3VFQA

Human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphoribose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
401
structure length
375
Chain Sequence
KCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
total genus 122
structure length 375
sequence length 401
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3vfqA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3vfqA01
3ETIA 3EW5A 1BPNA 2FG1A 4GVWA 4R6TA 5AILA 4JGKA 1LCPA 4ABLA 1SPVA 1LAMA 3Q6ZA 3KQXA 3JRUA 4K3NA 5CBMA 4J5QA 4TU0A 4ZX9A 3KR4A 5FSVA 5E3BA 3GPQA 4ESSA 2XD7A 3V45A 3H8EA 3SIJA 3KQZA 3PEIA 4JVVA 4ZYQA 2BFRA 1BPMA 1YD9A 4J4ZA 5FSZA 1TY8A 4ZY0A 4ZX8A 3EWOA 3GPOA 5CB5A 1ZR5A 1HJZA 1LAPA 5DUSA 4IQYA 3JZTA 1LANA 2ACFA 4ZY2A 5FSYA 3EWPA 3SIIA 2DX6A 4ETKA 3KZWA 2AFCA 4JCAA 3SIGA 4GUAA 3H8GA 2LGRA 3Q71A 4JLLA 5HOLA 4KSIA 2EEEA 4ZY1A 3IJ3A 4R76A 4ZI6A 2VRIA 3IIDA 4GVVA 3VFQA 1TXZA 1NJRA 3T8WA 4D86A 3SIHA 4R7MA 5FSXA 2J9AA 4J5RA 2L8RA 4ETJA 1VHUA 4KYBA 3H8FA 1GYTA 2EWBA 3EWRA 4UMLA 2FAVA 5D8NA 5CB3A 3GQOA 3EKEA 4ABKA 2FXKA 4J5SA 2X47A 2BFQA 3GPGA 4X2TA 5HIHA 3GQEA 3KR5A 1BLLE 1ZR3A 3EJFA 3IIFA 5CMSA 4K0CA 3EWQA 5FSUA 3EJGA 3V2BA
chains in the Genus database with same CATH superfamily
3ETIA 3EW5A 1BPNA 2FG1A 2KQVA 4GVWA 4R6TA 5AILA 4JGKA 1LCPA 4ABLA 1SPVA 1LAMA 3Q6ZA 3KQXA 3JRUA 4K3NA 5CBMA 4J5QA 4TU0A 4ZX9A 3KR4A 5FSVA 5E3BA 3GPQA 4ESSA 2XD7A 3V45A 3H8EA 3SIJA 3KQZA 2RNKA 3PEIA 4JVVA 4ZYQA 2BFRA 2JZDA 1BPMA 1YD9A 4J4ZA 5FSZA 1TY8A 4ZY0A 4ZX8A 3EWOA 3GPOA 2JZEA 5CB5A 1ZR5A 1HJZA 1LAPA 5DUSA 4IQYA 3JZTA 1LANA 2ACFA 4ZY2A 5FSYA 3EWPA 3SIIA 2DX6A 4ETKA 3KZWA 2AFCA 4JCAA 3SIGA 4GUAA 3H8GA 2LGRA 3Q71A 4JLLA 5HOLA 4KSIA 2EEEA 4ZY1A 3IJ3A 4R76A 2JZFA 2VRIA 3IIDA 4ZI6A 4GVVA 3VFQA 1TXZA 1NJRA 3T8WA 4D86A 3SIHA 4R7MA 5FSXA 2J9AA 4J5RA 2L8RA 2WCTA 4ETJA 2W2GA 1VHUA 4KYBA 3H8FA 1GYTA 2EWBA 3EWRA 4UMLA 2FAVA 5D8NA 5CB3A 3GQOA 3EKEA 4ABKA 2FXKA 4J5SA 2X47A 2BFQA 3GPGA 4X2TA 5HIHA 3GQEA 3KR5A 1BLLE 1ZR3A 3EJFA 3IIFA 5CMSA 4K0CA 3EWQA 5FSUA 3EJGA 3V2BA
chains in the Genus database with same CATH topology
3ETIA 3EW5A 1BPNA 2FG1A 4GVWA 4R6TA 5AILA 4JGKA 1LCPA 4ABLA 1SPVA 1LAMA 3Q6ZA 3KQXA 3JRUA 4K3NA 5CBMA 4J5QA 4TU0A 4ZX9A 3KR4A 5FSVA 5E3BA 3GPQA 4ESSA 2XD7A 3V45A 3H8EA 3SIJA 3KQZA 3PEIA 4JVVA 4ZYQA 2BFRA 1BPMA 1YD9A 4J4ZA 5FSZA 1TY8A 4ZY0A 4ZX8A 3EWOA 3GPOA 5CB5A 1ZR5A 1HJZA 1LAPA 5DUSA 4IQYA 3JZTA 1LANA 2ACFA 4ZY2A 5FSYA 3EWPA 3SIIA 2DX6A 4ETKA 3KZWA 2AFCA 4JCAA 3SIGA 4GUAA 3H8GA 2LGRA 3Q71A 4JLLA 5HOLA 4KSIA 2EEEA 4ZY1A 3IJ3A 4R76A 4ZI6A 2VRIA 3IIDA 4GVVA 3VFQA 1TXZA 1NJRA 3T8WA 4D86A 3SIHA 4R7MA 5FSXA 2J9AA 4J5RA 2L8RA 4ETJA 1VHUA 4KYBA 3H8FA 1GYTA 2EWBA 3EWRA 4UMLA 2FAVA 5D8NA 5CB3A 3GQOA 3EKEA 4ABKA 2FXKA 4J5SA 2X47A 2BFQA 3GPGA 4X2TA 5HIHA 3GQEA 3KR5A 1BLLE 1ZR3A 3EJFA 3IIFA 5CMSA 4K0CA 3EWQA 5FSUA 3EJGA 3V2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETI A;  3EW5 A;  1BPN A;  2FG1 A;  4GVW A;  4R6T A;  5AIL A;  4JGK A;  1LCP A;  4ABL A;  1SPV A;  1LAM A;  3Q6Z A;  3KQX A;  3JRU A;  4K3N A;  5CBM A;  4J5Q A;  4TU0 A;  4ZX9 A;  3KR4 A;  5FSV A;  5E3B A;  3GPQ A;  4ESS A;  2XD7 A;  3V45 A;  3H8E A;  3SIJ A;  3KQZ A;  3PEI A;  4JVV A;  4ZYQ A;  2BFR A;  1BPM A;  1YD9 A;  4J4Z A;  5FSZ A;  1TY8 A;  4ZY0 A;  4ZX8 A;  3EWO A;  3GPO A;  5CB5 A;  1ZR5 A;  1HJZ A;  1LAP A;  5DUS A;  4IQY A;  3JZT A;  1LAN A;  2ACF A;  4ZY2 A;  5FSY A;  3EWP A;  3SII A;  2DX6 A;  4ETK A;  3KZW A;  2AFC A;  4JCA A;  3SIG A;  4GUA A;  3H8G A;  2LGR A;  3Q71 A;  4JLL A;  5HOL A;  4KSI A;  2EEE A;  4ZY1 A;  3IJ3 A;  4R76 A;  4ZI6 A;  2VRI A;  3IID A;  4GVV A;  3VFQ A;  1TXZ A;  1NJR A;  3T8W A;  4D86 A;  3SIH A;  4R7M A;  5FSX A;  2J9A A;  4J5R A;  2L8R A;  4ETJ A;  1VHU A;  4KYB A;  3H8F A;  1GYT A;  2EWB A;  3EWR A;  4UML A;  2FAV A;  5D8N A;  5CB3 A;  3GQO A;  3EKE A;  4ABK A;  2FXK A;  4J5S A;  2X47 A;  2BFQ A;  3GPG A;  4X2T A;  5HIH A;  3GQE A;  3KR5 A;  1BLL E;  1ZR3 A;  3EJF A;  3IIF A;  5CMS A;  4K0C A;  3EWQ A;  5FSU A;  3EJG A;  3V2B A; 
#chains in the Genus database with same CATH topology
 3ETI A;  3EW5 A;  1BPN A;  2FG1 A;  2KQV A;  4GVW A;  4R6T A;  5AIL A;  4JGK A;  1LCP A;  4ABL A;  1SPV A;  1LAM A;  3Q6Z A;  3KQX A;  3JRU A;  4K3N A;  5CBM A;  4J5Q A;  4TU0 A;  4ZX9 A;  3KR4 A;  5FSV A;  5E3B A;  3GPQ A;  4ESS A;  2XD7 A;  3V45 A;  3H8E A;  3SIJ A;  3KQZ A;  2RNK A;  3PEI A;  4JVV A;  4ZYQ A;  2BFR A;  2JZD A;  1BPM A;  1YD9 A;  4J4Z A;  5FSZ A;  1TY8 A;  4ZY0 A;  4ZX8 A;  3EWO A;  3GPO A;  2JZE A;  5CB5 A;  1ZR5 A;  1HJZ A;  1LAP A;  5DUS A;  4IQY A;  3JZT A;  1LAN A;  2ACF A;  4ZY2 A;  5FSY A;  3EWP A;  3SII A;  2DX6 A;  4ETK A;  3KZW A;  2AFC A;  4JCA A;  3SIG A;  4GUA A;  3H8G A;  2LGR A;  3Q71 A;  4JLL A;  5HOL A;  4KSI A;  2EEE A;  4ZY1 A;  3IJ3 A;  4R76 A;  2JZF A;  2VRI A;  3IID A;  4ZI6 A;  4GVV A;  3VFQ A;  1TXZ A;  1NJR A;  3T8W A;  4D86 A;  3SIH A;  4R7M A;  5FSX A;  2J9A A;  4J5R A;  2L8R A;  2WCT A;  4ETJ A;  2W2G A;  1VHU A;  4KYB A;  3H8F A;  1GYT A;  2EWB A;  3EWR A;  4UML A;  2FAV A;  5D8N A;  5CB3 A;  3GQO A;  3EKE A;  4ABK A;  2FXK A;  4J5S A;  2X47 A;  2BFQ A;  3GPG A;  4X2T A;  5HIH A;  3GQE A;  3KR5 A;  1BLL E;  1ZR3 A;  3EJF A;  3IIF A;  5CMS A;  4K0C A;  3EWQ A;  5FSU A;  3EJG A;  3V2B A; 
#chains in the Genus database with same CATH homology
 3ETI A;  3EW5 A;  1BPN A;  2FG1 A;  4GVW A;  4R6T A;  5AIL A;  4JGK A;  1LCP A;  4ABL A;  1SPV A;  1LAM A;  3Q6Z A;  3KQX A;  3JRU A;  4K3N A;  5CBM A;  4J5Q A;  4TU0 A;  4ZX9 A;  3KR4 A;  5FSV A;  5E3B A;  3GPQ A;  4ESS A;  2XD7 A;  3V45 A;  3H8E A;  3SIJ A;  3KQZ A;  3PEI A;  4JVV A;  4ZYQ A;  2BFR A;  1BPM A;  1YD9 A;  4J4Z A;  5FSZ A;  1TY8 A;  4ZY0 A;  4ZX8 A;  3EWO A;  3GPO A;  5CB5 A;  1ZR5 A;  1HJZ A;  1LAP A;  5DUS A;  4IQY A;  3JZT A;  1LAN A;  2ACF A;  4ZY2 A;  5FSY A;  3EWP A;  3SII A;  2DX6 A;  4ETK A;  3KZW A;  2AFC A;  4JCA A;  3SIG A;  4GUA A;  3H8G A;  2LGR A;  3Q71 A;  4JLL A;  5HOL A;  4KSI A;  2EEE A;  4ZY1 A;  3IJ3 A;  4R76 A;  4ZI6 A;  2VRI A;  3IID A;  4GVV A;  3VFQ A;  1TXZ A;  1NJR A;  3T8W A;  4D86 A;  3SIH A;  4R7M A;  5FSX A;  2J9A A;  4J5R A;  2L8R A;  4ETJ A;  1VHU A;  4KYB A;  3H8F A;  1GYT A;  2EWB A;  3EWR A;  4UML A;  2FAV A;  5D8N A;  5CB3 A;  3GQO A;  3EKE A;  4ABK A;  2FXK A;  4J5S A;  2X47 A;  2BFQ A;  3GPG A;  4X2T A;  5HIH A;  3GQE A;  3KR5 A;  1BLL E;  1ZR3 A;  3EJF A;  3IIF A;  5CMS A;  4K0C A;  3EWQ A;  5FSU A;  3EJG A;  3V2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...