3VFQA

Human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphoribose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
401
structure length
375
Chain Sequence
KCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
total genus 122
structure length 375
sequence length 401
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3vfqA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3vfqA01
3Q71A 2J9AA 2BFQA 3EJFA 5CB3A 2AFCA 3GQOA 3EW5A 1BLLE 3EWPA 5HOLA 4R76A 4IQYA 3SIGA 3H8EA 1VHUA 2FG1A 3JZTA 5DUSA 5E3BA 4ETKA 5HIHA 2EWBA 4ZI6A 2LGRA 1GYTA 3PEIA 5CBMA 4JGKA 3SIJA 1SPVA 3IIDA 3EWQA 5CB5A 1LCPA 3KR5A 2XD7A 1TXZA 1BPMA 3EJGA 5FSXA 3VFQA 4UMLA 1YD9A 2EEEA 3KZWA 3KQXA 4ESSA 4R7MA 3IIFA 3GPOA 4ZX8A 4ABKA 3H8GA 3V45A 4ZY0A 4TU0A 3EWOA 4ZY1A 1LAMA 4D86A 1BPNA 2DX6A 4GVWA 3SIIA 2ACFA 4ZX9A 4ABLA 4GUAA 5FSZA 1NJRA 5FSUA 3GPQA 2VRIA 5FSVA 2FAVA 4ZY2A 2L8RA 3GQEA 4ZYQA 1ZR3A 5AILA 3EKEA 4R6TA 3ETIA 4JVVA 4ETJA 1HJZA 4KSIA 3H8FA 4K0CA 1ZR5A 3JRUA 4JLLA 4J5SA 4GVVA 4J5QA 4J4ZA 4X2TA 3SIHA 3IJ3A 1LAPA 5D8NA 4K3NA 3GPGA 1LANA 2FXKA 5CMSA 3T8WA 3KQZA 5FSYA 2BFRA 3KR4A 3Q6ZA 4KYBA 3V2BA 3EWRA 1TY8A 4JCAA 4J5RA 2X47A
chains in the Genus database with same CATH superfamily
3Q71A 2J9AA 2BFQA 2JZDA 3EJFA 5CB3A 2AFCA 3GQOA 3EW5A 1BLLE 3EWPA 5HOLA 4R76A 4IQYA 3SIGA 3H8EA 1VHUA 2FG1A 3JZTA 5DUSA 5E3BA 4ETKA 5HIHA 2EWBA 2WCTA 4ZI6A 2LGRA 1GYTA 3PEIA 5CBMA 4JGKA 3SIJA 1SPVA 2KQVA 3IIDA 3EWQA 5CB5A 1LCPA 3KR5A 2XD7A 1TXZA 1BPMA 3EJGA 5FSXA 3VFQA 4UMLA 1YD9A 2EEEA 3KZWA 3KQXA 4ESSA 4R7MA 3IIFA 3GPOA 4ZX8A 4ABKA 3H8GA 3V45A 4ZY0A 4TU0A 3EWOA 4ZY1A 1LAMA 2JZEA 4D86A 1BPNA 2DX6A 4GVWA 3SIIA 2ACFA 4ZX9A 4ABLA 4GUAA 5FSZA 1NJRA 5FSUA 3GPQA 2VRIA 5FSVA 2FAVA 4ZY2A 2L8RA 3GQEA 2JZFA 4ZYQA 1ZR3A 2RNKA 5AILA 3EKEA 4R6TA 3ETIA 4JVVA 4ETJA 1HJZA 4KSIA 3H8FA 4K0CA 1ZR5A 3JRUA 4JLLA 4J5SA 4GVVA 4J5QA 4J4ZA 4X2TA 3SIHA 3IJ3A 1LAPA 5D8NA 4K3NA 3GPGA 1LANA 2FXKA 5CMSA 3T8WA 3KQZA 5FSYA 2BFRA 3KR4A 3Q6ZA 2W2GA 4KYBA 3V2BA 3EWRA 1TY8A 4JCAA 4J5RA 2X47A
chains in the Genus database with same CATH topology
3Q71A 2J9AA 2BFQA 3EJFA 5CB3A 2AFCA 3GQOA 3EW5A 1BLLE 3EWPA 5HOLA 4R76A 4IQYA 3SIGA 3H8EA 1VHUA 2FG1A 3JZTA 5DUSA 5E3BA 4ETKA 5HIHA 2EWBA 4ZI6A 2LGRA 1GYTA 3PEIA 5CBMA 4JGKA 3SIJA 1SPVA 3IIDA 3EWQA 5CB5A 1LCPA 3KR5A 2XD7A 1TXZA 1BPMA 3EJGA 5FSXA 3VFQA 4UMLA 1YD9A 2EEEA 3KZWA 3KQXA 4ESSA 4R7MA 3IIFA 3GPOA 4ZX8A 4ABKA 3H8GA 3V45A 4ZY0A 4TU0A 3EWOA 4ZY1A 1LAMA 4D86A 1BPNA 2DX6A 4GVWA 3SIIA 2ACFA 4ZX9A 4ABLA 4GUAA 5FSZA 1NJRA 5FSUA 3GPQA 2VRIA 5FSVA 2FAVA 4ZY2A 2L8RA 3GQEA 4ZYQA 1ZR3A 5AILA 3EKEA 4R6TA 3ETIA 4JVVA 4ETJA 1HJZA 4KSIA 3H8FA 4K0CA 1ZR5A 3JRUA 4JLLA 4J5SA 4GVVA 4J5QA 4J4ZA 4X2TA 3SIHA 3IJ3A 1LAPA 5D8NA 4K3NA 3GPGA 1LANA 2FXKA 5CMSA 3T8WA 3KQZA 5FSYA 2BFRA 3KR4A 3Q6ZA 4KYBA 3V2BA 3EWRA 1TY8A 4JCAA 4J5RA 2X47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q71 A;  2J9A A;  2BFQ A;  3EJF A;  5CB3 A;  2AFC A;  3GQO A;  3EW5 A;  1BLL E;  3EWP A;  5HOL A;  4R76 A;  4IQY A;  3SIG A;  3H8E A;  1VHU A;  2FG1 A;  3JZT A;  5DUS A;  5E3B A;  4ETK A;  5HIH A;  2EWB A;  4ZI6 A;  2LGR A;  1GYT A;  3PEI A;  5CBM A;  4JGK A;  3SIJ A;  1SPV A;  3IID A;  3EWQ A;  5CB5 A;  1LCP A;  3KR5 A;  2XD7 A;  1TXZ A;  1BPM A;  3EJG A;  5FSX A;  3VFQ A;  4UML A;  1YD9 A;  2EEE A;  3KZW A;  3KQX A;  4ESS A;  4R7M A;  3IIF A;  3GPO A;  4ZX8 A;  4ABK A;  3H8G A;  3V45 A;  4ZY0 A;  4TU0 A;  3EWO A;  4ZY1 A;  1LAM A;  4D86 A;  1BPN A;  2DX6 A;  4GVW A;  3SII A;  2ACF A;  4ZX9 A;  4ABL A;  4GUA A;  5FSZ A;  1NJR A;  5FSU A;  3GPQ A;  2VRI A;  5FSV A;  2FAV A;  4ZY2 A;  2L8R A;  3GQE A;  4ZYQ A;  1ZR3 A;  5AIL A;  3EKE A;  4R6T A;  3ETI A;  4JVV A;  4ETJ A;  1HJZ A;  4KSI A;  3H8F A;  4K0C A;  1ZR5 A;  3JRU A;  4JLL A;  4J5S A;  4GVV A;  4J5Q A;  4J4Z A;  4X2T A;  3SIH A;  3IJ3 A;  1LAP A;  5D8N A;  4K3N A;  3GPG A;  1LAN A;  2FXK A;  5CMS A;  3T8W A;  3KQZ A;  5FSY A;  2BFR A;  3KR4 A;  3Q6Z A;  4KYB A;  3V2B A;  3EWR A;  1TY8 A;  4JCA A;  4J5R A;  2X47 A; 
#chains in the Genus database with same CATH topology
 3Q71 A;  2J9A A;  2BFQ A;  2JZD A;  3EJF A;  5CB3 A;  2AFC A;  3GQO A;  3EW5 A;  1BLL E;  3EWP A;  5HOL A;  4R76 A;  4IQY A;  3SIG A;  3H8E A;  1VHU A;  2FG1 A;  3JZT A;  5DUS A;  5E3B A;  4ETK A;  5HIH A;  2EWB A;  2WCT A;  4ZI6 A;  2LGR A;  1GYT A;  3PEI A;  5CBM A;  4JGK A;  3SIJ A;  1SPV A;  2KQV A;  3IID A;  3EWQ A;  5CB5 A;  1LCP A;  3KR5 A;  2XD7 A;  1TXZ A;  1BPM A;  3EJG A;  5FSX A;  3VFQ A;  4UML A;  1YD9 A;  2EEE A;  3KZW A;  3KQX A;  4ESS A;  4R7M A;  3IIF A;  3GPO A;  4ZX8 A;  4ABK A;  3H8G A;  3V45 A;  4ZY0 A;  4TU0 A;  3EWO A;  4ZY1 A;  1LAM A;  2JZE A;  4D86 A;  1BPN A;  2DX6 A;  4GVW A;  3SII A;  2ACF A;  4ZX9 A;  4ABL A;  4GUA A;  5FSZ A;  1NJR A;  5FSU A;  3GPQ A;  2VRI A;  5FSV A;  2FAV A;  4ZY2 A;  2L8R A;  3GQE A;  2JZF A;  4ZYQ A;  1ZR3 A;  2RNK A;  5AIL A;  3EKE A;  4R6T A;  3ETI A;  4JVV A;  4ETJ A;  1HJZ A;  4KSI A;  3H8F A;  4K0C A;  1ZR5 A;  3JRU A;  4JLL A;  4J5S A;  4GVV A;  4J5Q A;  4J4Z A;  4X2T A;  3SIH A;  3IJ3 A;  1LAP A;  5D8N A;  4K3N A;  3GPG A;  1LAN A;  2FXK A;  5CMS A;  3T8W A;  3KQZ A;  5FSY A;  2BFR A;  3KR4 A;  3Q6Z A;  2W2G A;  4KYB A;  3V2B A;  3EWR A;  1TY8 A;  4JCA A;  4J5R A;  2X47 A; 
#chains in the Genus database with same CATH homology
 3Q71 A;  2J9A A;  2BFQ A;  3EJF A;  5CB3 A;  2AFC A;  3GQO A;  3EW5 A;  1BLL E;  3EWP A;  5HOL A;  4R76 A;  4IQY A;  3SIG A;  3H8E A;  1VHU A;  2FG1 A;  3JZT A;  5DUS A;  5E3B A;  4ETK A;  5HIH A;  2EWB A;  4ZI6 A;  2LGR A;  1GYT A;  3PEI A;  5CBM A;  4JGK A;  3SIJ A;  1SPV A;  3IID A;  3EWQ A;  5CB5 A;  1LCP A;  3KR5 A;  2XD7 A;  1TXZ A;  1BPM A;  3EJG A;  5FSX A;  3VFQ A;  4UML A;  1YD9 A;  2EEE A;  3KZW A;  3KQX A;  4ESS A;  4R7M A;  3IIF A;  3GPO A;  4ZX8 A;  4ABK A;  3H8G A;  3V45 A;  4ZY0 A;  4TU0 A;  3EWO A;  4ZY1 A;  1LAM A;  4D86 A;  1BPN A;  2DX6 A;  4GVW A;  3SII A;  2ACF A;  4ZX9 A;  4ABL A;  4GUA A;  5FSZ A;  1NJR A;  5FSU A;  3GPQ A;  2VRI A;  5FSV A;  2FAV A;  4ZY2 A;  2L8R A;  3GQE A;  4ZYQ A;  1ZR3 A;  5AIL A;  3EKE A;  4R6T A;  3ETI A;  4JVV A;  4ETJ A;  1HJZ A;  4KSI A;  3H8F A;  4K0C A;  1ZR5 A;  3JRU A;  4JLL A;  4J5S A;  4GVV A;  4J5Q A;  4J4Z A;  4X2T A;  3SIH A;  3IJ3 A;  1LAP A;  5D8N A;  4K3N A;  3GPG A;  1LAN A;  2FXK A;  5CMS A;  3T8W A;  3KQZ A;  5FSY A;  2BFR A;  3KR4 A;  3Q6Z A;  4KYB A;  3V2B A;  3EWR A;  1TY8 A;  4JCA A;  4J5R A;  2X47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...