3VFZA

Crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
DSVTRMNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mycobacterium tuberculosis RsdA provides a conformational rationale for selective regulation of sigma-factor activity by proteolysis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable RNA polymerase sigma-D factor
total genus 21
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vfzA00
3KEOA 2LDUA 3BOQA 2IA0A 2OZ6A 1XB4A 5DYMA 1HKTA 1MJBA 5IT3A 5ED4A 3H3ZA 1K78A 2P7VB 1PP7U 1BC7C 4JK1X 3NEUA 3E3VA 3F8FA 2XASA 2VBWA 3FMSA 3GFJA 3NRVA 3VFZA 1R5GA 3LAPA 4LMYA 5E18F 4FHTA 3TOBA 5LLQA 4RB0A 3N97A 6PAXA 4G9YA 1ZGJA 3MAJA 2HOEA 1R36A 4NQWA 3I59A 3RTRA 4OU0A 2RC4A 1U8RA 2EFQA 5FFXA 5A2QZ 2VC1A 1HW2A 5A2QK 4ASNA 1ON1A 2IVMA 2M30A 2XGXA 4BHCA 3QP6A 1IZ1A 5HDGA 3WTUC 2H6BA 2HKXA 4B09A 4F7ZA 2IP2A 2P5LC 4A5NA 3MWMA 5LEKA 1HBXG 2IPQX 3HHGA 2MC3A 3HRMA 4EJTA 2DAOA 1W5SA 1WQ2A 2G7UA 4KIGA 4BXUA 4RB2C 2QYOA 2ZO4A 2XV4S 5K5OA 2DPDA 2IW5A 4HF0A 4KFCA 1O3SA 4HLXA 3WU1B 1ONVA 4GYIA 5F1RA 2HGCA 4CGZA 1B9MA 2XVCA 5IT9K 1F5TA 2DBBA 3KE2A 1FWZA 1O57A 4OIRF 5J8FA 2VN2A 2ADUA 5D6FA 1S29A 4AVPA 4ENJA 5HVQC 1QZYA 3RJPA 3ULQB 4RAZA 3D5LA 2EV6A 5HS7A 5BPIA 2D1VA 1XMKA 1A04A 1G4DA 1SAXA 3BDDA 1G6NA 2W25A 5DV5A 2ISZA 2BEOA 4HQEA 2NRAC 1P6RA 4L0YB 1P2FA 1YS6A 3LA2A 4LG0B 1IXRC 2P4WA 1OPCA 3ROUA 2L02A 2NYXA 2MD5A 4WK8F 3P9IA 4P96A 1J59A 1ZLJA 3CUQA 4HA8A 3T8TA 1QBJA 3BPXA 3M9AA 2DQRA 1BIBA 1O7FA 3WG9A 4GCVA 3GFMA 3K1NA 3HOSA 5LHHA 5CYVA 1SD6A 1UFMA 1OYWA 4GO1A 5LEJA 1G3WA 5DUKA 5HOOA 4MQVA 2HTJA 5LHGA 5FO5A 1W7PD 3W6KB 4ENMA 3MFKA 3U2RA 5CVIA 2DK8A 2ETHA 1ZGAA 2RGVA 5FD6A 1XGSA 1T6SA 5L3GA 3WE2A 1YW8A 2H94A 5HDKA 4KDPA 2AXLA 5L3FA 4HX8A 4KIFA 3KP4A 3IC7A 1AWCA 4LLNA 1NHAA 1SD5A 3EUHA 3FXRA 2HYFA 2XAQA 1O3QA 2OD5A 5DEQA 4KN7X 1QPMA 4CYDA 2HQRA 4HZFA 2ZCWA 2UXXA 3Q5FA 1C0WA 4Q48A 3WTXC 2L3DA 4UHTA 4I02A 2FA5A 5E1WA 2JTVA 3E5UA 4L5JA 4IVNA 1I1GA 1XSVA 1IRGA 1TQIA 1D8JA 1YTYA 1YLFA 2FNAA 5L3BA 2V6CA 3FZVA 1EH8A 3ABUA 2H09A 4HQMA 2KRFA 4HDUA 3R4KA 1JHHA 2RVCA 1K7AA 4HYEA 4XSZF 3ERED 1T38A 3GLXA 2IJLA 1Z7UA 1BN5A 1E17A 1U2WA 2ZBKA 5L3DA 2PLYA 2QBYB 2V1XA 2R7DA 4BH9A 1MKMA 4Q47A 4MQ9F 5FLXK 2STTA 1BJAA 3K9TA 2OQRA 1W5TA 2VE8A 3WGHA 4AIHA 1XDSA 2O03A 4LD5A 2V9VA 4O5VA 4GGGA 3BJOA 3EYIA 2HR3A 5ILVA 1FBSA 3ZMZA 4E70A 3SFZA 1S8NA 1WKMA 3ZN1A 2DI3A 5D6EA 2RN7A 3I54A 4CICA 2ZKZA 3RIRA 2R7FA 1BC8C 4HV5A 1RIOH 2W24A 1REPC 3SXYA 3BY6A 1ZG5A 2F5CA 1TNTA 3KP5A 3S2WA 3JSOA 4HF2A 4FX4A 1ZHFA 3GZ6A 4EGZA 4WXCA 3F6VA 4GYGA 2BBYA 3HSEA 4U88A 1TW2A 5JVTA 2PEXA 4M9XA 3HRSA 4YG2F 1K6OA 1KYZA 2LF8A 1XGNA 2HKOA 2LF7A 2YPRA 2M5WA 1XN7A 4BNCA 2PMHA 3DF8A 3K69A 4KMFA 2L4MA 1Q1HA 4WXHA 3SZTA 1RZ4A 2H6CA 2STWA 5CLSA 3T0YA 3JAMZ 2IA2A 3IKVA 4P9UA 2F2EA 2XAFA 5BS6A 3L7WA 4G8XA 1QZZA 1R22A 3F23A 3L2CA 4IRGA 3GUDA 5DCMB 2FRHA 5CVUA 4OINF 3CLOA 3OOPA 2EFWA 2ZNYA 3WODF 1MJ9A 2VT2A 1J0RA 2YU3A 2VBYA 3BROA 5E1ZB 3WTSC 5IT9Z 2EFNA 5L3EA 1FT9A 4KICA 3ZMUA 3K2ZA 2FBHA 2ESHA 1FX7A 3O2PE 3GVAA 2L54A 1U78A 5HS9A 1WWXA 2Q0OA 3KETA 2XIGA 4EVIA 3E6MA 2YX7A 3I71A 4L5IA 2CQKA 1LEBA 2WWYA 5D5UB 3FHZA 4NHJA 4U7BA 2VODA 4I2OA 3K0LA 1RNLA 2VOPA 3DPLC 4WWCA 3LSTA 2DPUA 1FNNA 2P8TA 4L9TA 4CXFA 4P9FA 2BGCA 1MGTA 2FU4A 4Y15A 4UV8A 2DTRA 2O8XA 1BI0A 3KCCA 1FP1D 4MGRA 1PP8F 1J5YA 1Z1DA 2COMA 4N9HA 1FSHA 2LSOA 4IJAA 1YIOA 3EQLF 1FYMA 3HYIA 1EH6A 4EJVA 1IXSB 3JW4A 3M8FA 1EH7A 4I01A 3ZMTA 2BV6A 1TBXA 5D8KB 4PGHA 4I0BA 5D4SA 4YIFA 1MZBA 2GZWA 4KN4X 4M72A 5LGTA 4G7OF 1KA8A 1X3UA 4WCGA 4L9JA 4EGYA 2FSWA 2QLZA 2UXNA 5ERIA 1BOAA 2QVOA 4HBLA 3WTVC 5D8LB 5E20A 4ZYDA 5CVRA 3V4GA 3KZZA 2A69F 4IXAA 5E8GA 1TNSA 4EM1A 3GEZA 2RNJA 5JI6A 1J75A 1RUNA 2GA2A 2XAHA 3R61A 3WU0A 5KVRA 3GFIA 1R7JA 2MA3A 2FMLA 1H0MA 1YS7A 3E97A 2VXZA 4G94A 4H0EA 3QU6A 1LDKB 2IA1A 3TO7A 2FXAA 1ZREA 1FP2A 1RUOA 1BBYA 1T0FA 3QPHA 3Q9SA 4UUVA 2RQPA 4AIJA 3E6CC 2K86A 2MH2A 3IRQA 2UZKA 3V8KA 4KUMA 5E17F 1PUEE 3I59B 3E5XA 4P5OA 1H9TA 3R6SA 4ZYEA 3WTTC 3G3ZA 5KK1A 3Q9VA 3RKWA 2MLGA 1JE8A 3MQ0A 3QU3A 2X4HA 2P7CB 4MEXF 1XDUA 5K5RA 4LK0F 1W7PB 1HKQA 1XGMA 4L9NA 2W57A 3JAMK 3KZYA 2FOKA 1F9NA 4UNOA 1G3TA 4M6YA 3RKXA 3RI4A 4MEYF 4IPAA 4M71A 1ZRDA 4G7HF 4HX7A 3KEQA 5ILSA 1MDMA 3I5UA 3V7RA 2G7HA 1WI9A 4MTDA 3LA7A 1XCVA 4RGRA 4CZZA 1OKRA 3QPTA 4TV7A 3FF5A 3LQQA 1SMTA 4DNCA 1T39A 1IN5A 1IW7F 1Z9CA 2QBYA 4EJOA 3TOAA 4G7ZF 2HQNA 3MCZA 4PDKA 3TKYA 1ZAOA 3GYHX 1KU3A 3PQJA 1Y0UA 3M8EA 1L3LA 3CDHA 2HTSA 4KYWA 2HFHA 1ZLKA 1CGPA 5AIPA 5H6QA 3WE3A 4B8XA 4EM0B 5BMZA 2FE3A 3F6OA 5E8IA 1DPUA 3QAHA 3U9GA 1JGSA 4AD9A 2ZNZA 2XHKA 1FBUA 3E6BA 3RYRA 2V79A 1GXQA 1ON2A 4LJZF 3HTSB 2A3SA 1V4RA 2ZFWA 5HDNA 1USTA 5CVJA 1IAWA 4HAMA 2FNPA 1HW5A 3KFWX 1DUXC 2PJPA 2A6HF 5HLGA 3WGIA 4YIIA 3J80Z 1LJ9A 3EYYA 2DW4A 1AOYA 4LLLA 3F3XA 3LQRA 2DLLA 1E2XA 1F4KA 3LAJA 4G6DA 4HX4A 4ESBA 2E7WA 3J7AO 5D4RA 2JT1A 1K79A 1B6AA 2DT5A 5AONA 2DQLA 1U6GA 1HSJA 3V7CA 3DQVC 2DK5A 1ZG3A 3F21A 3CUQB 2E7XA 4XBFA 4I0AA 3B73A 4PCQA 5TRDA 4AIKA 1J2XA 5JFRA 5LHIA 3TDZC 3L00A 1OMIA 3T5XA 4JQFA 3BPVA 2DU9A 2D2WA 2P6SA 1FC3A 3V7SA 1BM9A 2B0LA 3V8JA 3M1EA 4ZZLA 5JR3A 2TDXA 1D3YA 2CW0F 3WTWC 1TQMA 4EJUA 2JPBA 1YFHA 4ZZDA 1R1VA 1QQIA 1FZPB 2ZJ2A 4LFUA 5LRRA 5ICFA 3DFGA 3P9CA 3F8NA 2XROA 2EFPA 1YQAA 1B59A 3ECOA 4HOBA 1JXSA 2WV0A 1GXPA 4M73A 3QRFF 2Z3YA 4ESJA 2AS5F 3GW2A 2FMYA 3JTGA 2PBIA 3KLNA 3P9KA 1XGOA 1GHCA 2HWVA 1DDNA 3LWFA 3SZPA 1LEAA 2GIVA 2KIFA 4LLGF 2NS0A 3GXOA 3N4MA 3T8RA 4A0XA 1CF7A 1FYKA 1KGSA 4R1HA 2HEOA 4M9ZA 4BYYA 3I53A 1ZRCA 4KA4A 2CYYA 4RB1A 3KP7A 4IRIA 2F5DA 1J9IA 3U1DA 1BI1A 3IL2A 2NNYA 3VEPA 2F5FA 3PQKA 2XRNA 5JHUA 4Q4ZF 4M9SA 4I09A 2FQ3A 1SD7A 3RPQA 1FLIA 2Q2EA 3GX4X 4KT5C 1LB2A 3F72A 1SFXA 4RGSA 4O6JA 4NB5A 1IUYA 5ILUA 3ZPLA 2MBFA 3ABTA 2OAZA 1IN6A 4IHSA 4ENNA 1FBQA 2NAZA 4QLCU 4OMZA 2XKPA 1I1SA 1S6LA 3NQOA 2RV8A 4BAYA 1V3FA 3O3KA 2CFXA 3J81Z 3M7GA 3CUQC 2WTEA 4I98B 2M45A 3I4PA 2FEZA 1I6XA 3I64A 1HSTA 3HRTA 3K1MA 2YR2A 4BHBA 2JPCA 5D5XB 4PGGA 2P5VA 1F1ZA 3QOPA 2YSRA 4RGXA 2Z99A 3C18A 1IN8A 5H20A 5ICGA 2V1DA 2K4JA 3GWZA 3K1PA 2GAUA 5CJ9A 1YW7A 4YFNF 1TQPA 4DQ2A 4KMUX 2VBXA 2W84A 2HYGD 2GQQA 3VODA 1YW9A 2VOOA 3VOEA 2ESNA 1IN7A 1B9NA 5DUIA 3L9FA 1L0OC 4Z2YA 3EETA 3T1BA 5EEGA 1MJAA 1ZYRF 4UV9A 5BQTA 2OU2A 1ZG1A 1Z6TA 1S7OA 4OIOF 2P6TA 4IF4A 1G3YA 4Y17A 3V8LA 2YX4A 1KQ0A 1VTNC 1QO0D 5F64A 3GF2A 2UWMA 2ZMEB 4EQQA 2NNNA 3FX3A 2ELHA 1P4WA 3LFKA 4EM2A 3HRUA 2A6EF 3BWGA 4A6EA 2DFIA 1IF1A 1Z05A 1G3SA 1HXDA 5DDGA 4N0BA 2EA4A 2IT0A 3DKWA 2PFBA 4WX9A 4ON0A 2Z9OA 3COAC 1KQ8A 1B1BA 4IHTA 4R8HA 2QUFA 4A5MA 5J6XA 1R1UA 3QP5A 3ZMDA 3KLOA 2Q8KA 1FPQA 3CTAA 1SD4A 1O7LA 2CG4A 2W85A 3IWFA 3W6JB 3TQNA 5DCMA 3WTYC 4A12A 4BHPA 1Z6RA 2CGPA 2LKPA 4AWXB 1SFUA 4XSXF 3CO7C 2K7LA 1BI3A 2Z5UA 4RAYA 2O3FA 1SFEA 4XRFA 1HW1A 1XSXA 1RI7A 3R60A 2EWNA 1ZARA 2HZTA 3B02A 1IN4A 5DD4A 2MLKA 3CUOA 3DEUA 4O3MA 2A5YB 5K1YA 3MZHA 4UVBA 4MHGA 2C6YA 2O6GE 3SQNA 2O61A 3KP3A 3WGGA 3SHFA 1TW3A 4MTEA 5L3CA 1D8KA 2QM3A 4HV6A 2VT3A 1LQ1A 1YYVA 1K78B 1OR7A 4GXOA 3F22A 4WXDA 5ICCA 4HF1A 2K4BA 2MH9A 1FYLA 1ULYA 1U5TB 4P55A 2K27A 3H3UA 2EA2A 4U7DA 1I27A 2GXGA 4PZJA 1KYWA 4LK1F 1D5VA 3FM5A 5FFZA 5FGMA 1ZH5A 3CJNA 3C7JA 5FB2A 2Z33A 3CO6C 4ENKA 2CO5A 2EK5A 4XLNF 3IHUA 4ZH4F 2OA4A 4Y13A 1LDJA 3HSFA 1R58A 2QQBA 4MNUA 1GVJA 2CSOA 3RYPA 2VE9A 1LVAA 2M1BA 3E6DA 3I58A 4I7HA 4OIQF 2KIMA 2L4AA 5E1XA 3TO6A 1FSEA 3IKTA 1HKSA 3I0TA 1R1TA 4LB6B 1P92A 2Y48A 2HS5A 4CO8A 4JBAA 4L9VA 4LB5A 4RS8A 4CDGA 2M8EA 5DD8A 1LNWA 5D5WB 3BJAA 4A0ZA 2PMUA 2KKOA 4IRHA 3TDUC 3P7NA 2LNBA 4UXNA 2RDPA 2M87A 3G73A 1W4MA 3ECHA 1KQ9A 4K2EA 4WF2A 2J5PA 1P4AA 1EV7A 2HDCA 2JZYA 2XKOA 5HLHA 4UVAA 4EV0A 1UB9A 2A68F 4XLPF 1OYIA 1W7PA 1T98A 1KU2A 1QNTA 3ELKA 4EMSA 3AAFA 2WC2A 1MD0A 4U0WA 1JHFA 3ZP5A 2VBZA 3ML6A 3DP7A 1OYYA 5LRSA 2R3SA 5H6RA 2J5OA 5TJJA 3R0AA 1S3JA 4KNYA 2QQ9A 2Y75A 1U3EM 4KIBA 3HHHA 2DO7A 1R5HA 3R0JA 1BIAA 2E1CA 2FBIA 4RB3C 3D0SA 1XD7A 2ZXJA 4N9IA 3ZN0A 4OMYA 2H27A 2V1UA 1XSDA 3RKYA 1LDDA 3KP2A 2A61A 3WTZA 2BYVE 4R79A 3FMQA 2EV0A 3RPUA 4LG0A 4ZYHA 2CWEA 4HDVA 1ODDA 3IWZA 3TO9A 1UHWA 4ZYGA 2PG4A 4UVCA 4ETSA 4BQAA 4OOIA 3J81K 4L18B 4S04A 2EFOA 4G6QA 3JTHA 3FXUA 4M6XA 1FY7A 1I5ZA 2KIUA 1HQCA 2GA1A 1P4XA 2O0YA 2JSCA 1J7KA 5D5VB 1Z91A 2PQ8A 5HLIA 5LBQA 3OV8A 4Q5SF 5CVVA 4HLYA 1PDNC 1KU7A 3J80K 5F6FA 5K5QA 1WSUA 3FMRA 4LGWA 1U5TA 3BZ6A 4U0VA 2EB7A 5LGNA 1QGPA 1O3TA 3F8MA 4FT8A 1UCRA 2L01A 4YFKF 1STZA 3LA3A 3HSRA 4U0YA 4M74A 2ISYA 5BOXA 3BJ6A 3EDPA 3ZMVA 3TGNA 4A0YA 5BPDA 3VB2A 5FD5A 2BE5F 4FX0A 2KJCA 2QQAA 2ACJA 2OQGA 1XCBA 2VONA 1WRJA 1UHMA 3ZQ7A 3PFIA 4QWQA 2G9WA 1SMYF 1KU9A 2FF4A 3O6BB 5ICEA 3F8CA 2EJRA 3ISPA 3GO5A 4S05A 2A07F 1XMAA 3HUGA 3DXJF 3F8BA 3IRRA 3FXQA 1R23A 3ZMSA 3FM3A 1BI2A 1YG2A 3HOTA 2VC0A 3C1DA 1TLHB 4RGUA 2K02A 1DPRA 1IRFA 3REOA 3C3WA 4OIPF 1B4AA 1TTYA 5LGUA 1DP7P 4EJWA 2XAJA 3HTUA 1FOKA 2X0LA 5J8CA 2E1NA 3GZ5A 3E5QA 3DPTA 5HS8A 4CHUA 5EEHA 3L09A 2GXBA 3MZYA 3GFLA 2D1HA 1ZRFA 1IXCA 3FWEA 3JSPA 1CF7B 2QWWA 4A2UA 2RKHA 1ZN2A 4D0PA 3BP8A 2XAGA 1H9GA 4HW0A 1S7AA 2IRFG 2PN6A 4YFXF 4L0ZB 3H92A 3RDIA 2OBPA 2D45A 2EV5A 1USSA 2JRTA 2KJBA 2P5KA 3MEXA 1T2KA 3DV8A 5FLXZ 5AIQA 5DCFA 4ESFA 2ZMEA 1YO5C 2XUBA 2QENA 2OZUA 1MDMB 2GWRA 3KP6A 4A6DA 1O3RA 2F5EA 2QZ8A 2PI0A 2FBKA 1U5TC 3HIFA 1R00A 2Y0MA
chains in the Genus database with same CATH superfamily
3KEOA 4D1QA 2LDUA 3BOQA 2IA0A 3ESWB 4M3DA 2IBDA 3HL2A 2OZ6A 1XB4A 2L9SA 5DYMA 1HKTA 4DBRA 3SDGA 1MJBA 5IT3A 3CD6I 1UG2A 3I56I 3MN2A 5ED4A 5FKNA 2DYSH 3H3ZA 1K78A 2GBYA 1I39A 3VYSB 2P7VB 1PP7U 1BC7C 4JK1X 3NEUA 4L5EA 4Y7NJ 3E3VA 2V26A 3F8FA 2XASA 2XSDC 1Y6IA 3JRFA 2O8KA 2VBWA 3FMSA 2HVQA 1OCZH 1ZK8A 3GFJA 1QRYA 1R5GA 3NRVA 3VFZA 3LAPA 3L2VA 2DODA 4LMYA 5E18F 4FHTA 3TOBA 3U1KA 1VZ0A 4RB0A 5LLQA 3N97A 6PAXA 2AHQA 3QQAA 4G9YA 1ZGJA 5M3FJ 3MAJA 4C3HJ 2WAEA 1LPQA 2HOEA 1R36A 4NQWA 3G1OA 3I59A 3ZQIA 1SANA 3RTRA 2KRHA 2BY2A 2XGDA 4OU0A 3RQIA 1WJFA 1BW6A 2RC4A 2ID6A 4FETA 2VKDA 4NUBA 5FKLA 3FXKA 2XF5A 1U8RA 2EFQA 5FFXA 5A2QZ 1Z0XA 3J7YJ 2VC1A 1HW2A 5M5YJ 5A2QK 3HG9A 4ASNA 4S0HB 3S1QJ 1ON1A 1OLTA 2IVMA 2M30A 1G8XA 2XGXA 1R5ID 4BHCA 3QP6A 4BACA 1IZ1A 5HDGA 3WTUC 3HOXJ 2H6BA 5KAFC 3OSGA 1KZHA 1NH3A 2HKXA 4B09A 4DYRA 4F7ZA 2ELKA 2IP2A 2P5LC 1S9HA 4I76A 4A5NA 3MWMA 2B7EA 5LEKA 1HBXG 2IPQX 3HHGA 2ID3A 1IJWC 2G0EA 2MC3A 2KLOA 3U21A 2XAUA 1I6HJ 3HRMA 1JUMA 4EJTA 2DAOA 1W5SA 1WQ2A 1SAUA 2TCTA 1MH3A 2G7UA 4KIGA 4BXUA 4RB2C 2QYOA 2ZO4A 3BT9A 2XV4S 2RAEA 3DU6A 5K5OA 2DPDA 2IW5A 4RAGA 4A3FJ 3LSRA 2VQHA 2K5CA 1JKPC 4HF0A 4EEFG 1MBJA 4KFCA 2N8GA 1O3SA 2F6CA 4HLXA 3ZQCA 4N4NB 3CCYA 2DYRH 2JK3A 2OUMA 3WU1B 3SZGA 2E34A 1ONVA 4GYIA 4DZPA 4J19A 1UG0A 5F1RA 1MBEA 1ZTRA 3G1MA 2CQNA 4D7NA 2HGCA 2OPTA 1B9MA 3CDLA 4CGZA 2XVCA 3TBIA 2K85A 5IT9K 4D5FA 2ECCA 1F5TA 2DBBA 4BEHB 3KE2A 1FWZA 2QEXI 2R7XA 1O57A 4OIRF 5J8FA 3DWLE 3ZQQA 2VN2A 3Q0UA 3O8GA 3L2RA 1JT0A 3I4MJ 2ADUA 5D6FA 1S29A 2ME6A 2HU9A 4AVPA 4ENJA 5HVQC 1QZYA 3RJPA 2MC4A 1P9QC 3ULQB 4RAZA 3D5LA 4PK4A 2EV6A 5HS7A 1LUJB 3DEWA 1BL0A 5HNHA 5HLTA 5F0CA 5BPIA 2D1VA 4F93B 1XMKA 1A04A 4E7ZA 1G4DA 1SAXA 2UV1A 3BDDA 2R5YA 1G6NA 2W25A 2M9HA 5DV5A 2ISZA 2BEOA 1MMAA 4HQEA 2NRAC 2NOGA 2L7ZA 1P6RA 4C2TA 4L0YB 1P2FA 1YS6A 2HPIA 2DFEA 3LA2A 3HJEA 4LG0B 2EQRA 5J1YA 3HPGA 1W0UA 1RKTA 1IXRC 2F4OB 2P4WA 1AU7A 1OPCA 3ROUA 2L02A 2NYXA 1VQ7I 3V42A 2MD5A 4WK8F 3P9IA 4P96A 1J59A 1TC3C 2COBA 1ZLJA 3CUQA 4HA8A 5B1AH 3DTIA 3T8TA 1QBJA 3JRDA 2DMNA 3S1RJ 2R7ZJ 3BPXA 3LMMA 1YHQI 2IS2A 2L9VA 3M9AA 2DQRA 5E79C 3SDBA 3A02A 1BIBA 1JTXA 2GIZA 3OYNA 4XRSG 3BG7A 1O7FA 3WG9A 4GCVA 3GFMA 3K1NA 3HOSA 3LSGA 5LHHA 5CYVA 1SD6A 1UFMA 1OYWA 1MW7A 4GO1A 5FLMJ 5LEJA 1G3WA 5DUKA 5HOOA 5IY5H 4MQVA 5EEAA 2HTJA 4AYBA 5LHGA 2KP6A 2QKLB 5FO5A 1W7PD 3W6KB 4E6KG 1RKWA 4FCYA 3GLLA 4ENMA 2CUEA 1VQOI 3MFKA 2OCEA 3U2RA 5CVIA 2DK8A 4XKCA 2ETHA 3S1MJ 1ZGAA 2JJ7A 2RGVA 1SFOJ 5FD6A 1XGSA 1T6SA 5B3SH 5L3GA 1DU0A 1HCRA 2XB0X 1RPWA 4BJ6C 3WE2A 3GTLJ 1YW8A 1WJ5A 2H94A 5HDKA 4KDPA 2AXLA 4CCOA 3FK7A 1U9NA 4A3JJ 5L3FA 1JJ6C 1MMSA 3I55I 4HX8A 1VQ9I 3A01A 2BHYA 4KIFA 3KP4A 3IC7A 1AWCA 2EIMH 4LLNA 1NHAA 1SD5A 3EUHA 3MZ8A 3FXRA 2HYFA 4I99C 1UJ8A 2WV1A 2XAQA 1O3QA 2OD5A 5DEQA 4KN7X 3OYHA 4ZDLA 1QPMA 3FXJA 4CYDA 2HQRA 4HZFA 1X19A 2ZCWA 4CSWA 2HI3A 2UXXA 3I3LA 3UKGA 3Q5FA 1C0WA 4Q48A 3WTXC 1VQKI 2L3DA 2PMZA 4UHTA 4I02A 1J09A 2FA5A 2JTVA 2VKVA 4JYKA 4LIVA 5E1WA 2GM4A 2W48A 3E5UA 4L5JA 4IVNA 4B47A 1I1GA 1XSVA 4PJ0C 3S3MA 1IRGA 1TQIA 1XG1A 3P5JA 1AKHB 1D8JA 2FOWA 2HXIA 3WG7H 1WFXA 2ZSHB 1YTYA 2DA7A 2FNAA 1YLFA 1I3QJ 2EZIA 1ETKA 2L2OA 5L3BA 2V6CA 3FZVA 3BG9A 1EH8A 3K10A 4NBQA 4A69C 2AQEA 2H8WA 3ABUA 2H09A 4XKBA 4HQMA 3AFHA 2KRFA 4HDUA 3BTLA 3R4KA 1MNEA 1RETA 4E7IA 2IS4A 3ZCOA 1JHHA 1JI8A 1Y39A 2RVCA 3M07A 4G6TB 4HNTA 1K7AA 4HYEA 3S32A 4XSZF 4RLFA 3ERED 2MFZA 1T38A 1ORKA 3GLXA 3JR9A 2IJLA 1VQMI 1Z7UA 4NQWB 2HVRA 1BN5A 1E17A 1U2WA 3HOUJ 3ZQHA 4II2A 1MNDA 1VI0A 2ZBKA 5L3DA 3E0JB 2PLYA 2QBYB 3PO3J 2V1XA 3HEFA 2R7DA 4XR6A 4BH9A 2MD0A 3ASNH 4A3KJ 1TL8A 1MKMA 4V19K 2NS7A 4Q47A 4MQ9F 4XN3A 5FLXK 2DMTA 2STTA 1BJAA 3K9TA 2OQRA 1W5TA 2VE8A 3WGHA 4AIHA 4PSXA 1XDSA 2O03A 4LD5A 5IYCJ 2V9VA 1RC9A 3S14J 4O5VA 2VQLA 1WH7A 4GGGA 3BJOA 3EYIA 2HOAA 3KYCB 4HEA2 2HR3A 5ILVA 1FBSA 4LG3A 3ZMZA 3BQYA 4CCKA 1XC5A 4E70A 3SFZA 1TWCJ 1UZCA 1S8NA 1WKMA 3ZN1A 2DI3A 3WHBA 5D6EA 2RN7A 3A0HC 4BQNA 4RBOA 1EJ9A 3I54A 3VYTB 4CCJA 1VQ8I 4CICA 3DTKA 2ZKZA 4RLQA 2R7FA 3RIRA 2I10A 4UB8C 2AXTC 1BC8C 5J3LA 5E3LA 5EF6A 1E0EA 4HV5A 1RIOH 2LR8A 2W24A 1REPC 3SXYA 1FIAA 2VB6A 3BY6A 5GTIC 5CQEA 1OCOH 1ZG5A 3DTEA 1APLC 2M0MA 1MIJA 2F5CA 1GVDA 1TNTA 3KP5A 3S2WA 2LD5A 1N25A 3JSOA 3W2VA 5F27A 5FLVA 1GUUA 2HQAA 2R93J 4HF2A 4FX4A 1ZHFA 3GZ6A 5IYBJ 4EGZA 4WXCA 1IG7A 2BXZA 3F6VA 4GYGA 3HB9A 5EYRA 2BBYA 2LVSA 1ERDA 2Q1ZB 3HSEA 4U88A 4IL6C 2F5VA 1TW2A 4II3A 3G1LA 5JVTA 3QYEA 2PEXA 2W00A 3ZXSA 2NVTJ 2IGNA 4M9XA 3HRSA 4YG2F 1K6OA 1KYZA 2LF8A 1XGNA 2HKOA 2LF7A 2YPRA 3I9V2 2M5WA 1TWFJ 1QHGA 2EH3A 1XN7A 2P0WA 4BNCA 2PMHA 3DF8A 2EZHA 3K69A 4KMFA 2L4MA 3H5RA 4C9YA 1Q1HA 1D1BA 4WXHA 3SZTA 1RZ4A 2H6CA 2MW8A 2TRTA 1WGXA 5CLSA 3T0YA 2R5YB 2STWA 3JAMZ 2IA2A 4XLHA 2D5VA 1WJAA 3IKVA 2BW3A 2R7VA 3JRCA 1D5YA 2HDDA 3GTPJ 4P9UA 3NAUA 2W1OA 3DU5A 2F2EA 2XAFA 5BS6A 3L7WA 2DJIA 3VYUB 3K4BA 3ZR8X 4G8XA 1VQ6I 1QZZA 1R22A 2V1NA 3F23A 4XRSA 3EPZA 4IRGA 3L2CA 2QA4I 3GUDA 3SJMA 3PL8A 5DCMB 3JREA 2FRHA 4HNUA 1HLVA 4IQ4A 5CVUA 4OINF 4KITB 3O8HA 3CLOA 3OOPA 3HDDA 2EFWA 2ZNYA 3WODF 1MJ9A 3LSHA 4QSHA 2VT2A 3HC7A 5EGOB 1J0RA 1ITYA 2YU3A 4BE0A 2VBYA 3F0CA 2QSHX 2CUZA 3BROA 3HKZN 2QQ8A 3S3OA 5E1ZB 1Z21A 4I6ZA 4XLEA 3WTSC 2M34A 5IT9Z 2EFNA 5L3EA 1FT9A 4KICA 3HPHA 3ZMUA 4BBRJ 3OYFA 3K2ZA 2CW7A 2FBHA 2ESHA 4XQFA 1FX7A 2BW3B 4IHYA 3VYRB 3O2PE 5IOZA 3GVAA 2L54A 1T0FC 2K40A 2JA2A 1U78A 5HS9A 1WWXA 2Q0OA 3CJQB 2XIGA 4EVIA 1ETQA 5FJ8J 3KETA 1ZGWA 4RM2A 5IYDJ 3E6MA 2YX7A 2FX0A 5H2FC 3I71A 2HPMA 2LOOA 4L5IA 2CQKA 1AKHA 1JKQC 1LEBA 2WWYA 5D5UB 3FHZA 1VNDA 4BBSJ 2BVLA 2CUJA 1UAAA 4Y4RA 4NHJA 1NTCA 4U7BA 3LSPA 3LSIA 4HSRA 2VODA 4I2OA 3K0LA 1RNLA 3H9JA 2VOPA 4MO7A 3K4CA 1ETXA 3DPLC 4WWCA 4XL9A 1V55H 4V2FA 3LSTA 2K3PA 2DPUA 2H1LA 3KEYA 3RZDJ 1FNNA 1LFUP 4E7LA 2ZJQF 2P8TA 1YJWI 2PJRB 4L9TA 3OYCA 1W36D 4CXFA 4OAYA 2BGCA 4P9FA 3Q3SA 1MGTA 2FU4A 4Y15A 4UV8A 2DTRA 3DKXA 4PJLA 1IC8A 2O8XA 4D5CA 3RPUD 4BDZA 2KRCA 3CF5F 1BI0A 3KCCA 1FP1D 4MGRA 1PP8F 1J5YA 1Z1DA 2COMA 4N9HA 1FSHA 2LSOA 4IJAA 1YIOA 3EQLF 1FYMA 3HYIA 3HXLA 1EH6A 1WVRA 4GDFA 2JVHA 4EJVA 1IXSB 1GV5A 3JW4A 2K3FA 3M8FA 1EH7A 3H9QA 3BG6A 4PSWA 4I01A 3ZMTA 1HDPA 2BV6A 1TBXA 1ETWA 5D8KB 4PGHA 4I0BA 5D4SA 4A3LJ 4YIFA 1A36A 1MZBA 4RDUA 2GZWA 1OCTC 3N05A 1X3WB 4KN4X 4M72A 5LGTA 1K61A 1A31A 3HZJA 2VJJA 4G7OF 1KA8A 2QKMB 1E3PA 1IRZA 1H89C 2R92J 1P7IA 1BR4A 2E35A 3ABKH 1X3UA 2LMDA 3A4CA 4WCGA 1UHSA 3OYIA 3W6VA 1I3AA 3LSMA 4L9JA 4B3XA 4CYCB 2VPRA 2X48A 4EGYA 5IPAA 2FSWA 1D0XA 2QLZA 1E3OC 3CCQI 2UXNA 2L7FP 5ERIA 2BXYA 2LBFB 4DIQA 3MKZA 4BDYA 1BOAA 3BZKA 2QVOA 4HBLA 3WTVC 2LRDA 5D8LB 5E20A 4ZYDA 2M0CA 5CVRA 1OCCH 3V4GA 3S15J 3KZZA 2A69F 2Y0SN 4IXAA 5E8GA 1TNSA 4XORA 3GEZA 2RNJA 4EM1A 3CZ6A 5JI6A 3ZQLA 4LOCA 1J75A 1RUNA 1DGWY 3A0BC 2GA2A 3W2WA 1VFCA 1K4SA 4ZDOA 2XAHA 5GP9A 3R61A 3WU0A 5KVRA 3GFIA 1R7JA 2NVXJ 3DBHB 2MA3A 2FMLA 1H0MA 5J1RA 1YS7A 1MH4A 2CS3A 1LFPA 3E97A 4LITA 2VXZA 3PSIA 4IQJA 2Y69H 1OCPA 1T33A 1WJDA 4G94A 1IV6A 4H0EA 3QU6A 1LDKB 2IA1A 1QPIA 2IGMA 3TO7A 4BE2A 2A05A 2FXAA 1ZREA 3NWSA 1FP2A 5FRMA 1RUOA 1BBYA 1T0FA 3GTJJ 3QPHA 2M4GA 3Q9SA 5EDNA 4UUVA 1EA3A 1FOYA 3BTJA 3S2DJ 1TT0A 2RQPA 4CA0A 4AIJA 2X85A 1HOMA 2M2EA 3E6CC 2K86A 2MH2A 4FQGA 4RA2A 3IRQA 2L5QA 2DOFA 1RR7A 2UZKA 3V8KA 4N4OB 4KUMA 5E17F 1SVMA 1PUEE 3I59B 3E5XA 4P5OA 3SEQA 4E4HA 3R6SA 4ZYEA 3WTTC 4XOPA 5KAIC 3G71I 1H9TA 3G3ZA 5KK1A 3Q9VA 3RKWA 2MLGA 1JE8A 3MQ0A 3F9KA 3QU3A 3DPUA 4Z6YA 3ASOH 2KHMA 3QOEA 1YJNI 5HNFA 3BG3A 2VJ4A 4A3DJ 2KZVA 2X4HA 3OIQA 1K4TA 4MEXF 2KZGA 2P7CB 1WH5A 3B6CA 1XDUA 2M7AA 2CH0A 5K5RA 4LK0F 1W7PB 1HKQA 1XGMA 2QSFX 2W57A 4L9NA 2JN6A 5HODA 3JAMK 3KZYA 2FOKA 1F9NA 4JP0A 3BC8A 4BXXJ 4UNOA 1G3TA 1F43A 3K70D 4M6YA 3RKXA 3RI4A 1YJ9I 4MEYF 2CQ7A 2XGEA 4ZYAA 1VQ5I 5J47A 4IPAA 4M71A 1FEXA 2KQRA 5CKTA 3QWLA 1ZRDA 4G7HF 4NNJA 2R7TA 4HX7A 2LYCA 3KEQA 4XKWA 1Y8QB 4FTHA 3PUBA 5ILSA 1MDMA 3I5UA 3V7RA 3L1PA 3G6EI 2G7HA 1WI9A 2LY1A 3OYDA 4MTDA 3LA7A 1XCVA 4RGRA 1WJCA 1TT5B 4CZZA 1OKRA 4B43A 3QPTA 1X4OA 4TV7A 3FF5A 3LQQA 1SMTA 4KJZA 3M1CA 1GT0C 1Q1VA 1Z3XA 3K4KA 1V54H 3C2GA 4DNCA 2QF7A 1T39A 3CP8A 1IN5A 1Z67A 3K4MA 1Z7LA 1IW7F 2X9DA 1Z9CA 2QBYA 1X3ZB 4EJOA 3TOAA 4G7ZF 3IP4B 2HQNA 3MCZA 4PDKA 3AL0B 3M3YJ 2ZB9A 3TKYA 3J7AY 1ZAOA 3GYHX 1KU3A 3PQJA 1Y0UA 4KT6A 2DXIA 3M8EA 1L3LA 3CDHA 1XMXA 2HTSA 4RMNA 5DM6F 4KYWA 1X2MA 2I8DA 3S1NJ 2XB5A 2HFHA 3KZIC 2EILH 3MVPA 3H0DA 1ZLKA 2X1EA 2MGQA 1CGPA 4ZTFA 5AIPA 3K4JA 5H6QA 3WE3A 4HPQA 5GAEJ 2KT0A 3CJTB 4IEJA 4B8XA 4EM0B 5BMZA 3LNQA 2FE3A 3F6OA 5DM7F 3JRIA 4JOMA 3GZNB 5E8IA 1G59A 3TW6A 1DPUA 3QAHA 3U9GA 5IOYA 3GBGA 2O9LA 3IH2A 4CCMA 1YRNB 1HF0A 3CJRB 4UUSB 1JGSA 1MBFA 4RM3A 3RCOA 3MD2A 4AD9A 2CQXA 2ZNZA 2XHKA 1X58A 5KHDA 1FBUA 2X51A 3E6BA 3RYRA 2Y9ZA 2ME0A 2V79A 1GXQA 1ON2A 4LJZF 1B72B 3HTSB 3B6AA 2A3SA 1DQUA 1V4RA 2ZFWA 1YX5A 4AU7A 1USTA 5HDNA 1NG6A 5CVJA 3X2QH 3JRHA 1IAWA 2DDBA 2HDWA 5EG0A 4XM3A 4HAMA 2FNPA 4QPOA 2VKEA 1HW5A 3KFWX 2CUFA 2BOLA 1ZKGA 1DUXC 2PJPA 2A6HF 4MFDA 2DA4A 2Z1DA 5HLGA 4IX7A 2ZMEC 1VQLI 1H88C 3WGIA 1DU6A 2DFFA 2JMWA 4X1EA 4YIIA 2WBMA 3OMYA 5DTDA 3J80Z 3CCLI 2VPLA 1LJ9A 3EYYA 2DW4A 1AOYA 3H9GA 4LLLA 2NVUB 4A93J 2IS6A 1ENHA 3F3XA 3CC2I 1SEUA 3LQRA 4DJAA 2DLLA 3AL0C 1E2XA 2DA3A 2MG4A 5JLXA 2JA5J 1F4KA 3FXOA 4BS9A 2FJ1A 4F52A 3LAJA 4IZZA 2V4JC 1N77A 4DW6A 4G6DA 4HX4A 1FOWA 4ESBA 2E7WA 3J7AO 5D4RA 3FXMA 2JT1A 1K79A 1B6AA 1X1AA 2EZLA 1LKXA 2LG4A 3SYTA 1JKOC 3CCVI 2DT5A 5AONA 3PJRA 2DQLA 1U6GA 1HSJA 3HGGA 1GLNA 3DQVC 2DK5A 2R7QA 3V7CA 4A3MJ 2PJRA 2JA7J 3RZOJ 1R4MB 1ZG3A 3F21A 5E3MA 3H0GJ 3BLYA 3CUQB 3CMMA 2E7XA 2VIXA 3L2WA 4XBFA 4I0AA 3B73A 3BR0A 5E3NA 2VUMJ 1IO2A 3CCUI 4PCQA 5TRDA 4AIKA 2B63J 1J2XA 2XPUA 5JFRA 4XLCA 5LHIA 4LIUA 4W1UA 3TDZC 2V9PA 3L00A 1FMWA 3ABMH 2Z2SB 1OMIA 2CW8A 3RQ4A 3T5XA 4JQFA 5FKOA 3BPVA 3ZQGA 3TW7A 2R7OA 3L2UA 1RESA 2DU9A 4PFPA 2D2WA 2WA0A 2P6SA 1YIJI 1FC3A 2Y2ZA 3V7SA 1BM9A 2EINH 2B0LA 2XF6A 3V8JA 3M1EA 4ZZLA 5JR3A 2TDXA 2ICWG 2V6EA 1D3YA 1QA6A 2CW0F 3IH4A 3CCMI 4D9JA 5M3MJ 3WTWC 1TQMA 4EJUA 2F48A 2OV7A 2JPBA 1YFHA 3VWBA 1A6QA 1PUFA 3W2AA 4ZZDA 1R1VA 1QQIA 2NXNB 3AG3H 1FZPB 4AVZA 2ZJ2A 2KISA 4BY1J 2Q2EB 3CC7I 2VL8A 4LFUA 3VSLA 5LRRA 3PIOF 3PM1A 5ICFA 1NK2P 2A6TA 1Y56A 1R9TJ 3DFGA 3P9CA 3F8NA 1MBHA 2XROA 3H5AA 2EFPA 4FE7A 2ZXHA 3BCAA 1YQAA 1B59A 4IOAF 3ECOA 1WI3A 1MMGA 4HOBA 3CMEI 1JXSA 2WV0A 1GXPA 5F0FA 4M73A 3RKQA 3JRBA 3QRFF 2RREA 2Z3YA 2DA5A 4ESJA 2AS5F 3LSJA 3GW2A 2HZDA 4HG2A 2FMYA 3JTGA 3A1YA 2PBIA 4FASD 5TGTA 2LY9A 3OYLA 4XN0A 2IGKA 3KLNA 5CQGA 3FBIB 2YS9A 4ZJZA 3P9KA 1XGOA 2B9SA 2HWVA 5F04A 1GHCA 2FQ4A 1DDNA 3LWFA 3SZPA 3BR6A 1LEAA 1GV2A 2KDOA 2L0KA 1V5FA 2E5NA 4AIDA 4RAFA 2GIVA 2KIFA 3H1CA 3FIWA 4DOZA 4LLGF 3SEZA 2NS0A 2VJIA 3GXOA 5B5EC 4CCNA 3N4MA 3T8RA 4A0XA 1CF7A 3DLAA 2BY1A 3BTIA 1FYKA 4M3GA 1KGSA 4R1HA 2HEOA 2L9RA 4M9ZA 4BYYA 3I53A 1ZRCA 1VQNI 1LFBA 1S7EA 4KA4A 2CYYA 4RB1A 3KP7A 3FXLA 4IRIA 2F5DA 1J9IA 4HNVA 3U1DA 2OCCH 1BI1A 3IL2A 4BU2A 5FRNA 2VLAA 2NNYA 4CYCA 3D5SC 4M3BA 3VEPA 4A3GJ 1UELB 2R7SA 2F5FA 3PQKA 2XRNA 5JHUA 4Q4ZF 4M9SA 5C4JJ 4I09A 4UUSA 3Q0VA 1H8AC 4B3AA 1KONA 2JWTA 3TP0A 2FQ3A 1SD7A 3MKLA 3RPQA 1FLIA 4V2GA 4C3IJ 2Q2EA 3GX4X 1D1CA 1ZELA 5K7HA 2XRLA 3VSKA 4KT5C 2HVSA 1LB2A 3F72A 1SFXA 2MYSA 5GAGJ 4OAZA 3BR3A 4RGSA 5GAHJ 1CQTA 4O6JA 2LLKA 2DDAA 4AYBN 4PJJA 4NB5A 1IUYA 5ILUA 3BR1A 3ZPLA 4M3FA 2MBFA 2DA2A 3ABTA 2OAZA 1IN6A 4IHSA 4ENNA 3HUGB 1FBQA 2AQFA 3HGYA 2NAZA 4QLCU 4OMZA 1YITI 2XKPA 1I1SA 1S6LA 3NQOA 2VJ5A 5E3OA 2RV8A 2XF7A 2HQ5A 3OR2C 5TISC 4BAYA 1V3FA 3O3KA 2CFXA 5JVGF 3NARA 3SFIA 3J81Z 3HOZJ 3M7GA 1D0YA 2WTEA 3CUQC 3TL4X 1W36C 4I98B 2M45A 2LH9A 3I4PA 4C3JJ 4F55A 2K9QA 1X4PA 2FEZA 3K70C 1I6XA 3I64A 4BQOA 2WB1N 2NVYJ 2UUZA 5DS9A 1HSTA 3HRTA 3K1MA 3MKWB 2YR2A 4BHBA 3BR2A 2JPCA 3HBLA 4HRIA 4F92B 5D5XB 2DT6A 2P5VA 4PGGA 3OYMA 1F1ZA 3A01B 3QOPA 3E1SA 4ZDPA 3TMOA 4A3IJ 2DMQA 2ZSIB 2YSRA 3GTMJ 4RGXA 2W7NA 2Z99A 1M1EB 1BR1A 2PMZN 3C18A 2JSPA 1IN8A 5H20A 4XMYA 1YI2I 3JCUC 5ICGA 2V1DA 2K4JA 1T56A 3GWZA 3OIPA 4ANJA 3K1PA 3DBRB 2GAUA 3ZRGA 5CJ9A 1YW7A 2W4SA 4YFNF 1TQPA 5KCMA 4DQ2A 2KMUA 3G4SI 2AO9A 2V9KA 4A3CJ 3M4OJ 5M5XJ 3HOYJ 3W3CA 4KMUX 2VBXA 2W84A 4IHVA 2GLOA 1MBKA 2HYGD 1WHUA 2GQQA 3MKYB 2CV0A 1WJBA 1X1CA 3TP3A 3VODA 4BJTA 2IGOA 1YW9A 2VOOA 3VOEA 2ESNA 1IN7A 2JVGA 5JLWA 2FUG2 4XIDA 1B9NA 3H36A 5DUIA 3L9FA 1L0OC 3A03A 2VXDA 4Z2YA 2RQQA 3EETA 3T1BA 4ZTJA 1YX3A 5EEGA 3OYGA 1DGRM 1MJAA 1ZYRF 2O7OA 4UV9A 5BQTA 2OU2A 1I50J 1Z6TA 1ZG1A 2XC7A 1S7OA 4OIOF 3PIPF 3CCJI 3UNGC 2P6TA 4IF4A 1G3YA 4Y17A 5FKKA 3V8LA 2YX4A 1KQ0A 1VTNC 1ETOA 1QO0D 5F64A 3GF2A 3KX2A 1Z3YA 2KDZA 1VQPI 2ZXWH 5B66C 2ELJA 2UWMA 4DYCA 2ZMEB 3H5NA 1A35A 5IP7J 2NOJB 3K7AJ 4EQQA 1T8IA 1MMDA 2NNNA 1HDDC 1DP3A 3FX3A 1OCRH 2ELHA 5IP9J 2E1MB 3CLQA 4AM3A 1P4WA 3BR5A 2X1CA 3BZCA 3LFKA 1YOVB 4EM2A 3HRUA 2A6EF 2E71A 2MSYA 3BWGA 4IHXA 4A6EA 2E1MC 1FTZA 2DFIA 1IF1A 1Z05A 2E1OA 3OR1C 1G3SA 1HXDA 4AC0A 1VF9A 2LKSA 3OOUA 5DDGA 3FISA 4W97A 3VPRA 4N0BA 3K2AA 2EA4A 3OWTA 2IT0A 1LVKA 2BY3A 2CJJA 2PFBA 3DKWA 4BJ5C 4WX9A 4ON0A 5LD2C 3OIOA 2Z9OA 2WAQA 3COAC 3OL4A 4XONA 3OL3A 1KQ8A 4G12A 1B1BA 4IHTA 4R8HA 2ZJPF 2QUFA 4A5MA 5J6XA 1R1UA 3QP5A 3UR3C 2DA6A 3ZMDA 1B8IB 2EIKH 5LFAA 2MABA 2E2JJ 2M7BA 1R71A 1XTAA 2LBFA 4C30A 3KLOA 4CUGA 2VKHA 4BGDA 2Q8KA 1FPQA 3CTAA 4XLAA 1B72A 1SD4A 1HA8A 4CCLA 1O7LA 2CG4A 2W85A 5GADJ 3IWFA 4E7HA 2K9NA 3W6JB 3TQNA 3PNTA 3CMAI 9ANTA 5DCMA 2DOEA 1K83J 4BUPA 4J00A 3WTYC 4A12A 4HSTA 2YU9J 3D5RC 4BHPA 3AG2H 1Z6RA 2CGPA 3G2BA 2LKPA 3DEEA 4AWXB 1SFUA 2BHZA 2KIQA 4XSXF 4JX5A 2DN0A 1A6IA 1ZR4A 3FKIJ 1WZ2A 2ZFUA 3CO7C 2K7LA 2Z5UA 1BI3A 4RAYA 2O3FA 1SFEA 4NDLA 2K9LA 4XRFA 2CV2A 2F4IA 2LK2A 3QYBA 1HW1A 2IAIA 4F91B 1XSXA 4YEJA 4DBQA 1AHDP 3C2BA 1RI7A 3R60A 2EWNA 2QSGX 1ZARA 2Y31A 3HOWJ 5EZGA 2H8RA 4Y33A 3D1NI 5FKMA 2LTPA 2HZTA 1MMNA 3KPHA 2EBIA 3B02A 1IN4A 2ZXIA 1BW5A 5F0HA 1OR7C 5DD4A 2MLKA 3CUOA 3DEUA 4O3MA 2L7MP 2A5YB 2GOMA 4M6VA 1B8IA 2CV1A 5K1YA 3MZHA 4UVBA 4MHGA 2C6YA 2O6GE 3SQNA 1U9OA 2O61A 3KP3A 3WGGA 1MBGA 3EUKL 3OYKA 3SHFA 1TW3A 4MTEA 5L3CA 1D8KA 3GTOJ 3TEDA 1BJZA 2QM3A 4QPQA 2XSJC 3QPLA 4HV6A 3FKJA 1W0TA 1IRXA 4FISA 1EF4A 1JJ8C 3DBLB 2VT3A 4YELA 1LQ1A 4UY8I 2RNGA 4BY7J 1YYVA 4GFBA 1WCMJ 1K78B 1OR7A 4GXOA 3F22A 2OJED 4WXDA 4QTRA 3PUFA 4PJNA 5ICCA 3AG4H 3OY9A 4UB6C 4HF1A 4E7SA 2K4BA 2MH9A 4D7MA 3IV5A 3S3NA 3FHNA 1FYLA 1D0ZA 1ULYA 1U5TB 1JKRC 4P55A 3EUHC 3NWTA 4P1WA 4ABZA 1IDYA 5J40A 3ZQFA 1GDTA 3S8PA 2K27A 2R7RA 4BQQA 5K7FA 2OC6A 2CQQA 3H3UA 2EA2A 3CCEI 4U7DA 2JQ7A 1I27A 4CZCA 1POGA 2ZJRF 3DCFA 2GXGA 2JUCA 4PZJA 5K7ZA 1HC8A 1R49A 2VASA 2WB1A 1SVOA 1KYWA 3OYEA 1EKEA 4LK1F 1D5VA 3FM5A 2E2IJ 2M8GX 5FFZA 1S5LC 3ABLH 3CCSI 5FGMA 1ZH5A 3CJNA 1ZR2A 1O4XA 2P81A 4XNFA 1RR8C 3C7JA 4XOTA 4B48A 5FB2A 5C4XJ 4GRIA 5C3EJ 2GXAA 1S72I 2Z33A 3CO6C 2HOSA 4ENKA 1YRNA 2CO5A 2X6OA 2EK5A 2X6YA 5M5WJ 1MNMC 1Y0NA 4XLNF 2X6XA 2DMPA 3IHUA 4ZH4F 2E5ZA 2OA4A 4Y13A 1LDJA 3CDIA 3HSFA 4BKXA 1R58A 2QQBA 4MNUA 1GVJA 2CSOA 2YUSA 3RYPA 4B4CA 2VE9A 2R5ZA 3BG5A 4IO9F 1LVAA 1IGNA 3K6GA 4M3EA 2M1BA 3IAM2 1Z77A 3KYDB 3E6DA 2WY8Q 2LREA 4JX4A 3I58A 4I7HA 4OIQF 3CF2A 1BA5A 2KIMA 4J01A 2IS1A 2L4AA 5E1XA 2DCEA 3TO6A 1PYVA 1VQ4I 1FSEA 5EJCA 3RSNA 3E7LA 3IKTA 1ACIA 1HKSA 3I0TA 2F4MB 1R1TA 4E7JA 4LB6B 1IV8A 2XDVA 4PFOA 1R4NB 3OS2A 2ZC2A 1P92A 5BNGA 4E7KA 2Y48A 5FROA 3QPSA 2DA1A 4C2MJ 2HS5A 5B1BH 4CO8A 1Y1VJ 4JBAA 3OYBA 4L9VA 4BE1A 4LB5A 4RS8A 3AKZA 4CDGA 2M8EA 5DD8A 1LNWA 3OS0A 5EG0B 5D5WB 3KYLA 3BJAA 4A0ZA 2Y0SA 3AG1H 2PMUA 2KKOA 4IRHA 2QCOA 3H35A 3TDUC 3P7NA 1ETVA 2LNBA 1K6YA 4UXNA 3Q0WA 5F08A 3HKZA 2RDPA 2M87A 3G73A 2NS8A 3BTCA 1W4MA 2LC2A 4IOCF 3GCMA 3ECHA 2HOTA 3LOCA 4DZJA 1KQ9A 4K2EA 1PUFB 4WF2A 1WJEA 1WPKA 1P4AA 2J5PA 2R7WA 2OTLI 1EV7A 3OS1A 1N75A 2VI6A 2HDCA 2JZYA 2XKOA 5HLHA 4UVAA 4EV0A 1UB9A 2A68F 4XLPF 1X1PA 1XX5A 1OYIA 1W7PA 1T98A 1JUSA 3GTKJ 1KU2A 1QNTA 3ELKA 2W82A 2V7FA 4BEHA 2R5ZB 4EMSA 3AAFA 1TWGJ 2WC2A 1MD0A 3FDYA 1NG7A 4U0WA 1JHFA 2WAQN 4OWRB 1FOXA 3ZP5A 1BOBA 2VBZA 3ML6A 5J4YA 1ZQ3P 3HM5A 3ONQA 3DP7A 1TP4A 1OYYA 5LRSA 2R3SA 5H6RA 1PJRA 2DOAA 2J5OA 2CMPA 3LSKA 5TJJA 3L2QA 3OYAA 3R0AA 1XS9A 1S3JA 1NK3P 2DFHA 2QQ9A 2Y75A 1U3EM 4KNYA 1T08B 4KIBA 3HHHA 3HOVJ 2DO7A 1R5HA 2LFBA 3R0JA 2CRGA 1BIAA 2E1CA 4C2UA 2LKXA 4Y3OA 2QGUA 2FBIA 4RB3C 3D0SA 1XD7A 3BQZA 2ZXJA 4N9IA 3ZN0A 4OMYA 3VDXA 2H27A 1RRJA 2V1UA 1XSDA 2HYJA 3RKYA 5GTHC 1LDDA 2DT7B 1N78A 3KP2A 2A61A 5GPCA 3WTZA 2BYVE 4R79A 2BVMA 1T95A 3FMQA 2EV0A 3RPUA 4LG0A 1LE8A 2ECBA 4ZYHA 4XK4A 1X1DA 1JT6A 2DJNA 1MSEC 2CWEA 3C2HA 4XICA 1QVUA 3S2HJ 4HDVA 1ODDA 3IWZA 3TO9A 3IH3A 1UHWA 3IUOA 2JRMA 1LE8B 3WHCA 5CPRB 3FK6A 4EATA 5JHFA 4ZYGA 3JRGA 2PG4A 3OSFA 5KNLA 2VQCA 4UVCA 5F1JA 2KL4A 4ETSA 4BQAA 4OOIA 3J81K 4L18B 1X1BA 2L9NA 3H3VK 4S04A 2EFOA 2WAFA 2NVQJ 1A5JA 4G6QA 1QZEA 3WU2C 2WY7Q 1D1AA 2X1DA 3FXUA 1FY7A 3JTHA 1I5ZA 4M6XA 4YIRX 2R0QC 2KIUA 1HQCA 2GA1A 4KISA 2E36A 1P4XA 2O0YA 2JSCA 1J7KA 5D5VB 3PNVA 1Z91A 2CU7A 2PQ8A 5HLIA 5LBQA 1SFKA 3OV8A 4Q5SF 5CVVA 4HLYA 4DGWB 1PDNC 2H1KA 1KU7A 3J80K 5F6FA 5K5QA 3DKYA 4Y52J 1WSUA 3FMRA 4LGWA 1U5TA 3BZ6A 1P7JA 1XPXA 4H4KC 4U0VA 2M3AA 2EB7A 3GTGJ 1SVLA 3CESA 5LGNA 4A3EJ 1QGPA 1O3TA 3F8MA 2VQGA 4DYQA 4FT8A 5EZHA 1IDZA 1UCRA 2L01A 4YFKF 3S93A 1STZA 3JRAA 3LA3A 4A3BJ 3HSRA 4U0YA 4M74A 1E3HA 2ISYA 5BOXA 5C44J 1SC7A 4MFEA 3BJ6A 3EDPA 4NC6A 3ZMVA 3TGNA 4X0GA 4A0YA 2XPVA 4MIMA 5BPDA 3VB2A 3CCRI 1TZLA 5FD5A 3LFUA 2BE5F 4FX0A 2KJCA 2QQAA 1QVTA 1TWHJ 1OISA 2BZTA 2ACJA 2OQGA 4XLFA 2L7KA 1FMVA 4U87A 1XCBA 2VONA 1FIPA 1WRJA 4X6AJ 2R7UA 1UHMA 3ZQ7A 4MLOA 3PFIA 1AA7A 1FTTA 4QWQA 2G9WA 1TWAJ 2LP0A 2DTZA 1SMYF 1KU9A 2FF4A 2IXSA 3KIOA 3O6BB 5ICEA 3F8CA 3PSFA 1BR2A 4UUTA 2EJRA 3ISPA 3GO5A 5IP6A 4S05A 2A07F 1JGGA 2E2HJ 1XMAA 3HUGA 3DXJF 2KFDA 3F8BA 3ZGKA 3IRRA 1Y1WJ 3FXQA 1R23A 3ZMSA 3FM3A 1BI2A 3ERMA 1YG2A 2GOXB 4PJMA 2K9SA 2VC0A 3HOTA 1OFCX 3C1DA 1TLHB 4FE4A 4RGUA 4BL0B 2K02A 3DLLF 1DPRA 1IRFA 4ZC3A 2FD5A 3REOA 3C3WA 4OIPF 1B4AA 5EGOA 4XKVA 2XGCA 1TTYA 2JA6J 5LGUA 1DP7P 4IHWA 1R6RA 4PUSA 2A5WA 3EUAA 4NC8A 4EJWA 2XAJA 5J4VA 1V5EA 3HTUA 3J7ZI 1FOKA 3ZOBA 1OQYA 3I4NJ 2X0LA 5J8CA 2E1NA 2DMUA 1F36A 2LY2A 3GZ5A 1ETYA 4B44A 4QIWN 4F3QA 2Z16A 3E5QA 3DPTA 4JX6A 5HS8A 4CHUA 3K4LA 1V5GA 4AUXA 4IKFA 5EEHA 3L09A 3GTQJ 2GXBA 2XPWA 3MZYA 2KPMA 3BCBA 3GFLA 2D1HA 1ZRFA 3S17J 1IXCA 3FWEA 3JSPA 1CF7B 3IAS2 2QWWA 4CH7A 2E60A 2EIJH 4A2UA 1U8BA 2RKHA 3QODA 2M4KA 1ZN2A 2HNHA 3FBNB 5J1UA 4D0PA 3BP8A 2JUGA 5GPAA 4XRMA 2XAGA 1H9GA 1G2HA 2O5RA 2PX9A 2Y9YA 4HW0A 2E19A 3GMEA 3PNYA 1JTYA 2CFOA 1S7AA 2IRFG 2WADA 2PN6A 4YFXF 3S16J 1U0JA 3OYJA 2OF7A 4L0ZB 3A2KA 3H92A 4ITVA 3LL7A 1QU3A 3RDIA 2OBPA 3PO2J 1JUPA 2OTJI 1UMQA 3QYFA 2D45A 4BXFA 2HXOA 2EV5A 1USSA 2JRTA 2KJBA 2P5KA 3MEXA 1T2KA 1MSFC 3DV8A 2EPFA 3CMYA 2X6WA 4NC7A 5FLXZ 2BY0A 5AIQA 5DCFA 4ESFA 2EZKA 2IEKA 2ZMEA 1PVEA 1YO5C 1W5CC 2XUBA 2QENA 3CP2A 2OZUA 4B1RA 2JA8J 2K9MA 1MDMB 3CC4I 1FJLA 2GWRA 3KP6A 1IUFA 1OJLA 1Y8RB 4A6DA 3PFYA 2I5UA 1O3RA 1X2NA 3MMYB 4YRVA 2F5EA 2R4GA 2Y30A 1QHHD 2QZ8A 3M8JA 2PI0A 1YE9A 1W1WE 3K4NA 2FBKA 1U5TC 3HIFA 1R00A 2Y0MA 3CQZJ
chains in the Genus database with same CATH topology
3KEOA 2LDUA 3BOQA 2IA0A 2OZ6A 1XB4A 5DYMA 1HKTA 1MJBA 5IT3A 5ED4A 3H3ZA 1K78A 2P7VB 1PP7U 1BC7C 4JK1X 3NEUA 3E3VA 3F8FA 2XASA 2VBWA 3FMSA 3GFJA 3NRVA 3VFZA 1R5GA 3LAPA 4LMYA 5E18F 4FHTA 3TOBA 5LLQA 4RB0A 3N97A 6PAXA 4G9YA 1ZGJA 3MAJA 2HOEA 1R36A 4NQWA 3I59A 3RTRA 4OU0A 2RC4A 1U8RA 2EFQA 5FFXA 5A2QZ 2VC1A 1HW2A 5A2QK 4ASNA 1ON1A 2IVMA 2M30A 2XGXA 4BHCA 3QP6A 1IZ1A 5HDGA 3WTUC 2H6BA 2HKXA 4B09A 4F7ZA 2IP2A 2P5LC 4A5NA 3MWMA 5LEKA 1HBXG 2IPQX 3HHGA 2MC3A 3HRMA 4EJTA 2DAOA 1W5SA 1WQ2A 2G7UA 4KIGA 4BXUA 4RB2C 2QYOA 2ZO4A 2XV4S 5K5OA 2DPDA 2IW5A 4HF0A 4KFCA 1O3SA 4HLXA 3WU1B 1ONVA 4GYIA 5F1RA 2HGCA 4CGZA 1B9MA 2XVCA 5IT9K 1F5TA 2DBBA 3KE2A 1FWZA 1O57A 4OIRF 5J8FA 2VN2A 2ADUA 5D6FA 1S29A 4AVPA 4ENJA 5HVQC 1QZYA 3RJPA 3ULQB 4RAZA 3D5LA 2EV6A 5HS7A 5BPIA 2D1VA 1XMKA 1A04A 1G4DA 1SAXA 3BDDA 1G6NA 2W25A 5DV5A 2ISZA 2BEOA 4HQEA 2NRAC 1P6RA 4L0YB 1P2FA 1YS6A 3LA2A 4LG0B 1IXRC 2P4WA 1OPCA 3ROUA 2L02A 2NYXA 2MD5A 4WK8F 3P9IA 4P96A 1J59A 1ZLJA 3CUQA 4HA8A 3T8TA 1QBJA 3BPXA 3M9AA 2DQRA 1BIBA 1O7FA 3WG9A 4GCVA 3GFMA 3K1NA 3HOSA 5LHHA 5CYVA 1SD6A 1UFMA 1OYWA 4GO1A 5LEJA 1G3WA 5DUKA 5HOOA 4MQVA 2HTJA 5LHGA 5FO5A 1W7PD 3W6KB 4ENMA 3MFKA 3U2RA 5CVIA 2DK8A 2ETHA 1ZGAA 2RGVA 5FD6A 1XGSA 1T6SA 5L3GA 3WE2A 1YW8A 2H94A 5HDKA 4KDPA 2AXLA 5L3FA 4HX8A 4KIFA 3KP4A 3IC7A 1AWCA 4LLNA 1NHAA 1SD5A 3EUHA 3FXRA 2HYFA 2XAQA 1O3QA 2OD5A 5DEQA 4KN7X 1QPMA 4CYDA 2HQRA 4HZFA 2ZCWA 2UXXA 3Q5FA 1C0WA 4Q48A 3WTXC 2L3DA 4UHTA 4I02A 2FA5A 5E1WA 2JTVA 3E5UA 4L5JA 4IVNA 1I1GA 1XSVA 1IRGA 1TQIA 1D8JA 1YTYA 1YLFA 2FNAA 5L3BA 2V6CA 3FZVA 1EH8A 3ABUA 2H09A 4HQMA 2KRFA 4HDUA 3R4KA 1JHHA 2RVCA 1K7AA 4HYEA 4XSZF 3ERED 1T38A 3GLXA 2IJLA 1Z7UA 1BN5A 1E17A 1U2WA 2ZBKA 5L3DA 2PLYA 2QBYB 2V1XA 2R7DA 4BH9A 1MKMA 4Q47A 4MQ9F 5FLXK 2STTA 1BJAA 3K9TA 2OQRA 1W5TA 2VE8A 3WGHA 4AIHA 1XDSA 2O03A 4LD5A 2V9VA 4O5VA 4GGGA 3BJOA 3EYIA 2HR3A 5ILVA 1FBSA 3ZMZA 4E70A 3SFZA 1S8NA 1WKMA 3ZN1A 2DI3A 5D6EA 2RN7A 3I54A 4CICA 2ZKZA 3RIRA 2R7FA 1BC8C 4HV5A 1RIOH 2W24A 1REPC 3SXYA 3BY6A 1ZG5A 2F5CA 1TNTA 3KP5A 3S2WA 3JSOA 4HF2A 4FX4A 1ZHFA 3GZ6A 4EGZA 4WXCA 3F6VA 4GYGA 2BBYA 3HSEA 4U88A 1TW2A 5JVTA 2PEXA 4M9XA 3HRSA 4YG2F 1K6OA 1KYZA 2LF8A 1XGNA 2HKOA 2LF7A 2YPRA 2M5WA 1XN7A 4BNCA 2PMHA 3DF8A 3K69A 4KMFA 2L4MA 1Q1HA 4WXHA 3SZTA 1RZ4A 2H6CA 2STWA 5CLSA 3T0YA 3JAMZ 2IA2A 3IKVA 4P9UA 2F2EA 2XAFA 5BS6A 3L7WA 4G8XA 1QZZA 1R22A 3F23A 3L2CA 4IRGA 3GUDA 5DCMB 2FRHA 5CVUA 4OINF 3CLOA 3OOPA 2EFWA 2ZNYA 3WODF 1MJ9A 2VT2A 1J0RA 2YU3A 2VBYA 3BROA 5E1ZB 3WTSC 5IT9Z 2EFNA 5L3EA 1FT9A 4KICA 3ZMUA 3K2ZA 2FBHA 2ESHA 1FX7A 3O2PE 3GVAA 2L54A 1U78A 5HS9A 1WWXA 2Q0OA 3KETA 2XIGA 4EVIA 3E6MA 2YX7A 3I71A 4L5IA 2CQKA 1LEBA 2WWYA 5D5UB 3FHZA 4NHJA 4U7BA 2VODA 4I2OA 3K0LA 1RNLA 2VOPA 3DPLC 4WWCA 3LSTA 2DPUA 1FNNA 2P8TA 4L9TA 4CXFA 4P9FA 2BGCA 1MGTA 2FU4A 4Y15A 4UV8A 2DTRA 2O8XA 1BI0A 3KCCA 1FP1D 4MGRA 1PP8F 1J5YA 1Z1DA 2COMA 4N9HA 1FSHA 2LSOA 4IJAA 1YIOA 3EQLF 1FYMA 3HYIA 1EH6A 4EJVA 1IXSB 3JW4A 3M8FA 1EH7A 4I01A 3ZMTA 2BV6A 1TBXA 5D8KB 4PGHA 4I0BA 5D4SA 4YIFA 1MZBA 2GZWA 4KN4X 4M72A 5LGTA 4G7OF 1KA8A 1X3UA 4WCGA 4L9JA 4EGYA 2FSWA 2QLZA 2UXNA 5ERIA 1BOAA 2QVOA 4HBLA 3WTVC 5D8LB 5E20A 4ZYDA 5CVRA 3V4GA 3KZZA 2A69F 4IXAA 5E8GA 1TNSA 4EM1A 3GEZA 2RNJA 5JI6A 1J75A 1RUNA 2GA2A 2XAHA 3R61A 3WU0A 5KVRA 3GFIA 1R7JA 2MA3A 2FMLA 1H0MA 1YS7A 3E97A 2VXZA 4G94A 4H0EA 3QU6A 1LDKB 2IA1A 3TO7A 2FXAA 1ZREA 1FP2A 1RUOA 1BBYA 1T0FA 3QPHA 3Q9SA 4UUVA 2RQPA 4AIJA 3E6CC 2K86A 2MH2A 3IRQA 2UZKA 3V8KA 4KUMA 5E17F 1PUEE 3I59B 3E5XA 4P5OA 1H9TA 3R6SA 4ZYEA 3WTTC 3G3ZA 5KK1A 3Q9VA 3RKWA 2MLGA 1JE8A 3MQ0A 3QU3A 2X4HA 2P7CB 4MEXF 1XDUA 5K5RA 4LK0F 1W7PB 1HKQA 1XGMA 4L9NA 2W57A 3JAMK 3KZYA 2FOKA 1F9NA 4UNOA 1G3TA 4M6YA 3RKXA 3RI4A 4MEYF 4IPAA 4M71A 1ZRDA 4G7HF 4HX7A 3KEQA 5ILSA 1MDMA 3I5UA 3V7RA 2G7HA 1WI9A 4MTDA 3LA7A 1XCVA 4RGRA 4CZZA 1OKRA 3QPTA 4TV7A 3FF5A 3LQQA 1SMTA 4DNCA 1T39A 1IN5A 1IW7F 1Z9CA 2QBYA 4EJOA 3TOAA 4G7ZF 2HQNA 3MCZA 4PDKA 3TKYA 1ZAOA 3GYHX 1KU3A 3PQJA 1Y0UA 3M8EA 1L3LA 3CDHA 2HTSA 4KYWA 2HFHA 1ZLKA 1CGPA 5AIPA 5H6QA 3WE3A 4B8XA 4EM0B 5BMZA 2FE3A 3F6OA 5E8IA 1DPUA 3QAHA 3U9GA 1JGSA 4AD9A 2ZNZA 2XHKA 1FBUA 3E6BA 3RYRA 2V79A 1GXQA 1ON2A 4LJZF 3HTSB 2A3SA 1V4RA 2ZFWA 5HDNA 1USTA 5CVJA 1IAWA 4HAMA 2FNPA 1HW5A 3KFWX 1DUXC 2PJPA 2A6HF 5HLGA 3WGIA 4YIIA 3J80Z 1LJ9A 3EYYA 2DW4A 1AOYA 4LLLA 3F3XA 3LQRA 2DLLA 1E2XA 1F4KA 3LAJA 4G6DA 4HX4A 4ESBA 2E7WA 3J7AO 5D4RA 2JT1A 1K79A 1B6AA 2DT5A 5AONA 2DQLA 1U6GA 1HSJA 3V7CA 3DQVC 2DK5A 1ZG3A 3F21A 3CUQB 2E7XA 4XBFA 4I0AA 3B73A 4PCQA 5TRDA 4AIKA 1J2XA 5JFRA 5LHIA 3TDZC 3L00A 1OMIA 3T5XA 4JQFA 3BPVA 2DU9A 2D2WA 2P6SA 1FC3A 3V7SA 1BM9A 2B0LA 3V8JA 3M1EA 4ZZLA 5JR3A 2TDXA 1D3YA 2CW0F 3WTWC 1TQMA 4EJUA 2JPBA 1YFHA 4ZZDA 1R1VA 1QQIA 1FZPB 2ZJ2A 4LFUA 5LRRA 5ICFA 3DFGA 3P9CA 3F8NA 2XROA 2EFPA 1YQAA 1B59A 3ECOA 4HOBA 1JXSA 2WV0A 1GXPA 4M73A 3QRFF 2Z3YA 4ESJA 2AS5F 3GW2A 2FMYA 3JTGA 2PBIA 3KLNA 3P9KA 1XGOA 1GHCA 2HWVA 1DDNA 3LWFA 3SZPA 1LEAA 2GIVA 2KIFA 4LLGF 2NS0A 3GXOA 3N4MA 3T8RA 4A0XA 1CF7A 1FYKA 1KGSA 4R1HA 2HEOA 4M9ZA 4BYYA 3I53A 1ZRCA 4KA4A 2CYYA 4RB1A 3KP7A 4IRIA 2F5DA 1J9IA 3U1DA 1BI1A 3IL2A 2NNYA 3VEPA 2F5FA 3PQKA 2XRNA 5JHUA 4Q4ZF 4M9SA 4I09A 2FQ3A 1SD7A 3RPQA 1FLIA 2Q2EA 3GX4X 4KT5C 1LB2A 3F72A 1SFXA 4RGSA 4O6JA 4NB5A 1IUYA 5ILUA 3ZPLA 2MBFA 3ABTA 2OAZA 1IN6A 4IHSA 4ENNA 1FBQA 2NAZA 4QLCU 4OMZA 2XKPA 1I1SA 1S6LA 3NQOA 2RV8A 4BAYA 1V3FA 3O3KA 2CFXA 3J81Z 3M7GA 3CUQC 2WTEA 4I98B 2M45A 3I4PA 2FEZA 1I6XA 3I64A 1HSTA 3HRTA 3K1MA 2YR2A 4BHBA 2JPCA 5D5XB 4PGGA 2P5VA 1F1ZA 3QOPA 2YSRA 4RGXA 2Z99A 3C18A 1IN8A 5H20A 5ICGA 2V1DA 2K4JA 3GWZA 3K1PA 2GAUA 5CJ9A 1YW7A 4YFNF 1TQPA 4DQ2A 4KMUX 2VBXA 2W84A 2HYGD 2GQQA 3VODA 1YW9A 2VOOA 3VOEA 2ESNA 1IN7A 1B9NA 5DUIA 3L9FA 1L0OC 4Z2YA 3EETA 3T1BA 5EEGA 1MJAA 1ZYRF 4UV9A 5BQTA 2OU2A 1ZG1A 1Z6TA 1S7OA 4OIOF 2P6TA 4IF4A 1G3YA 4Y17A 3V8LA 2YX4A 1KQ0A 1VTNC 1QO0D 5F64A 3GF2A 2UWMA 2ZMEB 4EQQA 2NNNA 3FX3A 2ELHA 1P4WA 3LFKA 4EM2A 3HRUA 2A6EF 3BWGA 4A6EA 2DFIA 1IF1A 1Z05A 1G3SA 1HXDA 5DDGA 4N0BA 2EA4A 2IT0A 3DKWA 2PFBA 4WX9A 4ON0A 2Z9OA 3COAC 1KQ8A 1B1BA 4IHTA 4R8HA 2QUFA 4A5MA 5J6XA 1R1UA 3QP5A 3ZMDA 3KLOA 2Q8KA 1FPQA 3CTAA 1SD4A 1O7LA 2CG4A 2W85A 3IWFA 3W6JB 3TQNA 5DCMA 3WTYC 4A12A 4BHPA 1Z6RA 2CGPA 2LKPA 4AWXB 1SFUA 4XSXF 3CO7C 2K7LA 1BI3A 2Z5UA 4RAYA 2O3FA 1SFEA 4XRFA 1HW1A 1XSXA 1RI7A 3R60A 2EWNA 1ZARA 2HZTA 3B02A 1IN4A 5DD4A 2MLKA 3CUOA 3DEUA 4O3MA 2A5YB 5K1YA 3MZHA 4UVBA 4MHGA 2C6YA 2O6GE 3SQNA 2O61A 3KP3A 3WGGA 3SHFA 1TW3A 4MTEA 5L3CA 1D8KA 2QM3A 4HV6A 2VT3A 1LQ1A 1YYVA 1K78B 1OR7A 4GXOA 3F22A 4WXDA 5ICCA 4HF1A 2K4BA 2MH9A 1FYLA 1ULYA 1U5TB 4P55A 2K27A 3H3UA 2EA2A 4U7DA 1I27A 2GXGA 4PZJA 1KYWA 4LK1F 1D5VA 3FM5A 5FFZA 5FGMA 1ZH5A 3CJNA 3C7JA 5FB2A 2Z33A 3CO6C 4ENKA 2CO5A 2EK5A 4XLNF 3IHUA 4ZH4F 2OA4A 4Y13A 1LDJA 3HSFA 1R58A 2QQBA 4MNUA 1GVJA 2CSOA 3RYPA 2VE9A 1LVAA 2M1BA 3E6DA 3I58A 4I7HA 4OIQF 2KIMA 2L4AA 5E1XA 3TO6A 1FSEA 3IKTA 1HKSA 3I0TA 1R1TA 4LB6B 1P92A 2Y48A 2HS5A 4CO8A 4JBAA 4L9VA 4LB5A 4RS8A 4CDGA 2M8EA 5DD8A 1LNWA 5D5WB 3BJAA 4A0ZA 2PMUA 2KKOA 4IRHA 3TDUC 3P7NA 2LNBA 4UXNA 2RDPA 2M87A 3G73A 1W4MA 3ECHA 1KQ9A 4K2EA 4WF2A 2J5PA 1P4AA 1EV7A 2HDCA 2JZYA 2XKOA 5HLHA 4UVAA 4EV0A 1UB9A 2A68F 4XLPF 1OYIA 1W7PA 1T98A 1KU2A 1QNTA 3ELKA 4EMSA 3AAFA 2WC2A 1MD0A 4U0WA 1JHFA 3ZP5A 2VBZA 3ML6A 3DP7A 1OYYA 5LRSA 2R3SA 5H6RA 2J5OA 5TJJA 3R0AA 1S3JA 4KNYA 2QQ9A 2Y75A 1U3EM 4KIBA 3HHHA 2DO7A 1R5HA 3R0JA 1BIAA 2E1CA 2FBIA 4RB3C 3D0SA 1XD7A 2ZXJA 4N9IA 3ZN0A 4OMYA 2H27A 2V1UA 1XSDA 3RKYA 1LDDA 3KP2A 2A61A 3WTZA 2BYVE 4R79A 3FMQA 2EV0A 3RPUA 4LG0A 4ZYHA 2CWEA 4HDVA 1ODDA 3IWZA 3TO9A 1UHWA 4ZYGA 2PG4A 4UVCA 4ETSA 4BQAA 4OOIA 3J81K 4L18B 4S04A 2EFOA 4G6QA 3JTHA 3FXUA 4M6XA 1FY7A 1I5ZA 2KIUA 1HQCA 2GA1A 1P4XA 2O0YA 2JSCA 1J7KA 5D5VB 1Z91A 2PQ8A 5HLIA 5LBQA 3OV8A 4Q5SF 5CVVA 4HLYA 1PDNC 1KU7A 3J80K 5F6FA 5K5QA 1WSUA 3FMRA 4LGWA 1U5TA 3BZ6A 4U0VA 2EB7A 5LGNA 1QGPA 1O3TA 3F8MA 4FT8A 1UCRA 2L01A 4YFKF 1STZA 3LA3A 3HSRA 4U0YA 4M74A 2ISYA 5BOXA 3BJ6A 3EDPA 3ZMVA 3TGNA 4A0YA 5BPDA 3VB2A 5FD5A 2BE5F 4FX0A 2KJCA 2QQAA 2ACJA 2OQGA 1XCBA 2VONA 1WRJA 1UHMA 3ZQ7A 3PFIA 4QWQA 2G9WA 1SMYF 1KU9A 2FF4A 3O6BB 5ICEA 3F8CA 2EJRA 3ISPA 3GO5A 4S05A 2A07F 1XMAA 3HUGA 3DXJF 3F8BA 3IRRA 3FXQA 1R23A 3ZMSA 3FM3A 1BI2A 1YG2A 3HOTA 2VC0A 3C1DA 1TLHB 4RGUA 2K02A 1DPRA 1IRFA 3REOA 3C3WA 4OIPF 1B4AA 1TTYA 5LGUA 1DP7P 4EJWA 2XAJA 3HTUA 1FOKA 2X0LA 5J8CA 2E1NA 3GZ5A 3E5QA 3DPTA 5HS8A 4CHUA 5EEHA 3L09A 2GXBA 3MZYA 3GFLA 2D1HA 1ZRFA 1IXCA 3FWEA 3JSPA 1CF7B 2QWWA 4A2UA 2RKHA 1ZN2A 4D0PA 3BP8A 2XAGA 1H9GA 4HW0A 1S7AA 2IRFG 2PN6A 4YFXF 4L0ZB 3H92A 3RDIA 2OBPA 2D45A 2EV5A 1USSA 2JRTA 2KJBA 2P5KA 3MEXA 1T2KA 3DV8A 5FLXZ 5AIQA 5DCFA 4ESFA 2ZMEA 1YO5C 2XUBA 2QENA 2OZUA 1MDMB 2GWRA 3KP6A 4A6DA 1O3RA 2F5EA 2QZ8A 2PI0A 2FBKA 1U5TC 3HIFA 1R00A 2Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEO A;  2LDU A;  3BOQ A;  2IA0 A;  2OZ6 A;  1XB4 A;  5DYM A;  1HKT A;  1MJB A;  5IT3 A;  5ED4 A;  3H3Z A;  1K78 A;  2P7V B;  1PP7 U;  1BC7 C;  4JK1 X;  3NEU A;  3E3V A;  3F8F A;  2XAS A;  2VBW A;  3FMS A;  3GFJ A;  3NRV A;  3VFZ A;  1R5G A;  3LAP A;  4LMY A;  5E18 F;  4FHT A;  3TOB A;  5LLQ A;  4RB0 A;  3N97 A;  6PAX A;  4G9Y A;  1ZGJ A;  3MAJ A;  2HOE A;  1R36 A;  4NQW A;  3I59 A;  3RTR A;  4OU0 A;  2RC4 A;  1U8R A;  2EFQ A;  5FFX A;  5A2Q Z;  2VC1 A;  1HW2 A;  5A2Q K;  4ASN A;  1ON1 A;  2IVM A;  2M30 A;  2XGX A;  4BHC A;  3QP6 A;  1IZ1 A;  5HDG A;  3WTU C;  2H6B A;  2HKX A;  4B09 A;  4F7Z A;  2IP2 A;  2P5L C;  4A5N A;  3MWM A;  5LEK A;  1HBX G;  2IPQ X;  3HHG A;  2MC3 A;  3HRM A;  4EJT A;  2DAO A;  1W5S A;  1WQ2 A;  2G7U A;  4KIG A;  4BXU A;  4RB2 C;  2QYO A;  2ZO4 A;  2XV4 S;  5K5O A;  2DPD A;  2IW5 A;  4HF0 A;  4KFC A;  1O3S A;  4HLX A;  3WU1 B;  1ONV A;  4GYI A;  5F1R A;  2HGC A;  4CGZ A;  1B9M A;  2XVC A;  5IT9 K;  1F5T A;  2DBB A;  3KE2 A;  1FWZ A;  1O57 A;  4OIR F;  5J8F A;  2VN2 A;  2ADU A;  5D6F A;  1S29 A;  4AVP A;  4ENJ A;  5HVQ C;  1QZY A;  3RJP A;  3ULQ B;  4RAZ A;  3D5L A;  2EV6 A;  5HS7 A;  5BPI A;  2D1V A;  1XMK A;  1A04 A;  1G4D A;  1SAX A;  3BDD A;  1G6N A;  2W25 A;  5DV5 A;  2ISZ A;  2BEO A;  4HQE A;  2NRA C;  1P6R A;  4L0Y B;  1P2F A;  1YS6 A;  3LA2 A;  4LG0 B;  1IXR C;  2P4W A;  1OPC A;  3ROU A;  2L02 A;  2NYX A;  2MD5 A;  4WK8 F;  3P9I A;  4P96 A;  1J59 A;  1ZLJ A;  3CUQ A;  4HA8 A;  3T8T A;  1QBJ A;  3BPX A;  3M9A A;  2DQR A;  1BIB A;  1O7F A;  3WG9 A;  4GCV A;  3GFM A;  3K1N A;  3HOS A;  5LHH A;  5CYV A;  1SD6 A;  1UFM A;  1OYW A;  4GO1 A;  5LEJ A;  1G3W A;  5DUK A;  5HOO A;  4MQV A;  2HTJ A;  5LHG A;  5FO5 A;  1W7P D;  3W6K B;  4ENM A;  3MFK A;  3U2R A;  5CVI A;  2DK8 A;  2ETH A;  1ZGA A;  2RGV A;  5FD6 A;  1XGS A;  1T6S A;  5L3G A;  3WE2 A;  1YW8 A;  2H94 A;  5HDK A;  4KDP A;  2AXL A;  5L3F A;  4HX8 A;  4KIF A;  3KP4 A;  3IC7 A;  1AWC A;  4LLN A;  1NHA A;  1SD5 A;  3EUH A;  3FXR A;  2HYF A;  2XAQ A;  1O3Q A;  2OD5 A;  5DEQ A;  4KN7 X;  1QPM A;  4CYD A;  2HQR A;  4HZF A;  2ZCW A;  2UXX A;  3Q5F A;  1C0W A;  4Q48 A;  3WTX C;  2L3D A;  4UHT A;  4I02 A;  2FA5 A;  5E1W A;  2JTV A;  3E5U A;  4L5J A;  4IVN A;  1I1G A;  1XSV A;  1IRG A;  1TQI A;  1D8J A;  1YTY A;  1YLF A;  2FNA A;  5L3B A;  2V6C A;  3FZV A;  1EH8 A;  3ABU A;  2H09 A;  4HQM A;  2KRF A;  4HDU A;  3R4K A;  1JHH A;  2RVC A;  1K7A A;  4HYE A;  4XSZ F;  3ERE D;  1T38 A;  3GLX A;  2IJL A;  1Z7U A;  1BN5 A;  1E17 A;  1U2W A;  2ZBK A;  5L3D A;  2PLY A;  2QBY B;  2V1X A;  2R7D A;  4BH9 A;  1MKM A;  4Q47 A;  4MQ9 F;  5FLX K;  2STT A;  1BJA A;  3K9T A;  2OQR A;  1W5T A;  2VE8 A;  3WGH A;  4AIH A;  1XDS A;  2O03 A;  4LD5 A;  2V9V A;  4O5V A;  4GGG A;  3BJO A;  3EYI A;  2HR3 A;  5ILV A;  1FBS A;  3ZMZ A;  4E70 A;  3SFZ A;  1S8N A;  1WKM A;  3ZN1 A;  2DI3 A;  5D6E A;  2RN7 A;  3I54 A;  4CIC A;  2ZKZ A;  3RIR A;  2R7F A;  1BC8 C;  4HV5 A;  1RIO H;  2W24 A;  1REP C;  3SXY A;  3BY6 A;  1ZG5 A;  2F5C A;  1TNT A;  3KP5 A;  3S2W A;  3JSO A;  4HF2 A;  4FX4 A;  1ZHF A;  3GZ6 A;  4EGZ A;  4WXC A;  3F6V A;  4GYG A;  2BBY A;  3HSE A;  4U88 A;  1TW2 A;  5JVT A;  2PEX A;  4M9X A;  3HRS A;  4YG2 F;  1K6O A;  1KYZ A;  2LF8 A;  1XGN A;  2HKO A;  2LF7 A;  2YPR A;  2M5W A;  1XN7 A;  4BNC A;  2PMH A;  3DF8 A;  3K69 A;  4KMF A;  2L4M A;  1Q1H A;  4WXH A;  3SZT A;  1RZ4 A;  2H6C A;  2STW A;  5CLS A;  3T0Y A;  3JAM Z;  2IA2 A;  3IKV A;  4P9U A;  2F2E A;  2XAF A;  5BS6 A;  3L7W A;  4G8X A;  1QZZ A;  1R22 A;  3F23 A;  3L2C A;  4IRG A;  3GUD A;  5DCM B;  2FRH A;  5CVU A;  4OIN F;  3CLO A;  3OOP A;  2EFW A;  2ZNY A;  3WOD F;  1MJ9 A;  2VT2 A;  1J0R A;  2YU3 A;  2VBY A;  3BRO A;  5E1Z B;  3WTS C;  5IT9 Z;  2EFN A;  5L3E A;  1FT9 A;  4KIC A;  3ZMU A;  3K2Z A;  2FBH A;  2ESH A;  1FX7 A;  3O2P E;  3GVA A;  2L54 A;  1U78 A;  5HS9 A;  1WWX A;  2Q0O A;  3KET A;  2XIG A;  4EVI A;  3E6M A;  2YX7 A;  3I71 A;  4L5I A;  2CQK A;  1LEB A;  2WWY A;  5D5U B;  3FHZ A;  4NHJ A;  4U7B A;  2VOD A;  4I2O A;  3K0L A;  1RNL A;  2VOP A;  3DPL C;  4WWC A;  3LST A;  2DPU A;  1FNN A;  2P8T A;  4L9T A;  4CXF A;  4P9F A;  2BGC A;  1MGT A;  2FU4 A;  4Y15 A;  4UV8 A;  2DTR A;  2O8X A;  1BI0 A;  3KCC A;  1FP1 D;  4MGR A;  1PP8 F;  1J5Y A;  1Z1D A;  2COM A;  4N9H A;  1FSH A;  2LSO A;  4IJA A;  1YIO A;  3EQL F;  1FYM A;  3HYI A;  1EH6 A;  4EJV A;  1IXS B;  3JW4 A;  3M8F A;  1EH7 A;  4I01 A;  3ZMT A;  2BV6 A;  1TBX A;  5D8K B;  4PGH A;  4I0B A;  5D4S A;  4YIF A;  1MZB A;  2GZW A;  4KN4 X;  4M72 A;  5LGT A;  4G7O F;  1KA8 A;  1X3U A;  4WCG A;  4L9J A;  4EGY A;  2FSW A;  2QLZ A;  2UXN A;  5ERI A;  1BOA A;  2QVO A;  4HBL A;  3WTV C;  5D8L B;  5E20 A;  4ZYD A;  5CVR A;  3V4G A;  3KZZ A;  2A69 F;  4IXA A;  5E8G A;  1TNS A;  4EM1 A;  3GEZ A;  2RNJ A;  5JI6 A;  1J75 A;  1RUN A;  2GA2 A;  2XAH A;  3R61 A;  3WU0 A;  5KVR A;  3GFI A;  1R7J A;  2MA3 A;  2FML A;  1H0M A;  1YS7 A;  3E97 A;  2VXZ A;  4G94 A;  4H0E A;  3QU6 A;  1LDK B;  2IA1 A;  3TO7 A;  2FXA A;  1ZRE A;  1FP2 A;  1RUO A;  1BBY A;  1T0F A;  3QPH A;  3Q9S A;  4UUV A;  2RQP A;  4AIJ A;  3E6C C;  2K86 A;  2MH2 A;  3IRQ A;  2UZK A;  3V8K A;  4KUM A;  5E17 F;  1PUE E;  3I59 B;  3E5X A;  4P5O A;  1H9T A;  3R6S A;  4ZYE A;  3WTT C;  3G3Z A;  5KK1 A;  3Q9V A;  3RKW A;  2MLG A;  1JE8 A;  3MQ0 A;  3QU3 A;  2X4H A;  2P7C B;  4MEX F;  1XDU A;  5K5R A;  4LK0 F;  1W7P B;  1HKQ A;  1XGM A;  4L9N A;  2W57 A;  3JAM K;  3KZY A;  2FOK A;  1F9N A;  4UNO A;  1G3T A;  4M6Y A;  3RKX A;  3RI4 A;  4MEY F;  4IPA A;  4M71 A;  1ZRD A;  4G7H F;  4HX7 A;  3KEQ A;  5ILS A;  1MDM A;  3I5U A;  3V7R A;  2G7H A;  1WI9 A;  4MTD A;  3LA7 A;  1XCV A;  4RGR A;  4CZZ A;  1OKR A;  3QPT A;  4TV7 A;  3FF5 A;  3LQQ A;  1SMT A;  4DNC A;  1T39 A;  1IN5 A;  1IW7 F;  1Z9C A;  2QBY A;  4EJO A;  3TOA A;  4G7Z F;  2HQN A;  3MCZ A;  4PDK A;  3TKY A;  1ZAO A;  3GYH X;  1KU3 A;  3PQJ A;  1Y0U A;  3M8E A;  1L3L A;  3CDH A;  2HTS A;  4KYW A;  2HFH A;  1ZLK A;  1CGP A;  5AIP A;  5H6Q A;  3WE3 A;  4B8X A;  4EM0 B;  5BMZ A;  2FE3 A;  3F6O A;  5E8I A;  1DPU A;  3QAH A;  3U9G A;  1JGS A;  4AD9 A;  2ZNZ A;  2XHK A;  1FBU A;  3E6B A;  3RYR A;  2V79 A;  1GXQ A;  1ON2 A;  4LJZ F;  3HTS B;  2A3S A;  1V4R A;  2ZFW A;  5HDN A;  1UST A;  5CVJ A;  1IAW A;  4HAM A;  2FNP A;  1HW5 A;  3KFW X;  1DUX C;  2PJP A;  2A6H F;  5HLG A;  3WGI A;  4YII A;  3J80 Z;  1LJ9 A;  3EYY A;  2DW4 A;  1AOY A;  4LLL A;  3F3X A;  3LQR A;  2DLL A;  1E2X A;  1F4K A;  3LAJ A;  4G6D A;  4HX4 A;  4ESB A;  2E7W A;  3J7A O;  5D4R A;  2JT1 A;  1K79 A;  1B6A A;  2DT5 A;  5AON A;  2DQL A;  1U6G A;  1HSJ A;  3V7C A;  3DQV C;  2DK5 A;  1ZG3 A;  3F21 A;  3CUQ B;  2E7X A;  4XBF A;  4I0A A;  3B73 A;  4PCQ A;  5TRD A;  4AIK A;  1J2X A;  5JFR A;  5LHI A;  3TDZ C;  3L00 A;  1OMI A;  3T5X A;  4JQF A;  3BPV A;  2DU9 A;  2D2W A;  2P6S A;  1FC3 A;  3V7S A;  1BM9 A;  2B0L A;  3V8J A;  3M1E A;  4ZZL A;  5JR3 A;  2TDX A;  1D3Y A;  2CW0 F;  3WTW C;  1TQM A;  4EJU A;  2JPB A;  1YFH A;  4ZZD A;  1R1V A;  1QQI A;  1FZP B;  2ZJ2 A;  4LFU A;  5LRR A;  5ICF A;  3DFG A;  3P9C A;  3F8N A;  2XRO A;  2EFP A;  1YQA A;  1B59 A;  3ECO A;  4HOB A;  1JXS A;  2WV0 A;  1GXP A;  4M73 A;  3QRF F;  2Z3Y A;  4ESJ A;  2AS5 F;  3GW2 A;  2FMY A;  3JTG A;  2PBI A;  3KLN A;  3P9K A;  1XGO A;  1GHC A;  2HWV A;  1DDN A;  3LWF A;  3SZP A;  1LEA A;  2GIV A;  2KIF A;  4LLG F;  2NS0 A;  3GXO A;  3N4M A;  3T8R A;  4A0X A;  1CF7 A;  1FYK A;  1KGS A;  4R1H A;  2HEO A;  4M9Z A;  4BYY A;  3I53 A;  1ZRC A;  4KA4 A;  2CYY A;  4RB1 A;  3KP7 A;  4IRI A;  2F5D A;  1J9I A;  3U1D A;  1BI1 A;  3IL2 A;  2NNY A;  3VEP A;  2F5F A;  3PQK A;  2XRN A;  5JHU A;  4Q4Z F;  4M9S A;  4I09 A;  2FQ3 A;  1SD7 A;  3RPQ A;  1FLI A;  2Q2E A;  3GX4 X;  4KT5 C;  1LB2 A;  3F72 A;  1SFX A;  4RGS A;  4O6J A;  4NB5 A;  1IUY A;  5ILU A;  3ZPL A;  2MBF A;  3ABT A;  2OAZ A;  1IN6 A;  4IHS A;  4ENN A;  1FBQ A;  2NAZ A;  4QLC U;  4OMZ A;  2XKP A;  1I1S A;  1S6L A;  3NQO A;  2RV8 A;  4BAY A;  1V3F A;  3O3K A;  2CFX A;  3J81 Z;  3M7G A;  3CUQ C;  2WTE A;  4I98 B;  2M45 A;  3I4P A;  2FEZ A;  1I6X A;  3I64 A;  1HST A;  3HRT A;  3K1M A;  2YR2 A;  4BHB A;  2JPC A;  5D5X B;  4PGG A;  2P5V A;  1F1Z A;  3QOP A;  2YSR A;  4RGX A;  2Z99 A;  3C18 A;  1IN8 A;  5H20 A;  5ICG A;  2V1D A;  2K4J A;  3GWZ A;  3K1P A;  2GAU A;  5CJ9 A;  1YW7 A;  4YFN F;  1TQP A;  4DQ2 A;  4KMU X;  2VBX A;  2W84 A;  2HYG D;  2GQQ A;  3VOD A;  1YW9 A;  2VOO A;  3VOE A;  2ESN A;  1IN7 A;  1B9N A;  5DUI A;  3L9F A;  1L0O C;  4Z2Y A;  3EET A;  3T1B A;  5EEG A;  1MJA A;  1ZYR F;  4UV9 A;  5BQT A;  2OU2 A;  1ZG1 A;  1Z6T A;  1S7O A;  4OIO F;  2P6T A;  4IF4 A;  1G3Y A;  4Y17 A;  3V8L A;  2YX4 A;  1KQ0 A;  1VTN C;  1QO0 D;  5F64 A;  3GF2 A;  2UWM A;  2ZME B;  4EQQ A;  2NNN A;  3FX3 A;  2ELH A;  1P4W A;  3LFK A;  4EM2 A;  3HRU A;  2A6E F;  3BWG A;  4A6E A;  2DFI A;  1IF1 A;  1Z05 A;  1G3S A;  1HXD A;  5DDG A;  4N0B A;  2EA4 A;  2IT0 A;  3DKW A;  2PFB A;  4WX9 A;  4ON0 A;  2Z9O A;  3COA C;  1KQ8 A;  1B1B A;  4IHT A;  4R8H A;  2QUF A;  4A5M A;  5J6X A;  1R1U A;  3QP5 A;  3ZMD A;  3KLO A;  2Q8K A;  1FPQ A;  3CTA A;  1SD4 A;  1O7L A;  2CG4 A;  2W85 A;  3IWF A;  3W6J B;  3TQN A;  5DCM A;  3WTY C;  4A12 A;  4BHP A;  1Z6R A;  2CGP A;  2LKP A;  4AWX B;  1SFU A;  4XSX F;  3CO7 C;  2K7L A;  1BI3 A;  2Z5U A;  4RAY A;  2O3F A;  1SFE A;  4XRF A;  1HW1 A;  1XSX A;  1RI7 A;  3R60 A;  2EWN A;  1ZAR A;  2HZT A;  3B02 A;  1IN4 A;  5DD4 A;  2MLK A;  3CUO A;  3DEU A;  4O3M A;  2A5Y B;  5K1Y A;  3MZH A;  4UVB A;  4MHG A;  2C6Y A;  2O6G E;  3SQN A;  2O61 A;  3KP3 A;  3WGG A;  3SHF A;  1TW3 A;  4MTE A;  5L3C A;  1D8K A;  2QM3 A;  4HV6 A;  2VT3 A;  1LQ1 A;  1YYV A;  1K78 B;  1OR7 A;  4GXO A;  3F22 A;  4WXD A;  5ICC A;  4HF1 A;  2K4B A;  2MH9 A;  1FYL A;  1ULY A;  1U5T B;  4P55 A;  2K27 A;  3H3U A;  2EA2 A;  4U7D A;  1I27 A;  2GXG A;  4PZJ A;  1KYW A;  4LK1 F;  1D5V A;  3FM5 A;  5FFZ A;  5FGM A;  1ZH5 A;  3CJN A;  3C7J A;  5FB2 A;  2Z33 A;  3CO6 C;  4ENK A;  2CO5 A;  2EK5 A;  4XLN F;  3IHU A;  4ZH4 F;  2OA4 A;  4Y13 A;  1LDJ A;  3HSF A;  1R58 A;  2QQB A;  4MNU A;  1GVJ A;  2CSO A;  3RYP A;  2VE9 A;  1LVA A;  2M1B A;  3E6D A;  3I58 A;  4I7H A;  4OIQ F;  2KIM A;  2L4A A;  5E1X A;  3TO6 A;  1FSE A;  3IKT A;  1HKS A;  3I0T A;  1R1T A;  4LB6 B;  1P92 A;  2Y48 A;  2HS5 A;  4CO8 A;  4JBA A;  4L9V A;  4LB5 A;  4RS8 A;  4CDG A;  2M8E A;  5DD8 A;  1LNW A;  5D5W B;  3BJA A;  4A0Z A;  2PMU A;  2KKO A;  4IRH A;  3TDU C;  3P7N A;  2LNB A;  4UXN A;  2RDP A;  2M87 A;  3G73 A;  1W4M A;  3ECH A;  1KQ9 A;  4K2E A;  4WF2 A;  2J5P A;  1P4A A;  1EV7 A;  2HDC A;  2JZY A;  2XKO A;  5HLH A;  4UVA A;  4EV0 A;  1UB9 A;  2A68 F;  4XLP F;  1OYI A;  1W7P A;  1T98 A;  1KU2 A;  1QNT A;  3ELK A;  4EMS A;  3AAF A;  2WC2 A;  1MD0 A;  4U0W A;  1JHF A;  3ZP5 A;  2VBZ A;  3ML6 A;  3DP7 A;  1OYY A;  5LRS A;  2R3S A;  5H6R A;  2J5O A;  5TJJ A;  3R0A A;  1S3J A;  4KNY A;  2QQ9 A;  2Y75 A;  1U3E M;  4KIB A;  3HHH A;  2DO7 A;  1R5H A;  3R0J A;  1BIA A;  2E1C A;  2FBI A;  4RB3 C;  3D0S A;  1XD7 A;  2ZXJ A;  4N9I A;  3ZN0 A;  4OMY A;  2H27 A;  2V1U A;  1XSD A;  3RKY A;  1LDD A;  3KP2 A;  2A61 A;  3WTZ A;  2BYV E;  4R79 A;  3FMQ A;  2EV0 A;  3RPU A;  4LG0 A;  4ZYH A;  2CWE A;  4HDV A;  1ODD A;  3IWZ A;  3TO9 A;  1UHW A;  4ZYG A;  2PG4 A;  4UVC A;  4ETS A;  4BQA A;  4OOI A;  3J81 K;  4L18 B;  4S04 A;  2EFO A;  4G6Q A;  3JTH A;  3FXU A;  4M6X A;  1FY7 A;  1I5Z A;  2KIU A;  1HQC A;  2GA1 A;  1P4X A;  2O0Y A;  2JSC A;  1J7K A;  5D5V B;  1Z91 A;  2PQ8 A;  5HLI A;  5LBQ A;  3OV8 A;  4Q5S F;  5CVV A;  4HLY A;  1PDN C;  1KU7 A;  3J80 K;  5F6F A;  5K5Q A;  1WSU A;  3FMR A;  4LGW A;  1U5T A;  3BZ6 A;  4U0V A;  2EB7 A;  5LGN A;  1QGP A;  1O3T A;  3F8M A;  4FT8 A;  1UCR A;  2L01 A;  4YFK F;  1STZ A;  3LA3 A;  3HSR A;  4U0Y A;  4M74 A;  2ISY A;  5BOX A;  3BJ6 A;  3EDP A;  3ZMV A;  3TGN A;  4A0Y A;  5BPD A;  3VB2 A;  5FD5 A;  2BE5 F;  4FX0 A;  2KJC A;  2QQA A;  2ACJ A;  2OQG A;  1XCB A;  2VON A;  1WRJ A;  1UHM A;  3ZQ7 A;  3PFI A;  4QWQ A;  2G9W A;  1SMY F;  1KU9 A;  2FF4 A;  3O6B B;  5ICE A;  3F8C A;  2EJR A;  3ISP A;  3GO5 A;  4S05 A;  2A07 F;  1XMA A;  3HUG A;  3DXJ F;  3F8B A;  3IRR A;  3FXQ A;  1R23 A;  3ZMS A;  3FM3 A;  1BI2 A;  1YG2 A;  3HOT A;  2VC0 A;  3C1D A;  1TLH B;  4RGU A;  2K02 A;  1DPR A;  1IRF A;  3REO A;  3C3W A;  4OIP F;  1B4A A;  1TTY A;  5LGU A;  1DP7 P;  4EJW A;  2XAJ A;  3HTU A;  1FOK A;  2X0L A;  5J8C A;  2E1N A;  3GZ5 A;  3E5Q A;  3DPT A;  5HS8 A;  4CHU A;  5EEH A;  3L09 A;  2GXB A;  3MZY A;  3GFL A;  2D1H A;  1ZRF A;  1IXC A;  3FWE A;  3JSP A;  1CF7 B;  2QWW A;  4A2U A;  2RKH A;  1ZN2 A;  4D0P A;  3BP8 A;  2XAG A;  1H9G A;  4HW0 A;  1S7A A;  2IRF G;  2PN6 A;  4YFX F;  4L0Z B;  3H92 A;  3RDI A;  2OBP A;  2D45 A;  2EV5 A;  1USS A;  2JRT A;  2KJB A;  2P5K A;  3MEX A;  1T2K A;  3DV8 A;  5FLX Z;  5AIQ A;  5DCF A;  4ESF A;  2ZME A;  1YO5 C;  2XUB A;  2QEN A;  2OZU A;  1MDM B;  2GWR A;  3KP6 A;  4A6D A;  1O3R A;  2F5E A;  2QZ8 A;  2PI0 A;  2FBK A;  1U5T C;  3HIF A;  1R00 A;  2Y0M A; 
#chains in the Genus database with same CATH topology
 3KEO A;  4D1Q A;  2LDU A;  3BOQ A;  2IA0 A;  3ESW B;  4M3D A;  2IBD A;  3HL2 A;  2OZ6 A;  1XB4 A;  2L9S A;  5DYM A;  1HKT A;  4DBR A;  3SDG A;  1MJB A;  5IT3 A;  3CD6 I;  1UG2 A;  3I56 I;  3MN2 A;  5ED4 A;  5FKN A;  2DYS H;  3H3Z A;  1K78 A;  2GBY A;  1I39 A;  3VYS B;  2P7V B;  1PP7 U;  1BC7 C;  4JK1 X;  3NEU A;  4L5E A;  4Y7N J;  3E3V A;  2V26 A;  3F8F A;  2XAS A;  2XSD C;  1Y6I A;  3JRF A;  2O8K A;  2VBW A;  3FMS A;  2HVQ A;  1OCZ H;  1ZK8 A;  3GFJ A;  1QRY A;  1R5G A;  3NRV A;  3VFZ A;  3LAP A;  3L2V A;  2DOD A;  4LMY A;  5E18 F;  4FHT A;  3TOB A;  3U1K A;  1VZ0 A;  4RB0 A;  5LLQ A;  3N97 A;  6PAX A;  2AHQ A;  3QQA A;  4G9Y A;  1ZGJ A;  5M3F J;  3MAJ A;  4C3H J;  2WAE A;  1LPQ A;  2HOE A;  1R36 A;  4NQW A;  3G1O A;  3I59 A;  3ZQI A;  1SAN A;  3RTR A;  2KRH A;  2BY2 A;  2XGD A;  4OU0 A;  3RQI A;  1WJF A;  1BW6 A;  2RC4 A;  2ID6 A;  4FET A;  2VKD A;  4NUB A;  5FKL A;  3FXK A;  2XF5 A;  1U8R A;  2EFQ A;  5FFX A;  5A2Q Z;  1Z0X A;  3J7Y J;  2VC1 A;  1HW2 A;  5M5Y J;  5A2Q K;  3HG9 A;  4ASN A;  4S0H B;  3S1Q J;  1ON1 A;  1OLT A;  2IVM A;  2M30 A;  1G8X A;  2XGX A;  1R5I D;  4BHC A;  3QP6 A;  4BAC A;  1IZ1 A;  5HDG A;  3WTU C;  3HOX J;  2H6B A;  5KAF C;  3OSG A;  1KZH A;  1NH3 A;  2HKX A;  4B09 A;  4DYR A;  4F7Z A;  2ELK A;  2IP2 A;  2P5L C;  1S9H A;  4I76 A;  4A5N A;  3MWM A;  2B7E A;  5LEK A;  1HBX G;  2IPQ X;  3HHG A;  2ID3 A;  1IJW C;  2G0E A;  2MC3 A;  2KLO A;  3U21 A;  2XAU A;  1I6H J;  3HRM A;  1JUM A;  4EJT A;  2DAO A;  1W5S A;  1WQ2 A;  1SAU A;  2TCT A;  1MH3 A;  2G7U A;  4KIG A;  4BXU A;  4RB2 C;  2QYO A;  2ZO4 A;  3BT9 A;  2XV4 S;  2RAE A;  3DU6 A;  5K5O A;  2DPD A;  2IW5 A;  4RAG A;  4A3F J;  3LSR A;  2VQH A;  2K5C A;  1JKP C;  4HF0 A;  4EEF G;  1MBJ A;  4KFC A;  2N8G A;  1O3S A;  2F6C A;  4HLX A;  3ZQC A;  4N4N B;  3CCY A;  2DYR H;  2JK3 A;  2OUM A;  3WU1 B;  3SZG A;  2E34 A;  1ONV A;  4GYI A;  4DZP A;  4J19 A;  1UG0 A;  5F1R A;  1MBE A;  1ZTR A;  3G1M A;  2CQN A;  4D7N A;  2HGC A;  2OPT A;  1B9M A;  3CDL A;  4CGZ A;  2XVC A;  3TBI A;  2K85 A;  5IT9 K;  4D5F A;  2ECC A;  1F5T A;  2DBB A;  4BEH B;  3KE2 A;  1FWZ A;  2QEX I;  2R7X A;  1O57 A;  4OIR F;  5J8F A;  3DWL E;  3ZQQ A;  2VN2 A;  3Q0U A;  3O8G A;  3L2R A;  1JT0 A;  3I4M J;  2ADU A;  5D6F A;  1S29 A;  2ME6 A;  2HU9 A;  4AVP A;  4ENJ A;  5HVQ C;  1QZY A;  3RJP A;  2MC4 A;  1P9Q C;  3ULQ B;  4RAZ A;  3D5L A;  4PK4 A;  2EV6 A;  5HS7 A;  1LUJ B;  3DEW A;  1BL0 A;  5HNH A;  5HLT A;  5F0C A;  5BPI A;  2D1V A;  4F93 B;  1XMK A;  1A04 A;  4E7Z A;  1G4D A;  1SAX A;  2UV1 A;  3BDD A;  2R5Y A;  1G6N A;  2W25 A;  2M9H A;  5DV5 A;  2ISZ A;  2BEO A;  1MMA A;  4HQE A;  2NRA C;  2NOG A;  2L7Z A;  1P6R A;  4C2T A;  4L0Y B;  1P2F A;  1YS6 A;  2HPI A;  2DFE A;  3LA2 A;  3HJE A;  4LG0 B;  2EQR A;  5J1Y A;  3HPG A;  1W0U A;  1RKT A;  1IXR C;  2F4O B;  2P4W A;  1AU7 A;  1OPC A;  3ROU A;  2L02 A;  2NYX A;  1VQ7 I;  3V42 A;  2MD5 A;  4WK8 F;  3P9I A;  4P96 A;  1J59 A;  1TC3 C;  2COB A;  1ZLJ A;  3CUQ A;  4HA8 A;  5B1A H;  3DTI A;  3T8T A;  1QBJ A;  3JRD A;  2DMN A;  3S1R J;  2R7Z J;  3BPX A;  3LMM A;  1YHQ I;  2IS2 A;  2L9V A;  3M9A A;  2DQR A;  5E79 C;  3SDB A;  3A02 A;  1BIB A;  1JTX A;  2GIZ A;  3OYN A;  4XRS G;  3BG7 A;  1O7F A;  3WG9 A;  4GCV A;  3GFM A;  3K1N A;  3HOS A;  3LSG A;  5LHH A;  5CYV A;  1SD6 A;  1UFM A;  1OYW A;  1MW7 A;  4GO1 A;  5FLM J;  5LEJ A;  1G3W A;  5DUK A;  5HOO A;  5IY5 H;  4MQV A;  5EEA A;  2HTJ A;  4AYB A;  5LHG A;  2KP6 A;  2QKL B;  5FO5 A;  1W7P D;  3W6K B;  4E6K G;  1RKW A;  4FCY A;  3GLL A;  4ENM A;  2CUE A;  1VQO I;  3MFK A;  2OCE A;  3U2R A;  5CVI A;  2DK8 A;  4XKC A;  2ETH A;  3S1M J;  1ZGA A;  2JJ7 A;  2RGV A;  1SFO J;  5FD6 A;  1XGS A;  1T6S A;  5B3S H;  5L3G A;  1DU0 A;  1HCR A;  2XB0 X;  1RPW A;  4BJ6 C;  3WE2 A;  3GTL J;  1YW8 A;  1WJ5 A;  2H94 A;  5HDK A;  4KDP A;  2AXL A;  4CCO A;  3FK7 A;  1U9N A;  4A3J J;  5L3F A;  1JJ6 C;  1MMS A;  3I55 I;  4HX8 A;  1VQ9 I;  3A01 A;  2BHY A;  4KIF A;  3KP4 A;  3IC7 A;  1AWC A;  2EIM H;  4LLN A;  1NHA A;  1SD5 A;  3EUH A;  3MZ8 A;  3FXR A;  2HYF A;  4I99 C;  1UJ8 A;  2WV1 A;  2XAQ A;  1O3Q A;  2OD5 A;  5DEQ A;  4KN7 X;  3OYH A;  4ZDL A;  1QPM A;  3FXJ A;  4CYD A;  2HQR A;  4HZF A;  1X19 A;  2ZCW A;  4CSW A;  2HI3 A;  2UXX A;  3I3L A;  3UKG A;  3Q5F A;  1C0W A;  4Q48 A;  3WTX C;  1VQK I;  2L3D A;  2PMZ A;  4UHT A;  4I02 A;  1J09 A;  2FA5 A;  2JTV A;  2VKV A;  4JYK A;  4LIV A;  5E1W A;  2GM4 A;  2W48 A;  3E5U A;  4L5J A;  4IVN A;  4B47 A;  1I1G A;  1XSV A;  4PJ0 C;  3S3M A;  1IRG A;  1TQI A;  1XG1 A;  3P5J A;  1AKH B;  1D8J A;  2FOW A;  2HXI A;  3WG7 H;  1WFX A;  2ZSH B;  1YTY A;  2DA7 A;  2FNA A;  1YLF A;  1I3Q J;  2EZI A;  1ETK A;  2L2O A;  5L3B A;  2V6C A;  3FZV A;  3BG9 A;  1EH8 A;  3K10 A;  4NBQ A;  4A69 C;  2AQE A;  2H8W A;  3ABU A;  2H09 A;  4XKB A;  4HQM A;  3AFH A;  2KRF A;  4HDU A;  3BTL A;  3R4K A;  1MNE A;  1RET A;  4E7I A;  2IS4 A;  3ZCO A;  1JHH A;  1JI8 A;  1Y39 A;  2RVC A;  3M07 A;  4G6T B;  4HNT A;  1K7A A;  4HYE A;  3S32 A;  4XSZ F;  4RLF A;  3ERE D;  2MFZ A;  1T38 A;  1ORK A;  3GLX A;  3JR9 A;  2IJL A;  1VQM I;  1Z7U A;  4NQW B;  2HVR A;  1BN5 A;  1E17 A;  1U2W A;  3HOU J;  3ZQH A;  4II2 A;  1MND A;  1VI0 A;  2ZBK A;  5L3D A;  3E0J B;  2PLY A;  2QBY B;  3PO3 J;  2V1X A;  3HEF A;  2R7D A;  4XR6 A;  4BH9 A;  2MD0 A;  3ASN H;  4A3K J;  1TL8 A;  1MKM A;  4V19 K;  2NS7 A;  4Q47 A;  4MQ9 F;  4XN3 A;  5FLX K;  2DMT A;  2STT A;  1BJA A;  3K9T A;  2OQR A;  1W5T A;  2VE8 A;  3WGH A;  4AIH A;  4PSX A;  1XDS A;  2O03 A;  4LD5 A;  5IYC J;  2V9V A;  1RC9 A;  3S14 J;  4O5V A;  2VQL A;  1WH7 A;  4GGG A;  3BJO A;  3EYI A;  2HOA A;  3KYC B;  4HEA 2;  2HR3 A;  5ILV A;  1FBS A;  4LG3 A;  3ZMZ A;  3BQY A;  4CCK A;  1XC5 A;  4E70 A;  3SFZ A;  1TWC J;  1UZC A;  1S8N A;  1WKM A;  3ZN1 A;  2DI3 A;  3WHB A;  5D6E A;  2RN7 A;  3A0H C;  4BQN A;  4RBO A;  1EJ9 A;  3I54 A;  3VYT B;  4CCJ A;  1VQ8 I;  4CIC A;  3DTK A;  2ZKZ A;  4RLQ A;  2R7F A;  3RIR A;  2I10 A;  4UB8 C;  2AXT C;  1BC8 C;  5J3L A;  5E3L A;  5EF6 A;  1E0E A;  4HV5 A;  1RIO H;  2LR8 A;  2W24 A;  1REP C;  3SXY A;  1FIA A;  2VB6 A;  3BY6 A;  5GTI C;  5CQE A;  1OCO H;  1ZG5 A;  3DTE A;  1APL C;  2M0M A;  1MIJ A;  2F5C A;  1GVD A;  1TNT A;  3KP5 A;  3S2W A;  2LD5 A;  1N25 A;  3JSO A;  3W2V A;  5F27 A;  5FLV A;  1GUU A;  2HQA A;  2R93 J;  4HF2 A;  4FX4 A;  1ZHF A;  3GZ6 A;  5IYB J;  4EGZ A;  4WXC A;  1IG7 A;  2BXZ A;  3F6V A;  4GYG A;  3HB9 A;  5EYR A;  2BBY A;  2LVS A;  1ERD A;  2Q1Z B;  3HSE A;  4U88 A;  4IL6 C;  2F5V A;  1TW2 A;  4II3 A;  3G1L A;  5JVT A;  3QYE A;  2PEX A;  2W00 A;  3ZXS A;  2NVT J;  2IGN A;  4M9X A;  3HRS A;  4YG2 F;  1K6O A;  1KYZ A;  2LF8 A;  1XGN A;  2HKO A;  2LF7 A;  2YPR A;  3I9V 2;  2M5W A;  1TWF J;  1QHG A;  2EH3 A;  1XN7 A;  2P0W A;  4BNC A;  2PMH A;  3DF8 A;  2EZH A;  3K69 A;  4KMF A;  2L4M A;  3H5R A;  4C9Y A;  1Q1H A;  1D1B A;  4WXH A;  3SZT A;  1RZ4 A;  2H6C A;  2MW8 A;  2TRT A;  1WGX A;  5CLS A;  3T0Y A;  2R5Y B;  2STW A;  3JAM Z;  2IA2 A;  4XLH A;  2D5V A;  1WJA A;  3IKV A;  2BW3 A;  2R7V A;  3JRC A;  1D5Y A;  2HDD A;  3GTP J;  4P9U A;  3NAU A;  2W1O A;  3DU5 A;  2F2E A;  2XAF A;  5BS6 A;  3L7W A;  2DJI A;  3VYU B;  3K4B A;  3ZR8 X;  4G8X A;  1VQ6 I;  1QZZ A;  1R22 A;  2V1N A;  3F23 A;  4XRS A;  3EPZ A;  4IRG A;  3L2C A;  2QA4 I;  3GUD A;  3SJM A;  3PL8 A;  5DCM B;  3JRE A;  2FRH A;  4HNU A;  1HLV A;  4IQ4 A;  5CVU A;  4OIN F;  4KIT B;  3O8H A;  3CLO A;  3OOP A;  3HDD A;  2EFW A;  2ZNY A;  3WOD F;  1MJ9 A;  3LSH A;  4QSH A;  2VT2 A;  3HC7 A;  5EGO B;  1J0R A;  1ITY A;  2YU3 A;  4BE0 A;  2VBY A;  3F0C A;  2QSH X;  2CUZ A;  3BRO A;  3HKZ N;  2QQ8 A;  3S3O A;  5E1Z B;  1Z21 A;  4I6Z A;  4XLE A;  3WTS C;  2M34 A;  5IT9 Z;  2EFN A;  5L3E A;  1FT9 A;  4KIC A;  3HPH A;  3ZMU A;  4BBR J;  3OYF A;  3K2Z A;  2CW7 A;  2FBH A;  2ESH A;  4XQF A;  1FX7 A;  2BW3 B;  4IHY A;  3VYR B;  3O2P E;  5IOZ A;  3GVA A;  2L54 A;  1T0F C;  2K40 A;  2JA2 A;  1U78 A;  5HS9 A;  1WWX A;  2Q0O A;  3CJQ B;  2XIG A;  4EVI A;  1ETQ A;  5FJ8 J;  3KET A;  1ZGW A;  4RM2 A;  5IYD J;  3E6M A;  2YX7 A;  2FX0 A;  5H2F C;  3I71 A;  2HPM A;  2LOO A;  4L5I A;  2CQK A;  1AKH A;  1JKQ C;  1LEB A;  2WWY A;  5D5U B;  3FHZ A;  1VND A;  4BBS J;  2BVL A;  2CUJ A;  1UAA A;  4Y4R A;  4NHJ A;  1NTC A;  4U7B A;  3LSP A;  3LSI A;  4HSR A;  2VOD A;  4I2O A;  3K0L A;  1RNL A;  3H9J A;  2VOP A;  4MO7 A;  3K4C A;  1ETX A;  3DPL C;  4WWC A;  4XL9 A;  1V55 H;  4V2F A;  3LST A;  2K3P A;  2DPU A;  2H1L A;  3KEY A;  3RZD J;  1FNN A;  1LFU P;  4E7L A;  2ZJQ F;  2P8T A;  1YJW I;  2PJR B;  4L9T A;  3OYC A;  1W36 D;  4CXF A;  4OAY A;  2BGC A;  4P9F A;  3Q3S A;  1MGT A;  2FU4 A;  4Y15 A;  4UV8 A;  2DTR A;  3DKX A;  4PJL A;  1IC8 A;  2O8X A;  4D5C A;  3RPU D;  4BDZ A;  2KRC A;  3CF5 F;  1BI0 A;  3KCC A;  1FP1 D;  4MGR A;  1PP8 F;  1J5Y A;  1Z1D A;  2COM A;  4N9H A;  1FSH A;  2LSO A;  4IJA A;  1YIO A;  3EQL F;  1FYM A;  3HYI A;  3HXL A;  1EH6 A;  1WVR A;  4GDF A;  2JVH A;  4EJV A;  1IXS B;  1GV5 A;  3JW4 A;  2K3F A;  3M8F A;  1EH7 A;  3H9Q A;  3BG6 A;  4PSW A;  4I01 A;  3ZMT A;  1HDP A;  2BV6 A;  1TBX A;  1ETW A;  5D8K B;  4PGH A;  4I0B A;  5D4S A;  4A3L J;  4YIF A;  1A36 A;  1MZB A;  4RDU A;  2GZW A;  1OCT C;  3N05 A;  1X3W B;  4KN4 X;  4M72 A;  5LGT A;  1K61 A;  1A31 A;  3HZJ A;  2VJJ A;  4G7O F;  1KA8 A;  2QKM B;  1E3P A;  1IRZ A;  1H89 C;  2R92 J;  1P7I A;  1BR4 A;  2E35 A;  3ABK H;  1X3U A;  2LMD A;  3A4C A;  4WCG A;  1UHS A;  3OYI A;  3W6V A;  1I3A A;  3LSM A;  4L9J A;  4B3X A;  4CYC B;  2VPR A;  2X48 A;  4EGY A;  5IPA A;  2FSW A;  1D0X A;  2QLZ A;  1E3O C;  3CCQ I;  2UXN A;  2L7F P;  5ERI A;  2BXY A;  2LBF B;  4DIQ A;  3MKZ A;  4BDY A;  1BOA A;  3BZK A;  2QVO A;  4HBL A;  3WTV C;  2LRD A;  5D8L B;  5E20 A;  4ZYD A;  2M0C A;  5CVR A;  1OCC H;  3V4G A;  3S15 J;  3KZZ A;  2A69 F;  2Y0S N;  4IXA A;  5E8G A;  1TNS A;  4XOR A;  3GEZ A;  2RNJ A;  4EM1 A;  3CZ6 A;  5JI6 A;  3ZQL A;  4LOC A;  1J75 A;  1RUN A;  1DGW Y;  3A0B C;  2GA2 A;  3W2W A;  1VFC A;  1K4S A;  4ZDO A;  2XAH A;  5GP9 A;  3R61 A;  3WU0 A;  5KVR A;  3GFI A;  1R7J A;  2NVX J;  3DBH B;  2MA3 A;  2FML A;  1H0M A;  5J1R A;  1YS7 A;  1MH4 A;  2CS3 A;  1LFP A;  3E97 A;  4LIT A;  2VXZ A;  3PSI A;  4IQJ A;  2Y69 H;  1OCP A;  1T33 A;  1WJD A;  4G94 A;  1IV6 A;  4H0E A;  3QU6 A;  1LDK B;  2IA1 A;  1QPI A;  2IGM A;  3TO7 A;  4BE2 A;  2A05 A;  2FXA A;  1ZRE A;  3NWS A;  1FP2 A;  5FRM A;  1RUO A;  1BBY A;  1T0F A;  3GTJ J;  3QPH A;  2M4G A;  3Q9S A;  5EDN A;  4UUV A;  1EA3 A;  1FOY A;  3BTJ A;  3S2D J;  1TT0 A;  2RQP A;  4CA0 A;  4AIJ A;  2X85 A;  1HOM A;  2M2E A;  3E6C C;  2K86 A;  2MH2 A;  4FQG A;  4RA2 A;  3IRQ A;  2L5Q A;  2DOF A;  1RR7 A;  2UZK A;  3V8K A;  4N4O B;  4KUM A;  5E17 F;  1SVM A;  1PUE E;  3I59 B;  3E5X A;  4P5O A;  3SEQ A;  4E4H A;  3R6S A;  4ZYE A;  3WTT C;  4XOP A;  5KAI C;  3G71 I;  1H9T A;  3G3Z A;  5KK1 A;  3Q9V A;  3RKW A;  2MLG A;  1JE8 A;  3MQ0 A;  3F9K A;  3QU3 A;  3DPU A;  4Z6Y A;  3ASO H;  2KHM A;  3QOE A;  1YJN I;  5HNF A;  3BG3 A;  2VJ4 A;  4A3D J;  2KZV A;  2X4H A;  3OIQ A;  1K4T A;  4MEX F;  2KZG A;  2P7C B;  1WH5 A;  3B6C A;  1XDU A;  2M7A A;  2CH0 A;  5K5R A;  4LK0 F;  1W7P B;  1HKQ A;  1XGM A;  2QSF X;  2W57 A;  4L9N A;  2JN6 A;  5HOD A;  3JAM K;  3KZY A;  2FOK A;  1F9N A;  4JP0 A;  3BC8 A;  4BXX J;  4UNO A;  1G3T A;  1F43 A;  3K70 D;  4M6Y A;  3RKX A;  3RI4 A;  1YJ9 I;  4MEY F;  2CQ7 A;  2XGE A;  4ZYA A;  1VQ5 I;  5J47 A;  4IPA A;  4M71 A;  1FEX A;  2KQR A;  5CKT A;  3QWL A;  1ZRD A;  4G7H F;  4NNJ A;  2R7T A;  4HX7 A;  2LYC A;  3KEQ A;  4XKW A;  1Y8Q B;  4FTH A;  3PUB A;  5ILS A;  1MDM A;  3I5U A;  3V7R A;  3L1P A;  3G6E I;  2G7H A;  1WI9 A;  2LY1 A;  3OYD A;  4MTD A;  3LA7 A;  1XCV A;  4RGR A;  1WJC A;  1TT5 B;  4CZZ A;  1OKR A;  4B43 A;  3QPT A;  1X4O A;  4TV7 A;  3FF5 A;  3LQQ A;  1SMT A;  4KJZ A;  3M1C A;  1GT0 C;  1Q1V A;  1Z3X A;  3K4K A;  1V54 H;  3C2G A;  4DNC A;  2QF7 A;  1T39 A;  3CP8 A;  1IN5 A;  1Z67 A;  3K4M A;  1Z7L A;  1IW7 F;  2X9D A;  1Z9C A;  2QBY A;  1X3Z B;  4EJO A;  3TOA A;  4G7Z F;  3IP4 B;  2HQN A;  3MCZ A;  4PDK A;  3AL0 B;  3M3Y J;  2ZB9 A;  3TKY A;  3J7A Y;  1ZAO A;  3GYH X;  1KU3 A;  3PQJ A;  1Y0U A;  4KT6 A;  2DXI A;  3M8E A;  1L3L A;  3CDH A;  1XMX A;  2HTS A;  4RMN A;  5DM6 F;  4KYW A;  1X2M A;  2I8D A;  3S1N J;  2XB5 A;  2HFH A;  3KZI C;  2EIL H;  3MVP A;  3H0D A;  1ZLK A;  2X1E A;  2MGQ A;  1CGP A;  4ZTF A;  5AIP A;  3K4J A;  5H6Q A;  3WE3 A;  4HPQ A;  5GAE J;  2KT0 A;  3CJT B;  4IEJ A;  4B8X A;  4EM0 B;  5BMZ A;  3LNQ A;  2FE3 A;  3F6O A;  5DM7 F;  3JRI A;  4JOM A;  3GZN B;  5E8I A;  1G59 A;  3TW6 A;  1DPU A;  3QAH A;  3U9G A;  5IOY A;  3GBG A;  2O9L A;  3IH2 A;  4CCM A;  1YRN B;  1HF0 A;  3CJR B;  4UUS B;  1JGS A;  1MBF A;  4RM3 A;  3RCO A;  3MD2 A;  4AD9 A;  2CQX A;  2ZNZ A;  2XHK A;  1X58 A;  5KHD A;  1FBU A;  2X51 A;  3E6B A;  3RYR A;  2Y9Z A;  2ME0 A;  2V79 A;  1GXQ A;  1ON2 A;  4LJZ F;  1B72 B;  3HTS B;  3B6A A;  2A3S A;  1DQU A;  1V4R A;  2ZFW A;  1YX5 A;  4AU7 A;  1UST A;  5HDN A;  1NG6 A;  5CVJ A;  3X2Q H;  3JRH A;  1IAW A;  2DDB A;  2HDW A;  5EG0 A;  4XM3 A;  4HAM A;  2FNP A;  4QPO A;  2VKE A;  1HW5 A;  3KFW X;  2CUF A;  2BOL A;  1ZKG A;  1DUX C;  2PJP A;  2A6H F;  4MFD A;  2DA4 A;  2Z1D A;  5HLG A;  4IX7 A;  2ZME C;  1VQL I;  1H88 C;  3WGI A;  1DU6 A;  2DFF A;  2JMW A;  4X1E A;  4YII A;  2WBM A;  3OMY A;  5DTD A;  3J80 Z;  3CCL I;  2VPL A;  1LJ9 A;  3EYY A;  2DW4 A;  1AOY A;  3H9G A;  4LLL A;  2NVU B;  4A93 J;  2IS6 A;  1ENH A;  3F3X A;  3CC2 I;  1SEU A;  3LQR A;  4DJA A;  2DLL A;  3AL0 C;  1E2X A;  2DA3 A;  2MG4 A;  5JLX A;  2JA5 J;  1F4K A;  3FXO A;  4BS9 A;  2FJ1 A;  4F52 A;  3LAJ A;  4IZZ A;  2V4J C;  1N77 A;  4DW6 A;  4G6D A;  4HX4 A;  1FOW A;  4ESB A;  2E7W A;  3J7A O;  5D4R A;  3FXM A;  2JT1 A;  1K79 A;  1B6A A;  1X1A A;  2EZL A;  1LKX A;  2LG4 A;  3SYT A;  1JKO C;  3CCV I;  2DT5 A;  5AON A;  3PJR A;  2DQL A;  1U6G A;  1HSJ A;  3HGG A;  1GLN A;  3DQV C;  2DK5 A;  2R7Q A;  3V7C A;  4A3M J;  2PJR A;  2JA7 J;  3RZO J;  1R4M B;  1ZG3 A;  3F21 A;  5E3M A;  3H0G J;  3BLY A;  3CUQ B;  3CMM A;  2E7X A;  2VIX A;  3L2W A;  4XBF A;  4I0A A;  3B73 A;  3BR0 A;  5E3N A;  2VUM J;  1IO2 A;  3CCU I;  4PCQ A;  5TRD A;  4AIK A;  2B63 J;  1J2X A;  2XPU A;  5JFR A;  4XLC A;  5LHI A;  4LIU A;  4W1U A;  3TDZ C;  2V9P A;  3L00 A;  1FMW A;  3ABM H;  2Z2S B;  1OMI A;  2CW8 A;  3RQ4 A;  3T5X A;  4JQF A;  5FKO A;  3BPV A;  3ZQG A;  3TW7 A;  2R7O A;  3L2U A;  1RES A;  2DU9 A;  4PFP A;  2D2W A;  2WA0 A;  2P6S A;  1YIJ I;  1FC3 A;  2Y2Z A;  3V7S A;  1BM9 A;  2EIN H;  2B0L A;  2XF6 A;  3V8J A;  3M1E A;  4ZZL A;  5JR3 A;  2TDX A;  2ICW G;  2V6E A;  1D3Y A;  1QA6 A;  2CW0 F;  3IH4 A;  3CCM I;  4D9J A;  5M3M J;  3WTW C;  1TQM A;  4EJU A;  2F48 A;  2OV7 A;  2JPB A;  1YFH A;  3VWB A;  1A6Q A;  1PUF A;  3W2A A;  4ZZD A;  1R1V A;  1QQI A;  2NXN B;  3AG3 H;  1FZP B;  4AVZ A;  2ZJ2 A;  2KIS A;  4BY1 J;  2Q2E B;  3CC7 I;  2VL8 A;  4LFU A;  3VSL A;  5LRR A;  3PIO F;  3PM1 A;  5ICF A;  1NK2 P;  2A6T A;  1Y56 A;  1R9T J;  3DFG A;  3P9C A;  3F8N A;  1MBH A;  2XRO A;  3H5A A;  2EFP A;  4FE7 A;  2ZXH A;  3BCA A;  1YQA A;  1B59 A;  4IOA F;  3ECO A;  1WI3 A;  1MMG A;  4HOB A;  3CME I;  1JXS A;  2WV0 A;  1GXP A;  5F0F A;  4M73 A;  3RKQ A;  3JRB A;  3QRF F;  2RRE A;  2Z3Y A;  2DA5 A;  4ESJ A;  2AS5 F;  3LSJ A;  3GW2 A;  2HZD A;  4HG2 A;  2FMY A;  3JTG A;  3A1Y A;  2PBI A;  4FAS D;  5TGT A;  2LY9 A;  3OYL A;  4XN0 A;  2IGK A;  3KLN A;  5CQG A;  3FBI B;  2YS9 A;  4ZJZ A;  3P9K A;  1XGO A;  2B9S A;  2HWV A;  5F04 A;  1GHC A;  2FQ4 A;  1DDN A;  3LWF A;  3SZP A;  3BR6 A;  1LEA A;  1GV2 A;  2KDO A;  2L0K A;  1V5F A;  2E5N A;  4AID A;  4RAF A;  2GIV A;  2KIF A;  3H1C A;  3FIW A;  4DOZ A;  4LLG F;  3SEZ A;  2NS0 A;  2VJI A;  3GXO A;  5B5E C;  4CCN A;  3N4M A;  3T8R A;  4A0X A;  1CF7 A;  3DLA A;  2BY1 A;  3BTI A;  1FYK A;  4M3G A;  1KGS A;  4R1H A;  2HEO A;  2L9R A;  4M9Z A;  4BYY A;  3I53 A;  1ZRC A;  1VQN I;  1LFB A;  1S7E A;  4KA4 A;  2CYY A;  4RB1 A;  3KP7 A;  3FXL A;  4IRI A;  2F5D A;  1J9I A;  4HNV A;  3U1D A;  2OCC H;  1BI1 A;  3IL2 A;  4BU2 A;  5FRN A;  2VLA A;  2NNY A;  4CYC A;  3D5S C;  4M3B A;  3VEP A;  4A3G J;  1UEL B;  2R7S A;  2F5F A;  3PQK A;  2XRN A;  5JHU A;  4Q4Z F;  4M9S A;  5C4J J;  4I09 A;  4UUS A;  3Q0V A;  1H8A C;  4B3A A;  1KON A;  2JWT A;  3TP0 A;  2FQ3 A;  1SD7 A;  3MKL A;  3RPQ A;  1FLI A;  4V2G A;  4C3I J;  2Q2E A;  3GX4 X;  1D1C A;  1ZEL A;  5K7H A;  2XRL A;  3VSK A;  4KT5 C;  2HVS A;  1LB2 A;  3F72 A;  1SFX A;  2MYS A;  5GAG J;  4OAZ A;  3BR3 A;  4RGS A;  5GAH J;  1CQT A;  4O6J A;  2LLK A;  2DDA A;  4AYB N;  4PJJ A;  4NB5 A;  1IUY A;  5ILU A;  3BR1 A;  3ZPL A;  4M3F A;  2MBF A;  2DA2 A;  3ABT A;  2OAZ A;  1IN6 A;  4IHS A;  4ENN A;  3HUG B;  1FBQ A;  2AQF A;  3HGY A;  2NAZ A;  4QLC U;  4OMZ A;  1YIT I;  2XKP A;  1I1S A;  1S6L A;  3NQO A;  2VJ5 A;  5E3O A;  2RV8 A;  2XF7 A;  2HQ5 A;  3OR2 C;  5TIS C;  4BAY A;  1V3F A;  3O3K A;  2CFX A;  5JVG F;  3NAR A;  3SFI A;  3J81 Z;  3HOZ J;  3M7G A;  1D0Y A;  2WTE A;  3CUQ C;  3TL4 X;  1W36 C;  4I98 B;  2M45 A;  2LH9 A;  3I4P A;  4C3J J;  4F55 A;  2K9Q A;  1X4P A;  2FEZ A;  3K70 C;  1I6X A;  3I64 A;  4BQO A;  2WB1 N;  2NVY J;  2UUZ A;  5DS9 A;  1HST A;  3HRT A;  3K1M A;  3MKW B;  2YR2 A;  4BHB A;  3BR2 A;  2JPC A;  3HBL A;  4HRI A;  4F92 B;  5D5X B;  2DT6 A;  2P5V A;  4PGG A;  3OYM A;  1F1Z A;  3A01 B;  3QOP A;  3E1S A;  4ZDP A;  3TMO A;  4A3I J;  2DMQ A;  2ZSI B;  2YSR A;  3GTM J;  4RGX A;  2W7N A;  2Z99 A;  1M1E B;  1BR1 A;  2PMZ N;  3C18 A;  2JSP A;  1IN8 A;  5H20 A;  4XMY A;  1YI2 I;  3JCU C;  5ICG A;  2V1D A;  2K4J A;  1T56 A;  3GWZ A;  3OIP A;  4ANJ A;  3K1P A;  3DBR B;  2GAU A;  3ZRG A;  5CJ9 A;  1YW7 A;  2W4S A;  4YFN F;  1TQP A;  5KCM A;  4DQ2 A;  2KMU A;  3G4S I;  2AO9 A;  2V9K A;  4A3C J;  3M4O J;  5M5X J;  3HOY J;  3W3C A;  4KMU X;  2VBX A;  2W84 A;  4IHV A;  2GLO A;  1MBK A;  2HYG D;  1WHU A;  2GQQ A;  3MKY B;  2CV0 A;  1WJB A;  1X1C A;  3TP3 A;  3VOD A;  4BJT A;  2IGO A;  1YW9 A;  2VOO A;  3VOE A;  2ESN A;  1IN7 A;  2JVG A;  5JLW A;  2FUG 2;  4XID A;  1B9N A;  3H36 A;  5DUI A;  3L9F A;  1L0O C;  3A03 A;  2VXD A;  4Z2Y A;  2RQQ A;  3EET A;  3T1B A;  4ZTJ A;  1YX3 A;  5EEG A;  3OYG A;  1DGR M;  1MJA A;  1ZYR F;  2O7O A;  4UV9 A;  5BQT A;  2OU2 A;  1I50 J;  1Z6T A;  1ZG1 A;  2XC7 A;  1S7O A;  4OIO F;  3PIP F;  3CCJ I;  3UNG C;  2P6T A;  4IF4 A;  1G3Y A;  4Y17 A;  5FKK A;  3V8L A;  2YX4 A;  1KQ0 A;  1VTN C;  1ETO A;  1QO0 D;  5F64 A;  3GF2 A;  3KX2 A;  1Z3Y A;  2KDZ A;  1VQP I;  2ZXW H;  5B66 C;  2ELJ A;  2UWM A;  4DYC A;  2ZME B;  3H5N A;  1A35 A;  5IP7 J;  2NOJ B;  3K7A J;  4EQQ A;  1T8I A;  1MMD A;  2NNN A;  1HDD C;  1DP3 A;  3FX3 A;  1OCR H;  2ELH A;  5IP9 J;  2E1M B;  3CLQ A;  4AM3 A;  1P4W A;  3BR5 A;  2X1C A;  3BZC A;  3LFK A;  1YOV B;  4EM2 A;  3HRU A;  2A6E F;  2E71 A;  2MSY A;  3BWG A;  4IHX A;  4A6E A;  2E1M C;  1FTZ A;  2DFI A;  1IF1 A;  1Z05 A;  2E1O A;  3OR1 C;  1G3S A;  1HXD A;  4AC0 A;  1VF9 A;  2LKS A;  3OOU A;  5DDG A;  3FIS A;  4W97 A;  3VPR A;  4N0B A;  3K2A A;  2EA4 A;  3OWT A;  2IT0 A;  1LVK A;  2BY3 A;  2CJJ A;  2PFB A;  3DKW A;  4BJ5 C;  4WX9 A;  4ON0 A;  5LD2 C;  3OIO A;  2Z9O A;  2WAQ A;  3COA C;  3OL4 A;  4XON A;  3OL3 A;  1KQ8 A;  4G12 A;  1B1B A;  4IHT A;  4R8H A;  2ZJP F;  2QUF A;  4A5M A;  5J6X A;  1R1U A;  3QP5 A;  3UR3 C;  2DA6 A;  3ZMD A;  1B8I B;  2EIK H;  5LFA A;  2MAB A;  2E2J J;  2M7B A;  1R71 A;  1XTA A;  2LBF A;  4C30 A;  3KLO A;  4CUG A;  2VKH A;  4BGD A;  2Q8K A;  1FPQ A;  3CTA A;  4XLA A;  1B72 A;  1SD4 A;  1HA8 A;  4CCL A;  1O7L A;  2CG4 A;  2W85 A;  5GAD J;  3IWF A;  4E7H A;  2K9N A;  3W6J B;  3TQN A;  3PNT A;  3CMA I;  9ANT A;  5DCM A;  2DOE A;  1K83 J;  4BUP A;  4J00 A;  3WTY C;  4A12 A;  4HST A;  2YU9 J;  3D5R C;  4BHP A;  3AG2 H;  1Z6R A;  2CGP A;  3G2B A;  2LKP A;  3DEE A;  4AWX B;  1SFU A;  2BHZ A;  2KIQ A;  4XSX F;  4JX5 A;  2DN0 A;  1A6I A;  1ZR4 A;  3FKI J;  1WZ2 A;  2ZFU A;  3CO7 C;  2K7L A;  2Z5U A;  1BI3 A;  4RAY A;  2O3F A;  1SFE A;  4NDL A;  2K9L A;  4XRF A;  2CV2 A;  2F4I A;  2LK2 A;  3QYB A;  1HW1 A;  2IAI A;  4F91 B;  1XSX A;  4YEJ A;  4DBQ A;  1AHD P;  3C2B A;  1RI7 A;  3R60 A;  2EWN A;  2QSG X;  1ZAR A;  2Y31 A;  3HOW J;  5EZG A;  2H8R A;  4Y33 A;  3D1N I;  5FKM A;  2LTP A;  2HZT A;  1MMN A;  3KPH A;  2EBI A;  3B02 A;  1IN4 A;  2ZXI A;  1BW5 A;  5F0H A;  1OR7 C;  5DD4 A;  2MLK A;  3CUO A;  3DEU A;  4O3M A;  2L7M P;  2A5Y B;  2GOM A;  4M6V A;  1B8I A;  2CV1 A;  5K1Y A;  3MZH A;  4UVB A;  4MHG A;  2C6Y A;  2O6G E;  3SQN A;  1U9O A;  2O61 A;  3KP3 A;  3WGG A;  1MBG A;  3EUK L;  3OYK A;  3SHF A;  1TW3 A;  4MTE A;  5L3C A;  1D8K A;  3GTO J;  3TED A;  1BJZ A;  2QM3 A;  4QPQ A;  2XSJ C;  3QPL A;  4HV6 A;  3FKJ A;  1W0T A;  1IRX A;  4FIS A;  1EF4 A;  1JJ8 C;  3DBL B;  2VT3 A;  4YEL A;  1LQ1 A;  4UY8 I;  2RNG A;  4BY7 J;  1YYV A;  4GFB A;  1WCM J;  1K78 B;  1OR7 A;  4GXO A;  3F22 A;  2OJE D;  4WXD A;  4QTR A;  3PUF A;  4PJN A;  5ICC A;  3AG4 H;  3OY9 A;  4UB6 C;  4HF1 A;  4E7S A;  2K4B A;  2MH9 A;  4D7M A;  3IV5 A;  3S3N A;  3FHN A;  1FYL A;  1D0Z A;  1ULY A;  1U5T B;  1JKR C;  4P55 A;  3EUH C;  3NWT A;  4P1W A;  4ABZ A;  1IDY A;  5J40 A;  3ZQF A;  1GDT A;  3S8P A;  2K27 A;  2R7R A;  4BQQ A;  5K7F A;  2OC6 A;  2CQQ A;  3H3U A;  2EA2 A;  3CCE I;  4U7D A;  2JQ7 A;  1I27 A;  4CZC A;  1POG A;  2ZJR F;  3DCF A;  2GXG A;  2JUC A;  4PZJ A;  5K7Z A;  1HC8 A;  1R49 A;  2VAS A;  2WB1 A;  1SVO A;  1KYW A;  3OYE A;  1EKE A;  4LK1 F;  1D5V A;  3FM5 A;  2E2I J;  2M8G X;  5FFZ A;  1S5L C;  3ABL H;  3CCS I;  5FGM A;  1ZH5 A;  3CJN A;  1ZR2 A;  1O4X A;  2P81 A;  4XNF A;  1RR8 C;  3C7J A;  4XOT A;  4B48 A;  5FB2 A;  5C4X J;  4GRI A;  5C3E J;  2GXA A;  1S72 I;  2Z33 A;  3CO6 C;  2HOS A;  4ENK A;  1YRN A;  2CO5 A;  2X6O A;  2EK5 A;  2X6Y A;  5M5W J;  1MNM C;  1Y0N A;  4XLN F;  2X6X A;  2DMP A;  3IHU A;  4ZH4 F;  2E5Z A;  2OA4 A;  4Y13 A;  1LDJ A;  3CDI A;  3HSF A;  4BKX A;  1R58 A;  2QQB A;  4MNU A;  1GVJ A;  2CSO A;  2YUS A;  3RYP A;  4B4C A;  2VE9 A;  2R5Z A;  3BG5 A;  4IO9 F;  1LVA A;  1IGN A;  3K6G A;  4M3E A;  2M1B A;  3IAM 2;  1Z77 A;  3KYD B;  3E6D A;  2WY8 Q;  2LRE A;  4JX4 A;  3I58 A;  4I7H A;  4OIQ F;  3CF2 A;  1BA5 A;  2KIM A;  4J01 A;  2IS1 A;  2L4A A;  5E1X A;  2DCE A;  3TO6 A;  1PYV A;  1VQ4 I;  1FSE A;  5EJC A;  3RSN A;  3E7L A;  3IKT A;  1ACI A;  1HKS A;  3I0T A;  2F4M B;  1R1T A;  4E7J A;  4LB6 B;  1IV8 A;  2XDV A;  4PFO A;  1R4N B;  3OS2 A;  2ZC2 A;  1P92 A;  5BNG A;  4E7K A;  2Y48 A;  5FRO A;  3QPS A;  2DA1 A;  4C2M J;  2HS5 A;  5B1B H;  4CO8 A;  1Y1V J;  4JBA A;  3OYB A;  4L9V A;  4BE1 A;  4LB5 A;  4RS8 A;  3AKZ A;  4CDG A;  2M8E A;  5DD8 A;  1LNW A;  3OS0 A;  5EG0 B;  5D5W B;  3KYL A;  3BJA A;  4A0Z A;  2Y0S A;  3AG1 H;  2PMU A;  2KKO A;  4IRH A;  2QCO A;  3H35 A;  3TDU C;  3P7N A;  1ETV A;  2LNB A;  1K6Y A;  4UXN A;  3Q0W A;  5F08 A;  3HKZ A;  2RDP A;  2M87 A;  3G73 A;  2NS8 A;  3BTC A;  1W4M A;  2LC2 A;  4IOC F;  3GCM A;  3ECH A;  2HOT A;  3LOC A;  4DZJ A;  1KQ9 A;  4K2E A;  1PUF B;  4WF2 A;  1WJE A;  1WPK A;  1P4A A;  2J5P A;  2R7W A;  2OTL I;  1EV7 A;  3OS1 A;  1N75 A;  2VI6 A;  2HDC A;  2JZY A;  2XKO A;  5HLH A;  4UVA A;  4EV0 A;  1UB9 A;  2A68 F;  4XLP F;  1X1P A;  1XX5 A;  1OYI A;  1W7P A;  1T98 A;  1JUS A;  3GTK J;  1KU2 A;  1QNT A;  3ELK A;  2W82 A;  2V7F A;  4BEH A;  2R5Z B;  4EMS A;  3AAF A;  1TWG J;  2WC2 A;  1MD0 A;  3FDY A;  1NG7 A;  4U0W A;  1JHF A;  2WAQ N;  4OWR B;  1FOX A;  3ZP5 A;  1BOB A;  2VBZ A;  3ML6 A;  5J4Y A;  1ZQ3 P;  3HM5 A;  3ONQ A;  3DP7 A;  1TP4 A;  1OYY A;  5LRS A;  2R3S A;  5H6R A;  1PJR A;  2DOA A;  2J5O A;  2CMP A;  3LSK A;  5TJJ A;  3L2Q A;  3OYA A;  3R0A A;  1XS9 A;  1S3J A;  1NK3 P;  2DFH A;  2QQ9 A;  2Y75 A;  1U3E M;  4KNY A;  1T08 B;  4KIB A;  3HHH A;  3HOV J;  2DO7 A;  1R5H A;  2LFB A;  3R0J A;  2CRG A;  1BIA A;  2E1C A;  4C2U A;  2LKX A;  4Y3O A;  2QGU A;  2FBI A;  4RB3 C;  3D0S A;  1XD7 A;  3BQZ A;  2ZXJ A;  4N9I A;  3ZN0 A;  4OMY A;  3VDX A;  2H27 A;  1RRJ A;  2V1U A;  1XSD A;  2HYJ A;  3RKY A;  5GTH C;  1LDD A;  2DT7 B;  1N78 A;  3KP2 A;  2A61 A;  5GPC A;  3WTZ A;  2BYV E;  4R79 A;  2BVM A;  1T95 A;  3FMQ A;  2EV0 A;  3RPU A;  4LG0 A;  1LE8 A;  2ECB A;  4ZYH A;  4XK4 A;  1X1D A;  1JT6 A;  2DJN A;  1MSE C;  2CWE A;  3C2H A;  4XIC A;  1QVU A;  3S2H J;  4HDV A;  1ODD A;  3IWZ A;  3TO9 A;  3IH3 A;  1UHW A;  3IUO A;  2JRM A;  1LE8 B;  3WHC A;  5CPR B;  3FK6 A;  4EAT A;  5JHF A;  4ZYG A;  3JRG A;  2PG4 A;  3OSF A;  5KNL A;  2VQC A;  4UVC A;  5F1J A;  2KL4 A;  4ETS A;  4BQA A;  4OOI A;  3J81 K;  4L18 B;  1X1B A;  2L9N A;  3H3V K;  4S04 A;  2EFO A;  2WAF A;  2NVQ J;  1A5J A;  4G6Q A;  1QZE A;  3WU2 C;  2WY7 Q;  1D1A A;  2X1D A;  3FXU A;  1FY7 A;  3JTH A;  1I5Z A;  4M6X A;  4YIR X;  2R0Q C;  2KIU A;  1HQC A;  2GA1 A;  4KIS A;  2E36 A;  1P4X A;  2O0Y A;  2JSC A;  1J7K A;  5D5V B;  3PNV A;  1Z91 A;  2CU7 A;  2PQ8 A;  5HLI A;  5LBQ A;  1SFK A;  3OV8 A;  4Q5S F;  5CVV A;  4HLY A;  4DGW B;  1PDN C;  2H1K A;  1KU7 A;  3J80 K;  5F6F A;  5K5Q A;  3DKY A;  4Y52 J;  1WSU A;  3FMR A;  4LGW A;  1U5T A;  3BZ6 A;  1P7J A;  1XPX A;  4H4K C;  4U0V A;  2M3A A;  2EB7 A;  3GTG J;  1SVL A;  3CES A;  5LGN A;  4A3E J;  1QGP A;  1O3T A;  3F8M A;  2VQG A;  4DYQ A;  4FT8 A;  5EZH A;  1IDZ A;  1UCR A;  2L01 A;  4YFK F;  3S93 A;  1STZ A;  3JRA A;  3LA3 A;  4A3B J;  3HSR A;  4U0Y A;  4M74 A;  1E3H A;  2ISY A;  5BOX A;  5C44 J;  1SC7 A;  4MFE A;  3BJ6 A;  3EDP A;  4NC6 A;  3ZMV A;  3TGN A;  4X0G A;  4A0Y A;  2XPV A;  4MIM A;  5BPD A;  3VB2 A;  3CCR I;  1TZL A;  5FD5 A;  3LFU A;  2BE5 F;  4FX0 A;  2KJC A;  2QQA A;  1QVT A;  1TWH J;  1OIS A;  2BZT A;  2ACJ A;  2OQG A;  4XLF A;  2L7K A;  1FMV A;  4U87 A;  1XCB A;  2VON A;  1FIP A;  1WRJ A;  4X6A J;  2R7U A;  1UHM A;  3ZQ7 A;  4MLO A;  3PFI A;  1AA7 A;  1FTT A;  4QWQ A;  2G9W A;  1TWA J;  2LP0 A;  2DTZ A;  1SMY F;  1KU9 A;  2FF4 A;  2IXS A;  3KIO A;  3O6B B;  5ICE A;  3F8C A;  3PSF A;  1BR2 A;  4UUT A;  2EJR A;  3ISP A;  3GO5 A;  5IP6 A;  4S05 A;  2A07 F;  1JGG A;  2E2H J;  1XMA A;  3HUG A;  3DXJ F;  2KFD A;  3F8B A;  3ZGK A;  3IRR A;  1Y1W J;  3FXQ A;  1R23 A;  3ZMS A;  3FM3 A;  1BI2 A;  3ERM A;  1YG2 A;  2GOX B;  4PJM A;  2K9S A;  2VC0 A;  3HOT A;  1OFC X;  3C1D A;  1TLH B;  4FE4 A;  4RGU A;  4BL0 B;  2K02 A;  3DLL F;  1DPR A;  1IRF A;  4ZC3 A;  2FD5 A;  3REO A;  3C3W A;  4OIP F;  1B4A A;  5EGO A;  4XKV A;  2XGC A;  1TTY A;  2JA6 J;  5LGU A;  1DP7 P;  4IHW A;  1R6R A;  4PUS A;  2A5W A;  3EUA A;  4NC8 A;  4EJW A;  2XAJ A;  5J4V A;  1V5E A;  3HTU A;  3J7Z I;  1FOK A;  3ZOB A;  1OQY A;  3I4N J;  2X0L A;  5J8C A;  2E1N A;  2DMU A;  1F36 A;  2LY2 A;  3GZ5 A;  1ETY A;  4B44 A;  4QIW N;  4F3Q A;  2Z16 A;  3E5Q A;  3DPT A;  4JX6 A;  5HS8 A;  4CHU A;  3K4L A;  1V5G A;  4AUX A;  4IKF A;  5EEH A;  3L09 A;  3GTQ J;  2GXB A;  2XPW A;  3MZY A;  2KPM A;  3BCB A;  3GFL A;  2D1H A;  1ZRF A;  3S17 J;  1IXC A;  3FWE A;  3JSP A;  1CF7 B;  3IAS 2;  2QWW A;  4CH7 A;  2E60 A;  2EIJ H;  4A2U A;  1U8B A;  2RKH A;  3QOD A;  2M4K A;  1ZN2 A;  2HNH A;  3FBN B;  5J1U A;  4D0P A;  3BP8 A;  2JUG A;  5GPA A;  4XRM A;  2XAG A;  1H9G A;  1G2H A;  2O5R A;  2PX9 A;  2Y9Y A;  4HW0 A;  2E19 A;  3GME A;  3PNY A;  1JTY A;  2CFO A;  1S7A A;  2IRF G;  2WAD A;  2PN6 A;  4YFX F;  3S16 J;  1U0J A;  3OYJ A;  2OF7 A;  4L0Z B;  3A2K A;  3H92 A;  4ITV A;  3LL7 A;  1QU3 A;  3RDI A;  2OBP A;  3PO2 J;  1JUP A;  2OTJ I;  1UMQ A;  3QYF A;  2D45 A;  4BXF A;  2HXO A;  2EV5 A;  1USS A;  2JRT A;  2KJB A;  2P5K A;  3MEX A;  1T2K A;  1MSF C;  3DV8 A;  2EPF A;  3CMY A;  2X6W A;  4NC7 A;  5FLX Z;  2BY0 A;  5AIQ A;  5DCF A;  4ESF A;  2EZK A;  2IEK A;  2ZME A;  1PVE A;  1YO5 C;  1W5C C;  2XUB A;  2QEN A;  3CP2 A;  2OZU A;  4B1R A;  2JA8 J;  2K9M A;  1MDM B;  3CC4 I;  1FJL A;  2GWR A;  3KP6 A;  1IUF A;  1OJL A;  1Y8R B;  4A6D A;  3PFY A;  2I5U A;  1O3R A;  1X2N A;  3MMY B;  4YRV A;  2F5E A;  2R4G A;  2Y30 A;  1QHH D;  2QZ8 A;  3M8J A;  2PI0 A;  1YE9 A;  1W1W E;  3K4N A;  2FBK A;  1U5T C;  3HIF A;  1R00 A;  2Y0M A;  3CQZ J; 
#chains in the Genus database with same CATH homology
 3KEO A;  2LDU A;  3BOQ A;  2IA0 A;  2OZ6 A;  1XB4 A;  5DYM A;  1HKT A;  1MJB A;  5IT3 A;  5ED4 A;  3H3Z A;  1K78 A;  2P7V B;  1PP7 U;  1BC7 C;  4JK1 X;  3NEU A;  3E3V A;  3F8F A;  2XAS A;  2VBW A;  3FMS A;  3GFJ A;  3NRV A;  3VFZ A;  1R5G A;  3LAP A;  4LMY A;  5E18 F;  4FHT A;  3TOB A;  5LLQ A;  4RB0 A;  3N97 A;  6PAX A;  4G9Y A;  1ZGJ A;  3MAJ A;  2HOE A;  1R36 A;  4NQW A;  3I59 A;  3RTR A;  4OU0 A;  2RC4 A;  1U8R A;  2EFQ A;  5FFX A;  5A2Q Z;  2VC1 A;  1HW2 A;  5A2Q K;  4ASN A;  1ON1 A;  2IVM A;  2M30 A;  2XGX A;  4BHC A;  3QP6 A;  1IZ1 A;  5HDG A;  3WTU C;  2H6B A;  2HKX A;  4B09 A;  4F7Z A;  2IP2 A;  2P5L C;  4A5N A;  3MWM A;  5LEK A;  1HBX G;  2IPQ X;  3HHG A;  2MC3 A;  3HRM A;  4EJT A;  2DAO A;  1W5S A;  1WQ2 A;  2G7U A;  4KIG A;  4BXU A;  4RB2 C;  2QYO A;  2ZO4 A;  2XV4 S;  5K5O A;  2DPD A;  2IW5 A;  4HF0 A;  4KFC A;  1O3S A;  4HLX A;  3WU1 B;  1ONV A;  4GYI A;  5F1R A;  2HGC A;  4CGZ A;  1B9M A;  2XVC A;  5IT9 K;  1F5T A;  2DBB A;  3KE2 A;  1FWZ A;  1O57 A;  4OIR F;  5J8F A;  2VN2 A;  2ADU A;  5D6F A;  1S29 A;  4AVP A;  4ENJ A;  5HVQ C;  1QZY A;  3RJP A;  3ULQ B;  4RAZ A;  3D5L A;  2EV6 A;  5HS7 A;  5BPI A;  2D1V A;  1XMK A;  1A04 A;  1G4D A;  1SAX A;  3BDD A;  1G6N A;  2W25 A;  5DV5 A;  2ISZ A;  2BEO A;  4HQE A;  2NRA C;  1P6R A;  4L0Y B;  1P2F A;  1YS6 A;  3LA2 A;  4LG0 B;  1IXR C;  2P4W A;  1OPC A;  3ROU A;  2L02 A;  2NYX A;  2MD5 A;  4WK8 F;  3P9I A;  4P96 A;  1J59 A;  1ZLJ A;  3CUQ A;  4HA8 A;  3T8T A;  1QBJ A;  3BPX A;  3M9A A;  2DQR A;  1BIB A;  1O7F A;  3WG9 A;  4GCV A;  3GFM A;  3K1N A;  3HOS A;  5LHH A;  5CYV A;  1SD6 A;  1UFM A;  1OYW A;  4GO1 A;  5LEJ A;  1G3W A;  5DUK A;  5HOO A;  4MQV A;  2HTJ A;  5LHG A;  5FO5 A;  1W7P D;  3W6K B;  4ENM A;  3MFK A;  3U2R A;  5CVI A;  2DK8 A;  2ETH A;  1ZGA A;  2RGV A;  5FD6 A;  1XGS A;  1T6S A;  5L3G A;  3WE2 A;  1YW8 A;  2H94 A;  5HDK A;  4KDP A;  2AXL A;  5L3F A;  4HX8 A;  4KIF A;  3KP4 A;  3IC7 A;  1AWC A;  4LLN A;  1NHA A;  1SD5 A;  3EUH A;  3FXR A;  2HYF A;  2XAQ A;  1O3Q A;  2OD5 A;  5DEQ A;  4KN7 X;  1QPM A;  4CYD A;  2HQR A;  4HZF A;  2ZCW A;  2UXX A;  3Q5F A;  1C0W A;  4Q48 A;  3WTX C;  2L3D A;  4UHT A;  4I02 A;  2FA5 A;  5E1W A;  2JTV A;  3E5U A;  4L5J A;  4IVN A;  1I1G A;  1XSV A;  1IRG A;  1TQI A;  1D8J A;  1YTY A;  1YLF A;  2FNA A;  5L3B A;  2V6C A;  3FZV A;  1EH8 A;  3ABU A;  2H09 A;  4HQM A;  2KRF A;  4HDU A;  3R4K A;  1JHH A;  2RVC A;  1K7A A;  4HYE A;  4XSZ F;  3ERE D;  1T38 A;  3GLX A;  2IJL A;  1Z7U A;  1BN5 A;  1E17 A;  1U2W A;  2ZBK A;  5L3D A;  2PLY A;  2QBY B;  2V1X A;  2R7D A;  4BH9 A;  1MKM A;  4Q47 A;  4MQ9 F;  5FLX K;  2STT A;  1BJA A;  3K9T A;  2OQR A;  1W5T A;  2VE8 A;  3WGH A;  4AIH A;  1XDS A;  2O03 A;  4LD5 A;  2V9V A;  4O5V A;  4GGG A;  3BJO A;  3EYI A;  2HR3 A;  5ILV A;  1FBS A;  3ZMZ A;  4E70 A;  3SFZ A;  1S8N A;  1WKM A;  3ZN1 A;  2DI3 A;  5D6E A;  2RN7 A;  3I54 A;  4CIC A;  2ZKZ A;  3RIR A;  2R7F A;  1BC8 C;  4HV5 A;  1RIO H;  2W24 A;  1REP C;  3SXY A;  3BY6 A;  1ZG5 A;  2F5C A;  1TNT A;  3KP5 A;  3S2W A;  3JSO A;  4HF2 A;  4FX4 A;  1ZHF A;  3GZ6 A;  4EGZ A;  4WXC A;  3F6V A;  4GYG A;  2BBY A;  3HSE A;  4U88 A;  1TW2 A;  5JVT A;  2PEX A;  4M9X A;  3HRS A;  4YG2 F;  1K6O A;  1KYZ A;  2LF8 A;  1XGN A;  2HKO A;  2LF7 A;  2YPR A;  2M5W A;  1XN7 A;  4BNC A;  2PMH A;  3DF8 A;  3K69 A;  4KMF A;  2L4M A;  1Q1H A;  4WXH A;  3SZT A;  1RZ4 A;  2H6C A;  2STW A;  5CLS A;  3T0Y A;  3JAM Z;  2IA2 A;  3IKV A;  4P9U A;  2F2E A;  2XAF A;  5BS6 A;  3L7W A;  4G8X A;  1QZZ A;  1R22 A;  3F23 A;  3L2C A;  4IRG A;  3GUD A;  5DCM B;  2FRH A;  5CVU A;  4OIN F;  3CLO A;  3OOP A;  2EFW A;  2ZNY A;  3WOD F;  1MJ9 A;  2VT2 A;  1J0R A;  2YU3 A;  2VBY A;  3BRO A;  5E1Z B;  3WTS C;  5IT9 Z;  2EFN A;  5L3E A;  1FT9 A;  4KIC A;  3ZMU A;  3K2Z A;  2FBH A;  2ESH A;  1FX7 A;  3O2P E;  3GVA A;  2L54 A;  1U78 A;  5HS9 A;  1WWX A;  2Q0O A;  3KET A;  2XIG A;  4EVI A;  3E6M A;  2YX7 A;  3I71 A;  4L5I A;  2CQK A;  1LEB A;  2WWY A;  5D5U B;  3FHZ A;  4NHJ A;  4U7B A;  2VOD A;  4I2O A;  3K0L A;  1RNL A;  2VOP A;  3DPL C;  4WWC A;  3LST A;  2DPU A;  1FNN A;  2P8T A;  4L9T A;  4CXF A;  4P9F A;  2BGC A;  1MGT A;  2FU4 A;  4Y15 A;  4UV8 A;  2DTR A;  2O8X A;  1BI0 A;  3KCC A;  1FP1 D;  4MGR A;  1PP8 F;  1J5Y A;  1Z1D A;  2COM A;  4N9H A;  1FSH A;  2LSO A;  4IJA A;  1YIO A;  3EQL F;  1FYM A;  3HYI A;  1EH6 A;  4EJV A;  1IXS B;  3JW4 A;  3M8F A;  1EH7 A;  4I01 A;  3ZMT A;  2BV6 A;  1TBX A;  5D8K B;  4PGH A;  4I0B A;  5D4S A;  4YIF A;  1MZB A;  2GZW A;  4KN4 X;  4M72 A;  5LGT A;  4G7O F;  1KA8 A;  1X3U A;  4WCG A;  4L9J A;  4EGY A;  2FSW A;  2QLZ A;  2UXN A;  5ERI A;  1BOA A;  2QVO A;  4HBL A;  3WTV C;  5D8L B;  5E20 A;  4ZYD A;  5CVR A;  3V4G A;  3KZZ A;  2A69 F;  4IXA A;  5E8G A;  1TNS A;  4EM1 A;  3GEZ A;  2RNJ A;  5JI6 A;  1J75 A;  1RUN A;  2GA2 A;  2XAH A;  3R61 A;  3WU0 A;  5KVR A;  3GFI A;  1R7J A;  2MA3 A;  2FML A;  1H0M A;  1YS7 A;  3E97 A;  2VXZ A;  4G94 A;  4H0E A;  3QU6 A;  1LDK B;  2IA1 A;  3TO7 A;  2FXA A;  1ZRE A;  1FP2 A;  1RUO A;  1BBY A;  1T0F A;  3QPH A;  3Q9S A;  4UUV A;  2RQP A;  4AIJ A;  3E6C C;  2K86 A;  2MH2 A;  3IRQ A;  2UZK A;  3V8K A;  4KUM A;  5E17 F;  1PUE E;  3I59 B;  3E5X A;  4P5O A;  1H9T A;  3R6S A;  4ZYE A;  3WTT C;  3G3Z A;  5KK1 A;  3Q9V A;  3RKW A;  2MLG A;  1JE8 A;  3MQ0 A;  3QU3 A;  2X4H A;  2P7C B;  4MEX F;  1XDU A;  5K5R A;  4LK0 F;  1W7P B;  1HKQ A;  1XGM A;  4L9N A;  2W57 A;  3JAM K;  3KZY A;  2FOK A;  1F9N A;  4UNO A;  1G3T A;  4M6Y A;  3RKX A;  3RI4 A;  4MEY F;  4IPA A;  4M71 A;  1ZRD A;  4G7H F;  4HX7 A;  3KEQ A;  5ILS A;  1MDM A;  3I5U A;  3V7R A;  2G7H A;  1WI9 A;  4MTD A;  3LA7 A;  1XCV A;  4RGR A;  4CZZ A;  1OKR A;  3QPT A;  4TV7 A;  3FF5 A;  3LQQ A;  1SMT A;  4DNC A;  1T39 A;  1IN5 A;  1IW7 F;  1Z9C A;  2QBY A;  4EJO A;  3TOA A;  4G7Z F;  2HQN A;  3MCZ A;  4PDK A;  3TKY A;  1ZAO A;  3GYH X;  1KU3 A;  3PQJ A;  1Y0U A;  3M8E A;  1L3L A;  3CDH A;  2HTS A;  4KYW A;  2HFH A;  1ZLK A;  1CGP A;  5AIP A;  5H6Q A;  3WE3 A;  4B8X A;  4EM0 B;  5BMZ A;  2FE3 A;  3F6O A;  5E8I A;  1DPU A;  3QAH A;  3U9G A;  1JGS A;  4AD9 A;  2ZNZ A;  2XHK A;  1FBU A;  3E6B A;  3RYR A;  2V79 A;  1GXQ A;  1ON2 A;  4LJZ F;  3HTS B;  2A3S A;  1V4R A;  2ZFW A;  5HDN A;  1UST A;  5CVJ A;  1IAW A;  4HAM A;  2FNP A;  1HW5 A;  3KFW X;  1DUX C;  2PJP A;  2A6H F;  5HLG A;  3WGI A;  4YII A;  3J80 Z;  1LJ9 A;  3EYY A;  2DW4 A;  1AOY A;  4LLL A;  3F3X A;  3LQR A;  2DLL A;  1E2X A;  1F4K A;  3LAJ A;  4G6D A;  4HX4 A;  4ESB A;  2E7W A;  3J7A O;  5D4R A;  2JT1 A;  1K79 A;  1B6A A;  2DT5 A;  5AON A;  2DQL A;  1U6G A;  1HSJ A;  3V7C A;  3DQV C;  2DK5 A;  1ZG3 A;  3F21 A;  3CUQ B;  2E7X A;  4XBF A;  4I0A A;  3B73 A;  4PCQ A;  5TRD A;  4AIK A;  1J2X A;  5JFR A;  5LHI A;  3TDZ C;  3L00 A;  1OMI A;  3T5X A;  4JQF A;  3BPV A;  2DU9 A;  2D2W A;  2P6S A;  1FC3 A;  3V7S A;  1BM9 A;  2B0L A;  3V8J A;  3M1E A;  4ZZL A;  5JR3 A;  2TDX A;  1D3Y A;  2CW0 F;  3WTW C;  1TQM A;  4EJU A;  2JPB A;  1YFH A;  4ZZD A;  1R1V A;  1QQI A;  1FZP B;  2ZJ2 A;  4LFU A;  5LRR A;  5ICF A;  3DFG A;  3P9C A;  3F8N A;  2XRO A;  2EFP A;  1YQA A;  1B59 A;  3ECO A;  4HOB A;  1JXS A;  2WV0 A;  1GXP A;  4M73 A;  3QRF F;  2Z3Y A;  4ESJ A;  2AS5 F;  3GW2 A;  2FMY A;  3JTG A;  2PBI A;  3KLN A;  3P9K A;  1XGO A;  1GHC A;  2HWV A;  1DDN A;  3LWF A;  3SZP A;  1LEA A;  2GIV A;  2KIF A;  4LLG F;  2NS0 A;  3GXO A;  3N4M A;  3T8R A;  4A0X A;  1CF7 A;  1FYK A;  1KGS A;  4R1H A;  2HEO A;  4M9Z A;  4BYY A;  3I53 A;  1ZRC A;  4KA4 A;  2CYY A;  4RB1 A;  3KP7 A;  4IRI A;  2F5D A;  1J9I A;  3U1D A;  1BI1 A;  3IL2 A;  2NNY A;  3VEP A;  2F5F A;  3PQK A;  2XRN A;  5JHU A;  4Q4Z F;  4M9S A;  4I09 A;  2FQ3 A;  1SD7 A;  3RPQ A;  1FLI A;  2Q2E A;  3GX4 X;  4KT5 C;  1LB2 A;  3F72 A;  1SFX A;  4RGS A;  4O6J A;  4NB5 A;  1IUY A;  5ILU A;  3ZPL A;  2MBF A;  3ABT A;  2OAZ A;  1IN6 A;  4IHS A;  4ENN A;  1FBQ A;  2NAZ A;  4QLC U;  4OMZ A;  2XKP A;  1I1S A;  1S6L A;  3NQO A;  2RV8 A;  4BAY A;  1V3F A;  3O3K A;  2CFX A;  3J81 Z;  3M7G A;  3CUQ C;  2WTE A;  4I98 B;  2M45 A;  3I4P A;  2FEZ A;  1I6X A;  3I64 A;  1HST A;  3HRT A;  3K1M A;  2YR2 A;  4BHB A;  2JPC A;  5D5X B;  4PGG A;  2P5V A;  1F1Z A;  3QOP A;  2YSR A;  4RGX A;  2Z99 A;  3C18 A;  1IN8 A;  5H20 A;  5ICG A;  2V1D A;  2K4J A;  3GWZ A;  3K1P A;  2GAU A;  5CJ9 A;  1YW7 A;  4YFN F;  1TQP A;  4DQ2 A;  4KMU X;  2VBX A;  2W84 A;  2HYG D;  2GQQ A;  3VOD A;  1YW9 A;  2VOO A;  3VOE A;  2ESN A;  1IN7 A;  1B9N A;  5DUI A;  3L9F A;  1L0O C;  4Z2Y A;  3EET A;  3T1B A;  5EEG A;  1MJA A;  1ZYR F;  4UV9 A;  5BQT A;  2OU2 A;  1ZG1 A;  1Z6T A;  1S7O A;  4OIO F;  2P6T A;  4IF4 A;  1G3Y A;  4Y17 A;  3V8L A;  2YX4 A;  1KQ0 A;  1VTN C;  1QO0 D;  5F64 A;  3GF2 A;  2UWM A;  2ZME B;  4EQQ A;  2NNN A;  3FX3 A;  2ELH A;  1P4W A;  3LFK A;  4EM2 A;  3HRU A;  2A6E F;  3BWG A;  4A6E A;  2DFI A;  1IF1 A;  1Z05 A;  1G3S A;  1HXD A;  5DDG A;  4N0B A;  2EA4 A;  2IT0 A;  3DKW A;  2PFB A;  4WX9 A;  4ON0 A;  2Z9O A;  3COA C;  1KQ8 A;  1B1B A;  4IHT A;  4R8H A;  2QUF A;  4A5M A;  5J6X A;  1R1U A;  3QP5 A;  3ZMD A;  3KLO A;  2Q8K A;  1FPQ A;  3CTA A;  1SD4 A;  1O7L A;  2CG4 A;  2W85 A;  3IWF A;  3W6J B;  3TQN A;  5DCM A;  3WTY C;  4A12 A;  4BHP A;  1Z6R A;  2CGP A;  2LKP A;  4AWX B;  1SFU A;  4XSX F;  3CO7 C;  2K7L A;  1BI3 A;  2Z5U A;  4RAY A;  2O3F A;  1SFE A;  4XRF A;  1HW1 A;  1XSX A;  1RI7 A;  3R60 A;  2EWN A;  1ZAR A;  2HZT A;  3B02 A;  1IN4 A;  5DD4 A;  2MLK A;  3CUO A;  3DEU A;  4O3M A;  2A5Y B;  5K1Y A;  3MZH A;  4UVB A;  4MHG A;  2C6Y A;  2O6G E;  3SQN A;  2O61 A;  3KP3 A;  3WGG A;  3SHF A;  1TW3 A;  4MTE A;  5L3C A;  1D8K A;  2QM3 A;  4HV6 A;  2VT3 A;  1LQ1 A;  1YYV A;  1K78 B;  1OR7 A;  4GXO A;  3F22 A;  4WXD A;  5ICC A;  4HF1 A;  2K4B A;  2MH9 A;  1FYL A;  1ULY A;  1U5T B;  4P55 A;  2K27 A;  3H3U A;  2EA2 A;  4U7D A;  1I27 A;  2GXG A;  4PZJ A;  1KYW A;  4LK1 F;  1D5V A;  3FM5 A;  5FFZ A;  5FGM A;  1ZH5 A;  3CJN A;  3C7J A;  5FB2 A;  2Z33 A;  3CO6 C;  4ENK A;  2CO5 A;  2EK5 A;  4XLN F;  3IHU A;  4ZH4 F;  2OA4 A;  4Y13 A;  1LDJ A;  3HSF A;  1R58 A;  2QQB A;  4MNU A;  1GVJ A;  2CSO A;  3RYP A;  2VE9 A;  1LVA A;  2M1B A;  3E6D A;  3I58 A;  4I7H A;  4OIQ F;  2KIM A;  2L4A A;  5E1X A;  3TO6 A;  1FSE A;  3IKT A;  1HKS A;  3I0T A;  1R1T A;  4LB6 B;  1P92 A;  2Y48 A;  2HS5 A;  4CO8 A;  4JBA A;  4L9V A;  4LB5 A;  4RS8 A;  4CDG A;  2M8E A;  5DD8 A;  1LNW A;  5D5W B;  3BJA A;  4A0Z A;  2PMU A;  2KKO A;  4IRH A;  3TDU C;  3P7N A;  2LNB A;  4UXN A;  2RDP A;  2M87 A;  3G73 A;  1W4M A;  3ECH A;  1KQ9 A;  4K2E A;  4WF2 A;  2J5P A;  1P4A A;  1EV7 A;  2HDC A;  2JZY A;  2XKO A;  5HLH A;  4UVA A;  4EV0 A;  1UB9 A;  2A68 F;  4XLP F;  1OYI A;  1W7P A;  1T98 A;  1KU2 A;  1QNT A;  3ELK A;  4EMS A;  3AAF A;  2WC2 A;  1MD0 A;  4U0W A;  1JHF A;  3ZP5 A;  2VBZ A;  3ML6 A;  3DP7 A;  1OYY A;  5LRS A;  2R3S A;  5H6R A;  2J5O A;  5TJJ A;  3R0A A;  1S3J A;  4KNY A;  2QQ9 A;  2Y75 A;  1U3E M;  4KIB A;  3HHH A;  2DO7 A;  1R5H A;  3R0J A;  1BIA A;  2E1C A;  2FBI A;  4RB3 C;  3D0S A;  1XD7 A;  2ZXJ A;  4N9I A;  3ZN0 A;  4OMY A;  2H27 A;  2V1U A;  1XSD A;  3RKY A;  1LDD A;  3KP2 A;  2A61 A;  3WTZ A;  2BYV E;  4R79 A;  3FMQ A;  2EV0 A;  3RPU A;  4LG0 A;  4ZYH A;  2CWE A;  4HDV A;  1ODD A;  3IWZ A;  3TO9 A;  1UHW A;  4ZYG A;  2PG4 A;  4UVC A;  4ETS A;  4BQA A;  4OOI A;  3J81 K;  4L18 B;  4S04 A;  2EFO A;  4G6Q A;  3JTH A;  3FXU A;  4M6X A;  1FY7 A;  1I5Z A;  2KIU A;  1HQC A;  2GA1 A;  1P4X A;  2O0Y A;  2JSC A;  1J7K A;  5D5V B;  1Z91 A;  2PQ8 A;  5HLI A;  5LBQ A;  3OV8 A;  4Q5S F;  5CVV A;  4HLY A;  1PDN C;  1KU7 A;  3J80 K;  5F6F A;  5K5Q A;  1WSU A;  3FMR A;  4LGW A;  1U5T A;  3BZ6 A;  4U0V A;  2EB7 A;  5LGN A;  1QGP A;  1O3T A;  3F8M A;  4FT8 A;  1UCR A;  2L01 A;  4YFK F;  1STZ A;  3LA3 A;  3HSR A;  4U0Y A;  4M74 A;  2ISY A;  5BOX A;  3BJ6 A;  3EDP A;  3ZMV A;  3TGN A;  4A0Y A;  5BPD A;  3VB2 A;  5FD5 A;  2BE5 F;  4FX0 A;  2KJC A;  2QQA A;  2ACJ A;  2OQG A;  1XCB A;  2VON A;  1WRJ A;  1UHM A;  3ZQ7 A;  3PFI A;  4QWQ A;  2G9W A;  1SMY F;  1KU9 A;  2FF4 A;  3O6B B;  5ICE A;  3F8C A;  2EJR A;  3ISP A;  3GO5 A;  4S05 A;  2A07 F;  1XMA A;  3HUG A;  3DXJ F;  3F8B A;  3IRR A;  3FXQ A;  1R23 A;  3ZMS A;  3FM3 A;  1BI2 A;  1YG2 A;  3HOT A;  2VC0 A;  3C1D A;  1TLH B;  4RGU A;  2K02 A;  1DPR A;  1IRF A;  3REO A;  3C3W A;  4OIP F;  1B4A A;  1TTY A;  5LGU A;  1DP7 P;  4EJW A;  2XAJ A;  3HTU A;  1FOK A;  2X0L A;  5J8C A;  2E1N A;  3GZ5 A;  3E5Q A;  3DPT A;  5HS8 A;  4CHU A;  5EEH A;  3L09 A;  2GXB A;  3MZY A;  3GFL A;  2D1H A;  1ZRF A;  1IXC A;  3FWE A;  3JSP A;  1CF7 B;  2QWW A;  4A2U A;  2RKH A;  1ZN2 A;  4D0P A;  3BP8 A;  2XAG A;  1H9G A;  4HW0 A;  1S7A A;  2IRF G;  2PN6 A;  4YFX F;  4L0Z B;  3H92 A;  3RDI A;  2OBP A;  2D45 A;  2EV5 A;  1USS A;  2JRT A;  2KJB A;  2P5K A;  3MEX A;  1T2K A;  3DV8 A;  5FLX Z;  5AIQ A;  5DCF A;  4ESF A;  2ZME A;  1YO5 C;  2XUB A;  2QEN A;  2OZU A;  1MDM B;  2GWR A;  3KP6 A;  4A6D A;  1O3R A;  2F5E A;  2QZ8 A;  2PI0 A;  2FBK A;  1U5T C;  3HIF A;  1R00 A;  2Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...