT3H 2RIKA 4R0LA 5E1AB 1MHCA 3VJ6B 3L6FA 1QVOA 1OSPH 3OKNB 3CXHK 3CVIL 4OLWL 2ZSWB 1BQHB 5DJZB 4NQDD 2GTWA 3QXUA 4CU8A 1T3FB 4U1IA 4XPTH 3QJHB 1JK8B 3L3IA 2FEDD 4ZPVB 1WT5C 4WTWA 5ANMB 5I8KL 1T1XA 5EB9A 4RAUB 4M02A 3GSQA 1IAIL 4P57B 2XTJB 3BT2L 3NOIA 1TZIB 3DMMB 5DTFA 4H20L 2C1OB 3HR5B 4E41A 1IVLA 4DVBB 3L3KB 2MWCA 4AEHL 2HJLA 1F3JB 3JV6B 5MI0C 3SO5A 4YHPB 3VWKD 3EJZD 3GUTB 1GC1L 4XMPL 4OLUL 3IDXL 5C08D 3GKWH 2XXMB 1FFPA 2LTQC 3EOAB 3V4PH 3PQYE 4XP6L 4M03A 2GSGA 1FAIH 1K8IB 1RQ5A 1I4FA 4PJDF 4X7DC 1ZGLB 3KR3H 4GG6E 4DGIH 4QXTB 1A7RL 1U8OA 4MS8D 3EOBB 1ULVA 3RWGA 3HI6H 3SPVA 2VH5L 1EAPA 4JDTL 4URTB 4GXUN 3DUUA 4JG1L 4XBPA 3OPZL 4OCMC 3U36B 4X6BA 3W0WB 3OB0H 4PYHA 4HC1L 4JY4A 5DEFA 2HG5B 2VL5A 1MQ8A 2Q76B 1X4XA 3Q5OA 2ICWI 3MC0A 4JFOB 1RIVH 5D7SL 5E6YA 5C0IB 4KQ3L 3BP7A 3LN9A 4LLMA 4XI5C 2DM7A 5ILTL 1T7ZA 1ES0A 2DQFB 4F7MA 1BQSA 2Y36L 3GRWL 4Z7UB 4R3SB 3G6DL 1ITCA 1HH6A 5FGRA 3PABA 5A40E 2X4PB 3QP3A 3FQNB 4JZNB 2FGWH 4FOMA 1OGAA 4PJIB 5FM5M 1V7MH 2Q8BL 1BD2D 3WEXB 3HE6B 5CS7A 2YMXH 3O6LL 3QUZB 1C16B 2YXMA 4TN9A 3VCLB 4UIKL 3GBMH 5IMOA 5IEHA 1DFBL 5H2BA 4HUUB 3NIGE 3FO2A 3SJVA 4CN6A 3U1SH 5FYJE 4NQCB 1T7XA 1LEGB 5TDPB 2CDFB 3KYAA 2NY1C 1RU9L 4YHKH 2FX9L 3S3PA 2PR4H 4F37F 2XNAA 3O6FA 3O9WC 2R0ZH 5FK9B 4BZ1H 1PD6A 3ZDZE 3E3QE 1PDKA 1NCDL 2EDTA 3O2DL 4HKZA 5C09B 2OJZH 4OIIL 5KVDL 5DJ6B 1I7TA 2IH1B 5I1JH 1K3ZA 5KN5A 1CL7H 4NCDA 3REWB 1JHKH 4A6YH 3ME0A 4I2XB 4UQ2B 3OGCA 4FFYL 1LD9A 3M17A 3O11A 1KUMA 3MOAH 1UXWB 4PJAF 3RJDA 5FECA 2FECI 2GUOA 4NO0D 4Z7QE 3HPJB 3LEVH 1OAYL 4CADA 4LSRH 4EI6B 2A9MH 3KPRD 5T5FH 3BFOA 3G5XA 4JFDE 4X7CC 4LLWB 2UUDH 4XXCC 5TQ2L 3V5KB 3BRDA 4U1HA 1CLYH 4NN7B 4X7FC 2F54B 4WO4C 4R0LB 2ZCHL 5MP6L 4PRPE 3ZHDA 4WUUA 4DN3L 1MHCB 2NTFA 4KJPD 3L6FB 3GNMH 1QVOB 1FPTH 5L88H 1I1RA 3MRQA 3BSZH 4NJAH 3I3BA 2GTWB 4LCWD 4U1IB 3LHPL 4WFED 1MNUH 4XC3H 3L3IB 4LGRB 3S98A 5CINL 5EO9A 3ZE2E 1CDBA 3VXUE 1T1XB 2Q8AL 4Q9CA 3GSQB 4JVPA 1D6VH 2DDQL 5E5MA 4EEEA 5HI3C 5DTFB 1VFAA 4E41B 2VIRA 4UUJA 5FF6A 1YZZA 4OFIA 1S7UA 4NDMA 1S9VA 4G80A 5GRVK 1PKOA 3QCVH 5JIKA 2HJLB 5AAWA 1KB5B 3MRLB 1CT8A 2IAMA 5F7LB 5D93B 3QH3A 1BIIB 1R5WA 1C5CH 2JCCA 4CDGC 3TT1H 5D1QB 4HULB 2WMPA 2HT3D 1ZGLM 5GGQH 1G7PA 3TGXA 2IFFH 4RRPG 4RFOL 2VXQL 3WLBA 3WV0A 3LRHA 3C8KA 1FFPB 1C1EH 2WLZA 4LK4A 3IETA 1FSKC 4JFEA 4ZNEE 5A16A 2GSGB 4R4BA 3P4OA 1I4FB 1LP9F 4X9FA 3T2PA 3MO1A 4DKFL 5D2LA 3QI9A 1RZJC 4KK9D 1U8OB 3K0WA 3SPVB 1EAPB 3HC0A 3H9SE 3DUUB 3DHMA 2CXGA 4CMMA 1YYLH 2A9NL 4X6BB 2VDOH 4JY4B 4WFGD 3VFRA 5DEFB 1DCLA 2VL5B 4XAWH 2O93L 4OFKA 5D1XC 3W11C 3RVXD 3BP7B 4LLMB 5DRZA 5A2FA 3OKMB 1MFDH 1ES0B 5E08H 4F7MB 2DM3A 3CFJA 3IU3A 2OCFD 4HH9A 4PJCF 1HH6B 4NWUL 4RWYL 3RWFA 3PABB 2QTEA 4PJ9D 4OQTA 3KPSA 4C56D 4MXQC 5ALCH 2V7HA 2Y06H 1YEDA 5DZLA 5DC0A 5GGSA 3C5ZA 4PREB 1QKZH 4X6DE 1YMME 1ZS8A 3QEUA 2X4NB 5IMOB 5IEHB 4TVPL 5LWYH 3ULUC 4RAVA 5H2BB 3FO2B 5D9SA 3SJVB 3WO3B 2HT4D 1A7NH 2O5YL 2ZUYA 3MA9H 1HKLH 1D5IL 3LB6C 5FYKU 4MX7A 2XNAB 3O6FB 4BFEA 4YHLL 4NQUA 4LLYA 2OXGA 3PWVA 5B38G 1F5WA 4HKZB 1OAQH 1YEEH 4HH8A 4B7LA 1UB6A 3NZHH 2IC2A 4HHAA 1H8NA 1I7TB 2XZQH 3P9MA 5KN5B 1IFHL 4HGWA 4CUCA 2DD8H 1EEZA 1ZE3C 3RY4A 4YDJA 3OGCB 4M5YH 5DK0A 3F65A 1LD9B 3M17B 2W38A 3O11B 2YPVH 3MXVH 5FECB 3FOMA 5JUEL 2GUOB 2P49B 1BFOA 3AM8C 3V52L 3OG4B 1NDGA 1GGYA 3WFBL 1NMBH 1KLFA 3MRCA 3G5XB 3ARDC 5BRZB 4U1HB 35C8L 4FMFA 1HHIA 1P7QA 3CFCH 3MUGA 3WLWC 3AS2A 1FG2A 4DZ8A 2D7NA 2NTFB 4YBHA 4D8PA 2WP3O 4WW1A 4HAFA 5H35A 1HWGB 3KG5A 4GJTB 2AJVH 3MRQB 3LV3A 3NCCB 1AO7E 1HZHL 5TQ0H 3VH8A 2LVEA 1NFDF 1RUPL 2NZ9D 4M1DH 2VE6A 5EO9B 1AQKL 1EXUA 2VSCA 3MV8D 4OT1H 5HPOA 5F7UA 3QG7L 2IF7A 3RGVC 3SBWC 2R0WL 5JPMA 1VFMA 5E5MB 4X7TA 5JOPD 3K8KA 1VFAB 3MLVH 3S35L 5IROC 2VIRB 2R1YA 1CK0H 5EOCH 3SGEI 3V95A 5E5RB 1S7UB 4NDMB 2B5IB 5MEOB 4GAJH 1KFAL 4ZD3L 1EMTH 1EHLH 1MCRA 1CT8B 2IAMB 4KMTH 3QH3B 1IQWH 1R5WB 2DAVA 2JCCB 2ZKHH 3D9AL 4FTVD 4M4RA 4WEUD 1F4YH 3SDDA 1YNLL 2J6EH 1TVHA 1G7PB 5E6IC 4Z0BH 4PGDA 3RU8H 5GGTL 4B7IA 3JZ7A 4WI3A 1KCSL 2VKXA 3R1GL 3MUJA 4W6XB 4ONGL 3WLBB 3C8KB 3P4MA 4IOIA 4IS6A 3AXLA 2BERA 4KK6C 3VDCA 4E0RA 2WP3T 2ZUXA 1IGYA 3QXVA 5A16B 3UTTB 3MRIA 1CDIA 1QFUL 1PKQE 3P4OB 4R4BB 2KDGA 2Z35A 5FM8A 5CD3A 3KPTA 4LASL 1FNGA 3Q48A 1KCRL 1YNTA 3UMTA 4EDWH 3MO1B 1U8JA 2W9EH 3QI9B 4GUPA 4JFPA 3RL2A 3IDYB 5I74B 4I0CC 2P5EE 3HC0B 3ZKNC 1KJVA 4RZCA 2YD2A 4CMMB 1LO4H 3VDBA 2H32B 3MRJA 3VFRB 4G6KH 4H0HB 5AZ2L 5C0FA 1JRHI 3B5HA 1W2KT 1ND0A 3GHBH 4GRWB 4ELME 2B0SL 3C6LD 2GAZA 5CJ8A 2PO6D 3T3PE 1GAFL 5DRZB 1ZAGA 3EYQC 2FSEB 3CFJB 4NO5A 1TVDA 5EZJA 1XFPA 4QKXB 2VDRH 1MOEA 3IU3B 1DLFH 5F7EH 4HH9B 1UQSA 4HIHA 4DK3A 4O5LH 3HE7A 1MFCL 2GW5A 3D85B 1FGNL 3KPSB 3KPNA 5FYKD 5SWSE 1FYTD 2V7HB 4MA8H 1YEDB 1K4DA 5F3BA 1X4YA 1LILA 3C5ZB 4MDJA 4PRHE 4EXKA 3B9KC 1I1AD 4X6CE 1ZS8B 3EJYD 1FQ9C 4JRXB 3QEUB 3ZL4H 1HCFX 4RAVB 5D9SB 3NFSL 1KN2H 3UJIH 4JN1H 5TGBA 2OM5A 1FCCA 2QSQA 1JF1A 4MX7B 3UTZA 4YFEA 3QFJA 2VXSL 2P46B 5KSAD 4KQ4H 5DD1L 1EGJA 1Y18A 2YA0A 4KRPC 1VEPA 2MOVA 5E4EB 4HHAB 1G9NL 1AC0A 1RIUL 3ULSA 4QOKE 4HGWB 4F58L 4PS4H 2LU4A 3C8HA 5CSZA 3RUGE 2ZCLH 5B8CA 1EEZB 5A2LH 3NIDE 1MCWW 4YDJB 2YA2A 4X9BA 5DK0B 1DBBH 1MRCL 3MJ9A 4KKNA 4U1GB 1KEGL 1MFEL 3FOMB 5KTEH 1BFOB 4YDLC 3MV11 5HYEA 1TPXB 1OGTA 5DI8B 1NDGB 5GS0L 5ISZA 3MRCB 4N8CL 3B6SA 1LDPH 4K7PY 1Q0YL 1HHIB 1P7QB 4I13B 4JO2H 4XWGH 3MUGB 1FG2B 5F7NC 4I3GA 4D8PB 4JHWL 4OCWL 3WD5H 2OK0H 1RIHL 3UJTH 3LVEA 4M7LH 4WW1B 4XTRD 5H35B 4JAMA 3LV3B 3VH8B 1MCQA 1GC1C 1HHHA 2JKXA 2VE6B 4ODUA 1EXUB 1XGYL 3PWPA 1T5XA 2NR6D 4ZS7L 4UAOB 2Q87A 4CVUA 2APBA 1HINH 1SY6L 4KKBD 1FIGL 1ZHBA 1WWBX 4X7TB 1HCVA 3NCFB 1I9EA 1N7MH 5I8EA 2R1YB 2ZWLT 2AEQH 2IALA 5ITBL 2F53A 5KAQF 2HJFA 1OAXL 3IU4L 4EI5C 4I8DA 4OTXH 2W0PA 4P3CL 3SE9L 4GSDH 1BM3L 3U79A 1OD7A 3SDDB 4PGJA 3KYMA 4OD2A 3G5VA 1TVHB 3UC0L 2Z8WC 2QHRH 4PGDB 4L8CA 2Y25A 5TF1H 3B3IA 2EXWD 3P4MB 4PV9A 4IS6B 1VB9A 3AXLB 7FABH 4OQ1A 4E0RB 3TFKC 4OAWA 4TULL 1IGYB 1S7VA 4M1GH 3MRIB 1SBBA 3F62A 4Q2ZA 5IR1A 2Z35B 5CD3B 2CRMA 1YN6A 4XWOC 1FNGB 2COQA 3ZLQC 2YUXA 1YNTB 3OR7B 1U8JB 3ARRA 4GUPB 4JFPB 2JJSA 3RL2B 1DBJH 3F6IA 2VXUL 1KJVB 3EYSL 3ILPA 4RZCB 4HG4J 2CLRA 3K1DA 5GGVH 2OI9C 3MRJB 2KZWA 2X1QA 3OKDB 2XTJD 1K9TA 3DMMD 1MIEH 1ND0B 3KPPA 3NMEA 5SWZA 1S3KH 2GAZB 1QLRA 3DX9A 5D7KD 5EA0L 1JI1A 4HUKB 3QPXL 2YXFA 5JHLL 3QUXD 5EZJB 4NO5B 2BHZA 3TPUE 3UBXI 5F1KC 4Z7OF 5CD5C 3GIVA 4HIHB 4N9GB 4F15C 1IT9H 3HE7B 3KLAA 1HIML 5IGXH 5I75C 2E9WA 3S34L 2ZG2A 5GQBA 2NY2C 3KPNB 1I9JH 1RUKL 1K4DB 1RK1A 1MCDA 5F3BB 3ZE0F 1V7NH 3WDHA 3HG1A 5E8DL 1J11A 3BQUD 2G2RA 4XNYH 4B41A 1VGEL 2BNRE 2KUTA 3N9GH 2PETA 2PN5A 4FA8A 3P11H 4V1DE 2D7TL 5TGBB 4KU1A 3AC0A 1JF1B 3BIBX 3UTZB 4LRIA 5KVMC 1IKNA 4C57C 1RFDL 4KY1L 3QFJB 2E3VA 3JVGC 4FQXA 3IFOB 3TNNA 5EU3A 5FYJL 2HFTA 1I8IA 1MLBA 1Y18B 4G7VH 4UNVA 4TRPL 5IESH 3ZTJG 3OSKA 3ULSB 3W0WD 2IQ9L 5EC1A 5T1LA 3FN9A 3IFPA 2BX5A 3L5XL 5B8CB 3QUMA 3PHOA 1ADQH 5IFHL 4OI8A 4ZSOA 1CLCA 4IIQC 4UOJA 4PRID 3SN6N 1OGTB 1CFTA 2HKHH 1MREL 4PRAA 4U3CA 4FXKA 5ISZB 4OZGE 4BH8A 4Y4KC 3HNTH 3RGHA 3HE6D 3B6SB 3GHEH 3TF7C 1FZOA 1PFCA 5D4QA 3SGJA 3QUZD 2J8OA 3FO9A 4Y5YA 1A3LL 1SBSL 4L8SA 1EEYA 5IVZA 4LVOC 4JAMB 2H3NA 4NQCD 4KUCD 2FJFB 4NO2A 1HHHB 3TT3L 4ODUB 4JDZA 3QRGL 5SV3A 3PWPB 1T5XB 4MDIA 1HQRA 3Q6GL 4CN4A 4O9HL 3T0BA 3U82B 2E7CA 1ZHBB 1A3RL 3L3OA 4NKIH 3ARBD 2RR3A 3HNVL 5I8EB 2IALB 3HMXL 4QRRE 2F53B 1G1CA 2HJFB 1MCSA 4ODWA 4MMXC 4MAYC 3RHWF 2P8LA 2H2PD 4YH6A 4JRYE 4OSUL 4P9HH 2D0GA 3WNPA 3KYMB 4NYLA 4OCRH 4OD2B 1H3VA 1OB1A 1VGKA 3G5VB 4U1JA 1S5HA 4FQIL 4EVNA 1XIWD 1JPFA 1KENL 4L8CB 4M1CC 3W2DL 1MCLA 3V79C 1XEDA 3B3IB 2ED7A 4PV9B 4U6TA 1L9NA 4OAWB 3VXNB 3MQIA 1S7VB 2A1WH 4K3DL 5IR1B 5T1MA 1YN6B 3VXRA 4I3SH 5J12B 3QIBD 5EU7C 2XTLA 1BAFL 4YPJA 1GH7A 3PP3H 4Y19A 3R4DA 5F9OL 5ADOH 4HG4K 3ILPB 1BF2A 2DIBA 2RB8A 1CN4A 3AREC 1S7SA 2YBRA 1RUQL 1DQLH 3KPPB 4JY6A 3CX5J 4RMUA 4E41D 3HUJF 3P4LA 4LRNH 1QLRB 4ENED 3JWDH 2VERN 2W92A 4JFZL 5CJOL 3V6OC 1Q0XH 4OV5A 1D5XB 1I8KB 4NUGH 3GIVB 5DMIL 3U0TA 2OQJA 3KNBA 4N5UA 4UBDD 1EV2E 3AGVA 1RIVL 4Q6IB 1MUJA 1RK1B 2BOCA 3OG6B 2ZPKH 4R7NB 4HFUH 5D70H 2OL3H 2X1WL 2FBJL 2C7UA 2XKSA 3BGFB 3C5SA 3HG1B 5K9KA 1TLKA 5HHME 5FM5O 3ALWA 3TVMC 2QHLA 5C0RH 2G2RB 2GFBB 1NLDH 8CGTA 3RTQA 3X12A 5E8NA 1REIA 2CPCA 5JHDE 2Z8VC 4FQXB 3EBAA 4Y8AA 3TNNB 1I7UA 5EU3B 3MCLL 3G04B 4PJDE 1MLBB 1QPPA 2IPTL 3A6BL 3QXWA 4NKMA 4E5XA 3C08L 3LY6A 4LHQB 4QRQB 2PR4L 5F6IC 2WAHA 1GVIA 1XF5A 5EC1B 4GO6B 5T1LB 4KUZH 1JYVA 3IFPB 5IBLC 1WJ3A 3QUMB 3PHOB 5I1KH 2H26B 4OUOA 1PG7L 3VFPA 2YEZA 4ZSOB 1MLCA 3NPSC 4HV8A 1CFTB 4PRAB 4IRJC 1GL4B 4FXKB 4R7DA 4KKAD 1EO8L 1OGAD 1CQYA 1NEZG 4BH8B 1RULL 1FZOB 4KAQL 4QTHA 1AXSA 2MKLC 3IGAA 4NFBA 2HAZA 3FO9B 4Y5YB 3BD4A 2ZUVA 2A9ML 4L8SB 3WKNA 1EEYB 4LPWA 4WI5A 3D25B 5IVZB 3SJVD 1CE6A 4PGBB 2H3NB 3LMJL 3IDJA 4NO2B 1T20A 1CGYA 3O6FD 4JDZB 5CGTA 3UPRA 1OAKL 1J12A 3O9WA 4MDIB 4NWTH 1TNMA 1TITA 1AR1C 4PG9A 1FPTL 2CJUL 4GKOA 2GT9A 4LKCA 3L3OB 3OXSA 3H3BC 3S35X 1YPZA 5C7XH 3AFLA 4QTIH 3L3JA 5HPMA 1X3DA 2EEDA 1QBML 3WIHH 3HI5L 5IF0A 4ODWB 5C07A 2WUBH 5ESVA 1MPAH 1CDGA 2Q3ZA 1B4RA 1NGZA 4NYLB 1BX2A 1OB1B 1VGKB 3LRGA 4U1JB 1S5HB 4EVNB 1JPFB 3M1BA 5JW5A 4RFNB 3AY4A 4KK5C 4HDIA 4HXAL 1A7QH 4OZIF 4XXCA 1D5MB 1QHOA 4Y4HC 4E9LA 4YHZL 2FBOJ 5HD8C 4P49A 4WO4A 4WUUD 5T1MB 1QRNE 3VXRB 1I1YB 5KVFH 4HUVA 3QNYB 2APTA 1FVCA 3OKKA 3SDXA 1C1EL 4JY5L 4Y19B 4XP1L 1SEBA 2V5YA 2GJ6E 4AL8H 5T3ZD 1UM4H 4YHYB 1E4KC 2YD6A 4W68A 3A67H 4GMSL 1FGVH 1S7SB 2YBRB 1MCOH 2D31A 1T03L 3CX5K 5HI4C 3Q6FA 1U36A 3GSNL 5E2WH 2XG5A 3KPQA 5TF0A 4JY6B 3RRQA 3IFNL 4I4WA 5T3XH 3BKCL 4JM2C 3IYLW 1UWXH 3ALPA 4ZXBD 3W81A 5CWSA 4OV5B 2CXKA 3F58H 4AT6A 4P5MA 2CIIA 4CU7A 3U0TB 1G9NC 2OQJB 4OD1L 5FHAL 3KNBB 5MI0B 1KJ2A 1EO7A 3W5NA 2AJUH 1MWAH 4WFFE 3IS1X 1LO3H 1MF2L 1MUJB 2BOCB 2QSVA 5BVPL 1EK3A 3WKMH 3KYKH 2C7UB 2SEBB 3C5SB 5F9AC 2BY2A 5K9KB 2FX7H 3CX2A 4I1NB 4ZFOA 2LTQB 4JFED 3QG6A 4IDLA 3RTQB 5IV2B 3X12B 1QFPA 4TOYL 5E8NB 1LQVA 1G9MH 5GS0C 1JPSL 4QF1A 4WVRA 3Q5YA 1DEEB 1BVKA 4HKXA 1I7UB 1TJGL 4WHYH 1T7YA 3VGEA 5IIEA 1EPFA 1YJDH 4NKMB 4E5XB 2R4SH 1ZTXL 1HKLL 1U8QA 4LSUL 2Q86A 1YEIH 1XF5B 4UB0H 1MQKH 3OR6A 3MMEA 2XRAH 5J57B 2X09A 2DQEH 3VFPB 1OAQL 3FT3A 1YEKH 5D1XA 4NC2B 3EAKA 2YEZB 1MLCB 2E8ZA 2DQIH 4HV8B 5GZOD 1OAUH 1XCTA 4M8VA 5EULV 5KW9H 5HHQA 4R7DB 5A3IC 2DD8L 1MSPA 4KJWC 3KPSD 4XCEA 3OAZH 4D9QD 1N6VA 3C5ZD 4MXQA 5C8JA 2R29L 3A6CH 2Y5EA 1AXSB 3IGAB 3K74B 5EIQA 1KGCD 4AQOA 1IZJA 3QIUC 5C0ND 2EYSA 3FB5B 4JO4H 3ZYZA 1NAMA 2ZG1A 4JKMA 1I3RA 1NUNB 4EUPH 25C8L 1CE6B 4FFWD 1HYSD 4Z7UF 3IDJB 12E8L 1T20B 4TSAL 2NY1B 4V3EB 5I1CH 2Y07L 4PJIF 3M8OL 2BVEA 3VD5A 1U8IA 3EO1A 2ZCKL 4M9PA 2FD6L 1WV7T 4PG9B 4Y89A 5IWLC 2BNQD 1GPOL 1RV6X 2AJVL 2GT9B 3OXSB 1TQBC 1E6OH 4AZ8A 1JP5A 5CZVL 3LN5A 5LGHH 3MPCA 5D7LA 3BIAX 1CD8A 1YPZB 4FQ1H 3L3JB 4UTAL 5HPMB 4KGJA 5IF0B 5C07B 4OCXH 4KUCF 5ESVB 3MROA 4NFDA 5HHPA 4QNPF 4UV4L 3WDIA 5HHOD 1I3GH 3AM8A 3M1BB 5JW5B 1BWMA 4GXVH 3O6MH 5T1DH 1B0RA 4HDIB 4ELKA 3KLHC 4MMZC 2ZSVA 3NGBC 4G6AD 2R8SH 4X6EA 1FO0H 2MNUA 3ARDA 1FNAA 4GS7C 2J5LC 4QHLA 1IQWL 1P7QD 4WNQA 1Y6NR 2AJSH 5H94A 1F4XL 1U8PA 2Z31D 4WO4B 3EFDH 3B9EA 1BFSA 5E9DA 1G84A 3BP4A 4FQQA 2L0DA 5E2TH 4HUVB 4HMDA 3WFDH 1FVCB 3OKKB 4K7PX 3SDXB 4R97C 3MFFA 1SEBB 5CP7A 4FABH 5HHXH 5EZOH 1Z3GH 2X7LB 1ZT4A 2PYEA 1K6QH 2R69H 1A14L 2FO1A 2D31B 1JRHH 1CE1L 1F4AA 1NFDE 2E5EA 3SBWA 4EDWL 2M8XA 1HNGA 4I4WB 4APQC 4BZ2L 3RVWC 5IROA 1TJHH 4N1EA 4YXHH 2CQVA 5CWSB 1WBXA 4AT6B 4P5MB 1KOAA 2CIIB 4NUJA 3SDDD 1KJ2B 1V5JA 2F58H 2NW3A 1I1CA 4EUPG 4R96A 2NYYC 3E3QC 4FFEX 3I2CL 3N0PB 2RJMA 3NBNA 5E6IA 2JB5H 4KDTC 3BPLC 3FONA 5JIPA 1S5IH 4MAUL 1ZOXA 2CD0A 4ZFOB 2BSRA 1CLZL 3QG6B 4PRNA 1DQTA 5B39A 1MJ7L 4OCSL 4ETYA 1FSKB 2YPLA 4QF1B 1J1XL 4P2RA 1CFBA 1BVKB 4WGVB 1TTGA 1A4KB 4LF3B 1TDQA 5IIEB 5J11C 4P5TB 1GGUA 4O2FA 3BUYB 2WBWB 1FFOB 4JN1L 4NM4H 4LQ1A 1U8QB 2Q86B 5DGQA 1JNLH 5C0CB 1JWUA 3OR6B 3MMEB 3D6GA 1X5HA 3LQAH 5C0AA 1W72H 3FT3B 1ZWIB 5D1XB 5I30L 2P48B 1MHPL 4E42A 3N1PC 4F33A 2ARJA 5FO8A 3K7UA 5L2KD 3QPQD 1XCTB 3HE7D 4JQXC 5HHQB 2FDBP 2ZCLL 5B3JE 4XCEB 1X5KA 4UDUA 1QP1A 4D3CL 3C2AH 5C8JB 2VLKE 1QZ1A 1GOHA 1P84J 4D9RE 3QQNA 5EUKB 3S4SG 3B9KA 1WWWX 2EYSB 4EKXA 1X4ZA 1F6AA 4QRPA 32C2B 1I3RB 1U3HA 2AP2A 1J0HA 1IMHC 1F97A 4B0MM 4IOSD 3QEQA 3PXHA 1PJ9A 1U8IB 3EO1B 1P4BL 1CXLA 1NANH 5KAQG 5KJRL 5GGVY 2GK2A 1CZ8H 3LN5B 1SJVA 3QHTC 4HS3A 4O4YL 5I1IH 5D5ME 1F2XK 3TV3H 2AABL 3MROB 3MRHA 3BZEA 3GMLA 5HHPB 2ADJA 1QLEH 3GK8L 2J88H 1D7FA 1JYNA 4F57L 3WO4C 2JIXA 4KXZI 5ISZD 1TJIH 1AIFA 1MFAL 3HPLA 1CU4L 4ELKB 1B0RB 2ZSVB 4MHHG 4OJFH 4X6EB 4HXBL 4QHLB 4WNQB 4Z77A 3H6JA 3BDYH 5GJSL 4N0FA 1U8PB 1RAMA 4RGNB 3CMOH 2B1HH 5E9DB 3RA7H 3BP4B 2IPKB 4FQQB 4G7YL 4NP4H 1M7IA 2P42B 1T0MA 4XPBL 1FZJA 3MFFB 5CP7B 1L7TH 2H41A 1IEAA 5MERA 2UY6A 4XVTH 1ZT4B 2PYEB 3C9NA 4PJ5E 1FNEA 4AIXA 3SCMD 4GW4A 4M4PA 3UTSE 4YGAB 4F7EB 3KDMA 3UAJD 3AUVA 3QR2A 5E99H 4U2YA 1WBXB 5INDA 3AVEA 4Z7NE 4MB4A 4EI5A 4M6AA 4G9FA 4NUJB 3VFGH 3SKUD 4J6RH 2NW3B 3VD3A 2IANA 4ORGA 4R96B 3LRSA 3TZVC 2FB4H 1HEZA 4LNRA 1KCUH 3M07A 4HC1A 4HUWA 4XT1C 4L1DA 4Y1AA 5IB5A 5E6IB 4HIXH 3QAZC 4AMKH 1A9BA 5E24E 4HJJH 2GJJA 4OLEA 1PVHA 4JHBA 4XNUL 1IT9L 3E6HA 1ORSA 3LEYH 3LN4B 4N1HB 4PRNB 5E56A 5B39B 5KANI 5J89A 3TFKA 3HRZA 3RWCA 1I9JL 3BPOC 3GRWA 4WHTB 2YPLB 1OP5K 3ECBA 5SV4A 2JCCF 4P2RB 4QT5A 2LAGB 4FQJL 3PDOA 5CJQL 4I9WD 4N5EC 4O2FB 2X5PA 1MRDL 1PX4A 3FO0H 4S1SH 4PJHA 1KT2A 4KPHH 1JWUB 2OI9A 2EXYD 3MACL 1DANT 5SWZD 3K2UH 5C0AB 2FCBA 2XN9A 3QA3A 4G7VL 4NO3A 4AG4H 4HFWA 1KCLA 3RZCD 2PYFB 4E42B 2DTMH 2ID5A 2KQMA 3LZFL 5F9WC 2YUWA 1RJYA 1INDL 2ARJB 3EW3B 5FO8B 3TN0C 1SJHA 5E2JA 4PG2C 3O2DA 1KC5H 4D0CA 5E2UH 4MJ6A 2VOTA 5BV7L 5HDOA 2G9HA 4Z7OE 4KK8D 1P84K 5T33H 4LCIH 2A77H 3HG1D 3WIIL 2F9BT 1TNNA 4GRWF 4QRTA 4X9GA 3RL1A 3SDCC 3UDWC 3B9KB 4XNXL 4H5SA 3NACH 2DI7A 2I9LB 1F6AB 4QRPB 4XPFH 3ZE0E 1U3HB 4LLUA 4UILH 3OBAA 1N8ZA 4ZO9A 5K9QI 3DVFA 3GMMA 2UZXB 5KS9A 4NSKA 4FQXD 3QEQB 4KKLC 1IC1A 3UBXG 3JSSA 3JVGA 5FYKH 3ZKMD 2X4SA 1OWRM 4Q58C 1ZANH 2R2BA 2GHWB 1CFSA 4S0SD 1X5XA 5T1LD 4DKEL 2E7LE 2NY4C 2PF6A 1G7LA 1DL7L 1YEFL 2VO5A 3VA6A 2DQUH 4MLIA 3GMRA 2NX5A 3BYTA 4U0RB 3TJEL 1EEUA 3MRHB 4MNQE 3JV0A 3BZEB 2EDQA 3GMLB 4KROD 2ADJB 2EZ0C 5I1LA 4MJ4A 4GMTH 1T6WA 4YDLB 4YHOH 3GSVA 4IIQA 2JIXB 3EYUL 4FQCL 1AIFB 3HPLB 3Q0HA 4L4VA 2BFVH 4Y4KA 4Z77B 4PJ7A 4L4TA 1Z9LA 4MA3A 3TF7A 4N0FB 2Y6SD 5J6HA 1Z9OA 3UTQA 5J06A 1J1PH 1M7IB 1T0MB 1ACYL 4MB5A 1FZJB 5GIRA 5DJ8A 5MERB 1IEAB 5AG9A 1NL0H 2IEPA 4WFHE 2MPAH 5I6XC 5GRUL 1A7PH 5DEGA 5JIIA 3C9NB 4HLZH 1FNEB 5DRNA 4DVRL 4OCYH 1JPTH 4GW4B 3ZDYF 5DWUH 5FCUH 4PBXA 4KMLB 3KDMB 4KZEH 1FFNA 4NNPL 2DLTA 5ACMA 4X80L 2DJ4A 2AGJL 1C5BH 2CK2A 2I60L 5INDB 4LDEB 3EOTH 4F2MA 3GO1L 4QY8A 1JF5A 4PY8J 4MAYA 4EI5B 1DQQA 4G9FB 2FNBA 2IANB 4ORGB 3LRSB 4LNRB 3Q1SL 2IPUG 4HUWB 4Y1AB 5IB5B 2DQTL 1A9BB 3MV8E 4M3KB 4RNRA 2NY5H 4HPYH 5B3NA 4M61A 1Q8MA 3E6HB 1ORSB 4IDJH 5ERWA 3PDGA 3RWCB 4J3UA 4S1RL 2X1XR 1X6NA 3VXRD 3ECBB 4HFUL 1NUDA 4O02H 5J13C 5CLWA 4N0RA 4QT5B 3BE1L 3OF6A 2HRPH 3PDOB 4Y19D 1R5VB 1XAUA 3IJHB 2DQDH 1W0VA 1GGBH 2FZ3A 4NBZB 3ERYA 2BSTA 2EDBA 1KT2B 1A7BA 3TCLA 2DQCL 2EIBA 2ESVA 3AREA 3RDTC 1AH1A 4AIZA 2OI9B 4LEXH 2HKFH 4NZUH 4POZC 4TUKH 2MCPH 2CDGA 5IFAH 2BP3A 2CRYA 1CXEA 2XN9B 3L3HB 3QA3B 4G6MH 3OKEA 1WZMA 3CMGA 4NO3B 4HFWB 1EUUA 2FYYA 2PTUA 5CGMA 4LNVA 4WIQA 3QDGA 4NOBA 5LQBH 1F6LL 3V6OA 4ZUWB 3BEVA 2Z0BA 1CF8H 3HUJE 4XPHL 1SJHB 4KUZL 4D0CB 4MJ6B 1WUNT 4F15B 1A21A 4P46C 5I75B 2NY2B 2G9HB 3CFKA 1AJ7L 5C6TH 1JNJA 1A9EA 4QRTB 1IJ9A 4YR6B 4HLZG 4H5SB 5F7HA 2X44D 3TVMA 4QHNB 1OM3L 1UACH 4LLUB 3DHJA 4K94H 1N8ZB 3IRZA 1NUGA 3LKOA 4Q0XL 3GMMB 2Y7QA 5KS9B 4WTZG 4NSKB 3EYOA 1J18A 3BISA 3S5LG 3PL6D 1NMCC 2X4SB 4MQXC 4O58L 1ADQA 3BESR 2R2BB 1NCCL 1QLFA 5FYKE 1CFSB 4JO3H 3K8MA 1G7LB 2CKBA 3GMRB 2NX5B 1B90A 1NKRA 4GLRI 2XOTA 1J0JA 3S36L 4HD9A 2QLVB 4XI5D 2YSSA 4IIQB 4QTIL 5FKPA 1ZXQA 4IRJA 5HXMA 3N1FC 1X5ZA 4L4VB 3MYJB 2WUBL 3L1OL 2QKIA 1MPAL 1BEYL 4Y4KB 4L4TB 5GRYA 4MA3B 4DN4H 5J6HB 1EHNA 4LIQL 2VWEE 1S8DA 4GW5A 2WBJC 4AENA 4UI2A 3QUYC 4ZO6A 1QFWL 3FCTA 2MSPA 4LVOB 4ESKA 5GIRB 5L6YH 5DJ8B 2EDYA 2NY1D 3QDHA 2HA1A 1DBML 4NQEA 5DEGB 4J3TA 5F97E 3SGKC 2NXYB 3O9WD 5DRNB 4OLXH 1NCNA 4X4ME 5KVFL 3BOVA 4IMLA 5AAMA 5D8JL 1CGUA 1UA6L 4BQ6A 1FFNB 1B4JL 4LVEA 3QRFM 4C4KO 2X4UA 4ZUTA 4EN3C 1L0QA 3ILQC 3E1F1 4WDIA 4F2MB 4QY8B 4N8VG 2QV2A 1BECA 3QZWG 1DQQB 3DV4A 1L6XA 1MHEA 5DD5L 5A2KH 5HDQH 1CD9B 1I1FB 3VDAA 3HAEA 4RNRB 2DYPA 5HGDA 4M61B 5I1EH 1GHFL 5AZEH 1JN6A 1LK2A 4P99A 3MGOA 4LHJB 1V05A 5D7JC 4WO4D 3U4AA 5M7QA 1FG9C 1SEQL 4OZIE 1MAMH 2EDLA 3ARFC 1JWSA 2B2XH 1EH9A 3G9VA 4XPAH 3TYGL 4B5EA 1DBAH 4K8RL 4JM4H 4OM0H 2FO4A 1YUHA 1W0VB 3D69A 3WNOA 2FIKA 2HFGL 1KCVL 2FH6A 2BSTB 3QWRA 2FHFA 5TFSH 3AREB 2ESVB 4JB9H 1MCPL 5ADPL 4WHDA 4AIZB 3GBNH 1YY9C 1OTSC 1F2QA 5HI3D 2CDGB 4NGHH 1G7JA 4Y5XC 1N5YL 4JPWL 3OKEB 5E7FA 3DO7A 2QQLH 2FYYB 1J1OL 2R4SL 4XNQB 1A6UH 4X4ZA 1NC2D 3BEVB 4N8PA 1NAKL 4KJQC 1YEIL 1S9XA 1MQKL 2VLLA 4HBQA 1SJEA 5EU5A 4LPYA 3LIZL 2CMRH 2OR9H 1FL6A 1RVFL 2D0HA 3UP1A 4JPKH 3CFKB 3RAJL 4KKCC 4JQIH 1A9EB 4LU5H 1Q9KB 5B4MC 5ANME 5KW9L 4TTDC 4WHCA 3VXPB 3CK0L 4L3EA 2XTJE 1CDJA 4ZMAT 3OAUH 4UT7H 3CZJA 3LKOB 5DK2A 5AYUL 2Y7QB 4DJMA 1J8KA 3SOBH 1NCBL 3I9GH 3UYRL 4NZRH 5FUZL 2RBLA 4KRMB 4J4PC 1U2CA 3NCYP 5CCKH 3C09C 1QLFB 1M7DA 2IH3A 2CKBB 5F70A 4S1QH 2IWGA 3I85A 3OKLA 4R9HA 4XAKD 3ES6A 2C4XA 5C1MB 1QYGL 1A2YA 2VN4A 2N1KA 5D1ZC 5D1XD 3W11D 3DYOA 2V17H 2D7QA 5LGHL 5GSRA 3NPSB 4FQ1L 2WUCL 2YSSB 4H8WH 5TJWK 1SY6A 4FS0A 5FKPB 4WU7A 4F7TB 1NGQH 4IRJB 5FDWB 4LPCA 5IJVA 4JGUA 1A7OL 4MXQD 1HN1A 3D87B 4YDIL 3I50H 1S8DB 1LWRA 4GW5B 2B4CH 4F80A 1YYML 4TUOA 5I2IA 4GXVL 3ULUD 2VC2H 2RAMA 3FCTB 2A0LD 3EOYG 4YDKL 4RBPK 3H7BA 4GAGH 1LDSA 4DW2L 4NQEB 3QWOA 1MCJA 5TPWL 3INUH 4H0IA 4Z8FL 4Z7UE 4Y16C 1F58L 1A64A 4IMLB 3MBEB 5JXEC 2EDDA 5IWLA 5IVOA 4D0DB 4PJIE 5D7LD 4JQVC 5C86A 3PP4L 1RI8A 3N85H 4JLRA 2X4UB 5EZOL 1LK3L 4ZUTB 1T2QH 1RURH 1U92B 4WDIB 4PB0H 4G6JL 5F6HJ 4YX2H 1IAKA 2C1PA 1UKSA 3ARBC 1MHEB 4GG6A 4NQCE 1PY4A 2O5XH 5BMFL 2ADFL 1B2WL 2F8XC 4KVCH 3VRJA 2AJXH 1X5GA 4QNPE 4Y88A 3K4ZA 1QTYT 2DYPB 3ARDD 2XQBH 3QUKA 5E03A 4ZTPH 5C09E 1JN6B 5D2NE 1R3LA 1LK2B 1YQ2A 4XCNA 3MGOB 1U0QA 3WIFA 5HYJD 5JQ6L 4MGXA 1PQZA 2QADC 1UKTA 3WLWD 1XIWC 5E9DD 4RMTA 5BV7C 4ODBD 3V7AG 1JWSB 2JB5L 4P23B 4ZPTA 4ALAL 2E6JA 2WWKT 4I2XE 1N64H 2FO4B 1A6WL 1YUHB 4GAFB 3D69B 3X3GH 1R3HA 2PYED 4TSBH 1UXSA 5CILH 2L7UA 3RGVD 3FFDA 5IB2A 3EDJA 5BS0A 5JMRA 4NQDA 1G7JB 4O2CA 4ZOCA 4APQA 3OJ2C 2QBWA 4J12A 5DA0B 3DO7B 5GRXG 4GRLC 2F54E 1F3RB 1I9RL 2BXZA 4M6OH 5F21B 2M1KA 1S9XB 2VLLB 5DUPH 2ZG3A 1SJEB 5EU5B 2IBGA 5T3ZH 1FL6B 3UJJH 2DQGH 4PJFA 3GZKA 4JKWA 2YD7A 3H2WA 3E3QA 2XXCB 1GIGL 2C26A 4UOW1 5D96C 4NHUE 5E6ID 1B0GA 2APVA 4KDTA 3DGGA 4L3EB 2WANA 4KK6D 3FFCE 2IG2L 3VWKA 4U1NA 2YPLD 4ACPA 4E41E 5F96L 3QXTA 3HKFA 3T2NL 4F9LA 5KSUA 1H0DA 3P0VH 2J2ZA 5C08A 3FL7A 1U9KA 2YD8A 2GYSA 3ZKND 2ZUWA 1M7DB 3MODL 2IH3B 3RNKB 5DJCA 3OJMB 1R24A 2KKQA 1XGRB 1ZV5A 5DC4B 3OKLB 3U48A 5BXFA 1VACA 5EU6E 3ES6B 3V7AE 3CLEH 3SKOA 4PRPA 1T1ZB 5C0AD 1A2YB 1JGVL 3MV9E 2DICA 3P30L 4DZBA 4IRZL 4U6VL 1CZ8L 2ORBH 2J3SA 5GSRB 3KJ6L 3EYQD 3MX0A 5HGGS 2O26U 4KXZH 1CFVL 3VFNA 4NBYB 1V3MA 4WU7B 4TQEL 5D72H 4ZS6C 2YD9A 4JQXA 1WLHA 5IJVB 2AEIT 3HMXA 1H3PH 5IHBA 2X9YA 3IAPA 4NQVA 5IOPA 5FGCB 3B9KD 5AWNL 3MOBH 3IDGA 3CVHH 5F8QC 4TUOB 4GRWH 4QRPD 5I2IB 4BK4A 2YKLL 4OJFL 4F7PB 1BVLA 4NQXA 4M6NH 3JV4A 1YMHA 4NJ9H 3H7BB 4OLYH 1BJ1J 3QWOB 2VDNH 3FT2A 3CMOL 1JFQL 3WXVL 1IC5H 1ONQA 5F93C 1T22A 4MZ2A 1N0XL 3U0WH 4HEPG 2XFXB 1J88A 4KRPD 1MIML 5C6PB 1TQBB 4NQTA 3D1MC 2B7DT 1QRKA 4ODTH 4JLRB 3BKMH 4TYUA 2GTZA 4DQOH 3VRLF 4M7JL 4AIOA 3B5TA 1IAKB 1FO0A 2C1PB 2R56L 5EBWA 2BSSB 1E4JA 4GG6B 1BMGA 4HK3N 3KLSA 2AXHA 5LCVL 4XHQA 3MRPA 2ZZUT 3CCHA 5F1NA 3VRJB 2R4RH 5JA9A 4O2EA 1P2CA 1A3QA 3H9SA 4L4JA 2K7QA 4NZTH 1YPZF 3NGBB 2DL9A 2AXFA 4GS7B 3QHFH 2J5LB 1R3LB 3KYNA 4TNVK 4XCNB 3WIFB 3ZHKA 1PQZB 4ODSL 1KCUL 4BUGA 4AQ1B 4ZPTB 3HFML 2BY3A 1M7XA 4N0UA 1FDLH 4ZO8A 3MUY1 1UXSB 1Y0LA 4P9MH 3RIFK 3FFDB 5IB2B 3UYOD 5D71L 4OLZH 5BS0B 4LAQH 4X6DA 3BIKA 1YMMA 2XWJA 5BRZE 4NQDB 4O2CB 5GS1A 3O3AA 2BJMH 3DX7A 4EOWH 4APQB 1MWAB 2IBBA 3KHOA 3SDXF 5CJBA 4KPHL 4EI5D 4G9FD 3WHE0 4HUXA 2GJZA 2OSLA 4U1LA 2IAND 1MFBH 4PJFB 3O81A 4KRLB 2F15A 1B6UA 3TZVA 3H9YA 1CL7I 4Y1AD 1IKFH 4OBRA 1B0GB 2JF1A 1X9QA 3BPLB 3QHZL 3MJ7A 1H3UA 3RKDC 2VXVL 1QSEA 4M5ZH 3VWKB 4DOHE 3TFKD 1OQOA 4U1NB 5T33L 3N50A 4LCIL 4XWOD 3QJFA 5KSUB 1H0DB 2V7NB 3ZYOA 3REVA 5C08B 4N5EA 5J11B 5IM7A 1W72A 3F12A 3G08A 2ICCA 1RZKH 3P9LA 4V3DB 1MH5A 1AHWC 5DJCB 1R24B 5DT1H 5BXFB 1VACB 1IBGH 2XN9D 4RQQA 1TZHA 3S36X 1JIBA 3GIZL 3UTTE 2DM4A 4HQQH 5HVFB 1GZQA 3KVQA 5CD5D 3VFNB 5SWQB 1OCWH 1WWAX 3TN0A 4PG2A 4JKPL 2ICEB 2NY2D 2DBLH 2VISA 2B8OT 3IDNB 4ONHA 4NQVB 5IOPB 1DN2A 4GMTL 3ZT7A 3IDGB 5MEND 1FORH 4L29A 3UDWA 3SDCA 4G8EA 4JRWA 1ORQA 4EIGB 1QBLL 4ZOEA 3NAAH 4QXGH 5IK3A 4OGXH 4LLVA 5FHBH 2JB6A 3ROOA 5CBEA 1HH9B 1BVLB 4GRWE 4NQXB 3JV4B 4X7SL 4C56A 1YMHB 1BD2B 3CSYA 3TWCH 4Q9RH 3QQ9C 3FT2B 3LKQA 1DVFC 4L8BA 4LBEA 4U4BA 5L7XH 1AC6A 4WW2F 1ONQB 2J8UE 5GSVA 4U1MA 1T22B 1UYWH 4RMQA 2VLRD 1CICC 3VH8G 3KPSE 4UINL 4I3RH 1KJMA 2GTZB 3ULUF 1K4CB 1OP9A 4KRNA 4JRXE 1EZVX 1KGCE 4K8RC 3ELAT 4F3FA 4KZDL 3RY6C 1AGCA 4HBCH 4LEOA 3IAGC 1WVZA 2HP4A 4MWFB 1FO0B 4FZEL 4NKQB 4PP1C 5EBWB 2NY7H 4ZUUA 4YPGA 4XVSL 4CW1A 3MRPB 4JREB 1BFTA 2P5EA 3O2WH 4O2EB 1OPGH 3GSNA 1EGJH 1P2CB 3QIWC 4L4VD 3SGDH 2FEEI 4U7KA 4Y4KD 3DROA 2AXFB 5GS2D 4RWHA 1WEJL 1IAOA 3RI5K 2VTFA 2AK1L 2ERJC 3L5HA 1ZT7A 3MJ9H 5FV2A 1VSCA 4N0UB 2R2CA 3WXWL 4K3JL 4ZTOH 1NLBH 5H37G 1Y0LB 4QHKI 1FNHA 3NZ8A 4M8QA 1CD1A 2R2HB 1UFUA 4LGSB 1NKOA 4X6DB 3BIKB 1YMMB 1YN7A 4X6CA 2XWJB 4MCZA 2XY2A 5GS1B 3V9FA 3L3DA 3O3AB 4LCWB 3DX7B 4LSTL 4N90D 3DNKA 3TH3T 4OM1H 5ABDE 3ZDYE 4LPUA 3E8UH 7CGTA 5EUOE 3V5HA 2MQCA 2VR9A 2BOBA 2B1AH 3U9PL 4XPGL 2X1OA 4F7CB 4MAYD 1TMCA 3FN0L 2HKFL 3U4BH 4HUXB 2GJZB 1HNFA 2OSLB 2VXTH 4U1LB 4LSSH 3TJHC 4G6ML 3TZVB 1T80A 2EDKA 1HXYB 4M1CD 4V2CB 4XBEL 3A0OA 4NRXA 1QSEB 1BBDH 1MCFA 3GMNA 1RUAH 4R4FL 1JTTA 3BPOB 5JW3H 3F7YA 1ZLUK 4NHCL 3DRQA 1UM5H 3QJFB 4OD3L 2XI9A 3OF6D 4G8FA 3REVB 3RPIB 4D9LL 1IILE 5IB3A 4PLKC 4QRSA 1CVSC 1YEJL 1KELL 3MNWA 1W72B 3F12B 3TA3C 3G08B 1IAII 3P9LB 4TVPD 1MH5B 3ARED 2ESVD 5K9JH 4TSCH 4P4KC 2P8MA 3MUZ1 3MNZA 3VI3F 4P2QD 3RDTA 4M48H 5F44A 4YK4C 1TZHB 3H3PH 3QDGD 4X83A 1CDUA 3MSPA 3T1WA 1GZQB 5F9WB 2DLEA 2EC9T 4MD4A 4D2NA 3TN0B 4LQFH 5I9QC 4XMLH 4P46A 1IQDA 1NH6A 3QT2A 4R2GC 1YY8A 1CGWA 3FQRA 4ONHB 1KBGH 4L29B 5JDSA 2VLMD 2EIDA 4G8EB 4HF5L 3TVMD 1ORQB 4LSPH 3WN5A 4LLVB 2JB6B 4F8TA 3ROOB 4LOUC 4C56B 2W60A 3GI9H 4J7RA 3MREA 5DUML 1FRGL 4LCCC 3LKQB 4L8BB 5GSVB 2EICA 4U1MB 1P4IH 1XR9B 4OGZA 3V4VH 3TO4C 1CDCA 1WTLA 1KJMB 2VMFA 1M71A 2H9GA 2NY4B 5C3TA 3P2TA 4OLXL 5C0BD 5IBLD 4JGMA 3NCJH 5L9DH 4F3FB 3VRIA 1AGCB 3RWIA 1E6JL 4LEOB 4KDWA 4NM8L 4YPGB 1UEYA 1KYOJ 4DGYH 4CW1B 3TBVA 3CC5A 1ZA6A 1EJ6A 1AKJA 2BVUA 3O3UN 3GSNB 2KQNA 3UO1L 5KVEL 3VG0H 3QFJE 1GGCL 4X4XA 3T0XA 3IT8D 1NGXA 5GRJH 3DROB 2EH7H 2VDKH 1SM3L 3DUSA 1QR4A 4XXDA 3VFOA 1IC7H 1IAOB 2WBJA 3QUMH 4FFVC 4ODHH 4HS8H 1ZT7B 2H45A 3QISA 3QUYA 4ZFGH 5FO7A 4P5KA 4NQED 2J4WL 2HLFC 5I6XB 4N0YH 1FC1A 3SGKA 4YXLL 4BA8A 4M8QB 1AR1D 2Z93A 1A6VH 1F4WL 2F5BL 1E4WL 1YN7B 4KI5E 4ZFFA 4MCZB 3L3DB 2VLJD 3V5HB 3EFFA 1CGTA 5LBSH 3ULVL 4MXVF 3X3FL 2EO9A 2RCSH 4JFFA 4EN3A 5TFSL 4JB9L 4KTDH 1TMCB 1DBKL 1MJUH 2AJYL 2F5AL 1A47A 2EO1A 2Y1VA 4UV7L 3G6JE 3AAZA 4YUEL 3PWPE 4XC1L 4KK5D 2PTTA 2E7LC 1ODAA 1LO0H 2ILLA 4NRXB 5EBLB 3GMNB 4Y4HD 3L5WA 1B6DA 4UNTA 4JCLA 1HE7A 4JPKL 1YEGL 5HD8D 4JO1L 5D7JA 3L5IA 1G0YR 3F7YB 1FC2D 2MFNA 5ECJE 5AYQA 3DRQB 2F53E 1LE5A 4AM0A 5J13B 3ARFA 4G8FB 1NBYA 4JG0H 5IB3B 5FGSA 1Q1JL 4QRSB 1AGBA 4WUKH 3CSPA 5IW1B 5IQ7L 2X2YA 5IT2H 4UT7L 4OZGA 1JHLH 2I5YH 5ESAB 4LL9A 4NZJA 1NCAH 3NCYS 2HH0H 2P8MB 1KB5L 3MNZB 4MYWB 3RDTB 3GB7A 4PJXA 2QQKH 5HI4D 3CXHJ 2GQHA 4JM2D 4Y5XA 5I18H 4DKDC 3EO0A 3ARXA 4MXWH 1T04A 2QQNL 3EO9H 2WZPD 1HYRC 4Q6YA 4UT6H 1H5BC 1LGVA 2N56A 4P46B 1IQDB 2V17L 3T3MF 4Y4FC 3FQRB 1Z0MA 3BWUC 4YIQA 2O5ZL 1H9VA 2NY3C 1R0AL 5JDSB 5I1GH 1CLOL 5BO1L 1OARL 3WN5B 5FYJU 1T21B 2O61A 2X89A 4PJBE 2D7OA 3MREB 5FA4A 1ZEAL 3LSOA 1DP0A 5GS0D 4JRYA 1J5OL 3BQUA 5DRWA 3ARGC 5IB1A 2H1PL 1ZKAA 4I18C 1GGIH 4UT9L 4XCFH 1IGIL 2BVOA 1RZ8A 1WC7B 2DQJL 4G42A 4LHUA 2X4OA 2KL6A 1JTPA 1M71B 5DEZA 2I9TA 4WI8A 3INUL 3HG1E 4OZHA 3CSGA 3RP1A 4M7LT 3VRIB 3OKOA 4CDHA 3SKJH 1F6FB 1F42A 5HVHB 2AXGA 5CSGA 5D1ZA 5ID1A 5KS9F 4EBQL 1L6ZA 5ALBH 2HWZL 3TBVB 3CC5B 3MLXL 1ZA6B 1T2QL 5E8OA 1AKJB 2CUMA 2YWZA 5EO0B 1QFOA 4KJWD 5A3ID 5DZOA 4X4YA 2V2XA 2FX8L 1NGXB 1R3IH 5DSCA 3CU1A 4Z6AT 3DUSB 4XVJL 4MNGE 1EEQA 4J3WA 4Z18A 4N68A 4XXDB 3VFOB 4YJZL 3QIUD 4QYOA 4CJ0A 3PUCA 2WBJB 1DZBA 4QXUL 2BRRL 2XQBL 5L2JA 3G9AB 5DQ9A 4P5KB 5FO7B 4ZTPL 4OIAA 3HNSH 2UWEE 5FA3A 1OW0C 1ZLSH 3PGFL 2X1PA 3PJSA 4RISL 4G43A 2V2TB 4R90L 5E8PB 1RD6A 2Z93B 4ZFFB 3MXWH 3D39E 2CIKA 3E2HB 3BXNA 2HFFB 1EBAA 3AB0B 4JQVA 3NA9H 3PQYD 3FN3A 3I3EA 4K23H 4HUNB 1CGVA 1A5FH 1BBJA 4PY8I 4JFFB 4RIRA 4EN3B 3QQ3A 3SKMA 3FMGH 5A2JH 1IGML 5JHDA 1XGQA 3TBSA 3GI8H 3ARBA 2FJGA 4NN5C 4Z9KB 3AAZB 1Q72L 5DXWA 3BZDA 4PTTA 2R9HC 3PHQA 3KLHD 3GKZA 1A0QH 1PG7W 3AROA 2PTTB 5DC9B 3DRTA 5DUPL 2YA1A 3OL2A 3O3BA 4PY7B 4MJ5B 3L5WB 2E6QA 1A8JH 5TE6L 1ZHLA 1BZ9B 5D7IE 3U7AA 5D7JB 1INEL 1N3NA 4XCCH 1XIWA 4CBPA 3VGAC 1LE5B 4AM0B 1ZT1A 3ARFB 1NBVH 4YWGH 3ZSSA 1NBYB 1FFRA 5JR1H 2GSIA 2DQHL 4OZGB 4FN0A 5F3HA 3O6KH 1WISA 2OP4H 5GGSY 5DLML 2R0LH 3QIBA 2UZIH 4KH2A 4C83B 3LD8C 2VDLH 5BS0D 1FCGA 3GB7B 4PJXB 3NPZB 4YHML 1ZGLP 4X8XA 2EDXA 3SE4C 4APQD 4Y5XB 3RVWD 4LAJH 5IP4A 4ERSL 2W07A 3MR9A 3EO0B 5FYJD 3ARPA 3VXRE 1DQDL 3T0EC 1T04B 5TE4H 2NYYD 1JUFA 3MRKA 3ARYA 4UDTA 2NXZC 4YIQB 3QUXB 1UWGH 5JORA 1P1ZA 5I1HL 1N4XL 2AI0H 1VENA 3MLUH 4ODXA 3HS0B 3X13A 5KG9B 2YUZA 3T4YB 3T0DA 3DUHA 5LGJB 3V5DA 2O61B 5J3HC 1EFQA 4XZUA 1H3PL 5FA4B 5DD3H 3LSOB 2OZ4L 4JRYB 1U8HA 2D03H 3BQUB 5IB1B 1KJ2H 3HC3H 1AFVL 1JV5A 5DMKA 1F90H 5JLZA 1RZ8B 1AE6H 4G42B 4LHUB 4NJ9L 2AEPL 2X4OB 4PGCA 4OLYL 1BFVH 1T66C 3D18A 3UROR 2I9TB 1IC5L 5LXGL 1CXFA 4PRPD 1KIRA 3PL6C 4OQTL 4OZHB 4WCYL 4ZOBA 1E4XI 1QRNA 1MJ8L 5DUBA 2AXGB 5D1ZB 5ID1B 5GGRA 1VFBA 1ZK9A 4MA7L 1YNKL 2QQQA 5J6GA 3C87A 1U6AH 1AY1H 1NEZA 2GJ6A 3VD9A 1BQLH 1RZJH 3LS4H 3CD4A 4X4YB 2V2XB 1PY9A 3VXUD 2DKMA 5DSCB 4NN6C 4FQLH 4PRIB 3ZTNH 1FVDA 4QYOB 4UMGA 4GOSA 3EIFA 1UCTA 2CUHA 3NH7H 3BKJL 3VI4F 4NZTL 6FABH 5L2JB 4K3EH 5DQ9B 3TNMA 3WJLA 1R5IB 3RQ3A 5FA3B