3VFPA

Crystal structure of hla b*3508 lpep158g, hla mutant gly158
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRGYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title The Energetic Basis Underpinning T-cell Receptor Recognition of a Super-bulged Peptide Bound to a Major Histocompatibility Complex Class I Molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vfpA01
4J3SA 3O6FD 4RWYH 3IDJA 4PUBH 1F13A 5HVFB 3X13B 1BVLB 2K7PA 4P2YA 1JHTB 3CIQA 3WLWC 1AD0A 4R2GD 1GC1C 1MF2H 1U3HC 3GRWL 4LVHB 2ENSA 4O51A 4ZTPH 1G7PA 4UNVA 3CSPA 4K3JL 5ETUB 4O4YL 2FO1A 5IP4A 1Y18B 1A4KA 4JB9H 5D5ME 1ETZB 3CMOL 1H3WM 1C5DB 1UVQA 5TF1L 2IPKB 1I1FA 4GMSH 4L9LA 3P77A 3SKNB 3W5MA 5I0DA 4QRPE 1OAXL 4H25A 1MCIA 1UCBL 5I74B 5INDB 5CJ8A 2AXFB 5ISZB 3JTSB 1P53A 4ZNEE 3FN0H 2ID5A 2BJML 4OZHE 4HGWB 4NKDA 5DHVH 4D0BB 5IIEB 4WW1B 4GG6E 5JQHC 1CD1A 1KB9J 2MQCA 3ULSA 1YEEL 3MLSL 5FCUH 3MV8A 4PJIB 5TDPA 4OGXL 3WXVL 3Q1SL 4GXVH 4JHWL 4MJ2A 3KPSB 2YC1A 5F7NC 5CEZL 2NXYD 4ZXBA 3GM0A 4HWNA 3DBXB 4OLUL 3CFJB 5E1AB 3U4BH 4TSAL 3QIWA 3N1MC 1E4WL 3T77A 1IARB 2FL5A 5FGCE 5C8JB 2ORBL 25C8H 4EJ1C 1GIGL 1MHPL 4XBGB 1DQLH 3MZTA 3IF1B 1PFCA 4NQSA 3ULVF 4P4KB 3ZSTA 4FTVE 4R6UA 5CJXC 5K93A 2R0WH 5HGBB 3WDJA 5DMGC 1CE6B 1ACYH 4G6KH 3KPOA 5FA3B 3WO4B 5CZVL 1U36A 5ALCH 5L6YH 1OTSC 3GJFK 3MRQB 4LAQL 4MLIA 4PD4K 4Q74A 1A3RH 3KYNB 1K2DB 2C7UA 1JPSL 3WSQL 4MZ3A 4WUUB 4MJ6B 2NTFB 2D31A 3TIEA 1X5FA 4NKOB 1UEMA 2CLVA 5TE6L 3V9FA 1NCBL 5LAXA 4H88L 3LMJH 4DGVH 3AFLA 1J8KA 1IGCL 3SE4A 3TCLB 1S9WA 4OT1H 4HD9A 3TIDA 4OCLC 1E6OL 2HKHH 2YSSB 3QPXH 4QGYA 3T1FB 1UJTA 4ZFOL 4GW4A 2VSDA 2WINA 5LXGH 3BHBA 4YHMH 3CVHL 1X6NA 3S37X 4LPXA 4I48A 1NGWB 3PGCA 1T4KA 5F7EH 4G80B 5DURB 3GO1H 4LCWA 1FLTX 2J88H 1KPRA 4NC1E 1H8NA 2VAJA 2D7OA 4X7SL 2EH7L 4UIMB 4FXKA 4B5EA 4WFGE 1WAAF 4OZFH 4HKZA 1MEXL 1FL5A 5D8JL 1A5FL 2XV6B 3FFCE 5C0AB 4MGXA 4CU8A 1RIVH 3ECBB 3LEVL 2EDKA 3H0TA 1TVHA 2OTPA 5EOCJ 3N9GH 1UWGL 4MNHA 1Z9MA 2O5ZH 2RHEA 5A1AA 2E9JA 2Q8BH 4AQ1B 1CD0A 4UBDD 1MFCH 2IJ0C 1RUMH 3RZCB 4QTIH 1MI5B 3K2UH 4I3RH 2YD5A 4LVOC 4YLQT 2I9TB 2ZOLA 4NJAL 1BIHA 4JY5H 5AWNH 3U48A 3LQMA 3HMWL 4ODBD 2JK5B 4UINH 4R97B 3G5ZA 4BQBA 4WHTB 4ZTPL 4JREC 5JA8B 4R0LC 5HI4D 3RKDC 1KCKA 2H32B 4FQCL 3GMLB 3F5WA 3FB8A 4N5ED 2VR9A 4L4VA 4J8RA 2XNAB 3VFMA 5LBSH 1XGQB 1G9NC 4GMSL 1WT5C 3X13A 1RFDL 1BVLA 1JHTA 1UYWH 1AGCB 4I5BB 1T7XA 2YPLD 4OLXH 1YJDH 5JA9A 1ES0B 1HHJB 3H7BA 1ZS8B 5ETUA 3L3OA 5C7XH 1Y18A 4XVTH 5HJ3A 5F97E 1ETZA 1JP5A 1C5DA 1OARL 1HOCB 3LRHA 3QXTA 2IPKA 5EBMA 4HJJH 4LPVA 5FCUL 3SKNA 3QHTC 4G7YH 4L8BA 1KTKE 3H3KA 2AXFA 4HKJA 3JTSA 3WEXB 4QNPF 5C1MB 5KVDH 4YDLC 2DQUH 4HGWA 5IHZA 4N68A 3U4BL 3FT2A 5LCVH 3KVQA 1QRND 5ILTH 3GM8A 4D0BA 5IIEA 4PBVC 4HJGB 2EEBA 4P2QD 25C8L 4DUXA 2XY2A 3P0VH 4PJIA 5I8KL 5E8NA 1OOAA 2ZUTA 1QFWH 1W72L 2XICA 3HMXA 5IESH 3KPSA 4NQDB 1FNHA 3MRMB 5IB1B 4LPWA 4PJDF 4KK9D 5E1AA 2MOVA 5F72S 3ZKMC 3UBXB 4Z7NE 3QP3A 5GXBB 1RZJL 2MTPA 3MOQA 3Q6GL 5L6YL 1U8IB 5C8JA 4Z7WF 4HWZB 3BIBX 3QQ3B 4XBGA 5L2KD 1RU9L 1A3RL 3IF1A 3QJFB 3CLFL 3OJDB 3BDYL 4R4BA 4IOFC 4KTYA 5IR1A 2VLKB 4P4KA 3JWDC 3NCCB 4I0PB 4R9HA 4FNLL 5E2WH 1S7WA 4BSVB 5HGBA 5DEGB 5IB4B 2ZUQC 4P3CL 1AGFB 5FA3A 4HF5L 3ROLA 4ZQKA 5IFJA 1T7ZA 1ZANH 4HDIA 3LMJL 3MRQA 3BQUB 4WHDA 4PJFB 1S3KL 5KSBF 4LRIA 1WEJH 3KYNA 4D3CL 1K2DA 5L88H 3OSKA 2D7PA 1IKFH 4G5ZH 2D7TH 5HD8C 4WUUA 4MJ6A 3QPXL 4PJGE 5DMKB 4TQEL 4W6WB 3VFSA 4NKOA 1G9MH 1PG7L 7FABH 3UC0H 3ARFC 2X6MA 4N0RA 5LXGL 1D6EB 3KS0J 2PTVA 2BVOA 3MLVH 3SE9H 3CSYB 3IFLH 4PJAF 5DGRA 4YXHH 2IF7A 4YHNB 2VLJD 3TCLA 5DJAB 3V0AC 4NSKA 3CK0H 4X6EB 5HI3D 5EZIH 4MAYB 4U7MA 1RUKH 3SJVA 2YSSA 4JY6A 5LG1A 3T1FA 4PRIB 4RMVA 5A3IC 1AGDA 4K55A 1BBDL 1I1CA 3VWJD 5MI0C 2QQLL 5DJ8B 5C0CB 1QSEB 2X4OB 4M8VA 3DNKA 3NOIA 5GRJL 3GIVB 3HNTH 3N9GL 2O5ZL 2AJUL 2LVEA 2Q8BL 1KXQE 2GT9A 4E42B 3V8CA 1NBVH 3KJ4C 4UIMA 2A6KA 5GGTA 2HKFH 1RUML 1KCSH 4QTIL 3D39D 4F37F 4QXUH 3CFCL 5C0AA 3VRJB 4XMLH 3ZZ1A 1OAYH 2FNBA 4JY5L 3TT1H 4TTDC 3SDAB 3BPNC 4X9FA 3IJYB 5EOTB 5AZ2H 3KLSA 5GGUB 3B9KC 4G8IA 2APVA 4N8VG 1P2CB 1JRHL 3TYFA 2DQEH 4C56B 3RZCA 5CD5C 1IC1A 2HFFA 2PF6A 5D7IA 4XBEH 1A14H 5LBSL 2I9TA 2EDHA 5CZXC 3MPCA 2YPLE 2QQNH 1A7OH 1RULH 5H8DA 1FP5A 3HAEH 4P2RB 2CKBB 2JK5A 2UUDH 3QULA 3PP4H 3D5OF 4ZS6C 4RNRB 1YJDL 4KFZC 4JANB 5HHOA 1FRGL 3GMLA 3VGFA 3KYOB 3P0YH 5DMIH 4OAWB 2VLLB 5L9DH 2V6HA 3D9AL 5L0QC 4Y16C 1QFUL 3DHMA 1P6AB 1XGQA 5I75B 1V05A 2QLVB 5LVEA 2OR9H 5K9JL 4KDTA 1BZ7B 4G7YL 1AGCA 1LD9B 4I5BA 5F9OH 4LSSL 5B3JE 4GAFB 1KFAH 2H1PH 5DRNB 1ES0A 1HHJA 1JZ6A 2BOCB 3C6LC 1ZS8A 4GW1B 4LIQE 2A38A 3FT4A 1U3ZA 4P2QE 3D3VE 1RK1B 4P3WA 4POUB 1JYWA 1YECH 1HOCA 4G8GA 1NDMB 2ARJQ 4GW5B 4Z95H 4Z0BL 3QUZD 3T08A 3MRCB 1P69B 4NNPH 4N9GB 4BFIB 2ADJB 1QFWL 4RGMB 3WLBB 4JCLA 4TUJB 1FO0B 4M6MH 3WEXA 5IESL 2VOTA 1E4KA 1DBAH 1ND0B 1KV3A 2RR3A 2X89D 4YIQB 1CDHA 2DQJH 5TE4H 3ZT6A 2FZ3B 1G7LB 3VFPB 3IAPA 1FVEB 4Z7OE 5JPNB 5JIKA 5L2KE 4OSUL 3SDXE 1X44A 4L9LC 2F8OA 4ODHH 3MRMA 4WCYH 1A6ZB 2X4RA 5IMMB 4EQ3A 5E2WL 4Z77A 4CW1B 1RMFL 2DQHL 1CICD 4LARH 1OTTD 2P8PB 4F7MB 1NFDE 1U8IA 1B0RA 3SKJH 4XPHH 3RY6A 3GFUA 3QQ3A 1G7HB 1M1SA 3QJFA 3OJDA 1DQTA 1WEJL 3DVIA 3MJ9H 5L88L 1SEQH 2FB4H 5F8QC 1IKFL 2FHFA 1U58B 4G5ZL 2COQA 2NCMA 4WDIB 1GZPA 4BSVA 1NGYA 2FH6A 4G9FA 1RIHL 7FABL 5IB4A 1KCUH 5I1GH 1OW0A 1AGFA 5D5MB 2VLJE 1DVFD 3NFSL 3LS4L 3BIKB 3ZKNC 1S7UB 3BQUA 4RWHA 3QIWC 4OZFG 4YXHL 4B53A 3IT8D 4QRPB 1WZLA 4DKFL 4JM2F 3P4NB 2IFFL 5EZIL 3NCJH 1X7QB 2R69L 4PGBB 1JGUH 3V8OA 2MKWA 4JG1H 2QEJA 4J3UA 1U3JA 2XKNB 4JLRA 2FEDD 3WL9A 4LDLB 4P5TD 2F9BT 3CSYA 5DYOB 5KANG 1LO3H 3NACH 4YHNA 4ZTOH 5DJAA 1IGTB 1KCRH 4X6EA 3UTQB 2RB8A 1WWWX 2R0LL 4MAYA 4NO3B 3D39E 5K9KA 3MBED 2VITB 1S7XB 4LU5L 5D93C 2HKFL 2IBZY 4PRIA 4OLYH 3OAUH 4OBSA 1MVUB 1JPTH 4H1LB 3T0AA 4M9PA 4UNTA 4XCYB 3F7QA 2VDPH 3MLYH 3BUTA 3ZE2F 5DJ8A 5C0CA 1OAYL 1QSEA 5FGCB 4YBLB 5JHLL 1HZHH 2PYFB 1T1WA 4IEFB 3GSOA 5HYIA 3GSVA 1BAFL 3TBTA 1GGCH 2Y5EA 5FYKL 1MFAH 2HRLA 4E42A 4ODXB 1F4XL 4M6OL 2DQEL 5ANMA 3ULVL 4FTVB 3QUKB 1CDCA 2A9NH 4BH7B 3H42H 5MEOB 2VDLL 1U8MB 5A2IH 4X5XB 1CFVL 3HE7B 5AZEL 1ZXQA 3O3EB 2QQNL 3HCVB 4S11A 1N5YH 4HXAL 1J1PH 2H9GB 4GBXB 4PLJC 5EOTA 5EG6C 1OAQH 4BZ2H 3IB4A 3CDGB 4KVCH 1Z3GL 1P2CA 4PJHA 4TPRL 4C56A 3DI2B 1TTGA 4HUUB 3P0YL 2B1HH 1AQKH 1DP0A 4RMUA 2WWKT 3I6LD 2P4AB 5ELIA 3MCLL 4HPYH 5INCB 1HKLH 1R5WB 2VXTL 1CDGA 5C3LD 4L29B 2OR9L 2CKBA 1KF9B 1QVOA 3QNYA 5F9OL 4M61A 3OKEB 3V6FB 3LD8C 5HHQB 4RNRA 3IVKA 4JANA 3CXHJ 4HH8A 4KAQH 5E94B 4OAWA 2VLLA 3TA3B 5C0GB 1YECL 5FB8B 4ZFZB 4JHZA 1BZ7A 1LD9A 2IMNA 4G6AD 2I5YL 3K4AA 4K9EL 4NHCH 5HGGS 2BOCA 1PZ5A 3HE6D 4GW1A 1OSZB 2DQJL 1RK1A 1YPZE 4IRJB 1P4BL 2W60B 1XIWD 3VI3F 5IFHH 2DJ4A 2B4CC 3FFCB 4DVRH 3KPQB 4N9GA 4BFIA 2EDFA 3AU1B 4KJPD 1BLNA 2HT2C 4TUJA 3G04B 3KNBA 3WLBA 1FIEA 1ZWIB 3T4AB 1FZJB 1ND0A 5D1QD 2X1WL 3E6HB 4PRHA 2FZ3A 3JV4B 1IL1B 4FXGB 3P2TA 1G7LA 4LARL 3VFPA 3U30B 4BFEA 1IT9H 3QEGH 4R2GB 2OS7A 4HJ0D 4M7JL 3SKJL 1F4WH 3PWVB 2FECL 4XPHL 1P7QD 1YC7A 2CD0A 4FQJH 1DUZB 3SGJA 4FFZH 2ZCHH 4P5MB 5JOPD 1SEQL 3STLB 4LMQI 2FB4L 4GJTB 1A6ZA 5IMMA 5IHLB 5I74C 4FFVD 5C0RH 4CW1A 4M6NL 1KCUL 5I1GL 3VG0H 3U46B 2P8PA 4F7MA 5HY9B 3FQUB 4HBCH 2APFA 5JW3H 3GJEB 4XWOD 1G7HA 4PB9H 2PTTB 1H8SA 1DLFH 1IC5H 2W0KA 3NCJL 5CP7B 5EUOF 1X4ZA 4X9IA 2HJKB 4EEEA 4WDIA 1DANU 3MRNB 1DSFH 3V6ZB 5EOQH 5GQBA 3L3HB 3EDKA 5FK9B 3QQNA 3PQYD 5ITFB 4E0RA 3P4OB 3VRLE 4ZTOL 2LABA 1KCRL 1MRCH 3P4NA 3QA3B 4NKIL 1X7QA 2QV2A 4KI5D 5BW7A 4ZNEA 1PVHA 4KH2A 4PGBA 2NW3A 1NMBH 2QQKH 1KUMA 2WBWB 4OZHA 2EYTB 1SQ2N 1GGIH 5TGBA 5LQBL 3R8QA 2XKNA 3DYMA 1RUPL 2VDPL 4GG6A 1YY8A 1OD9A 4YFLF 5DYOA 1U92B 4YBQD 1ZT1A 2OJZH 3WO4C 2H6PA 1INEH 4ZG1A 1IGTA 4Y19D 4ZS7H 4NT6B 3UTQA 4NO3A 1MFAL 2VITA 1S7XA 3BGMB 3HAEG 5EC1B 4LRIC 5DVKA 3H42L 4XMPH 1I8KB 4H1LA 3B2VL 2XA8H 3K3QA 4XCYA 3CC5B 4O2FB 3MMEB 3KGRA 4MS8D 2PYFA 5BS0A 5F3HB 5EN2A 1BECA 2PW1B 2EDBA 3DI3B 2IAND 4KVCL 4ODXA 4ZUSB 1ROWA 1SEBB 3I6LE 4FTVA 1BJ1J 5I1HH 1U8MA 3DROB 4PJ9D 4X5XA 3BW9A 1R24B 3HE7A 4HEME 1G0DA 1PKQE 2YUWA 1KIRA 2A2QT 3FMGH 2H9GA 4GBXA 2DAVA 3CDGA 3L95A 2E7LE 1LVEA 1D6VH 1GH7A 3UTTD 3PUCA 3TEUA 4KAQL 4HUUA 3WV0A 3GMRB 4L4TD 1FLRL 2ZUXA 5IEKA 1TMCB 3TJHD 2YD4A 3UAJC 2HJFA 4JQVC 4Y1AD 1R5WA 4L29A 4DZ8B 5ESAB 4U6HA 1JNLH 2JIXD 3OKEA 3V6FA 1NSNH 2E7CA 3KPMB 5C6WH 1A9BA 4UAOC 4HIIB 3Q48A 5B21A 4MQ7B 1BVZA 5FAAA 3WD5H 5K59F 2EDQA 4RA3A 5T1MB 5EU7E 4RCAA 5E94A 5MEQB 2J1KA 3TGXA 5C0GA 2UVFA 4U3XA 1BF8A 1S78C 2YD8A 3RZCC 5I71B 1C7TA 2OMBA 5AAWA 4DVRL 1SMAA 4OD1H 2CJUL 1CGSL 4E5XB 4PRAA 4R8WL 1OSZA 4R97C 1HEZB 1CXIA 4OB5L 4IRJA 1YNKL 5DHYA 1IKNA 4XP9H 2PNDA 3AVEA 3FFCA 3QEGL 5T5FL 2IH3B 2KQMA 1F4WL 3U4AA 1HK6A 1JPFB 3KPQA 3L7FB 4JFZH 2W65B 1OWRM 5EB9A 4OCYL 4HH9B 4NM4H 3AU1A 2E9IA 4BFBD 2HTKD 1ZWIA 1BF2A 4GKSB 1FZJA 1Q0XH 5MEPB 5C0RL 3QDJD 1AKJD 2WBKA 1ZK9A 3F7VB 1IL1A 2CDEA 3MR9B 1JTOA 1TJHH 4KVNL 4P23B 4YDIH 2C4XA 2FCBA 1RHHB 4FFYH 3V6OA 3PWVA 2CLZB 2YPLB 1PKOA 1NCCH 1XR9B 1WWAX 4GAGL 1EBPA 5BMFH 1DUZA 4LPYA 4Z76B 3TFKD 4P5MA 5DD1L 1A02N 4KJQC 2OXGA 4EVNA 2XXMB 3OR7A 2F54D 1JI1A 1WGOA 4QYOB 35C8H 3WUWB 1E4KC 4MA7H 3PQYE 3IDYB 1E28B 3U46A 5I1EL 5HY9A 2EYRB 4KZEL 3GJEA 4I3SH 1EERB 3RUGB 4ELME 4TSBH 1DBML 2ITCB 1F6AB 2PTTA 5TFSH 4DGIL 2VXQL 5CP7A 1LK2A 3JBG7 2VKWA 1KPVA 1UB5B 3V6ZA 4JVPA 4P2QB 3D3VB 4U7KA 3L3HA 5FK9A 3PNWB 2ITDB 4YX2L 5ITFA 2AERT 5T3XH 3P4OA 4JFYA 4X9GA 5F96L 5DTFB 1Q8MA 2F8XC 5GS0D 4ZS7L 4IOIB 4R90H 5JIHA 2KL6A 5I18L 4G6JH 3BJ91 4HV8A 4LSTH 3V7AG 3UJTH 4XMPL 1NQBA 4F7PB 3HC3H 4I0PC 1DL7H 1VFBB 1FH5H 1SVZA 4UDUB 5DC4B 1FYTE 3D69A 1JFQH 5EORH 5L2KB 4OZIF 3GNML 1OW0C 2IANE 4JO3H 5D1ZD 4LQ1A 3SDXB 2VZVA 4OI7A 3FAWA 4NT6A 2DDQL 4NWUH 3BQUC 1CGTA 3ZDXE 2F19H 4PBXA 4DQOL 8FABB 3ULUC 3BGMA 3EZ8A 5EC1A 3VFUB 1QNZH 5E56A 1HQRB 1I8KA 1MY5A 4WHCA 3RDTB 5ID0B 3QZWB 1FIGL 3CC5A 5HI5C 2GSGB 1T89C 4O2FA 1NFDB 3MMEA 5GIRA 1TFHA 2FR4A 5F3HA 3B43A 4LHUB 2PW1A 1WF5A 2UZXB 5DJXB 2Y36H 3NFNA 5DD6A 4ZUSA 1Q9LA 3O2VH 1D6VL 1SEBA 3CZFB 3MUGB 2A83B 1LE9B 4Y1AE 3DROA 3HUJF 5JORA 4X6DF 3CFKB 2O5YH 2DLIA 1JGVL 3K46A 2VLJB 4RISL 3BP4B 1ZE3C 4S1QH 2DM2A 3U2SA 4K8RL 5HHVH 3HG1D 4U1IA 1Z0MA 4OFDA 4ZDHA 2C4FU 4POZC 4W4OA 1MJ7H 5GGRB 5TF0A 5D7KD 4K94H 3GMRA 4PJGA 1IAIL 1TMCA 1UKQA 4RMTA 43CAB 3H9SD 4PB0L 1O7VA 1KLUB 4BQCA 5IBUB 4DZ8A 1KG0B 1U8NB 4OD1L 3T2QA 2OI9C 1F5WA 4NQCD 3KPMA 2MQ0A 3SDAC 4LEXL 4MQ7A 3D39B 2P8MB 5T1MA 5I15H 3VG9B 1YYLH 5E0QA 2PTUA 3QQ9C 3PE9A 1VACB 4NZUH 3BZFB 2IPTH 3OPZL 3TN0D 4JFZL 1K3IA 5JLZB 3JTCA 2X4SB 2ZUSA 4E5XA 4OKDA 4IDJL 4HWEL 2YPKB 4KK5D 4PJEF 2AV7B 3EOAB 1HEZA 1N64L 5FHBL 4PRBB 4QGTA 1MCFA 15C8L 4M7LH 1QPPA 1PSKL 3WDIA 3ZE1E 1CU4L 2P5WD 3C5JB 4NUGH 2IH3A 3TNNB 2EH8H 3FQXA 4G6FB 2W65A 4HH9A 1MFBH 4WGWB 2F54E 3IFNH 5DUMH 1INQB 1NL0H 3S3PA 5I75C 4RBPK 4GKSA 4HWUA 3INUL 3LOWA 3L6FB 4FOMA 5I1CL 4N5EA 5GGSB 4GAJH 1GC1H 3SQBA 1U8PB 1UH4A 3F7VA 3RNQB 3MR9A 1TITA 3W9DB 2YEZB 4A6YH 5JR1H 3RTQD 3T65B 3KPPB 3WJLA 4D0DB 5F70A 3VXQB 4YHML 2CLZA 2M8XA 2YPLA 3O2DH 4I3SL 4X6CF 1Y0LA 4Z76A 2F58H 4HIEA 3MCKB 1F6FB 3C60B 4AEIH 2OR7A 1WVZA 2NY1B 4RGMC 2IPUG 4QYOA 4J4PD 3VGDA 3WUWA 4LAJH 3G9AB 2NZ9C 3QUZB 4YGVB 3VXRD 4UT6H 3O6KH 4FA8A 2EYRA 3FRPA 3MLZH 4NZRH 5T3XL 3QI9D 3EYUH 3QIUB 2K7QA 1F6AA 4XB7A 1T7WA 2Q20A 4R90L 3RNKA 1MCLA 1Y6NR 2NXZB 5JIIA 3QT2A 3SGJC 1QRNA 1KIUA 1J1XH 1SBSH 1OT2A 3OB0K 4DGYH 1Z5LB 3GSQB 4P2QA 3D3VA 1YPZB 4N0YH 5E8PA 1FFQA 3PNWA 2ITDA 4X6BA 2XKUA 3KAAA 5EORL 1AP2A 1R3IH 3FQTB 1QPXA 4N8PA 2JB6B 4KDWA 1VKXB 4I13B 4IOIA 1AY1H 4HHAB 4QHNB 2CRMA 2IQ9L 4XPBH 1CICB 1DQML 3T0WA 1QNZL 3MLXH 3ARYA 4F7PA 1VFAB 5AUMA 4UIKL 3QUXD 4RA0C 4UDUA 1S9YB 5L2KA 1EO7A 4G43B 3MJ8A 5KVEH 4O58H 2IPUK 5J11B 1VDGA 4M8QA 1KXVC 2YZ8A 1IQDA 4J1UB 1NEZG 4NQXB 4WJ5B 8FABA 3MACH 3VFUA 1WBZA 2DQFB 1EHAA 1HQRA 1RZFL 2NY3B 4OIIH 3RDTA 5ID0A 5DQJB 4TULH 2XTLA 3QZWA 4M48L 2O5YL 1BFVL 2GSGA 4OFYD 1MY7A 1NFDA 5CEZD 1LP9E 3OG4B 4O00A 4ZUVB 4ODUA 4XCCL 5CGYC 4LHUA 1VHPA 4HG4K 1R6VA 4N5UA 3QEQD 3VXTB 3CCHA 3P11H 3BFOA 3CZFA 4LF3A 1MJ7L 3MUGA 4DUWA 3H9SE 2A83A 1LE9A 4K94L 1JHLH 5EZJB 5IBLD 5B8CA 3C8DA 1I7TB 5EU6D 3R0MA 3OGCB 3CFKA 5HTSA 4KJWD 5IVOA 2VLJA 4ONFH 2GY5A 4AIZB 3RWDB 4CMMA 4QKXB 4CBPA 1ACZA 1MNUH 2CLRB 3MBEB 1TETH 4RGOL 4YBLC 5FYKU 2DYPD 5F21B 3G6JB 1H0DB 3EYQD 4BZ1H 3VWJA 2AEWA 3S3SA 4QRSB 3MUJA 43CAA 3QIBD 1RV6X 4Y4HD 1KLUA 3RL2B 4NJ9H 2W9LA 3LH2H 1PW3A 5I8CB 1U8NA 3HE7C 4EXKA 4UV4L 4F3FA 3BPOB 1OLZA 4P5KA 1UFUA 5JOEA 4AH2B 4GBXC 3D39A 2P8MA 2JJTA 2VYRE 1W0YT 2D0HA 2P5WE 1G7MB 1J11A 1MIMH 4WU7B 3L9RA 1VACA 1G1YA 1NFIA 2IEPA 3CX5J 3OAZH 1HHHB 2G9HB 4TTGA 3X11B 2HT4C 1KJ2B 5F1NA 5JLZA 1MFBL 3OAYH 3C9NA 4PGEB 4NC2B 1G6RL 4X4ME 4RGND 2VDMH 2AV7A 2CUHA 5EZOH 4MJID 3K8KA 4N1EA 4PRBA 1GC1L 5IHBA 3RGVD 5DLMH 1J0IA 4A6YL 3TBSB 2R56L 3NCFB 5JR1L 2IAMB 3C5JA 3FJTA 3TNNA 3TA3C 2ZSWB 5ADOH 2L7JA 4AJ0A 3NIGF 3O2DL 1PKQB 1AXTL 5IM7B 5E8OB 3T0XA 4ETQB 1ZLUK 1G9NH 5DC9B 4AQOA 5ACZB 4Z7VA 1J8HD 3VXRE 2BCKB 3NIDE 2CO7B 1JMZA 2BMKB 2W0PA 1U8PA 3GK8H 5BV7L 3RNQA 4NC1C 3ARED 3W9DA 2YEZA 4UT6L 3T65A 1IGYB 3KPPA 1MFEH 3F7YB 4D0DA 3VXQA 1NLDL 1X9QA 3MGAA 3C6SB 3DSFH 1IKNC 5D7LE 3HE6B 3VFVA 3WS6C 1V3MA 2JTDA 1ZHNB 3JXAA 2E27H 1NCDL 1XIWB 4DFIA 1J1XL 3GI9L 2VZ3A 3QUZA 4YGVA 1X5YA 3DXAB 2MCG1 4YH6A 1ITCA 1CL7I 2DM7A 3S36X 4D94A 4MB3A 4M1GL 1R3IL 2N1KA 3U30C 2BSSB 4R2GC 3VD4A 5CINH 1ZTXH 2X89A 5D1QB 3IETB 3ZL4L 2NQCA 3SCMB 1ZOXA 4XXCA 4RQQA 4HS3B 3L3GB 1CDBA 4V2CB 1SY6H 5E8EA 4OIBA 1UQSB 1YPZA 2VMFA 1D9KD 1C1EH 1NGXB 5CJOH 4HULB 3Q5OA 4Z9KB 3S98A 3OGOE 3QWRD 2NY2B 3FQTA 1SJXA 1YDPB 5KVEL 2JB6A 1VKXA 1N8ZB 4KK6D 3AMLA 1KXTB 4HS8H 3R06B 1A6VL 1KN2L 4Y4FB 3I6KB 2CK0H 4QHNA 2VC2H 3KG5A 4JZJB 1CICA 1WTLA 3LVEA 2BFVH 3I2CH 1Q9KB 3EHBD 3M8OH 4OIIL 1FFNB 4TULL 3JWDH 5H2BA 3RAJL 2WK2A 3QEQE 1JF6A 1I9EA 4K23H 5FF6B 5ERWA 1BWWA 4LSVH 5SX4I 5DGQA 5CILL 3IDUA 2MMXA 4J1UA 2DKMA 3L5XH 5EU6E 3WJJA 4WJ5A 4BKLB 2HVJA 1QEWB 4F2MB 3FB7B 3H9ZA 4MD0B 1OAZH 5DQJA 2NY0D 2QADD 3QH3B 4NDMB 2XZZA 4PD4J 2DI9A 1N5AB 5B39B 5MEND 3OKDB 4ONFL 1S7QA 3DMMB 3KJ6H 3M1BA 3VXTA 3H9HA 4ELMB 3V0VB 3VFNA 1DR9A 1K5NB 4MVBC 1EHLH 3BIAX 5HYSG 5L7XL 1I7TA 3OGCA 4P5TA 3MGTA 4G42B 4U2YA 4AIZA 3RWDA 4GKNB 3QQ4B 4RX4D 2YD9A 1P4LB 2CLRA 2AK4D 3MBEA 4OZGE 3BP6B 1X5AA 5T5NF 5KOVC 4DWHA 4D0CA 1H0DA 1ZA3B 4WI5A 2XG5A 1MIML 4DW2L 1KIQB 4QRSA 5M95B 1KB5A 1JI2A 5IBTH 2EDOA 4PJ8B 2W0LA 1FYTB 3BI9X 4RGNE 4J3TA 4J3VA 4E9LA 2QSTA 1D7FA 2IANB 2HP4A 4MJIE 2XZAH 4PJXE 4Y5VB 1OPGH 2LVCA 4OKVB 2AAVA 2R9HD 4LGPB 1FZOB 4MQXD 4PJ9B 4N0UE 4N8CH 1G7MA 2AJ3B 5DLML 4FZEL 1NBZB 1A6WH 4W4OC 4WU7A 3G6DL 5J13B 4JJ5B 1XH3B 1HHHA 1MIEH 2G9HA 4KQ3L 3X11A 3LS5H 1KJ2A 4M02A 4UV7H 4PGEA 4YE4H 2AKRB 2RJMA 1G9NL 1G1CA 2XZCL 4Z7QF 4JRYE 2O61B 3VMNA 2GAZB 3GK8L 2Y9RT 3J8F7 1JCKA 4Y1AB 2B2XH 3TBSA 1AR1C 1Z2KA 1J5OH 1CFBA 3EJYC 2JIXB 2ZSWA 1U41A 1PKQA 1JNHB 3DURB 4JE4B 4U6TA 3THMH 5I71C 3ZYZA 2MCPH 1RURH 5SV4A 3A6OA 3NA9H 3GBNH 4QXGH 4HW6A 4ETQA 5BZWA 1SYSA 2BCKA 2BVQA 2BMKA 3FQRB 2E7LA 2EDNA 3GBMH 1JWUB 2DLGA 3HNSL 1CLYL 2F15A 1IGYA 4YNYA 2UZIL 3P4LA 1VFUA 3IU4H 1UM5L 4XPFH 3RWGB 3FT3A 3BYTA 2UWEE 3C6SA 5E2UL 1A1MA 1OCWL 1WWBX 2Z93A 4PG9B 3OX8B 2H2SD 1ZLVH 3HE6A 5CINL 1ZTXL 3B5GA 3P30L 3QDGD 1ZHNA 4LVNC 1UKSA 3V4PH 3V5DB 3ARDD 4MLSA 4Q7DA 2XWJA 1DBBH 1XIWA 5HHPB 3RVUD 5AAMA 2SEBB 3NCMA 1XGUB 3VFTA 4MX7B 4CADB 4HQQH 3R1GH 5T1LB 1C1EL 5ENWA 4N5EC 3TNMB 1Q1JH 3CVIL 2EE3A 3IAQA 3ARBD 4P23C 2BSSA 3WJLC 4HS8L 1EPFA 3TO4D 5D1QA 3IETA 1VPOH 3HPJB 3SCMA 1K4CB 3DTXB 1QLFB 4HS3A 1PAMA 2VC2L 3CLEH 1GOFA 3L3GA 4PV8B 4Z8FH 1UQSA 1H8OA 1T66D 3NIFF 1R5VB 3BRGC 1P7QA 1F58H 2VDNH 4UT7L 1EIBA 1U8QB 3N0PB 5J9PB 1FORL 1MHCB 4JRXE 3PXHA 3IDYC 1YDPA 4TOYL 2HLFC 1N8ZA 1JK8B 4LSVL 3R06A 2F54B 1YQVL 2XXCB 3I6KA 4HUXB 4PLOB 5BZDB 1DEDA 1SM3L 2YRPA 3GIZH 4UT9L 2F74B 5MENE 3OKMB 2MFNA 1CIUA 1Q9KA 1N0XH 1FFNA 1LILA 3CU7A 4OD3L 4OF7A 5DRXB 4F58H 4XP4L 4LCIH 3VW3L 2G5BB 5F9JB 2MKLC 4ZOAA 5FF6A 1JMXA 3HR5B 5IOPB 4ZUTB 3BD4A 1CFNB 5EWIH 1EGJA 1EHLL 1M71B 1QEWA 3I3BA 5F7MC 4MD0A 5GRVL 4L5FL 3QH3A 4NDMA 3PQYA 1FFPA 5F7WC 4AYFA 2QR0B 5B39A 5C6PB 3OKDA 2AK4E 4OGAD 5GISL 5AEAA 2F5AL 4WW2A 4YDVB 5CCKH 1WSST 3QAZB 2X5PA 1NAMB 2EZ0D 4F7EA 4YHOH 4ELMA 5D2LE 3DARA 4BSWB 1K5NA 3FB6B 1I1AD 1J86A 3ESUF 4PJBE 2VDOL 1NANI 3SGKA 3MODL 4MD4B 1JUFA 1UZ8B 4KC3B 3QUML 5IB2B 1CDUA 1CF8L 5E7FA 3GZKA 2EDXA 4GKNA 3RDTC 1GGYA 1P4LA 4U7SA 5GRUH 2LAAA 3OKKB 4QCIB 4H8WL 4NN5B 1YNTA 4CVUA 1DBJL 2OK0H 1RD6A 4N8CL 1ZHBB 1KIQA 3WNPA 1A6WL 3TYGL 2AI0H 4NO2B 4MS8A 5AG9A 4XBPB 1DE4B 4I9WD 3LS5L 1F90L 1V3JA 1FYTA 4MHHG 2IANA 3P73B 2GCYB 4YE4L 3WIHA 2A1WL 3PL6D 4OKVA 4ODTL 3WFBH 2CIIB 4ODSL 1FZOA 4PJ9A 1EHNA 2AJ3A 4YHPB 1V7NH 4DTGL 4XAWH 1NBZA 5KVMC 4JJ5A 3SE8H 1XH3A 2E8YA 1BJ8A 3FO0H 1XGPB 3QCUL 1ADQL 1DEEB 1A7NL 1N2RB 3FRUB 3KXFD 1LP9B 4JFDE 2MCPL 1RURL 1C08B 4XCEA 3NA9L 2VXSH 3GBNL 2AKRA 3OJMB 3UTTA 1U93B 4L4TA 1PQZB 4U3HA 3JUYA 2O61A 3DOSA 3LN4B 4HFUH 4KHXH 4CRPA 2HH0H 3TJHA 3Q5TA 3H9SB 5D96B 1I3UA 2GJJA 4Y1AA 2ZUVA 4ZAKD 3VG9C 2DMCA 4I18B 5IW1B 2JIXA 5FYKD 5ICZB 5E1HB 1JNHA 3ALXA 1TCRA 3ULVD 2AP2A 3BZEB 4M43L 1YMHB 4JQXA 2R0ZH 3FQRA 1I9JH 3I9GH 1OM3H 2X2YA 4LRNH 1JWUA 1RJCA 4XRCA 1M7IB 2NW2B 3TN0B 3X14A 4HUVB 3RWGA 4ETYA 3IRZA 1CGVA 4J23A 2UYLB 3MRGB 2IH1B 1AGEA 1EH9A 3OX8A 1VPOL 3CAFA 3S34H 1MWAH 2B4CH 3F62A 4KHTL 3V5DA 2N4IA 1MCEA 3MX0A 4PJFF 1XGUA 2ADGB 1MFDH 5FDWB 4CADA 3D6GA 2P5WB 3QEUB 5T1LA 3ULUF 1URLA 3GSUB 4FFWC 1F58L 2WNGA 3VXUD 3MA9L 2B39A 2Y5TB 3MFFA 3WIIH 4JM4H 2DS4A 1BGXH 3HPJA 3VXOB 1CDIA 3DTXA 1QLFA 1AKJA 4K7PL 4TRPL 3BAEH 2NY6D 4OUOA 3C60C 3QB7C 1WWCA 2APBA 2NY1C 1EUTA 1T2QH 1OGAE 5T33H 4FABH 1MHCA 5FYJH 3QUZC 3TFKA 5F7DA 1JK8A 1MPAH 2F54A 5B38G 2PXYB 5E6YA 4FQQB 3NTCL 3QIUC 3S5LB 3ZDZF 3AMKA 1JZ4A 2F74A 4OCRH 1DCLA 1YEJH 3OKMA 2NXZC 3BVNA 3CXDH 1HINH 4ZYKA 2LAGB 4RDQG 4PV9B 1SHMA 1N59B 2VLRB 2PKDA 4CDGC 3X3GH 2G5BA 5F9JA 1YYMH 1XGRB 3I50L 5CCKL 3ESVF 4JO4L 3HR5A 1T2XA 5DJ2B 2BSTB 4ZUTA 4TNVF 2X4PB 1QFWM 5D7LB 1QBLH 1A6UL 1CFNA 5E8DL 1BFOA 4FMKA 4WO4D 1W8NA 3PHSA 1CLZL 4U4BA 5GS3A 1CICC 2QR0A 4M3JA 2VH5H 3EW3B 3UZEA 1IMHC 4PJ7E 1PY4A 4CU6A 5B4MD 2DF3A 1NAMA 5FKAB 1S7SB 2CDGB 3BGAA 4HK3N 4BSWA 3EYSH 3FB6A 4TVPE 1T6WA 5J11C 3KPRD 3KLHD 3VH8B 4R7NB 3H2WA 3P40A 1FZKB 4U0RB 1UZ8A 3MBXH 4IDLA 5IB2A 4MJ5B 5GRVK 3V79C 1ORQA 5D1ZA 2NY3C 3BMVA 5C9JB 1JNJA 1IGML 4EBQL 4U6YB 4H0IA 1Z9LA 4U1HB 5KSUA 1JHKH 3OKKA 4QCIA 3QEHA 5GGVH 4EDXA 2AW2A 1QA9A 1DLHB 2R4SH 1EEQA 5DK0A 4M6AA 1ZHBA 5J56B 2E8ZA 3KXFE 4NO2A 2FYYB 3PWUB 4XBPA 2FEDC 3FO0L 2Q7NA 2WWMD 5IHUL 3QFDB 3QEQB 1H3PL 1ZHKB 2GCYA 3WFEH 3LKSB 5GJTH 3DUHA 3GJFA 2DQIL 1F4YH 2CIIA 4HFUL 4KHXL 3MBEC 1UWEH 5IJKA 4EUPG 5FYKE 2OSLB 2FX8H 4UOJA 4W70A 3H6JA 5H37H 4G59A 3ULVE 2DD8L 2HAZA 1VA9A 1N2RA 5EA0L 1FCGA 5LWYH 1UEYA 3L3KA 2DYPB 4XP5L 1U93A 1I3RB 3WXWL 2V7HB 3CDYA 5C0NC 3BT2H 1PQZA 2W9DL 3HFMH 5IEHA 4NM8H 4OLZH 1F2XK 3BPOC 2P46B 3I9GL 2AJVL 3H9SA 3QIBB 1TNNA 3KPLB 5IW1A 4OCXH 5ICZA 4NQCA 2ESVD 4XAKD 4YHYB 3BZEA 1MWAL 4OZGB 3RL1A 3X17A 2BDNH 4GRMB 2WLYA 5F1OB 3G9VA 4JN2B 5D6DC 2N7AA 1M7IA 4GMTH 2NW2A 5GJSH 3TN0A 1MQ8A 1IM3A 1DTUA 3FO1B 4ONGH 1R3LA 5CFHA 1A7PH 3BP5A 3PG2A 3MRGA 2IAMC 4ZFOB 2FX7L 2NY7L 1Y6KR 4JM4L 4N90D 4RGNB 4KWUA 4GOSA 2H32H 1BGXL 4MJIB 5D5MF 3CVHB 4XH2A 3JWOC 4PJXB 3Q5YA 3RGVB 5CHNA 3D18B 2I26N 2P24A 4NIKB 2ADGA 5FDWA 4I4WB 1HSAB 4HZLB 2P5WA 4N0UB 3QEUA 1NCWH 2E7LC 3DSNA 1T2QL 1JZ3A 2ARWA 4G8EB 1RZGB 1P7KA 2BSRB 3MTRA 2YD1A 3VXOA 2EXWC 1KYOK 4OUUB 1CR9L 3O11B 4X4MA 4NP4L 2B1AH 3HE6C 3AREB 4JRYB 1EJOH 4R7DB 2Z9TA 5DI8A 1FE8H 4PGCA 2GQHA 2D0GA 1ZEAH 1FGNH 2YOCA 4TNWF 1TVBB 3UDWC 1KELL 1DQDL 3G6AB 2A6DB 2APTA 4LK4A 4J4PA 4FQQA 4P2OD 5GRWA 4HMEA 1T3FB 1RZ7H 3U9UB 1RJLB 3ILQD 2CMRL 3VXRA 5D1QC 1JN6A 4I0CC 4QRUB 3SCMC 4JPWH 1QSVA 1AFVH 1ZMYA 2ZNXA 3QI9A 4PV9A 1N59A 1XGRA 5D70L 5DJ2A 5HSFA 2BSTA 2NY2C 2X4PA 4WY7L 4TN9A 1TDQA 1OQXA 1WBXB 3H3BC 4LPCA 5DHXB 2EEAA 4WWKB 4Y4FC 1D9KB 1O5DT 4G6ML 3GRWA 1I7UB 3EBAA 3LRSB 2UV3A 2PYEE 4X4YB 4JZJC 2OL3L 5E95B 1OP3K 1QLRB 5JPMB 4XHJC 4XWOC 1A7RL 5FKAA 5IVNA 4Q6IB 2CDGA 3H3PH 3O8XB 3UJJH 2FGWH 3UO1H 1NMAH 4MSWA 1GGTA 3VH8A 4R7NA 1WC7B 4GFTB 2EDWA 3TJEL 3ZKXB 5CD3B 3QJHA 4KQ4L 3BUYB 3L5IA 4MJ5A 4OTXL 4QNPE 4WUKH 1XGYH 3ULUH 4JRXB 1Q9OA 1LEKB 3DPBA 2G75B 4U6YA 2NY4D 4U1HA 3WFEL 3BPCB 5GJTL 4HCRL 3DMMC 3GEWB 5BRZD 3MRRB 3JSSA 1R5IB 2C9AA 2HWZL 1DLHA 1OD7A 2Z35B 2NY0B 2QADB 4UB0H 4NKMA 1W72B 3ROOA 1UM4L 4KPHH 3QRGH 4OFYA 4YHKL 4AENB 5MENB 1E4XL 4QWWD 3SGKC 2FYYA 4PJDE 3BO8B 3QEQA 1ZGLM 2I60L 1ZHKA 4P4RB 5E70A 2WWKO 2DQDL 3S35H 3M17B 4F7TB 2HT3D 2GJ6D 2Y72A 3LKSA 4Y4KB 4WEUD 1G7JB 1LO2L 3V7AE 5B3NA 5C0BD 3HFML 2D03H 4EIZC 4Z6AT 5EU6A 4Z7WE 3I02B 2OSLA 1YZZA 2WBJB 3BDBA 2ESVE 4XNMB 4X8JB 5DJZB 3FO2B 2PO6B 2XPGB 1KPUB 1OAUH 5IB3B 2AQ2A 2J12B 2AS5M 4JFFD 2AK4B 1FPTH 5T5NG 2OJEB 3UYRH 1FGVH 2DYPA 4PJ8C 1I3RA 1PX4A 2V7HA 4KKLD 2EXYD 4IM8A 4IRSD 4XB8A 1IM9D 5D2LB 2YWYA 5I1LB 4Y5VC 4PJBB 2XIDA 4J3XA 4MQSB 3O9WB 3QIBA 3KPLA 4YK4B 3WHXB 4PJ9C 2CKNA 4N90E 2DBLH 1JPST 3OWEA 2AABH 5J13C 1F45A 4JPVH 1OY3B 1QBMH 1TJGH 4OZGA 3TV3H 4MXWL 4LNRB 4GRMA 1EAPA 4MWFA 4NRYB 5IMKA 2BNUB 2DB8A 3RVWC 3LQAC 4PJAE 1MJJB 5FO9B 3BE1H 4JN2A 2RQ8A 3IDXH 3TP4A 2CKBH 2W59A 4K8RD 5C9KA 1FG9C 3FO1A 5KN5B 4KRPD 4ZFOA 4JM2D 4UZGA 4L1DA 3OKNB 4LOUC 4MJIA 1DQQB 3CVHA 4PJXA 3SDCB 4KUZH 3IYLW 4X8XA 4JFED 2B1AL 3RGVA 1TQCB 3FN9A 1I85C 4PYGA 1HSAA 4HZLA 4N0UA 3MCG1 1A6TA 1RY7B 2CUMA 5HVHB 1G7IB 3DUUB 2Z4QB 4G8EA 4K3DH 1EMTH 1FGNL 32C2B 1WIPA 2IBGA 3ARGD 2BSRA 3F7PC 1LMKA 1J8HA 4JFDB 4O02L 4OUUA 2VAAB 1XF3B 3O11A 1K85A 3NPSB 5F9AC 1BOGA 5EBGA 3KYKH 2V9TA 3AREA 4JRYA 4R7DA 4JZNB 2C3VA 1L6XA 2P42B 5DJYB 4XC3L 5JQ6L 2NY5C 1AFVL 4EDWL 4R26L 3K74B 1TJIH 4MAUH 5EBWA 1DN0B 4P2CG 3MLRH 1FO0H 1AC6A 3FZUC 5GS2H 3WFCH 4N1CA 3D85D 1TVBA 4XNUL 4ZUUA 3G6AA 1M7DB 3N50A 4Z7NF 2HTKC 5J06A 1T3FA 4R4FH 1DBKH 1E6JL 4QRUA 1B6DA 2P44B 3MUHL 3HC0B 4KXZI 4IHOB 2FWOB 2BERA 1KSRA 2P43B 2WP3T 3MFGB 1NC4B 1B6UA 4EI5B 4YWGL 1KBGL 3BWUC 2UWEA 2ZG3A 4M5YL 1JGLH 3H3PL 4QEGA 3UJJL 1S7RA 1WBXA 4UOW1 4V3DB 3L5WB 3UO1L 1VEMA 2IC2A 3SDDB 5ADPL 5GGVY 1D9KA 4YXLH 4YEEA 2J5LB 1FDLL 1I7UA 2VWEE 3LRSA 3QWRA 2V17H 3D2UB 2KKQA 3E0GA 5EU5B 2RBLA 1ORSB 2J3SA 2FX9H 3ULUL 1QLRA 3X3FH 2D9QB 5ESQB 3U0PB 3AM8A 3CPLB 2Z91B 3OKYA 4WENB 5F1KC 2IADA 5H37G 4U6XB 4HUMB 2FBJL 2DQCH 3PHOB 5D7JD 4UB0L 5T3XD 4KPHL 3QRGL 3BUYA 4N0CD 3JUZA 1SJHB 1OGAB 2GJ6E 2YD6A 3B3IB 1EGJL 3MXVL 4JHBA 4JY4B 4KKNA 2G75A 5F9WB 3S35L 3TBYA 3BPCA 5GS0C 5KVGL 3MRRA 4DVBB 1R5IA 1C16A 3QAZC 3QG7H 5CSBA 3T2NH 2D03L 1CXLA 1JGDB 1NKRA 4GQ9H 2Z35A 1W72A 2X44D 2WUBH 5MENA 4JFFE 3MRLB 2A77H 4IRZH 1WQVT 3QO1A 3UTZB 3EJZD 2F5BH 1MAMH 3BO8A 4GRLD 4P4RA 5FYLH 3B9VA 2V2XA 4F7TA 1QYGH 4Y4KA 4M5ZH 1FC1A 1G7JA 3ZYIA 3PP3H 5JW5B 4UNUA 1UADC 4H1LH 1K9TA 5CGTA 5D7SL 4XPAL 3I02A 2EC9U 4NN5C 3HPLA 4X8JA 5DJZA 1KJ3L 3FO2A 3LSOB 4HKBB 1ZLSL 2PR4L 2XPGA 1KPUA 5IB3A 4RX4A 5D2NA 1KT2B 2DBLL 4NQVB 2AK4A 2AABL 3SJVE 2OJEA 4PJ7B 2Z8SA 4JPVL 2GJZB 4PRNA 4WI2A 4LLMA 4U1MA 1QBML 1TJGL 5D2LA 5DR5L 1CLOL 4JDZA 4PJBA 1I9RL 1A7QH 2XN9D 3WHXA 1CGXA 2VQ1B 1ONQA 5GGQL 1IILE 5IJKC 1CD9B 2I24N 1FSKB 3RWFB 3KS0H 4NOBA 3PL6B 1OP5H 2OP4L 4AEEA 4AG4H 3TZVB 2OLDA 3BKJH 4JHAL 2BNUA 2APWA 4NRYA 4YHIB 3RUGF 3BWAB 1MJJA 4O2CB 1M4KA 4QRTB 5DFVD 2DI7A 3O3BB 4UU9B 1E27B 3QCVH 4I0KA 1Z6JT 3KXFB 2OX5A 4OZFA 5D96C 1T22A 1QFPA 4K3DL 3RX5A 3S4SB 4I18C 3OKNA 1DQQA 1U91B 1CBVH 4JAMA 3DX7B 1HILA 2H45A 5CMAB 5D7IE 3VDCA 2WV3A 3T0ED 4ZAKB 2P48B 4ODWA 3RJDA 2YZ1A 4LQFH 3ZKQD 1V7ML 1A4JB 1TJIL 4HK0B 4MAUL 3UBXG 1G7IA 1FO0L 4BH8A 2Z4QA 32C2A 3NAAL 5KSVA 4YUEH 2VLMD 3TN0C 5CLWA 4JFDA 2JB5H 4PLNC 5HHOE 5FOBB 1CE1L 2VAAA 4Z7OF 4EN3D 5JXAL 2WQ8A 4R4FL 5TQ0L 5JZ7D 1RZKC 3S37H 2NNAA 3MLUH 1FAIH 5KANI 1AIFB 4JZNA 5DJYA 3SDXF 2WIMA 2VXUH 1W0WB 3GMQB 1F11B 1J0KA 2ZCLH 2D7NA 3WLWD 1N7MH 3QDGA 3EFFB 5JOFB 3ARDA 1M7DA 3TH3T 4NRZB 4IIQA 4GKZA 4KY1H 3OZ9L 4XXDA 5KW9L 1JRHI 4YXLL 1TNMA 3MRIA 2FWOA 2MQ3A 2FSEA 3MJ7A 4WU5B 1DFBL 4OM1H 3TO4A 3ES6B 5SX5K 4FP8L 3DRTA 1H3XA 4BZYA 1Q38A 5T3XE 2NY6B 4YDKH 3SDDA 2PXYC 1MJ8H 4YHZL 3M07A 4QOKD 5DJDB 4O5LL 5M7QA 1FV1A 3D2UA 4XPTH 1KLGB 4GRWE 4FZ8L 5EU5A 5A16B 1LO4L 5C0JB 2QJDA 3CPLA 4PRPD 4KZDL 2GEEA 4AL8H 4GH7B 4S1SH 2ICCA 1YNLH 1A6PA 3VI3E 4D9QD 1YA5A 3QG7L 3T2NL 1X5XA 5IVXF 3L1OH 4Y5XB 1WCBA 3V95A 1KTRL 2UVEA 4K3EL 2AEPH 3EOTH 4HXBH 4IRZL 4K3HA 3SDYH 4M93B 2ZCKL 2CRYA 3B3IA 1U0QA 3PABB 4JY4A 3PHQB 5FYLL 4O51B 3HNVL 3VCLA 2QSQA 1QYGL 4QRRD 1QFWI 4M5ZL 4DVBA 3QXDB 3V4VH 5A2FA 1HHIB 3RQ3A 2HJLA 2BVUA 2RGSA 3MRLA 2HFGH 3HZVB 4NO5A 3NZ8B 5J0BA 3UTZA 2CRIA 4UMGA 4U0RC 3PWNB 4HG4J 4H25B 2G60L 5C2BH 2GK0A 1MVFA 1I9IH 4M7KL 2XFXA 1J0ZA 3QHZL 2EECA 1I1AA 5HDQL 3MC0A 4LLUA 5JW5A 4XWGL 2XN9E 1NEUA 3WKNA 2D9CA 2R2CA 4M3KB 4ENED 1A7QL 2Q7YB 4HKBA 3LSOA 4Q9QH 3UYPA 2PYEB 5EUOE 1A0QL 3GHBH 4NHUE 4NQVA 3AS3A 3AY4C 3TVMB 3ZTNH 2J4WH 3N85L 4PJ7A 3DWTA 3O0RH 5CZKA 5KJRL 4Z78B 3SKOA 4AG4L 4ZXBB 3U9PL 1LEGB 1HH9B 4TNVK 2DQGH 5GHWH 2MPAL 2VQ1A 5K33A 5CIPB 1KN4H 1M6OA 2FJHB 1KEGH 3PL6A 3K4DA 5CJQH 3RKPA 4CN6A 2LV4A 5ANME 2PCPB 4UI2A 3OR6B 4PR5B 4JG0H 3W11C 5F6HI 4YHIA 3BWAA 4QRTA 3O3BA 1OWWA 1OAKL 1E27A 3EO0B 3WMSA 2AJSL 4LQFL 2EKJA 4JPIB 4AM0B 2J2ZA 3KXFA 3QIBC 5GPRA 4YUEL 2QSCL 4OF0A 1E4JA 1UB6A 1U91A 5DK2B 2DICA 4YHYC 3S37L 2WIIB 1FAIL 2DQTH 4ZAKA 3GGWA 1JWMB 2XYCA 3V2AR 4CUCA 3OJ2C 2ESVB 4Y7MA 4HK0A 1IJ9A 3GKWL 3EOYG 2NLJB 2R1YA 2AGJH 1N7ML 1S9WB 3PJSB 3LEXB 3TIDB 1WLHA 2HMIC 4OJFH 5FOBA 3UTOA 3PGDB 3HAEA 4RGNC 4OCSL 5EZLA 1P7HL 4B41A 5KVFL 3OHXB 4GW4B 2WINB 1I3VA 3IS1X 3BHBB 3RGVC 1W0WA 2YRLA 3MOBL 4IS6B 1F11A 1S5HB 4YFEA 3ET9F 3U7WL 1EHXA 1T5XB 1KPRB 5JOFA 4D2NA 4NGHL 5DRZA 4KGLA 4U1JA 5JXED 1WBYB 1BEYL 3TF7A 1FL5B 1IGJA 1CS6A 1O7SA 4PRPE 3AREC 2AEQH 2FIKA 1GGBL 5KAQF 1TVHB 3ES6A 5K59E 3CX5K 1TTUA 4MNHB 5EO0A 3NFPB 4OM0H 1EZVY 1YNLL 2CXGA 5SWSD 5H35B 1YY9D 5LGKA 2ZKHL 4PRHE 1UM6L 2NZIA 4F57H 1OB1B 3SKMB 4KMTH 5DJDA 2AJXH 1TVDA 3FFDB 1KLGA 4O9HH 3SDYL 3BH8B 1DDHB 3G6JF 4QRRE 2IFGA 5C0JA 3HZYB 2OZ4L 2VABB 2E7MA 1HCFX 1WAAA 2IG2H 4H20L 3UPRA 4LIQH 2R4RH 3GUTB 4L1HA 5DS8A 3AC0A 1YC8A 3FB8B 4S0SD 4Y5XA 3OV6A 4YJZL 1F3DH 3VFMB 4KJYB 2RAMA 3ZKMD 4WWKC 5DRWB 2HFGL 1D9KC 1FG2B 4UTBL 4DAGL 3RHWF 2B0SH 2R39A 3PABA 3PHQA 2Y7QB 4EZMA 2A74A 3GBLA 1KENL 3AM8C 3H7BB 1EZVX 4ERSL 1IC4L 2YHGA 3OXRA 3QXDA 5DD5L 3L3OB 4IOFD 4ZFFB 4Q6IC 3O8XC 12E8L 2VISB 2EDTA 2X42A 5HJ3B 1HHIA 2Y25A 2ADFH 4H0HB 4OQTH 1S7VA 3HZVA 3NZ8A 1NGPH 1Q72H 5EBMB 3ZKXC 4BA8A 3VI4F 3PWNA 2FHBA 4L8BB 2FECI 2J4WL 2B7DT 4P9HL 4HKJB 3O0RL 1YEKH 2DLTA 5F44A 3DVNA 2AJYL 1CK0H 3A67L 5GRYA 5F3BA 5HD8D 5IHZB 3PP3K 3FT2B 3O6LL 5L8LB 2Q7YA 5DD0H 5GHWL 3SGDH 3ARFD 3WFDL 4WFHD 4L9DA 1WZMA 2NY0C 1N3NB 2PYEA 4P3DB 5E8NB 3TC9A 3HZKB 1QZ1A 1VADA 3TVMA 4U33A 2BRRH 2WAHA 1AHWB 2XG4A 1QKZH 4Z78A 3CFBB 1XFPA 1N6QL 3RPKA 3N1QC 1ZGLA 2X70A 2BVEA 3NABH 3U83A 1LEGA 2D4DA 1RZJC 4Y4KC 1HH9A 2YUVA 4U49A 4XZUB 4JN1L 4X80H 1EO8L 3MZGB 4YR6B 3PV7A 5BS0E 2G5RA 2WBJC 4H26B 5CIPA 2HFEB 5J6HA 2NX5D 1UCTA 2PO6C 2FJHA 1ZVSB 4R4BB 5IR1B 2PCPA 4JDVA 3OR6A 4PR5A 4RMQA 1S7WB 3L3IB 4LSRL 4OZIE 5LKNA 3ROLB 4P0DA 3EO0A 4ZQKB 1U95B 5IFJB 4GS7B 4JFFB 4JPIA 4AM0A 1MCWM 4HDIB 4LPUA 3O9WC 1F2QA 3KLDA 4JEGB 4DKEH 1OP9A 4PJDA 2AGJL 3BISA 4YK4C 5HDBF 4LFHG 1IM9B 5DK2A 1HWGB 4G3YH 4OJFL 4KV5F 4XCNB 4AIOA 4G8FA 3B9KD 1DQJB 1TTFA 5HHMD 4XCFL 3RX7A 2WIIA 3SEPA 3VFSB 2R9HC 3RBSA 5AYUH 3O6MH 2P7TA 4Z7WA 1JWMA 3IRPX 1RK0B 2BVOB 2ESVA 1LNUA 1BJ1H 2AJZB 5CZXD 2ZPKH 4JKPH 4LLWA 2NLJA 3MV7D 4HGMA 1NUNB 4NSKB 3KHQA 3PJSA 3LEXA 4RZCA 3SJVB 1PGRB 4HPOH 1KIPA 1NEZB 4X6DE 5GS1A 4JY6B 5F88B 3PGDA 3OMZA 1T6VN 3AS0A 2V2WB 1IQWL 5I19H 1AGDB 4V1DE 3OHXA 3SDCC 2CGRL 1A8JH 3OBAA 1DZBA 5ITBH 1TQCC 1PZUB 2L0DA 1TXKA 4KRPB 5CUSL 5C09E 1L7TH 4IS6A 5KSBA 1S5HA 4HBQA 5DMYA 5SWSE 5BO1H 2VXVL 4JPKH 2R8SL 4MCZA 1T5XA 1B2WH 2VDKL 5HVHC 4M62L 2GT9B 3HC4L 2A6KB 3JTTA 1WBYA 1MELA 1HYSC 1NUDA 1NDGA 3C6LD 4PTTA 4KMTL 3DV4A 3ZT7A 3DHJA 3NPSC 4PJAA 1CT8A 1F00I 2AJXL 2W9EL 1NJ9B 1CWVA 1CL7H 1JIBA 4ELKA 5TQ2H 2D4FA 1EDQA 3NVQA 5HHXL 2YD2A 5FOJA 1YEIH 3NFPA 1Y6MR 2H2SC 4G8IB 5H35A 4HWBH 3TYFB 3VFOB 4WIQA 1OB1A 3SKMA 2HFFB 5D7IB 3RVUC 3KDMA 3Q6FB 4FQIH 3V6OE 3FFDA 1T7VA 4RWYL 1MRDH 2VZTA 4PUBL 3BH8A 1DDHA 3HZYA 3QULB 1MF2L 2VABA 4ZNCD 2VO5A 4P2OA 1OGTB 3UPCA 4UQ3B 4EI5C 3GUTA 3MRJA 1TQBB 5HHOB 1EEUA 3I6GB 1B4JH 2ENYA 4JB9L 1VEOA 1J12A 2ADFL 4KJYA 3MRKA 4OQTL 4L3ED 5DRWA 3SDDC 3T2OA 1FG2A 1T66C 1Q72L 2J5LC 3IAGC 3EGSB 4EQ2A 2Y7QA 5SX4H 2J7LA 1YEKL 5DO2D 5DEZA 3FN0L 3PWLB 2VDQH 3MV8D 5F6IB 3FT4B 4ZFFA 3D25A 4HC1H 3MRHB 1UWXH 2GTWB 2VISA 2QKIB 2XRAH 4X6CE 2X4TB 1N6VA 4G8GB 5DD0L 2YBRA 5DDHA 3ZHLA 3HR6A 2AVGA 4GXVL 3ZKND 4OGZA 3HZMA 3PDOB 2YR3A 4XT1C 3NABL 5F9WC 1V5JA 2EO1A 4RMSA 5FUOH 1S5IH 1UC6A 4HS6A 1N3NA 4GRWB 4P3DA 3HZKA 4OGAC 1DQLL 5BRZA 1AHWA 4Z7UF 3TPUE 4ZD3H 5A2JH 1MREH 1EO5A 2EZ0C 3CFBA 2X4RB 5BVPH 2R0WL 5F93C 4Z77B 2MNUA 3EJJX 1ACYL 4G6KL 4XZUA 4QXTA 4QHMB 1TZHB 1EJ6A 5ALCL 1MCKA 1B0RB 4YR6A 2RFXA 4DKEL 4H26A 4BELD 2HFEA 2GJ6A 1HN1A 5HHME 4QLRA 5C0BA 1QFOA 1ZVSA 5F7KC 4DZBB 2GSIB 1UA6H 4NYLB 1GZPB 4PYHA 2R23B 1NGYB 3L3IA 4G9FB 4Q0XH 4W4NA 5K9OB 5I1IH 3MLWH 1MCWW 1U95A 3MV7E 3RZWA 4JFFA 3RFZC 4DGVL 5IROC 1OSPH 1NGQH 2ZPKL 4JKPL 4R96B 3VXSD 5I16B 3S96B 2MWCA 3DYPA 4IRSA 4PLJD 1IM9A 4OT1L 3RRQA 4HPOL 4XCNA 2HKHL 1AXSB 3ZE1F 3IDNB 3FKUS 1DQJA 3PL6C 4JFXB 3A6BH 2XN9B 5E4EB 3ZDYF 4JLRB 1KJMA 1KJ2H 3TZVC 1RK0A 3WUWG 3WL9B 1G6VK 1KTDB 2AJZA 2IGFH 1I1RA 2ZUWA 5F7EL 5EUOB 3WNMA 4WI4A 3GB7B 4NHUB 4JPKL 3GO1L 5BO1L 2J88L 3WFZA 1NEZA 5K9KB 4I3GA 5F88A 1C5CH 3E1F1 2V2WA 3OKOA 5I1AB 3K80A 3JWOH 3D0VB 1RIVL 4ZAKC 4JM2A 4WI3A 2BNRD 4OLVH 4XP6H 1T1WB 1CYGA 3GSOB 3GSVB 3BZDA 3TBTB 2JELH 3ULVC 5DMJB 3DV6B 4HWBL 1MFCL 5ANMB 5J57B 3K2UL 1BM3H 4I3RL 2LQRA 2DIJA 1NJ9A 1IAII 1L0XA 4NCDA 1WFOA 5AWNL 5IFAH 4UINL 1ULVA 1ITBB 4L4VD 4QY8B 3KYMB 3WNOA 4CVZB 4KTDH 2Z31D 4PJHB 1CN4A 3VFOA 1A3QA 4QF1A 1B4JL 3MRFA 5C3TA 1F8TH 1EEYA 1G6RB 2XQBH 3Q6FA 2AV1A 4JO1H 3HI1A 3D85A 1P9MC 4GG8B 1UYWL 3QZWG 1CVRA 1QVOB 3QNYB 3V5HB 4M61B 2V5MA 1OGTA 4MZ2A 1PYWA 4OLXL 4UQ3A 2Y6SC 4X83A 3IVKB 5MP6H 4LHUG 1F6LL 5C7XL 3I6GA 5FYJD 1R0AH 4XVTL 5ISZD 3WHE1 3NIGE 2NY6C 1GVIA 1IFHH 1CFTB 2GK2A 4HJJL 1NC2D 3B2UD 4K9EC 3EGSA 5BV7B 4LLVA 4NWTH 4GUPB 2EE2A 4OCWH 1L0YA 2IMMA 1QRNE 5KVDL 1GOHA 1PZ5B 3PWLA 4QXWA 2DQUL 3MRHA 2GTWA 5LCVL 1LP9F 3BXNA 2QKIA 5ILTL 2X4TA 4LLDB 3ILPA 4B50A 4Y5XC 5E2JA 4PRPB 2E7BA 3P0VL 5IGXH 3NZHH 1MCHA 1BLNB 2X1QA 3KNBB 2FEEL 3PDOA 4M93C 4I77H 4ZD3L 4MXQD 5IBUG 3CX2A 1P84J 5GGRY 5BVPL 3JVGA 4FQHB 2Q87A 5J3HC 4N0CA 4PRHB 1NANH 2P8LB 3F58H 1X4YA 5EIQA 3PV6B 5IVZB 3QWOA 3DGCR 4C59B 1L9NA 3BSZH 3LPGA 3W0WD 2YWZA 1UA6L 2GY7B 1WJ3A 1XF1A 3IU3B 4F7CB 4QHMA 1TZHA 4U1NA 4G7VH 3VXSE 2FH8A 4NZTH 1ZANL 4GRLA 1LQVA 1OSPL 1I8IA 3SQOH 2CDFB 2AK1H 4HFWB 4BQ8A 2C5DC 3EZJB 4XMKH 4DZBA 5A2KH 3RU8H 2D7TL 3TVMC 2GSIA 1JZ5A 1FL3B 1ERNA 4NYLA 4R4ND 4HT1H 2R23A 3TWCH 4BYHA 3E6FA 1G9ML 5K9OA 3UC0L 2XQYG 4ZXBC 2B5IB 4YC2B 1BOYA 3MLVL 2OTWA 4NNYB 3PWJB 3SE9L 4E0RB 4NKQB 3IFLL 1T0PB 4R96A 3WIHH 2WWMC 4Z0XA 5HYQB 5I16A 3S96A 3CK0L 2BC4B 4W81A 1RUKL 3LKRB 3WNNA 1AXSA 2NW3B 3IDNA 1XAUA 4JFXA 5GGSY 4OZHB 5C07D 1D3CA 3EIFA 4NUJB 4BSJA 5DURD 4DKDC 2ZUUA 4S1DC 4UOW0 2XN9A 4MDIA 4U6VH 2BNRE 5TGBB 4KUCF 3VDBA 4GG6B 1KTDA 1YY8B 1D5IH 3UAJD 3ZHKA 5DD3H 4XP6L 1QSFD 5EUOA 1ZT1B 4XC1H 3NIDF 3LQAH 2H6PB 1FBIH 3ARXA 3GB7A 4NHUA 3HNTL 4XNYH 3LV3B 3V5KA 1NBVL 4EOWH 2ATKB 1KCSL 5E4IA 1BM3L 4QXUL 5I1AA 1RHFA 1BQHB 4JFPB 1JFMA 4ALAH 4XMLL 3D0VA 4B7LA 1S78D 3RZCD 4GAYB 3TT1L 2FRGP 5FUCE 1MI5D 1JNNH 1T7YA 2KBGA 2YMXH 4XPGH 3RVVC 5BS0B 5EN2B 5AZ2L 4LKXB 5F7UA 4KTDL 2XQYK 3DV6A 5SWZD 3SE4C 4KTEH 1OHQA 5D4QA 5HYSA 5ICXB 5IT2H 3QYCA 5IKCB 4XBEL 2R2EB 1WISA 1A14L 5DA4A 4OZIB 1A3LH 3BW9B 4JO1L 3UJIH 1UG9A 1A7OL 1RULL 1I8MB 2E6JA 1KIRB 1HYRC 3GMNB 5EH1A 1KYOJ 3CUPB 3PP4L 4QY8A 3KYMA 2NY5H 5GZND 2OR8A 4Z7VE 2K3TA 3REVB 4CVZA 3L95B 2V5YA 1BX2B 3VMOA 2J8OA 3VGEA 5DMIL 1I4FB 5L9DL 5AYQA 1G6RA 1MCRA 5IEKB 4KKCC 5IB5B 1X6LA 2HJFB 43C9A 3H7LA 3P9LA 2W92A 5J8OA 4GG8A 5E6IB 4U6HB 4Z7QE 1K6QH 3V5HA 3C2AH 4A6YA 4WEBH 1KFAL 1A9BB 2H1PL 1P4IH 3GKZA 4P57B 4KJQD 4X6DB 3O2DA 1WFNA 4V1DB 1EFXD 4Z95L 5KAQG 4OLEA 1CFTA 2GUOB 4NNPL 5C09B 5IGXL 3S9DB 5KS9F 4GUPA 4G9DA 5EIIA 3F12B 3QXVA 4M6ML 1U9KA 4KMQA 1DBAL 4PRAB 2E3VA 4QOKA 4ZUWB 2ICEB 1OQOA 5TE4L 3E8UH 1J10A 5DHYB 1UWXK 4NQDD 4XX1G 4LLDA 4KK8D 4PRPA 1KCVH 4Y2DB 3W0WE 4O2EA 4RAUB 3SPVB 3OQ3B 5HDLA 1FYHB 2AXHA 4ODHL 4RFEB 3U82B 3BSZL 4WCYL 5LGJB 3NMEA 1U8OB 4LVHC 1WIOA 4FQHA 5D71H 3O6FB 3QHFH 2CDEB 2P8LA 1GZQB 4JJHA 5GS0H 2VLKD 2HVKA 4I2XE 4I0PD 3W39B 1NAMH 1CFQB 3PV6A 5FDYA 5HYEA 5IVZA 3SQOL 1FC2D 4X9HA 3T0DA 1A2YB 4QRRA 1XCTB 3HB3C 5ICYB 3MJ9L 1N4XH 4EVNB 3NIFE 3RU8L 3OR7B 2FBOJ 1EAJA 2X1OA 3IU3A 4J3WA 5F7YC 2YS4A 1JVKA 4F7CA 3ULUD 4JGJA 5F1IA 2XWBA 3UTSD 2CDFA 2VWEC 4HFWA 4ORGB 2BNQD 1NH6A 5DK3A 4YHLH 5C07E 1I7RA 4OV6F 4WTZG 1LK2B 5IQ7H 1MQKH 2E9WA 1JGUL 3W81A 1FL3A 3UROR 4JG1L 1KPVB 1AHWC 3A6CH 1A6AB 2GKIA 1QSFE 4X6CB 4NNYA 2EDYA 3PWJA 1LO3L 2DTMH 4JFYB 3NACL 1KEMH 3C5ZD 3LQAL 1FBIL 4CU7A 5HYQA 4XNYL 2NXYB 2BC4A 3B83A 5B38B 1QBBA 2IWGA 3RHWK 3LKRA 1I1YB 1XGTB 2HT3C 4HV8B 4FQXD 4NUJA 4POZD 3P3YA 4OLYL 3OAUL 1NUGA 1H3GA 3QXAA 1JPTL 4P4KC 1ZSDB 4NRXA 5ACLA 3EO1A 3ZTJH 3MLYL 3D69B 1TLKA 4L3CB 1HZHL 2YMXL 4XPGL 4HAGA 5J1AB 4YQXH 5SWZE 4DCQA 4GS7C 3KPTA 3LV3A 1GGCL 3QUMB 3BH9B 1A9EB 3RVXC 4OQ1A 2ATKA 3SDAD 1D5ZB 2A9NL 4CJ0A 4P49A 4XVJH 1BQHA 4JFPA 1YEFH 3MNZA 3HHRB 3UJIL 4RRPG 3QQ9D 5DQDH 5AD0B 4GAYA 5GIRB 2WUCH 2FR4B 1N5YL 1J1PL 4UTAH 1T03H 2JCCE 4LKXA 4HUWB 1OAQL 4BZ2L 3B9KB 3NFNB 5DD6B 3IGAB 3KR3H 1IRAY 5HHMB 5EUKB 1Q9LB 5F7LB 4P2RD 5JMOC 2X4UB 5ICXA 2B1HL 1AQKL 5IKCA 2R2EA 4YAQB 5JORB 4OZIA 4MNQD 3QCTH 3RJQB 3LIZH 4HPYL 1I8MA 1HKLL 3MV7B 4WI7A 3J7HA 4K8RC 1GRWA 1RZKH 4TUKH 4F9LA 1MOEA 3GMNA 1GPOH 3IJSB 3CUPA 1LO5A 3U2SB 4KRPC 4Q9RH 4PRDB 4U1IB 4EKXA 3REVA 4F8TA 4ZDHB 1BX2A 4NBXB 1LO0H 2W07A 4M7ZB 1AGBA 3E3QE 3VRIB 3RWCA 1I4FA 4PJGB 1Q94B 5IB5A 1GAFH 1WT5A 3LEYH 5E6IA 5TPWH 2M1KA 2UUDK 3GSXB 5JXEA 4S0UC 4P57A 4NHCL 1MHEA 5I30H 3LRGA 4NQDE 3HUJA 2C26A 4X6DA 4HIHA 3REWB 4EUPB 2UY7A 5ECJE 5GS2D 4S2SA 4V1DA 5IFHL 4MHHI 2GUOA 4JR9H 3KWWB 5C09A 3SE3A 3F12A 5SWSA 1NCTA 1WICA 1RQ5A 4ZUWA 4F8QA 1UZ6E 1C7SA 2ICEA 3QHFL 1AI1H 4PLKD 3S97C 1TQBC 3F6LA 2X1PA 1IT9L 3SOBH 4CMHB 3FQXB 1X5IA 5JOPE 4Y2DA 4FQJL 4RAUA 5DJ0A 3SPVA 4FFZL 2ZCHL 1JGEB 5LGJA 4RFEA 4KDTC 1U8OA 2I9LB 3EKCA 3AS1A 2VSCA 2H26B 3O6FA 3CNKA 1AE6H 3VG0L 3K8MA 4WHYH 3UTSE 4O4YH 1GZQA 2FJGA 5F6IC 4UUJA 1OF2B 4NN6B 1LEIB 4HBCL 2BNQE 1J18A 4JCMA 5JW3L 2DTSA 3W39A 3R0NA 1CFQA 3CMOH 1JZ8A 5TF1H 2JJWA 4PJEA 1A2YA 1Y0LB 3O3UN 2DN7A 4Y88A 1XCTA 2LU4A 4YHLL 1J0YA 4PB9L 4HIEB 5ICYA 1IC5L 1DLFL 2Y23A 3VD5A 1OAXH 3O3DB 5CJBA 4AZ8A 4XHQA 3U4EA 3S36H 1DSFL 4PP1C 4QRPD 5DZOA 3DGGA 5EOQL 1ZGLP 1YUHB 1RSFA 1PDKA 4KDVA 4PJCF 3C5SB 4XI5C 4KI5E 2B8OT 2DTML 1X5GA 3ZDZE 4ORGA 3MLSH 1MRCL 5CGYD 3RNKB 4CDHA 4OGXH 3TESA 3Q1SH 1JZ7A 2Z0BA 4U1LB 1MH5B 1NMBL 2QQKL 3K1DA 1QRNB 4NCC1 2I07A 4QRQB 3IJHB 4X7CC 1FL6A 1A6AA 1GGIL 4M1DH 4C4KT 5E8PB 5SWQB 3ARTA 1U8HB 5FYLD 4X6BB 2HLAA 4X6CA 1QHPA 2X9YA 3SGEH 4Y19E 4D9LH 4TSAH 1AP2B 4HK3J 1E4WH 2OJZL 1INEL 4YQXL 4OF6A 2ORBH 3L7EA 5B38A 1HIMH 1ZKAA 1K8IB 3RY6C 2Q8AH 1I1YA 1XGTA 3ARPA 5D93B 1HNGA 1EVTC 4HLZH 1CG9B 1ZSDA 4XVJL 2XA8L 5AUMB 2R2BA 3P9MA 4FQLH 5DQDL 4ISVA 2YA1A 4FTVD 3WNKA 4L3CA 5CZVH 5MERB 3MJ8B 5J1AA 4CNIA 1T03L 4M8QB 3QUMA 1IQDB 3BH9A 1A9EA 3TPUA 5LGHH 4MNQE 1D5ZA 4NZDA 1WBZB 1JPSH 5DFWH 5I1HL 2GHWB 2BVPB 2HG5B 2YKLH 1HHKB 3QCTL 5AD0A 3O41A 2J8UF 1LK3H 4TUKL 3VXSB 4YZFE 3WO3B 4ODUB 1GPOL 3FMGL 5E4EC 3BJLA 4BUGA 3BZ4A 2P5ED 5K9QG 2HT4D 3UTTE 4H88H 3I3DA 4HUWA 5CWSB 3VGHA 4L4TE 3B9KA 3CCHB 3IGAA 5HHMA 5EUKA 3VXPA 2FJFA 4LF3B 3AUVA 2EDEA 1LO0L 2X4UA 4MAYC 1E6OH 4AMKH 5B8CB 3MYZA 4YAQA 4GLRI 5DFVC 4X9BA 3MV7A 3AGVA 4CMMB 3LEYL 3IJSA 3TA3D 3CVHH 1JNLL 1TZIB 5DVMA 1NSNL 4PRDA 2WP3O 1HSBB 4GXUM 3L3JB 1WV7T 2QBWA 4DK6A 3WD5L 1ZHLB 1ADQA 1QQDB 3VWJB 3VRIA 4X7SH 2EH7H 1Q94A 3QUYD 5EC2A 2EO9A 1MEXH 1KTLA 5EO1A 1A5FH 4JR9L 4WFGD 4F3FB 3GSXA 4P5KB 3C6LA 4Z5RA 1XF4A 3TT3H 3REWA 3R8BB 5JZ7C 4EUPA 3NN8B 1BQUA 1AI1L 2F53D 4KXZH 3L9RB 1NFIB 4XP9L 3FHQA 4M9OA 3FL7A 5I2IB 3WN5B 3KWWA 2IBBA 5F1NB 2O26U 4NM4L 2Z31B 3C9NB 4NJAH 3HMWH 3QDJE 4KI1A 4Q9CA 4LFHD 3UCRA 2R1XA 1Q0XL 2HTLD 3BRDA 5I1DB 1AE6L 5DEFB 1XZ0A 1TJHL 2YN3A 4PJ7F 4FQCH 4YDIL 2FO4A 3LKOA 4FFYL 1NCCL 5E5UB 1A7BA 1UGNA 5BMFL 1RFDH 1JGEA 5BV7C 4Z7VB 1OLLA 2I9LA 3S36L 35C8L 2H26A 4ZO9A 4L3EA 4MA7L 1HI6B 4QHLB 2IQAA 4J7RA 3O4LD 1NC2B 1OF2A 1BZ9B 3F8UB 1LEIA 4AT6B 3HN3A 1OARH 4F37K 3BKMH 4TSBL 5DUBB 2CIKA 4ZPVB 3UXFA 3VFVB 5TFSL 1U6AH 1XF5A 3ZTJG 5AG8A 3O3DA 4CVXB 2KPNA 1G0XA 5FYLE 3LKNB 3QDMD 3DRQB 4M1DL 1YUHA 3C5SA 4D9LL 3BP7B 3GMMB 5BXFA 5DSCB 4RDQF 5KOMC 1OVZA 4HGKC 5I8KH 1HIML 4LGRB 4U1LA 4RQQB 1MH5A 2Q8AL 2ZSVB 1W72H 4G6JL 4LSTL 4QRQA 3UJTL 3IJHA 4MVBD 3HC3L 3TBWB 5E8EB 1FNAA 5SWQA 3DYOA 1DL7L 1U8HA 4Y8DC 4FQLL 1FH5L 4IMLB 3IDMA 1JFQL 1FNSH 1RZJH 4JO3L 3Q6GH 3W0WB 5C71A 4ZOBA 1MCPH 2OMNA 1K8IA 4NWUL 2OL3B 2F19L 3B4NA 4YDJB 1RU9H 3WNLA 2Z92B 1X5LA 3EYFB 4ZO8A 1N26A 4XTRD 5LGHL 1LE5A 3CLFH 2XKSA 4FQ2H 3BDYH 1WITA 3NCEB 1CG9A 4FNLH 2YKLL 1T0NB 3RVTC 2P5EE 5H2BB 4ENEC 5F71A 1T83A 4P3CH 4I2XB 1LK3L 1E0OB 1FNGB 4HF5H 5MERA 2B5IC 4YC2C 5JIPA 5ERWB 4KGJA 1Z9OA 4Q9BA 5GRXG 2Y36L 1S3KH 3O2VL 3D48R 3ARQA 2HVJB 4D3CH 4AMKL 5BQ7B 5BW7C 1DVFB 1JWSB 2I25N 1T1XA 2BVPA 2HG5A 1HHKA 3BMWA 1M7XA 4TQEH 4LBEA 1PG7H 3DJ9A 2G2RA 3HG1E 5I73B 3VXSA 4JFOA 1S7QB 1JV5A 4JGUA 4S1QL 5HPMA 4LHJB 5HHVL 5CWSA 5D7KE 3M1BB 5J1TC 3H9HB 3O4OB 5C07B 3VFNB 4FG6C 1DUYA 3S7GA 3K1KC 2VIRB 4P5TB 3S5LG 3NCBB 3FOMA 3MGTB 1CDYA 1QSFB 4NQCE 1AR1D 2LU7A 1BBDH 5HGHB 3EJYD 1F3RB 4OFVA 4K07A 2W0FB 1TZIA 2QQLH 2X05A 1HSBA 4UAOB 1AC0A 3L3JA 1HH6B 5GRJH 2F53E 4LSUH 4D0CB 1ZHLA 2AJUH 1QQDA 3TT3L 5I15L 1YYLL 4BK5A 1KB5B 2BNRA 4NZUL 5C6TH 4S0TD 2IPTL 4CGTA 1FVCA 3CFCH 1RVFH 2EE6A 4WHYG 2YPVH 5SWZB 4F9LC 1CXFA 9CGTA 3LB6D 1PY9A 4M7LL 1QG3A 5E9DD 3NN8A 1JRHH 3UEZA 3NA4A 1T04B 1MWAA 5KZCD 3HRZB 3VH8G 3B9EA 4NUGL 5I2IA 2EH8L 3WN5A 3U9UA 5GZOC 5DUML 3IFNL 2Z31A 4P23D 1NL0L 4LLYB 1T2JA 3UYOD 2JCCB 5E6IC 1JYNA 3WYRA 2ZZUT 1XT5A 3ARUA 3O4LE 4GAJL 4JVUA 5JXEC 5I1DA 4S10A 5DEFA 1B88A 1BFTA 5IV2B 1FRGH 4FQPA 4DKAA 3D9AH 1QFUH 3BKML 2OTUB 2F58L 2QSVA 4DN3H 2HLFD 2W38A 4NQTA 5K9JH 1U6AL 3QDME 5BZWB 4AEIL 4LSSH 1SYSB 1QUNA 2BVQB 5ISZA 5INDA 3SE3C 1YY9C 3RIFF 1EFXB 5IQ9B 1HI6A 2VB5A 4QHLA 5MHSD 2CK2A 1A47A 1XR8B 3O6KL 1NC2A 1BZ9A 4YNYB 3MLZL 1IAMA 4IRJC 4NZRL 4AT6A 3TO2B 2VE6B 4WW1A 8CGTA 3FT3B 4Z0BH 3EYUL 1A1MB 2Z93B 3IS0X 4X0KB 3D3VD 2OXHA 5DUBA 4HLZG 1BMGA 2LFGA 4ZPVA 3P0GB 4Y2DC 1CTOA 4CVXA 1QP1A 1BPVA 5FCSH 3UZVB 5BVJB 2XWJB 3LKNA 1SBSL 4RFNB 4DGYL 5JNYB 3VFTB 3DRQA 2NPLX 4N0YL 3T2PA 4AEHH 3BRFA 5ENWB 3DBXA 3ZE0E 3CFJA 3O6FC 3BP7A 3GMMA 1FNSL 3ELAT 4IOSD 5DSCA 5CP3H 4MXQA 4Q58C 4ZOCA 2J6EH 4OSUH 3V6OC 1JTPA 2HN7B 1MCPL 1AY1L 4C83B 3T3PE 2WM0A 2ZSVA 3QNZB 4XPBL 1EK3A 2YA2A 4FQ2L 3L5HA 3MLXL 3Q3GB 3TBWA 2GFBB 1CFSB 4Z18A 1P7QB 1RMFH 2H3NB 4IMLA 1CE6A 2DLHA 2DQHH 5E6ZA 4O58L 4AK1A 3LKQB 3W0WA 3RDTD 4P46D 1IE5A 2OL3A 4YDJA 2ARJB 1K8DB 2Z92A 3EYFA 1WTGT 3MACL 4WV1B 4W6XB 3T8XB 4LHUD 3K0WA 5CEZE 3NBNA 3VFRB 1D5XB 1T0NA 3UTSB 5BOZG 2NTFA 5JTWA 1RIHH 1FN4B 2BNQB 4I2XA 1FNGA 2EDDA 2DI8A 1IC7H 3NFSH 2VUYA 3LS4H 4WNQB 5A2LH 4TVPH 3P11L 7CGTA 3DIFB 4DKFH 2E7HA 2NXYC 2IFFH 1JHLL 5BQ7A 2R69H 5I17B 1DVFA 1JWSA 1QACA 1EV2E 4MCYB 1CIDA 3PQYB 4HCRA 1FFPB 3OKLB 5DVNA 4D9RD 5FGBA 3C5ZB 3WHE0 4WW2B 1MCDA 3PWPD 3MROB 4XVUD 1NGWA 4F7EB 1MNUL 3B5TA 1TETL 4ZO7A 4FQXB 1PJ9A 1V3LA 4G80A 5C07A 1ZAGA 5E24E 4J2XA 4LSUL 2R0LH 4BZ1L 1I8LA 3BPLB 4LU5H 3FONB 2VIRA 3B9AA 5EPMB 1JUFB 4JQVA 3V52H 1QSFA 5C6TL 1G0YR 2V5TA 5F8RC 1E4XI 4NJ9L 5HGHA 3LH2L 4Y19B 2W0FA 3E2HB 4NBZB 4H8WC 4C57C 1RVFL 2AEIT 2OI9B 3ECBA 4IBLT 2YPVL 4HKXB 3QR2A 5JHLH 5E9DE 1HH6A 1YNTB 1BAFH 4YGAB 3V7MA 5FYKH 3PIQB 4JGMA 5C0IB 1F4XH 4M6OH 1YMMD 4V3EB 3QPQD 3ULVH 4BM7A 3B9DA 1MI5A 2VDLH 2CQVA 4WTWA 1CFVH 3ARZA 5AZEH 2GIYA 5SWZA 1UACH 4YEFA 4XGZB 4HXAH 2VDML 4G6FD 1BBJB 5EZOL 2Q1EA 4WHTA 2VQTA 4Y5YB 1Z3GH 1P5VA 3EDEA 3F7RA 4MNQB 5EU4B 1II4E 3P9WB 4MA1B 4TPRH 2H32A 1T04A 4M7ZC 3HRZA 5KG9B 1MFNA 4FFWD 2XNAA 5ADOL 1J8HE 3MCLH 4CN1A 2VXTH 4DN3L 4XCEB 3RUGE 4LLYA 3UTTB 2O93L 2JCCA 4L4TB 5MHSE 4PJIF 4ONOA 2JKXA 3V6BR 5IV2A 3T1WA 3C60D 1REIA 4LCCB