3VFQA

Human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphoribose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
401
structure length
375
Chain Sequence
KCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 14
publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 122
structure length 375
sequence length 401
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3vfqA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3vfqA01
3GPGA 4ETJA 3JRUA 4R7MA 2FAVA 4ZX9A 1BPMA 4K0CA 5FSVA 1ZR3A 3V2BA 4TU0A 1NJRA 3ETIA 5CBMA 4J4ZA 5FSXA 4ZI6A 3EKEA 5FSZA 3SIGA 5DUSA 4UMLA 2AFCA 3KR4A 4ABKA 3SIHA 3H8FA 1BLLE 4ZX8A 4GVVA 4R6TA 4ZYQA 4ZY1A 3KR5A 2VRIA 3GQOA 3GPOA 2ACFA 3JZTA 4KYBA 4J5QA 1HJZA 1LAPA 2EEEA 3KQZA 3EWRA 3EJGA 2FXKA 2FG1A 3H8EA 3Q6ZA 4X2TA 3IIDA 2L8RA 3VFQA 3EJFA 3SIIA 3EWQA 4JVVA 5FSUA 1LANA 2LGRA 2J9AA 4GVWA 3PEIA 1ZR5A 3EW5A 1BPNA 1SPVA 3H8GA 3V45A 4J5SA 1YD9A 2BFRA 5E3BA 2X47A 4K3NA 2EWBA 4ESSA 3EWOA 5HOLA 5AILA 4JGKA 4ABLA 4J5RA 3KZWA 2XD7A 4ZY2A 3SIJA 5FSYA 1VHUA 3EWPA 1LAMA 3GPQA 4IQYA 3IIFA 1GYTA 5HIHA 4JCAA 3IJ3A 4D86A 2BFQA 2DX6A 5CMSA 3Q71A 4ETKA 3GQEA 4KSIA 1LCPA 5CB3A 4GUAA 4ZY0A 3KQXA 5CB5A 4JLLA 3T8WA 4R76A 1TY8A 1TXZA 5D8NA
chains in the Genus database with same CATH superfamily
3GPGA 4ETJA 3JRUA 4R7MA 2FAVA 4ZX9A 1BPMA 4K0CA 5FSVA 1ZR3A 3V2BA 4TU0A 1NJRA 3ETIA 5CBMA 4J4ZA 5FSXA 4ZI6A 3EKEA 5FSZA 3SIGA 5DUSA 4UMLA 2AFCA 2W2GA 3KR4A 4ABKA 3SIHA 2JZFA 3H8FA 1BLLE 4ZX8A 2WCTA 4GVVA 4R6TA 4ZYQA 4ZY1A 3KR5A 2VRIA 3GQOA 3GPOA 2ACFA 3JZTA 4KYBA 4J5QA 1HJZA 1LAPA 2EEEA 3KQZA 3EWRA 3EJGA 2FXKA 2FG1A 3H8EA 3Q6ZA 4X2TA 3IIDA 2L8RA 3VFQA 3EJFA 3SIIA 3EWQA 4JVVA 5FSUA 1LANA 2LGRA 2J9AA 4GVWA 3PEIA 1ZR5A 3EW5A 1BPNA 1SPVA 3H8GA 3V45A 4J5SA 1YD9A 2RNKA 2BFRA 5E3BA 2X47A 4K3NA 2EWBA 4ESSA 3EWOA 5HOLA 5AILA 4JGKA 4ABLA 4J5RA 3KZWA 2XD7A 4ZY2A 3SIJA 2KQVA 5FSYA 1VHUA 3EWPA 1LAMA 3GPQA 4IQYA 3IIFA 1GYTA 5HIHA 4JCAA 3IJ3A 2JZEA 4D86A 2BFQA 2DX6A 5CMSA 3Q71A 4ETKA 3GQEA 2JZDA 4KSIA 1LCPA 5CB3A 4GUAA 4ZY0A 3KQXA 5CB5A 4JLLA 3T8WA 4R76A 1TY8A 1TXZA 5D8NA
chains in the Genus database with same CATH topology
3GPGA 4ETJA 3JRUA 4R7MA 2FAVA 4ZX9A 1BPMA 4K0CA 5FSVA 1ZR3A 3V2BA 4TU0A 1NJRA 3ETIA 5CBMA 4J4ZA 5FSXA 4ZI6A 3EKEA 5FSZA 3SIGA 5DUSA 4UMLA 2AFCA 3KR4A 4ABKA 3SIHA 3H8FA 1BLLE 4ZX8A 4GVVA 4R6TA 4ZYQA 4ZY1A 3KR5A 2VRIA 3GQOA 3GPOA 2ACFA 3JZTA 4KYBA 4J5QA 1HJZA 1LAPA 2EEEA 3KQZA 3EWRA 3EJGA 2FXKA 2FG1A 3H8EA 3Q6ZA 4X2TA 3IIDA 2L8RA 3VFQA 3EJFA 3SIIA 3EWQA 4JVVA 5FSUA 1LANA 2LGRA 2J9AA 4GVWA 3PEIA 1ZR5A 3EW5A 1BPNA 1SPVA 3H8GA 3V45A 4J5SA 1YD9A 2BFRA 5E3BA 2X47A 4K3NA 2EWBA 4ESSA 3EWOA 5HOLA 5AILA 4JGKA 4ABLA 4J5RA 3KZWA 2XD7A 4ZY2A 3SIJA 5FSYA 1VHUA 3EWPA 1LAMA 3GPQA 4IQYA 3IIFA 1GYTA 5HIHA 4JCAA 3IJ3A 4D86A 2BFQA 2DX6A 5CMSA 3Q71A 4ETKA 3GQEA 4KSIA 1LCPA 5CB3A 4GUAA 4ZY0A 3KQXA 5CB5A 4JLLA 3T8WA 4R76A 1TY8A 1TXZA 5D8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPG A;  4ETJ A;  3JRU A;  4R7M A;  2FAV A;  4ZX9 A;  1BPM A;  4K0C A;  5FSV A;  1ZR3 A;  3V2B A;  4TU0 A;  1NJR A;  3ETI A;  5CBM A;  4J4Z A;  5FSX A;  4ZI6 A;  3EKE A;  5FSZ A;  3SIG A;  5DUS A;  4UML A;  2AFC A;  3KR4 A;  4ABK A;  3SIH A;  3H8F A;  1BLL E;  4ZX8 A;  4GVV A;  4R6T A;  4ZYQ A;  4ZY1 A;  3KR5 A;  2VRI A;  3GQO A;  3GPO A;  2ACF A;  3JZT A;  4KYB A;  4J5Q A;  1HJZ A;  1LAP A;  2EEE A;  3KQZ A;  3EWR A;  3EJG A;  2FXK A;  2FG1 A;  3H8E A;  3Q6Z A;  4X2T A;  3IID A;  2L8R A;  3VFQ A;  3EJF A;  3SII A;  3EWQ A;  4JVV A;  5FSU A;  1LAN A;  2LGR A;  2J9A A;  4GVW A;  3PEI A;  1ZR5 A;  3EW5 A;  1BPN A;  1SPV A;  3H8G A;  3V45 A;  4J5S A;  1YD9 A;  2BFR A;  5E3B A;  2X47 A;  4K3N A;  2EWB A;  4ESS A;  3EWO A;  5HOL A;  5AIL A;  4JGK A;  4ABL A;  4J5R A;  3KZW A;  2XD7 A;  4ZY2 A;  3SIJ A;  5FSY A;  1VHU A;  3EWP A;  1LAM A;  3GPQ A;  4IQY A;  3IIF A;  1GYT A;  5HIH A;  4JCA A;  3IJ3 A;  4D86 A;  2BFQ A;  2DX6 A;  5CMS A;  3Q71 A;  4ETK A;  3GQE A;  4KSI A;  1LCP A;  5CB3 A;  4GUA A;  4ZY0 A;  3KQX A;  5CB5 A;  4JLL A;  3T8W A;  4R76 A;  1TY8 A;  1TXZ A;  5D8N A; 
#chains in the Genus database with same CATH topology
 3GPG A;  4ETJ A;  3JRU A;  4R7M A;  2FAV A;  4ZX9 A;  1BPM A;  4K0C A;  5FSV A;  1ZR3 A;  3V2B A;  4TU0 A;  1NJR A;  3ETI A;  5CBM A;  4J4Z A;  5FSX A;  4ZI6 A;  3EKE A;  5FSZ A;  3SIG A;  5DUS A;  4UML A;  2AFC A;  2W2G A;  3KR4 A;  4ABK A;  3SIH A;  2JZF A;  3H8F A;  1BLL E;  4ZX8 A;  2WCT A;  4GVV A;  4R6T A;  4ZYQ A;  4ZY1 A;  3KR5 A;  2VRI A;  3GQO A;  3GPO A;  2ACF A;  3JZT A;  4KYB A;  4J5Q A;  1HJZ A;  1LAP A;  2EEE A;  3KQZ A;  3EWR A;  3EJG A;  2FXK A;  2FG1 A;  3H8E A;  3Q6Z A;  4X2T A;  3IID A;  2L8R A;  3VFQ A;  3EJF A;  3SII A;  3EWQ A;  4JVV A;  5FSU A;  1LAN A;  2LGR A;  2J9A A;  4GVW A;  3PEI A;  1ZR5 A;  3EW5 A;  1BPN A;  1SPV A;  3H8G A;  3V45 A;  4J5S A;  1YD9 A;  2RNK A;  2BFR A;  5E3B A;  2X47 A;  4K3N A;  2EWB A;  4ESS A;  3EWO A;  5HOL A;  5AIL A;  4JGK A;  4ABL A;  4J5R A;  3KZW A;  2XD7 A;  4ZY2 A;  3SIJ A;  2KQV A;  5FSY A;  1VHU A;  3EWP A;  1LAM A;  3GPQ A;  4IQY A;  3IIF A;  1GYT A;  5HIH A;  4JCA A;  3IJ3 A;  2JZE A;  4D86 A;  2BFQ A;  2DX6 A;  5CMS A;  3Q71 A;  4ETK A;  3GQE A;  2JZD A;  4KSI A;  1LCP A;  5CB3 A;  4GUA A;  4ZY0 A;  3KQX A;  5CB5 A;  4JLL A;  3T8W A;  4R76 A;  1TY8 A;  1TXZ A;  5D8N A; 
#chains in the Genus database with same CATH homology
 3GPG A;  4ETJ A;  3JRU A;  4R7M A;  2FAV A;  4ZX9 A;  1BPM A;  4K0C A;  5FSV A;  1ZR3 A;  3V2B A;  4TU0 A;  1NJR A;  3ETI A;  5CBM A;  4J4Z A;  5FSX A;  4ZI6 A;  3EKE A;  5FSZ A;  3SIG A;  5DUS A;  4UML A;  2AFC A;  3KR4 A;  4ABK A;  3SIH A;  3H8F A;  1BLL E;  4ZX8 A;  4GVV A;  4R6T A;  4ZYQ A;  4ZY1 A;  3KR5 A;  2VRI A;  3GQO A;  3GPO A;  2ACF A;  3JZT A;  4KYB A;  4J5Q A;  1HJZ A;  1LAP A;  2EEE A;  3KQZ A;  3EWR A;  3EJG A;  2FXK A;  2FG1 A;  3H8E A;  3Q6Z A;  4X2T A;  3IID A;  2L8R A;  3VFQ A;  3EJF A;  3SII A;  3EWQ A;  4JVV A;  5FSU A;  1LAN A;  2LGR A;  2J9A A;  4GVW A;  3PEI A;  1ZR5 A;  3EW5 A;  1BPN A;  1SPV A;  3H8G A;  3V45 A;  4J5S A;  1YD9 A;  2BFR A;  5E3B A;  2X47 A;  4K3N A;  2EWB A;  4ESS A;  3EWO A;  5HOL A;  5AIL A;  4JGK A;  4ABL A;  4J5R A;  3KZW A;  2XD7 A;  4ZY2 A;  3SIJ A;  5FSY A;  1VHU A;  3EWP A;  1LAM A;  3GPQ A;  4IQY A;  3IIF A;  1GYT A;  5HIH A;  4JCA A;  3IJ3 A;  4D86 A;  2BFQ A;  2DX6 A;  5CMS A;  3Q71 A;  4ETK A;  3GQE A;  4KSI A;  1LCP A;  5CB3 A;  4GUA A;  4ZY0 A;  3KQX A;  5CB5 A;  4JLL A;  3T8W A;  4R76 A;  1TY8 A;  1TXZ A;  5D8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...