3VFZA

Crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
DSVTRMNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mycobacterium tuberculosis RsdA provides a conformational rationale for selective regulation of sigma-factor activity by proteolysis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable RNA polymerase sigma-D factor
total genus 21
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vfzA00
3ECHA 3FXRA 2FBKA 3K1MA 3DP7A 2QQAA 5L3FA 2O0YA 4MTDA 1JHFA 1BN5A 2Z33A 1LEBA 3K1PA 3FM5A 1X3UA 5D5WB 4OOIA 4HDVA 5HLGA 1KQ8A 2FMYA 5FGMA 1J0RA 3BPXA 5BOXA 1ZRCA 2XHKA 2EFOA 3NEUA 2H09A 2EFPA 4S05A 4IHSA 3VB2A 1FWZA 5E18F 2F2EA 3U9GA 4WCGA 5LRSA 2Y0MA 1IN7A 3WTUC 3KEQA 2QYOA 1BM9A 5D5XB 2YPRA 3GYHX 2W85A 4OIRF 5JHUA 2E1CA 1TW2A 4MQ9F 3GVAA 4AWXB 1XCVA 3W6KB 3WGGA 5HS7A 1SD4A 2XAFA 3HSEA 1MD0A 4ESFA 1KA8A 1FY7A 3I54A 4N0BA 1FLIA 2RKHA 3QAHA 3EQLF 5H6RA 4RGSA 4OINF 2ISZA 3CUOA 1W7PA 4Q47A 4LD5A 5ILUA 2FNAA 5ICFA 2XKPA 3E5XA 3O2PE 3F6VA 1J7KA 1RNLA 3KP3A 3P9IA 3G73A 1FYMA 5L3CA 3HHHA 1L0OC 2K86A 4HX8A 2EV0A 1R5HA 2QENA 2O3FA 1XDUA 2L02A 5F1RA 3DFGA 3T8RA 2J5PA 4LMYA 5ICEA 3T8TA 2DO7A 3BOQA 1FYKA 1WKMA 4NHJA 4CZZA 4Y17A 3PQJA 3V7RA 5LGTA 4MGRA 3KZZA 3P7NA 2L4AA 4EJUA 2CSOA 3E5QA 3H3UA 2DPDA 3JW4A 5LHIA 2HYGD 4HF1A 2P5KA 1QPMA 2F5DA 3RKXA 4BQAA 3GW2A 4XLNF 5LHGA 3GFJA 3ECOA 3HRUA 2OBPA 4LG0A 5E20A 2R7FA 4MQVA 2QLZA 3Q9VA 2BBYA 3LA3A 1OPCA 2ELHA 1QZZA 4PCQA 4RGUA 2M87A 4BHPA 4QWQA 4KFCA 4HQMA 1R23A 4XSXF 4M6XA 2ETHA 2D1HA 1WI9A 3L9FA 3J7AO 2DK5A 2VT3A 1KU7A 4LB6B 4EM2A 2HGCA 2XAGA 1BC8C 3BDDA 4YIIA 4R79A 3GFLA 2UWMA 2W25A 1WWXA 2A68F 1VTNC 3LSTA 1YW8A 1H0MA 2CFXA 2COMA 3PFIA 3QP5A 4FX4A 1UHWA 4LFUA 2VBZA 4G9YA 3PQKA 1FNNA 2JZYA 2VXZA 2A3SA 3RDIA 2V6CA 5ED4A 3CJNA 1YFHA 2F5EA 2FNPA 1RZ4A 2RGVA 2W84A 4L0ZB 1QBJA 3FWEA 1ZYRF 3EUHA 1R22A 3RJPA 1BI1A 4JK1X 5D4SA 3F8CA 2FRHA 5D6FA 3NRVA 2P5VA 4JQFA 5K5OA 4QLCU 1Z05A 2OU2A 4XLPF 2A07F 2XRNA 2A5YB 2H27A 4HAMA 5FFXA 2VOOA 1H9GA 2X4HA 3W6JB 1HW1A 1LJ9A 3V8KA 2GIVA 3I4PA 3QU3A 2G7HA 3JAMK 5H20A 3GZ6A 2MA3A 1JE8A 5HS9A 3F8BA 1SFXA 1O3SA 1U8RA 1L3LA 2M30A 4G7HF 2HTJA 1RIOH 2XUBA 3QOPA 4KN4X 2MD5A 1BIAA 2TDXA 1U5TA 4UV8A 2FBIA 4MNUA 4YIFA 4O3MA 1V3FA 5E8IA 5JVTA 3OV8A 3WTYC 1U3EM 5CLSA 1TBXA 3E5UA 1FX7A 3ABTA 3TDZC 4CXFA 1REPC 2MH2A 5D5VB 2XASA 4G7ZF 1IRGA 5LRRA 5TJJA 4GYIA 4L5JA 3GWZA 4IRHA 3KLNA 2R7DA 1IUYA 2GA1A 1G3YA 3CDHA 1T2KA 1FC3A 5HVQC 3F8MA 6PAXA 2OZUA 1XGNA 2VC1A 3ZQ7A 2V1UA 3JSPA 4EGZA 1SFEA 2BE5F 4ZYHA 4ZYGA 5HDGA 2HKOA 1YTYA 3BJ6A 1KYZA 1HKSA 2W24A 1J9IA 1EH8A 3TOAA 3LA2A 1T38A 1U6GA 2GXGA 2CW0F 3C1DA 3MCZA 5HS8A 4KN7X 2GZWA 1HSJA 5DCFA 2JTVA 1IXCA 2F5CA 2Z99A 2V1XA 1SD6A 1D8KA 4UUVA 3IRQA 2P8TA 2BYVE 3QRFF 3KP4A 4YG2F 1YW9A 3CUQA 2WV0A 2VONA 1P4XA 2DU9A 2FQ3A 1C0WA 1IN6A 2ZO4A 2EFQA 2XV4S 1FZPB 2P4WA 5F64A 1V4RA 3DPLC 2OAZA 3K1NA 2XROA 2YX7A 1IZ1A 2PEXA 2MLGA 1FP1D 3I53A 1P4WA 4P96A 1HW2A 3WTZA 2DAOA 3KFWX 1U5TC 1JXSA 2F5FA 1EV7A 2FU4A 3J80Z 1KYWA 1P2FA 1ON2A 3T5XA 3I5UA 4ZYEA 4RAZA 4KYWA 4BAYA 4LLLA 4EQQA 5DD4A 2E7WA 1KU3A 4I0BA 2D2WA 5CVUA 4ZZLA 3FHZA 1UFMA 4BHCA 3G3ZA 3WTVC 1PP8F 4BNCA 4E70A 4PDKA 1EH7A 1Z9CA 1XGOA 3MEXA 2STTA 4WXDA 2DT5A 1BBYA 1U2WA 1BI0A 3K0LA 1O3RA 4NQWA 4IJAA 5CJ9A 1PP7U 2UXXA 3QPHA 1H9TA 4AVPA 4IPAA 4GYGA 5BQTA 1FBUA 3WODF 4DNCA 3R4KA 1U5TB 4LB5A 2Z9OA 1ODDA 3L00A 3RKWA 1ULYA 3QPTA 2VBYA 5ILVA 4KICA 3FM3A 1WQ2A 4G6QA 3CUQB 2CWEA 3OOPA 4ASNA 1O3TA 3WTTC 1LQ1A 1XSXA 3E3VA 3MWMA 2MH9A 3EDPA 1D8JA 5HLIA 4Z2YA 1O3QA 1SMTA 3ZN0A 1ZGJA 2EA2A 2P6SA 1F5TA 1QQIA 3VOEA 2HS5A 2CO5A 2GWRA 1Z91A 5CVRA 1SAXA 3K9TA 3WTSC 1Q1HA 2NYXA 2CQKA 2E7XA 3HOSA 3KP7A 2EFWA 2EA4A 1I27A 3O6BB 3BROA 4I98B 2K7LA 3LWFA 3HOTA 5K5QA 3JTGA 3TOBA 5D6EA 4YFNF 3R0AA 3L2CA 3HTSB 2QUFA 1XDSA 1Z6RA 3JSOA 3SZTA 2L4MA 5BPIA 3U2RA 3GFIA 4M9SA 2O61A 1DUXC 4I0AA 4H0EA 2M1BA 2PQ8A 5EEGA 1XSVA 3BP8A 4HV6A 1BI2A 5H6QA 3KP2A 5K5RA 3MFKA 1ZRDA 1NHAA 4EGYA 3N4MA 3WG9A 1GXPA 4HX4A 2PFBA 2KJBA 4OIOF 2NRAC 2RDPA 4CHUA 1LVAA 1ZLJA 4MEXF 3CLOA 2HQRA 4FX0A 2JRTA 1LEAA 5A2QZ 1R58A 3VEPA 1W7PD 1XD7A 4M74A 3WE3A 3HSFA 1YLFA 1FSHA 2A6HF 2PI0A 2OQRA 1G6NA 2EB7A 3TGNA 1F9NA 3DEUA 4BH9A 4EJVA 2J5OA 3KP6A 1OR7A 4RB3C 1G3TA 3BWGA 4RB2C 4HF2A 2ZJ2A 4CO8A 1DP7P 1S6LA 2RN7A 3TO9A 5EEHA 4ENNA 2BEOA 3F21A 3DXJF 4KDPA 5IT3A 2FSWA 1SD5A 3LAJA 1W5SA 4ON0A 4LLNA 1Z1DA 1LDKB 1KQ9A 4M9ZA 2GXBA 1R36A 2V9VA 1OYIA 3ABUA 2PN6A 3FMRA 4UHTA 1G3WA 3RIRA 3TDUC 1B4AA 1RI7A 2GA2A 3ROUA 2LKPA 3F22A 5FB2A 4UVAA 3DV8A 2ZKZA 4KMUX 5DUIA 1RUOA 1O57A 3CO7C 1YW7A 4U88A 1I1GA 4F7ZA 4A0YA 4CYDA 2UXNA 2VOPA 2ZNYA 1GVJA 1ZH5A 3ZN1A 3SZPA 2EV6A 4NB5A 4EV0A 1ZAOA 1ZG5A 1XN7A 4ESBA 3HHGA 1CGPA 1XMKA 3K69A 1IW7F 3HRTA 2L01A 1K78B 4KT5C 3GFMA 4IXAA 2KJCA 5HOOA 4OIQF 5KK1A 5IT9Z 3LQQA 4YFXF 1U78A 1HKTA 2QQ9A 4IRIA 5BPDA 1TNTA 1T39A 1B59A 5LHHA 2HEOA 2WTEA 2CG4A 5BMZA 1HW5A 2HDCA 2CYYA 3SHFA 4Y15A 1DPUA 1J5YA 3I0TA 1IAWA 5D4RA 1GXQA 1W5TA 4HDUA 4GO1A 5LBQA 2DFIA 2BV6A 2XAHA 4WF2A 3C3WA 1R1TA 5DCMB 2A61A 3ULQB 3ML6A 4EJTA 2G7UA 2ZFWA 3E6DA 3RPQA 1MKMA 2V1DA 1TW3A 2L3DA 4KIBA 3LAPA 4KIFA 4XRFA 4U0YA 4A6DA 2JSCA 4HBLA 3N97A 1MZBA 1TQPA 2O6GE 2OQGA 5J6XA 1YO5C 3V8LA 4IRGA 1CF7A 4ETSA 4PGHA 4N9IA 1P92A 2P7CB 1KGSA 1B6AA 3MZYA 1FSEA 1IXRC 2FOKA 3HSRA 4S04A 2WWYA 3JAMZ 1R1UA 2DBBA 1F1ZA 3EYIA 2IA1A 1HBXG 3RTRA 1MDMA 2ESNA 2E1NA 2DQRA 1E17A 1USTA 4U0WA 4RB0A 3RPUA 2XKOA 1K7AA 4A6EA 4JBAA 4LK1F 4L18B 2NAZA 4WK8F 2RC4A 5FLXK 4WX9A 2P7VB 4BXUA 1XCBA 3TO6A 5DD8A 5DUKA 4MTEA 2MBFA 1MGTA 3IHUA 2AS5F 2EFNA 5AONA 2HZTA 2ZCWA 1B9NA 2QVOA 4KNYA 2GAUA 3GUDA 1FYLA 4I2OA 3WGHA 3MQ0A 3LFKA 4L9NA 3FF5A 4LJZF 3S2WA 2XAQA 4UV9A 2M8EA 4FT8A 1MJBA 2VODA 2HKXA 3IC7A 5L3GA 4O6JA 2ACJA 3SQNA 3ZMTA 3BPVA 2VC0A 3Q9SA 3H92A 2D1VA 3KEOA 1OMIA 1ON1A 4AIHA 5CYVA 1A04A 2H94A 2A69F 3M8EA 3HTUA 5DCMA 2JT1A 1BOAA 2Y75A 2YU3A 3DQVC 3F3XA 2HOEA 3RKYA 3WGIA 4CGZA 4BHBA 1TQIA 1B9MA 2XGXA 1HXDA 3HRMA 4PZJA 5DDGA 2EK5A 2A6EF 3V7CA 2FBHA 1ZHFA 2DTRA 4OIPF 1P4AA 3F23A 4WXCA 2EJRA 1T6SA 4B09A 2VE8A 3P9KA 3I71A 2PMUA 1JGSA 2IJLA 4IVNA 2K4JA 3KP5A 2Q0OA 2K02A 4HLXA 5ILSA 3WTXC 3V8JA 2STWA 4EM0B 1G3SA 3KETA 2YSRA 3ZPLA 1BI3A 1IN4A 2MC3A 1EH6A 2KIFA 1OKRA 1XGMA 1XMAA 1SD7A 2ZNZA 2QWWA 3WU1B 3ZMUA 2HYFA 2VT2A 3R6SA 2VE9A 1K78A 2EWNA 4RS8A 4A0XA 1S8NA 4AD9A 2MLKA 3IWZA 5AIPA 2WC2A 4G8XA 4GCVA 5TRDA 1J59A 4AIKA 2P6TA 2FEZA 5CVIA 5K1YA 3IRRA 3WTWC 4B8XA 1YYVA 3T0YA 4M6YA 2IP2A 4IF4A 2QBYB 3K2ZA 2QZ8A 4WWCA 4UVCA 5E1XA 5JI6A 3FX3A 4GXOA 4ENJA 3FMQA 4O5VA 4P55A 3M1EA 2M5WA 3RYPA 2DPUA 3COAC 2XVCA 4IHTA 4MHGA 3KE2A 1ZGAA 4U0VA 1KQ0A 5BS6A 3B02A 2Q8KA 1PUEE 5DEQA 3R0JA 4D0PA 5L3EA 5LGUA 4RGXA 4Y13A 1R00A 1W4MA 3TKYA 3BZ6A 4P5OA 4R8HA 3ZP5A 2LNBA 4HQEA 2HFHA 4G7OF 3CO6C 3B73A 3E6BA 5HDKA 3TQNA 4UVBA 3M9AA 2IA2A 2QM3A 3M8FA 4L9TA 3J80K 4CDGA 2KRFA 1K6OA 1CF7B 2JPBA 4OU0A 1Z6TA 4FHTA 1FPQA 4LK0F 1BC7C 4MEYF 3RI4A 3Q5FA 3DPTA 4OMYA 1FBSA 2DW4A 5LLQA 3R61A 4EM1A 2LSOA 3HUGA 2ZMEB 3I59B 5E17F 2L54A 1LB2A 1OYWA 2RNJA 5E1ZB 4EJOA 2K4BA 1FOKA 5AIQA 1RUNA 3EETA 4XSZF 1AWCA 3F72A 4EMSA 5D5UB 3V4GA 2V79A 1HKQA 2PLYA 2VN2A 5FLXZ 5E8GA 4ZYDA 4LLGF 4P9FA 1DDNA 2LF7A 1O7LA 3TO7A 2ESHA 3L09A 1S7OA 1ZG1A 1QGPA 1ONVA 4A12A 3ISPA 2AXLA 2X0LA 4YFKF 1TLHB 2KKOA 1UB9A 2ZBKA 3P9CA 4UNOA 3FXQA 2IRFG 3D0SA 4L9VA 2B0LA 4ENMA 2HQNA 3H3ZA 3L7WA 2KIUA 4HLYA 1T0FA 2JPCA 2LDUA 3KLOA 1FP2A 1STZA 1TTYA 3IKVA 4A2UA 4HYEA 2H6BA 1SMYF 5D8LB 4L9JA 3REOA 2IVMA 5DYMA 4AIJA 2G9WA 1ZLKA 3WU0A 3AAFA 3SXYA 3E97A 2NNYA 2NS0A 2YR2A 1UHMA 3CTAA 1QZYA 3LA7A 4HOBA 1PDNC 3SFZA 2FXAA 4M71A 4EVIA 3O3KA 2XAJA 1Z7UA 2Z3YA 5CVJA 2OZ6A 1BJAA 3GF2A 4P9UA 1IF1A 2FE3A 1P6RA 5A2QK 5L3DA 4LGWA 5E1WA 1AOYA 4M9XA 4BYYA 2VBXA 4WXHA 4RAYA 1UCRA 2RV8A 3C7JA 1T98A 4M72A 4HX7A 1WRJA 3QU6A 1S29A 2O8XA 3GXOA 3VFZA 5FO5A 5J8FA 5KVRA 1LDJA 1YG2A 1TNSA 5ERIA 4U7BA 4KMFA 1BIBA 1E2XA 3BJAA 1D5VA 3QP6A 2R3SA 3GZ5A 1IRFA 3MAJA 1GHCA 2O03A 1OYYA 2C6YA 3F6OA 1YS6A 3M7GA 5HDNA 2XIGA 3HIFA 1ZN2A 3T1BA 2QQBA 3BY6A 4DQ2A 1YIOA 3F8NA 2ZXJA 4I7HA 4U7DA 1HQCA 2PJPA 4CICA 3MZHA 1I1SA 1QO0D 3I58A 3FZVA 1XSDA 1TQMA 5LGNA 4HA8A 3KZYA 5D8KB 4L0YB 1XB4A 2CGPA 4R1HA 1XGSA 2M45A 4HW0A 5FFZA 3JTHA 4L5IA 2P5LC 2PMHA 3ERED 2DLLA 5CVVA 3U1DA 1DPRA 3HRSA 1D3YA 2DQLA 3IL2A 3F8FA 3RYRA 2GQQA 5FD5A 5LEKA 5ICGA 3ELKA 2BGCA 4Q48A 4XBFA 1J75A 3EYYA 3GX4X 4M73A 1MJ9A 2HTSA 2UZKA 2DI3A 5JFRA 2H6CA 2FMLA 1S7AA 1KU9A 3I59A 3ZMSA 5LEJA 2ADUA 4I01A 4LG0B 3V7SA 4I09A 5JR3A 4UXNA 1YS7A 1R7JA 3IWFA 3GEZA 1MJAA 4ENKA 2EV5A 2DK8A 3D5LA 1S3JA 2IPQX 4A5NA 1WSUA 2FF4A 3BJOA 1FT9A 3GLXA 1ZG3A 1I6XA 1Y0UA 1F4KA 1O7FA 1USSA 1ZRFA 3CUQC 4RB1A 2OD5A 1KU2A 2RVCA 2D45A 4I02A 1LDDA 5IT9K 1IN8A 2FA5A 3DKWA 5FD6A 3WE2A 1FBQA 4HV5A 4ZZDA 5HLHA 4PGGA 1W7PB 2HR3A 1YQAA 1MDMB 3C18A 5L3BA 2QBYA 2VBWA 5J8CA 2W57A 2IA0A 1HSTA 1R1VA 1LNWA 3KCCA 2LF8A 4RGRA 5DV5A 1K79A 3ZMDA 4KUMA 3FXUA 4KA4A 4Q4ZF 1G4DA 2IT0A 1J2XA 2ISYA 3E6CC 3J81Z 2NNNA 2PG4A 4N9HA 3NQOA 3IKTA 3R60A 4A5MA 4K2EA 2RQPA 5ICCA 4HF0A 3DF8A 3HYIA 4ZH4F 4KIGA 1JHHA 4G94A 1ZREA 4EJWA 4OMZA 4Q5SF 3E6MA 2YX4A 1ZARA 1IN5A 2ZMEA 2IW5A 3ZMVA 3I64A 2K27A 2PBIA 3GO5A 5F6FA 3J81K 4GGGA 2Z5UA 1SFUA 1R5GA 4ESJA 2OA4A 2HWVA 4HZFA 2Q2EA 1B1BA 1I5ZA 4G6DA 3FMSA 4TV7A 4A0ZA 1QNTA 2Y48A 3VODA 3LQRA 3ZMZA 2KIMA 1IXSB
chains in the Genus database with same CATH superfamily
2PMZN 3ECHA 3FXRA 2FBKA 3K10A 1T8IA 3K1MA 2R92J 4ZJZA 1IJWC 3MKYB 3DP7A 4BJ5C 2QQAA 1H88C 5L3FA 3EUAA 2O0YA 4E7SA 3H35A 1Y1VJ 3VYSB 1E3OC 4MTDA 1TWCJ 1JHFA 1BN5A 4CCKA 3OIQA 4CH7A 5IY5H 2Z33A 2LLKA 1JT6A 1LEBA 3VSKA 3A03A 1FTZA 5TISC 1ZQ3P 3K1PA 3BLYA 3FM5A 1X3UA 3ZRGA 2KLOA 5D5WB 4OOIA 4HDVA 3GCMA 5HLGA 1KQ8A 1MNEA 5M5XJ 5M5YJ 2ZMEC 2ZXIA 2FMYA 4XM3A 3HOZJ 2MFZA 5FGMA 4YRVA 1J0RA 2W1OA 3BPXA 1XG1A 3O8HA 4I99C 3UNGC 5BOXA 2XHKA 2EFOA 1ZRCA 3NEUA 2CJJA 2H09A 2EFPA 1IO2A 4S05A 4IHSA 4F3QA 3VB2A 1FWZA 2ID3A 1WJCA 3OMYA 2ZJQF 3OS1A 5E18F 2F2EA 3G4SI 3U9GA 4WCGA 5LRSA 2OF7A 2Y0MA 2XC7A 1IN7A 3WTUC 3KEQA 2QYOA 1BM9A 5D5XB 4AC0A 2YPRA 3GYHX 2W85A 4OIRF 1MH3A 5JHUA 1OR7C 4XLAA 2E1CA 2BHYA 1TW2A 4MQ9F 1JUPA 3DTKA 3GVAA 2QSGX 4AWXB 5EZHA 1XCVA 3W6KB 3WGGA 2K3FA 5HS7A 1SD4A 4CCJA 3UKGA 2XAFA 3HSEA 2VB6A 2L0KA 1MD0A 3D5SC 3DCFA 4ESFA 2EBIA 4Y7NJ 3K4KA 3U21A 3I9V2 1KA8A 1FY7A 3I54A 4N0BA 5IYBJ 1FLIA 2RKHA 3QAHA 2CUJA 3EQLF 5H6RA 4RGSA 3BTIA 3IV5A 4OINF 4X1EA 2ISZA 3CUOA 5HLTA 3CF5F 1W7PA 5FKNA 2D5VA 5JHFA 4Q47A 4E7ZA 1LKXA 4LD5A 4JOMA 3QODA 4FETA 2Y9YA 1V54H 3S32A 5ILUA 2Y0SN 2FNAA 5ICFA 3OYJA 2XKPA 3E5XA 3ASNH 3O2PE 5HNFA 1R4NB 3IP4B 1R5ID 1BOBA 3DEEA 5FJ8J 3CP8A 3CF2A 3F6VA 5IYCJ 5M5WJ 1J7KA 1RNLA 2X9DA 3KP3A 3P9IA 5EYRA 3AL0C 3G73A 2JN6A 4PFPA 1FYMA 5L3CA 3K6GA 1T33A 3HHHA 3JRGA 3MVPA 2CQQA 3LSRA 1L0OC 1N78A 2XGDA 2K86A 3A0HC 3G1MA 4HX8A 4L5EA 1R6RA 2HXIA 4UUTA 2QF7A 2EV0A 3A01B 1R5HA 2QENA 2ZB9A 3DWLE 4HNTA 3JCUC 2O3FA 1QA6A 1XDUA 2DA4A 4P1WA 2L02A 2CU7A 5F1RA 3LMMA 3DLLF 2DN0A 3DFGA 4D9JA 2V6EA 3T8RA 4II3A 1VQ5I 2J5PA 4LMYA 5ICEA 3T8TA 3K2AA 1Z67A 2DO7A 3BOQA 4PSWA 2CRGA 1PUFB 4BJ6C 1FYKA 1WKMA 4NHJA 2L9RA 4CZZA 5EGOB 1S5LC 3OSFA 4Y17A 3PQJA 3V7RA 4F91B 3OIPA 5LGTA 4MGRA 3KZZA 5CKTA 3P7NA 2QKMB 5M3MJ 2R7WA 2L4AA 1X2MA 1VI0A 4EJUA 2CSOA 2DTZA 3E5QA 5B1AH 3H3UA 1ACIA 2L5QA 4XONA 2DPDA 2BY1A 3LSGA 3JW4A 3NARA 2R7TA 2YU9J 2MYSA 2YS9A 5LHIA 4BDYA 1APLC 2PJRB 4DYQA 2HYGD 4HF1A 2P5KA 2NVUB 3H9QA 1QPMA 3ZQGA 2F5DA 3RKXA 4HEA2 4BQAA 3GW2A 4XLNF 5J4VA 2X48A 3D5RC 2WAQA 3FK6A 2N8GA 4C2MJ 5LHGA 3GFJA 3ECOA 4IQ4A 3CCYA 2F4IA 3HRUA 2E2IJ 2E36A 2OBPA 4LG0A 3GTGJ 5E20A 4XIDA 2R7FA 4MQVA 2M4KA 3CCUI 2QLZA 2VL8A 3HM5A 3Q9VA 3S17J 4ITVA 1TWFJ 2BBYA 2CUZA 3LA3A 1OPCA 2CQ7A 2NVXJ 2ELHA 1QZZA 2HPIA 3BCAA 1DU0A 4PCQA 2Y31A 4RGUA 1MBEA 2M87A 4BHPA 3BC8A 4J01A 2DODA 4QWQA 4KFCA 4HQMA 3ABMH 4E6KG 2H8RA 1R23A 4XSXF 4M6XA 4JX4A 4XKBA 5EZGA 2ETHA 3WU2C 1ZR4A 2D1HA 1WI9A 3MN2A 3S14J 3L9FA 3J7AO 3DTIA 2DK5A 2VT3A 2OC6A 2Y9ZA 1RC9A 2XRLA 3K4NA 4LB6B 4EM2A 1KU7A 1YX3A 2I8DA 2HGCA 2XAGA 5GAEJ 1H89C 1Z77A 2COBA 2XPUA 1BC8C 4XLHA 4KITB 2XF5A 3BDDA 4JX6A 4LIUA 4IHYA 3P5JA 4YIIA 1OCOH 4R79A 1WVRA 3GFLA 2UWMA 3M8JA 2W25A 3MZ8A 4PJLA 5IYDJ 1WWXA 2A68F 2K3PA 5DS9A 3CCVI 1I6HJ 1VTNC 4DBQA 3LSTA 5JLXA 4XQFA 1ITYA 1YW8A 1Z3XA 1MW7A 3PIOF 1H0MA 2CFXA 2COMA 3PFIA 3KPHA 3S1MJ 3QP5A 1D5YA 4FX4A 1SVOA 1UHWA 4LFUA 2VBZA 4G9YA 4MO7A 3PQKA 5EGOA 5JVGF 3G1OA 3VDXA 1FNNA 4M3EA 3CJQB 2JZYA 1A36A 4XMYA 2VXZA 2A3SA 1LFUP 3RDIA 5IOZA 3UR3C 2IBDA 2V6CA 5FROA 3OYHA 1VQNI 5ED4A 1AHDP 2VQGA 3CJNA 1YFHA 3PNVA 2K85A 4BBRJ 2X85A 2DYRH 4QIWN 2F5EA 2FNPA 1RZ4A 2RGVA 2W84A 4L0ZB 2JRMA 1Y8QB 5F27A 1QBJA 3FWEA 1ZYRF 3EUHA 1R22A 3RJPA 2AQEA 2WB1A 3OR2C 2E2JJ 5LFAA 1BI1A 3B6AA 1ETXA 3ESWB 4JK1X 4QTRA 4NNJA 5D4SA 3F8CA 1VFCA 2CS3A 2FRHA 3CLQA 5D6FA 1GUUA 3NRVA 3N05A 2P5VA 5FRNA 4JQFA 3QWLA 2HYJA 5K5OA 2R5YB 4QPQA 4QLCU 1HF0A 4Y4RA 1Z05A 2OU2A 3M4OJ 4XLPF 4RM3A 5J47A 2XRNA 2A07F 1K4TA 3RSNA 4C2TA 1VQ4I 2A5YB 2H27A 1IUFA 3GTQJ 1E0EA 4HAMA 5FFXA 3CC7I 2VOOA 1H9GA 1NG7A 3W2AA 2GBYA 1SAUA 2X4HA 3W6JB 1HW1A 2B9SA 1LJ9A 3V8KA 1A5JA 1Z0XA 2GIVA 3I4PA 4XKVA 3QU3A 2G7HA 3JAMK 5H20A 3GZ6A 2MA3A 3S15J 2DA2A 1JE8A 5HS9A 2R7QA 3F8BA 2E5ZA 3V42A 1RKWA 2MGQA 1D1CA 1BW5A 2JVHA 1SFXA 1XX5A 3LSJA 4YIRX 1O3SA 2DOFA 3AKZA 2CUEA 1U8RA 1ZTRA 2O9LA 1L3LA 1ETVA 2BZTA 2M30A 2VXDA 4G7HF 4IL6C 1MIJA 2HTJA 1TWHJ 1RIOH 4Y33A 4A3KJ 3TW6A 1JKOC 2IAIA 3L2WA 2LD5A 5B5EC 4D1QA 4F92B 2BY3A 1SFOJ 2DMPA 3Q0UA 2XUBA 1WJEA 1X1CA 3QOPA 4KN4X 2MD5A 1BIAA 2TDXA 1U5TA 4UV8A 3ZQHA 3RCOA 4E7HA 2FBIA 4MNUA 2BHZA 1I50J 4ANJA 4XRMA 4YIFA 4O3MA 2EIMH 2JA2A 5GTHC 2XDVA 2R7VA 2LC2A 2OUMA 1BR2A 1V3FA 5E8IA 5JVTA 1XC5A 3OV8A 3WTYC 3PUFA 4Y3OA 1X19A 3OYDA 3BT9A 1U3EM 5CLSA 1TBXA 3E5UA 2HOAA 1FX7A 4AU7A 3QPSA 4B4CA 3VWBA 3FISA 3SDBA 2HDWA 3GTJJ 3PO3J 2VASA 3ABTA 3TDZC 4B47A 3OS2A 4CXFA 4BY1J 1MMDA 4I76A 3M07A 3CDLA 3G1LA 1D1BA 1REPC 2MH2A 2IXSA 3HPHA 5D5VB 4E4HA 3HOWJ 5CPRB 2XASA 4G7ZF 1IRGA 5LRRA 5TJJA 1R4MB 2M34A 4GYIA 1WJFA 1ENHA 4L5JA 3F0CA 1Z21A 3GWZA 4IRHA 3VPRA 1EF4A 1YOVB 3AFHA 2R7DA 3KLNA 4B48A 1IUYA 2GA1A 2M3AA 4DGWB 1G3YA 2A05A 3CDHA 1T2KA 2M0CA 1FC3A 2VPRA 2V1NA 3F8MA 3S93A 5HVQC 6PAXA 2OZUA 1XGNA 2VC1A 1X1PA 4S0HB 4MFDA 2X6XA 3FBNB 1LE8B 3ZQ7A 2V1UA 3LNQA 3JSPA 4EGZA 1SFEA 3SDGA 1EJ9A 3KX2A 3OIOA 2ELKA 2M8GX 3H5NA 4A3GJ 2BE5F 4ZYHA 4ZYGA 2VUMJ 2K9NA 5HDGA 2HKOA 4NC7A 3BJ6A 1KYZA 1KZHA 3EPZA 3CCQI 3OSGA 1HKSA 1YTYA 2W24A 3SYTA 1FEXA 1J9IA 1EH8A 2DOAA 3LA2A 3TOAA 1T38A 1U6GA 3E7LA 2GXGA 2CW0F 3OYNA 3KYDB 3BR0A 3C1DA 3MCZA 2LP0A 5HS8A 1EA3A 1LPQA 4KN7X 3H0DA 2GZWA 2KP6A 4OAYA 1HSJA 2PJRA 2HXOA 2NOGA 4CCMA 4E7JA 4XN0A 1WJAA 2V4JC 3K4MA 5DCFA 4C3JJ 5IP9J 2JTVA 1IXCA 2F5CA 5F04A 2Z99A 2V1XA 3CMYA 1VQ8I 3IH4A 5GP9A 2WA0A 4M3FA 2RREA 1SD6A 4RLQA 1D8KA 1K6YA 3LSIA 3W2WA 4UUVA 1T56A 1YX5A 2I10A 3IRQA 3S16J 2P8TA 2BYVE 3QRFF 1ERDA 4BY7J 3K4LA 3QQAA 4E7IA 3IH2A 3WHBA 2M7BA 1SEUA 1OFCX 3KP4A 4YG2F 1YW9A 3CUQA 2JUGA 1S72I 2WV0A 3DU5A 4XKWA 1P4XA 1D0ZA 2KZGA 2DU9A 4YELA 2R5ZA 2VONA 2FQ3A 3TP3A 1C0WA 1IN6A 2ZO4A 2EFQA 3J7YJ 4A3CJ 1ZKGA 2XV4S 3OL4A 1FZPB 2P4WA 4IHWA 3JRDA 5F64A 2VQLA 1V4RA 2LTPA 3DPLC 2OAZA 3K1NA 2XROA 2K9QA 2YX7A 2ECCA 4XL9A 1IZ1A 2PEXA 2MLGA 2HNHA 3TL4X 3BG9A 2XGEA 1FP1D 3I53A 3CCRI 1P4WA 4P96A 4BXFA 1U8BA 3OYEA 1HW2A 3A0BC 2DT7B 3WTZA 2DAOA 3KFWX 1U5TC 1WJDA 4CYCA 1X58A 1JXSA 2F5FA 1EV7A 3L1PA 1ETYA 2FU4A 5B66C 2HZDA 3J80Z 1KYWA 1P2FA 2V7FA 1ON2A 1X3WB 3T5XA 2B63J 3I5UA 2HQAA 2XB5A 3A2KA 4ZYEA 3DEWA 4RAZA 1JKRC 2DMUA 2R7UA 4E7KA 1FOWA 1JGGA 4KYWA 1Y0NA 2FX0A 4DYRA 3MKWB 4BAYA 2R4GA 4LLLA 4EQQA 5DD4A 1KONA 3FHNA 4Y52J 3ABKH 4D7MA 2E7WA 1KU3A 4I0BA 2D2WA 2XAUA 5CVUA 1DGWY 4ZZLA 3FHZA 1G8XA 1UFMA 3OYMA 4BHCA 1O4XA 1XTAA 3G3ZA 4A3LJ 2H1LA 3WTVC 3H1CA 3TP0A 2QCOA 5GPCA 3K4CA 1PP8F 4E70A 4BNCA 4PDKA 1EH7A 1Z9CA 1XGOA 4XLEA 3H9GA 3JREA 1UAAA 3RZOJ 3MEXA 2STTA 4WXDA 2DT5A 3HEFA 3L2VA 1BBYA 1U2WA 1GT0C 1BI0A 5IP6A 3K0LA 3NAUA 3HUGB 3GTLJ 4M3GA 1O3RA 4NQWA 4IJAA 5CJ9A 1PP7U 2UXXA 3OS0A 3QPHA 1H9TA 4AVPA 4HNVA 4IPAA 4GYGA 5BQTA 1VQPI 4F55A 1FBUA 3WODF 4CSWA 4DNCA 3R4KA 1U5TB 4LB5A 4GFBA 1FIPA 4ZDOA 2Z9OA 1ODDA 2FJ1A 3L00A 2HDDA 1DGRM 3HG9A 4UUSA 1OISA 3RKWA 2ZJRF 1ULYA 2L9VA 3PJRA 3QPTA 2VBYA 5ILVA 2VLAA 4KICA 2LREA 2DMQA 1UHSA 3FM3A 1WJ5A 1WQ2A 4G6QA 3CUQB 2CWEA 4D5CA 3OOPA 4ASNA 1O3TA 4KISA 4CUGA 3WTTC 3C2BA 2NVYJ 4AM3A 1LQ1A 1XSXA 2V9PA 3E3VA 3MWMA 5GPAA 2BVLA 2MH9A 2DA5A 3EDPA 1V5GA 1D8JA 5HLIA 4BJTA 3W3CA 1ETKA 4Z2YA 1O3QA 3CP2A 1HLVA 1SMTA 3ZN0A 3I4MJ 1ZGJA 1VF9A 3GMEA 2EA2A 2P6SA 1WHUA 1F5TA 1QQIA 2M2EA 2WB1N 3VOEA 3VYTB 5F0HA 4A93J 2LBFB 2HS5A 2CO5A 3HKZA 2GWRA 1Z91A 5CVRA 4A3EJ 3K9TA 1SAXA 2CV2A 3WTSC 5EF6A 1Q1HA 2NYXA 1Y39A 2CQKA 4M6VA 2E7XA 2ECBA 3ZXSA 3KP7A 3HOSA 2MABA 1ZR2A 1PJRA 2EFWA 3S8PA 4LIVA 2EA4A 2O8KA 4HRIA 2JA7J 1I27A 3O6BB 4FCYA 3BROA 4I98B 2K7LA 1IRZA 2NVTJ 3LWFA 3HDDA 3RQ4A 3HOTA 3QYBA 1MH4A 5K5QA 2DA7A 3JTGA 3TOBA 5D6EA 4YFNF 3O8GA 1R9TJ 3R0AA 3L2CA 3S2HJ 4XLCA 4AIDA 3HTSB 2QUFA 2EZHA 3BR3A 1XDSA 2BXYA 2CUFA 2HU9A 1HDDC 1Z6RA 3JSOA 3SZTA 2CV1A 2L4MA 5BPIA 3U2RA 4XOPA 1TC3C 3A1YA 3X2QH 3GFIA 4ABZA 4M9SA 2O61A 1DUXC 2ICWG 2W48A 4IEJA 4I0AA 4H0EA 4CYCB 2M1BA 2PQ8A 4G6TB 5GAHJ 5K7FA 5EEGA 1XSVA 3BP8A 4A3BJ 4HV6A 1BI2A 2GIZA 5H6QA 3KP2A 5K5RA 3U1KA 2FD5A 4W97A 3QPLA 5FLMJ 3MFKA 2X1DA 1ZRDA 4QPOA 1NHAA 4EGYA 3N4MA 3WG9A 1GXPA 3ZQLA 4HX4A 2PFBA 2KJBA 4OIOF 1GVDA 1UZCA 2NRAC 2RDPA 3S3NA 4CHUA 1LVAA 1ZLJA 4MEXF 3CLOA 2HQRA 3KZIC 4NDLA 2E35A 2F4OB 3PNTA 4XK4A 3RQIA 4FX0A 3FKJA 4M3BA 4LOCA 2JRTA 1S7EA 1LEAA 5A2QZ 4MLOA 1VQ6I 1UMQA 1R58A 2VKDA 3VEPA 3I55I 1W7PD 1XD7A 3CJRB 4M74A 3WE3A 3HSFA 1YLFA 1FSHA 3G71I 2A6HF 2PI0A 2OQRA 2OCCH 1G6NA 2EB7A 5E3NA 2EIJH 2ME6A 3TGNA 3RZDJ 1F9NA 3BZKA 3DEUA 4C30A 3SFIA 4BH9A 3CESA 4EJVA 2J5OA 3KP6A 1OR7A 4RB3C 1G3TA 3ZQQA 3BWGA 4RB2C 4HF2A 2XGCA 2ZJ2A 1S6LA 4CO8A 2Y30A 1DP7P 2RN7A 3H5RA 2DDBA 2WBMA 3TO9A 1MMGA 2LYCA 3W2VA 4XORA 5EEHA 4DIQA 4IX7A 4ENNA 2BEOA 3LSHA 3PNYA 2UUZA 3L2RA 3DXJF 4JX5A 3F21A 2M7AA 1WH7A 1H8AC 4KDPA 5IT3A 4XLFA 3DTEA 1PVEA 2FSWA 3K4BA 1YJNI 1V5EA 3L2UA 1SD5A 3LAJA 1QPIA 1W5SA 4ON0A 4LLNA 1BW6A 4D7NA 1Z1DA 1QU3A 1LDKB 5KCMA 1B72A 2E34A 1KQ9A 4M9ZA 2GXBA 1JT0A 1R36A 2V9VA 1W0TA 5EEAA 1IV8A 1OYIA 3ABUA 2PN6A 2ZSHB 3FMRA 4UHTA 2JA8J 4GRIA 4Z6YA 1GV2A 3OYGA 3DBHB 1G3WA 3RIRA 2ME0A 4RLFA 3TDUC 4AVZA 3WG7H 5CQEA 1B4AA 2DCEA 4FQGA 4IOAF 2JSPA 2HVSA 3I4NJ 1RI7A 2GA2A 3ROUA 2LKPA 3F22A 2X6OA 1FIAA 4HPQA 4UVAA 2TRTA 3DV8A 4EEFG 5FB2A 2CV0A 2ZKZA 3PUBA 4KMUX 5DUIA 1RUOA 1O57A 3CO7C 1YW7A 2JWTA 4B44A 4U88A 1I1GA 3ZCOA 4F7ZA 3SEQA 4G12A 2F48A 4A0YA 4CYDA 2UXNA 4UB8C 2E1MC 2VOPA 2ZNYA 4DZPA 1GVJA 1ZH5A 3ZN1A 3SZPA 4XOTA 2EV6A 4NB5A 2R93J 1GV5A 4NC6A 2X1CA 4EV0A 1ZAOA 4C9YA 2GOXB 1ZG5A 1XN7A 4LITA 3SEZA 4ESBA 3HHGA 1CGPA 1W0UA 3FXJA 1XMKA 3K69A 1IW7F 3HRTA 1WPKA 2L01A 3BTCA 1K78B 1T0FC 4KT5C 3GFMA 4NC8A 4E7LA 4IXAA 2KJCA 5HOOA 4OIQF 1X3ZB 2IS2A 5KK1A 2QQ8A 5KAIC 3HBLA 5FKOA 5IT9Z 3LQQA 2O7OA 4YFXF 1U78A 1TZLA 3OYIA 1HKTA 2DOEA 1W5CC 1YE9A 2QQ9A 5BPDA 4IRIA 1TNTA 3HGYA 2DA1A 1B59A 1T39A 2GLOA 5LHHA 2HEOA 3DLAA 3CMEI 1B8IA 2WTEA 2CG4A 2VI6A 5BMZA 1HW5A 2HDCA 2CYYA 3SHFA 3KEYA 3JRFA 2CQNA 2VKVA 4H4KC 2VJJA 2H8WA 3Q3SA 1YIJI 4Y15A 4OWRB 1MBGA 1DPUA 2LRDA 1J5YA 3DU6A 3Q0WA 3I0TA 5C44J 4EATA 1IAWA 5D4RA 5IOYA 1GXQA 2MW8A 1W5TA 2JQ7A 4HDUA 2KRHA 4GO1A 5GTIC 3S1NJ 3JR9A 2DJNA 2X51A 2R5ZB 5LBQA 1UJ8A 2DFIA 1K61A 2KFDA 2BV6A 2XAHA 4WF2A 3C3WA 1R1TA 5DCMB 2A61A 3ULQB 4XRSA 3ML6A 2BW3A 4EJTA 2NS8A 2G7UA 3NWTA 2ZFWA 3G6EI 4QSHA 3E6DA 1A35A 3RPQA 4JP0A 1MKMA 2XF6A 2V1DA 3CCJI 1WGXA 1TW3A 2L3DA 4KIBA 3LAPA 4KIFA 4X6AJ 4XRFA 4A3MJ 4U0YA 4A6DA 2JSCA 4HBLA 3N97A 4PK4A 3GTPJ 1MZBA 2KPMA 1TQPA 2O6GE 2OQGA 2NS7A 1HOMA 5F0CA 2XPWA 5J6XA 1YO5C 3V8LA 1ZK8A 2VKHA 4IRGA 1NTCA 3S1RJ 1CF7A 2DYSH 4ETSA 3AG3H 2AHQA 1JUSA 1J09A 4PGHA 5DM6F 2WV1A 4N9IA 1P92A 4C2UA 3SJMA 1R49A 2DT6A 1XMXA 3CCLI 3PSIA 4ZDLA 2XF7A 5CQGA 4CA0A 2P7CB 1KGSA 1T08B 3CMAI 1B6AA 2W82A 2OPTA 3IAM2 3MZYA 5F08A 2LK2A 1FSEA 2W00A 1X4OA 1ETOA 1IXRC 2FOKA 3HSRA 4V2FA 4S04A 3A01A 2WWYA 3JAMZ 4IZZA 1AKHB 1JKQC 3JRHA 1R1UA 2DBBA 1F1ZA 2EPFA 3EYIA 4JYKA 4CCLA 2BY0A 2IA1A 1HBXG 5E3MA 2K9LA 2VJ4A 1DP3A 3CQZJ 3RTRA 4PFOA 1YJ9I 1MDMA 1IG7A 5IP7J 2ESNA 2E1NA 2DQRA 2LY9A 2RQQA 1X1BA 2P0WA 1E17A 3EUHC 3GTOJ 3MKLA 1USTA 4CCNA 4U0WA 4RB0A 3RPUA 2XKOA 3HJEA 1K7AA 4A6EA 4JBAA 2K5CA 4LK1F 1G2HA 2OV7A 2WY7Q 4L18B 2NAZA 4WK8F 3HZJA 1EKEA 2L7MP 2RC4A 5FLXK 2QGUA 5F0FA 4WX9A 2HOSA 2P7VB 4BXUA 1XCBA 3TO6A 5DD8A 5DUKA 2MG4A 4MTEA 2MBFA 1MGTA 3IHUA 4BU2A 2AS5F 2EFNA 2Q2EB 1VQOI 5AONA 2BOLA 2ZFUA 2LH9A 2EILH 1AKHA 2HZTA 1DU6A 2PX9A 3AG1H 1N25A 3FXMA 4FTHA 2ZCWA 1B9NA 2EQRA 2QVOA 4KNYA 2KIQA 2GAUA 3GUDA 1Y56A 1FYLA 4IHVA 3WGHA 4I2OA 3M1CA 1JTYA 4BL0B 3MQ0A 3LFKA 1ZGWA 4L9NA 3FF5A 4LJZF 3S2WA 2BVMA 2XAQA 3LSMA 2LG4A 2EZIA 4UV9A 2M8EA 2P81A 4FT8A 1IDYA 1MJBA 1VNDA 3H0GJ 2VODA 5EJCA 2HKXA 4KJZA 9ANTA 2MSYA 3ZQIA 3IC7A 3FIWA 5L3GA 4N4OB 4O6JA 2BW3B 3AG4H 2ACJA 3SQNA 3GLLA 4M3DA 3I56I 3ZMTA 2QEXI 3K70C 3BPVA 1NG6A 2VC0A 3HB9A 4DYCA 3CCEI 5J1UA 2E60A 3Q9SA 3HXLA 3H92A 4U87A 2D1VA 3KEOA 2DXIA 1OMIA 1ON1A 1FJLA 2QSHX 2LKXA 4AIHA 5KNLA 5CYVA 4J19A 1A04A 1QVUA 2H94A 4FASD 3K4JA 1OQYA 2HPMA 2VIXA 2A69F 3AG2H 3M8EA 2Z2SB 3HTUA 4NUBA 2CW7A 5DCMA 1T95A 2JT1A 1BOAA 1X4PA 2Y75A 2R5YA 1SANA 2YU3A 3DQVC 4UY8I 3VYRB 2DDAA 3F3XA 2HOEA 3RKYA 3OYAA 3WGIA 4CGZA 3B6CA 4BHBA 1TQIA 1B9MA 3VYUB 3TBIA 2XGXA 2CMPA 1HXDA 3HRMA 4PZJA 5DDGA 2EK5A 2A6EF 1NK2P 3V7CA 2FBHA 1ZHFA 2DTRA 4OIPF 1P4AA 4PJJA 4J00A 2AXTC 1W36D 2KZVA 1QHHD 2I5UA 4WXCA 3F23A 2EJRA 1T6SA 3CCMI 3VSLA 4B09A 2E71A 1SVLA 2EH3A 2VE8A 3P9KA 3H36A 2KT0A 3I71A 2PMUA 4BQOA 1JGSA 1LFPA 2IJLA 2LR8A 4IVNA 2K4JA 2NVQJ 2JUCA 3EUKL 3KP5A 2Q0OA 2K02A 3HC7A 3OOUA 4HLXA 5ILSA 3WTXC 2Y69H 3BCBA 3V8JA 5GADJ 3HOXJ 4EM0B 3OYCA 1G3SA 2GOMA 4DW6A 2KMUA 3KETA 3OYFA 1R71A 2YSRA 4XICA 1XPXA 3ZPLA 1Q1VA 4HNUA 2VQCA 1SC7A 4ZTJA 4BQQA 1BI3A 1IN4A 2OTJI 2MC3A 2VJ5A 3JRCA 2IS1A 5IPAA 1EH6A 3PM1A 2KIFA 3BTJA 1OKRA 1XGMA 1XMAA 1SD7A 2ZNZA 1X1AA 2QWWA 1N75A 2IGMA 1K83J 5EDNA 3C2HA 1BR4A 1BL0A 4PJNA 4ZDPA 1RESA 3WU1B 3ZMUA 2JJ7A 4KT6A 1MMAA 2HYFA 1ZELA 2VT2A 3R6SA 3OY9A 2VE9A 1K78A 2EWNA 4RS8A 4RAFA 4A0XA 1S8NA 2IEKA 4AD9A 2MLKA 1E3PA 3IWZA 3NWSA 5AIPA 2WC2A 2X6WA 2TCTA 1RETA 4G8XA 4GCVA 3DKYA 1VQ9I 4RA2A 1JJ8C 5TRDA 1J59A 2LY1A 4AIKA 4B3XA 1MMSA 2P6TA 2DFHA 2FEZA 2A6TA 1MMNA 5CVIA 3GZNB 5K1YA 3IRRA 3WTWC 4B8XA 5BNGA 1YYVA 2QSFX 3T0YA 4M6YA 2IP2A 4IF4A 3A4CA 3K2ZA 4XNFA 2QBYB 1IC8A 2QZ8A 2IS4A 3CC2I 4UVCA 5E1XA 5TGTA 5JI6A 3FX3A 4WWCA 1BJZA 4GXOA 3JRBA 4ENJA 2JMWA 4FE7A 3FMQA 3ZGKA 2F5VA 2OJED 4LG3A 4O5VA 5C4XJ 3CD6I 4P55A 3M1EA 2MD0A 5HNHA 2M5WA 3RYPA 2DPUA 1PYVA 1MBJA 3COAC 2E19A 2XVCA 3GTMJ 4IHTA 2JA6J 4MHGA 3PL8A 3KE2A 1ZGAA 2IGNA 4C3IJ 4U0VA 2W7NA 1KQ0A 3LFUA 5BS6A 1YHQI 4HG2A 3B02A 3BTLA 2Q8KA 1PUEE 1WZ2A 5DEQA 3R0JA 4D0PA 1YI2I 4RMNA 1OLTA 5L3EA 5LGUA 3CCSI 4RGXA 4Y13A 1R00A 4IQJA 5B1BH 4CCOA 5E3LA 2F6CA 2GXAA 1X1DA 4MIMA 1W4MA 5F1JA 2AQFA 3TKYA 3BZ6A 4P5OA 4R8HA 3ZP5A 4BE1A 4DOZA 2LNBA 1M1EB 3M3YJ 2HI3A 4HQEA 2XB0X 1ETQA 4YEJA 2KQRA 3CZ6A 2HFHA 1F36A 4IHXA 4G7OF 3CO6C 1YRNB 1BR1A 1VZ0A 3B73A 3E6BA 4BDZA 1OCTC 5HDKA 3TQNA 1IGNA 4UVBA 1OCPA 3M9AA 4II2A 3KYCB 2IA2A 2QM3A 2NXNB 2MC4A 3BG7A 3FBIB 3M8FA 2V9KA 4L9TA 2Y0SA 5FKLA 5LD2C 3J80K 5E79C 4CDGA 2KRFA 1K6OA 4V19K 1CF7B 2HVRA 2JPBA 3QYEA 5C4JJ 4OU0A 3HKZN 1Z6TA 4FHTA 1FPQA 1SFKA 2B7EA 2L7ZA 4LK0F 3IH3A 1BC7C 3ZQCA 4MEYF 3RI4A 3Q5FA 3DPTA 5J3LA 1I3QJ 4OMYA 1FBSA 2DW4A 1OJLA 5LLQA 3R61A 5KAFC 1LFBA 5K7HA 3Q0VA 4ZTFA 3BR6A 4ZC3A 3OR1C 4EM1A 2LSOA 3HUGA 2ZMEB 2RAEA 2ID6A 3I59B 5E17F 2L54A 3LSKA 3D1NI 1LB2A 1U9OA 1OYWA 1HC8A 2KISA 2RNJA 1IV6A 4BGDA 5E1ZB 2JK3A 4BS9A 1X2NA 4EJOA 3GTKJ 2K4BA 2DFEA 1FOKA 3S3OA 5AIQA 1A31A 1AU7A 2W4SA 3HOUJ 1RUNA 3RKQA 3EETA 1S9HA 1MBKA 1QVTA 3BG3A 4XSZF 3H3VK 1AWCA 3F72A 4EMSA 5D5UB 4XN3A 5K7ZA 3S1QJ 3V4GA 2V79A 1HKQA 2PLYA 5J4YA 2VN2A 5FLXZ 3PIPF 5E8GA 2QKLB 4ZYDA 3CJTB 4BE2A 4V2GA 4LLGF 4P9FA 1E3HA 2LF7A 4DBRA 1O7LA 1DDNA 3ASOH 2KDOA 3PO2J 3HGGA 5E3OA 3TO7A 5FRMA 2ESHA 5J1RA 3L09A 3RPUD 5GAGJ 1S7OA 1ZG1A 3ONQA 2LOOA 1QGPA 1ONVA 2V26A 5J1YA 4A12A 4DJAA 2DA3A 3ISPA 1B72B 1QHGA 2HVQA 2AXLA 1IRXA 4BUPA 2X0LA 4YFKF 1TLHB 2KKOA 2LMDA 3J7AY 4I6ZA 1UB9A 2ZBKA 3P9CA 4UNOA 2ZXWH 3FXQA 4HSRA 1OCZH 1WCMJ 2IRFG 3D0SA 4L9VA 2B0LA 3BR2A 3MD2A 4ENMA 3F9KA 2KL4A 2HQNA 2K9MA 1JKPC 3DPUA 3H3ZA 4RDUA 3LSPA 3L7WA 1U0JA 2FUG2 2KIUA 4HLYA 1RKTA 1OCRH 1T0FA 2JPCA 4PJ0C 4FISA 2LDUA 5J40A 4RM2A 3KLOA 3IAS2 3BZCA 1FP2A 2LFBA 4W1UA 1NK3P 1STZA 1TTYA 3IKVA 1VQKI 4A2UA 2K40A 4HYEA 3C2GA 2CQXA 2H6BA 4IKFA 3AL0B 1SMYF 1TT0A 3ABLH 1Z3YA 4L9JA 5D8LB 3REOA 1RR8C 2IVMA 4A3FJ 5DYMA 2R7RA 2G9WA 4AIJA 2R7OA 1ZLKA 3WU0A 2ZJPF 3AAFA 1UG2A 1ORKA 3E97A 3SXYA 2LY2A 2AO9A 2HOTA 2NNYA 2NS0A 2YR2A 1UHMA 2DMNA 3CTAA 1QZYA 3LA7A 1GLNA 1P7IA 4N4NB 4HOBA 1PDNC 3SFZA 2FXAA 4M71A 3A02A 3CC4I 4X0GA 4EVIA 3JRAA 3O3KA 3E0JB 4NQWB 2XAJA 4BEHB 1UELB 1Z7UA 4AYBA 2Z3YA 1RPWA 4BKXA 2GM4A 5H2FC 5CVJA 1B8IB 2VPLA 2M9HA 4HSTA 1VQ7I 2VQHA 3SZGA 5HODA 2EIKH 2OZ6A 1YRNA 3IUOA 4RBOA 1BJAA 3GF2A 2L2OA 2KDZA 1F43A 4P9UA 1IF1A 2FE3A 1P6RA 1WH5A 5A2QK 5EG0A 5L3DA 4LGWA 5E1WA 2CW8A 2KHMA 4MFEA 1AOYA 3LL7A 4M9XA 4BYYA 3ZR8X 2FOWA 2VBXA 2LBFA 4WXHA 3OYBA 4RAYA 1UCRA 2UV1A 2RV8A 3C7JA 2E2HJ 1T98A 1MNDA 4M72A 4HX7A 1WRJA 4F93B 1JTXA 5KHDA 4BACA 3QU6A 2WAFA 1VQMI 3L2QA 4PJMA 3HOYJ 2L9NA 1S29A 1QZEA 2O8XA 3TMOA 3GXOA 3VFZA 2L7FP 5FO5A 5J8FA 5KVRA 1LDJA 1YG2A 1TNSA 5ERIA 4U7BA 4KMFA 1BIBA 2Q1ZB 3JRIA 2ZXHA 1E2XA 3BJAA 1D5VA 2OCEA 3HL2A 3QP6A 2STWA 2R3SA 3GZ5A 2XSDC 4A3DJ 1IRFA 2M4GA 3MAJA 4AUXA 1GHCA 2O03A 3H9JA 1OYYA 3OYKA 1MNMC 2C6YA 1Y8RB 3F6OA 1YS6A 2EZKA 2JA5J 1RRJA 3M7GA 4AYBN 5HDNA 4RAGA 1FOXA 2XIGA 3HIFA 2DFFA 1ZN2A 4C3HJ 2LKSA 3T1BA 2QQBA 3BY6A 2WAQN 4DQ2A 2ELJA 2F4MB 1YIOA 3F8NA 2VKEA 2OTLI 2ZXJA 4I7HA 3FK7A 1U9NA 3FXKA 1G59A 4U7DA 1HQCA 2PJPA 2CH0A 3DKXA 1LE8A 4CICA 3MZHA 1MBHA 1I1SA 1IDZA 2FQ4A 1QO0D 3G2BA 3I58A 5JLWA 2XSJC 3FZVA 1XSDA 4B1RA 1TQMA 1I3AA 5LGNA 4HA8A 3KZYA 2Y2ZA 1JJ6C 2IGOA 5D8KB 4L0YB 3S2DJ 1XB4A 4IO9F 4R1HA 5FFZA 1XGSA 2M45A 4HW0A 2CGPA 1WI3A 3JTHA 3OL3A 4B3AA 4L5IA 2P5LC 2EINH 2PMHA 2WAEA 2R7XA 4F52A 3ERED 2DLLA 2R0QC 5CVVA 2H1KA 3U1DA 1DPRA 3HRSA 2L9SA 1D3YA 2DQLA 3IL2A 3MKZA 1Y6IA 3F8FA 3RYRA 2LVSA 2GQQA 5FD5A 2DA6A 3TW7A 5LEKA 5ICGA 3ELKA 2BGCA 4Q48A 3I3LA 4XBFA 4UB6C 1A6IA 1POGA 1J75A 3EYYA 3GX4X 3H5AA 3FXOA 1MJ9A 4M73A 3DBRB 2ZC2A 3PFYA 1YJWI 4FE4A 1TP4A 1JUMA 2HTSA 3TEDA 1HCRA 2Z1DA 2UZKA 5M3FJ 2DI3A 5JFRA 1YITI 1FMWA 3BG6A 5FKMA 4DZJA 2H6CA 3GBGA 2FMLA 1S7AA 1LUJB 2BXZA 1D1AA 1KU9A 5FLVA 1I39A 1FOYA 3I59A 1WFXA 2YUSA 3ZMSA 5LEJA 2ADUA 2E1MB 4I01A 4LG0B 1MBFA 4B43A 2X6YA 3V7SA 2BY2A 4I09A 3K70D 5JR3A 2DMTA 4UXNA 1YS7A 1R7JA 3IWFA 3E1SA 3GEZA 2G0EA 1MJAA 4ENKA 2EV5A 2DK8A 3D5LA 1TWAJ 3BG5A 1S3JA 2IPQX 3CDIA 4A5NA 3ZOBA 1WSUA 1MSFC 3WHCA 4A69C 2FF4A 1SVMA 3BJOA 1FT9A 3GLXA 3OWTA 4NBQA 3PSFA 1ZG3A 4D5FA 2E1OA 1I6XA 1Y0UA 1F4KA 4BQNA 1HA8A 1O7FA 1USSA 1ZRFA 1K4SA 3CUQC 1Y1WJ 4BXXJ 4RB1A 2M0MA 1W1WE 2OD5A 1KU2A 2RVCA 3FXLA 1CQTA 2A5WA 1PUFA 2D45A 3CMMA 4I02A 2O5RA 3QOEA 1LDDA 1D0YA 4BBSJ 5IT9K 5B3SH 3BQYA 3FKIJ 1IN8A 2FA5A 3DKWA 3FDYA 3ZQFA 5FD6A 3KYLA 3WE2A 5DTDA 1FBQA 4HV5A 4ZZDA 5HLHA 4PGGA 1A6QA 1W7PB 2HR3A 1YQAA 1MDMB 3C18A 2L7KA 4A3JJ 5L3BA 2QBYA 2VBWA 5J8CA 2W57A 3OYLA 5EG0B 4A3IJ 2IA0A 1DQUA 2Z16A 1TL8A 1HSTA 1LVKA 2IGKA 2KRCA 1R1VA 2QA4I 3HOVJ 1LNWA 3KCCA 2LF8A 3DBLB 3ERMA 1ETWA 3BQZA 4RGRA 2R7ZJ 4BEHA 2R7SA 1V5FA 5DV5A 1D0XA 3MMYB 4ZYAA 1K79A 1TT5B 4CZCA 3ZMDA 4KUMA 3FXUA 4UUSB 4KA4A 2E5NA 4Q4ZF 1G4DA 2IS6A 4PUSA 4XRSG 2IT0A 1J2XA 1Z7LA 2DJIA 2JVGA 2ISYA 3E6CC 3J81Z 3HPGA 2NNNA 2PG4A 4N9HA 1OCCH 1UG0A 3NQOA 3IKTA 3R60A 4OAZA 3KIOA 4A5MA 3K7AJ 1N77A 4K2EA 2RQPA 2K9SA 5ICCA 1FMVA 2CFOA 4HF0A 5DM7F 3DF8A 3HYIA 2VJIA 5FKKA 4ZH4F 1W36C 1JI8A 1P9QC 4PSXA 2WADA 1JHHA 1AA7A 3QYFA 4KIGA 1TWGJ 3J7ZI 4G94A 1ZREA 4EJWA 4OMZA 4Q5SF 3E6MA 3BR5A 2YX4A 4BE0A 1FTTA 1VQLI 1ZARA 2ZMEA 1IN5A 2IW5A 3ZMVA 1P7JA 2RNGA 4XKCA 4XR6A 3I64A 1WJBA 2K27A 1XS9A 1GDTA 2PBIA 2ZSIB 3GO5A 5F6FA 3J81K 1NH3A 4GGGA 2XPVA 2Z5UA 1RR7A 1SFUA 2PMZA 1R5GA 5C3EJ 1QRYA 3W6VA 4ESJA 1MSEC 2OA4A 1BA5A 2EZLA 2HWVA 4IOCF 3LOCA 2WY8Q 4HZFA 2Q2EA 3S3MA 1B1BA 1I5ZA 4G6DA 3FMSA 4TV7A 4A0ZA 1HDPA 1QNTA 2HQ5A 1V55H 2Y48A 3VODA 3LQRA 4GDFA 2X1EA 3ZMZA 2KIMA 1IXSB 3BR1A 2NOJB
chains in the Genus database with same CATH topology
3ECHA 3FXRA 2FBKA 3K1MA 3DP7A 2QQAA 5L3FA 2O0YA 4MTDA 1JHFA 1BN5A 2Z33A 1LEBA 3K1PA 3FM5A 1X3UA 5D5WB 4OOIA 4HDVA 5HLGA 1KQ8A 2FMYA 5FGMA 1J0RA 3BPXA 5BOXA 1ZRCA 2XHKA 2EFOA 3NEUA 2H09A 2EFPA 4S05A 4IHSA 3VB2A 1FWZA 5E18F 2F2EA 3U9GA 4WCGA 5LRSA 2Y0MA 1IN7A 3WTUC 3KEQA 2QYOA 1BM9A 5D5XB 2YPRA 3GYHX 2W85A 4OIRF 5JHUA 2E1CA 1TW2A 4MQ9F 3GVAA 4AWXB 1XCVA 3W6KB 3WGGA 5HS7A 1SD4A 2XAFA 3HSEA 1MD0A 4ESFA 1KA8A 1FY7A 3I54A 4N0BA 1FLIA 2RKHA 3QAHA 3EQLF 5H6RA 4RGSA 4OINF 2ISZA 3CUOA 1W7PA 4Q47A 4LD5A 5ILUA 2FNAA 5ICFA 2XKPA 3E5XA 3O2PE 3F6VA 1J7KA 1RNLA 3KP3A 3P9IA 3G73A 1FYMA 5L3CA 3HHHA 1L0OC 2K86A 4HX8A 2EV0A 1R5HA 2QENA 2O3FA 1XDUA 2L02A 5F1RA 3DFGA 3T8RA 2J5PA 4LMYA 5ICEA 3T8TA 2DO7A 3BOQA 1FYKA 1WKMA 4NHJA 4CZZA 4Y17A 3PQJA 3V7RA 5LGTA 4MGRA 3KZZA 3P7NA 2L4AA 4EJUA 2CSOA 3E5QA 3H3UA 2DPDA 3JW4A 5LHIA 2HYGD 4HF1A 2P5KA 1QPMA 2F5DA 3RKXA 4BQAA 3GW2A 4XLNF 5LHGA 3GFJA 3ECOA 3HRUA 2OBPA 4LG0A 5E20A 2R7FA 4MQVA 2QLZA 3Q9VA 2BBYA 3LA3A 1OPCA 2ELHA 1QZZA 4PCQA 4RGUA 2M87A 4BHPA 4QWQA 4KFCA 4HQMA 1R23A 4XSXF 4M6XA 2ETHA 2D1HA 1WI9A 3L9FA 3J7AO 2DK5A 2VT3A 1KU7A 4LB6B 4EM2A 2HGCA 2XAGA 1BC8C 3BDDA 4YIIA 4R79A 3GFLA 2UWMA 2W25A 1WWXA 2A68F 1VTNC 3LSTA 1YW8A 1H0MA 2CFXA 2COMA 3PFIA 3QP5A 4FX4A 1UHWA 4LFUA 2VBZA 4G9YA 3PQKA 1FNNA 2JZYA 2VXZA 2A3SA 3RDIA 2V6CA 5ED4A 3CJNA 1YFHA 2F5EA 2FNPA 1RZ4A 2RGVA 2W84A 4L0ZB 1QBJA 3FWEA 1ZYRF 3EUHA 1R22A 3RJPA 1BI1A 4JK1X 5D4SA 3F8CA 2FRHA 5D6FA 3NRVA 2P5VA 4JQFA 5K5OA 4QLCU 1Z05A 2OU2A 4XLPF 2A07F 2XRNA 2A5YB 2H27A 4HAMA 5FFXA 2VOOA 1H9GA 2X4HA 3W6JB 1HW1A 1LJ9A 3V8KA 2GIVA 3I4PA 3QU3A 2G7HA 3JAMK 5H20A 3GZ6A 2MA3A 1JE8A 5HS9A 3F8BA 1SFXA 1O3SA 1U8RA 1L3LA 2M30A 4G7HF 2HTJA 1RIOH 2XUBA 3QOPA 4KN4X 2MD5A 1BIAA 2TDXA 1U5TA 4UV8A 2FBIA 4MNUA 4YIFA 4O3MA 1V3FA 5E8IA 5JVTA 3OV8A 3WTYC 1U3EM 5CLSA 1TBXA 3E5UA 1FX7A 3ABTA 3TDZC 4CXFA 1REPC 2MH2A 5D5VB 2XASA 4G7ZF 1IRGA 5LRRA 5TJJA 4GYIA 4L5JA 3GWZA 4IRHA 3KLNA 2R7DA 1IUYA 2GA1A 1G3YA 3CDHA 1T2KA 1FC3A 5HVQC 3F8MA 6PAXA 2OZUA 1XGNA 2VC1A 3ZQ7A 2V1UA 3JSPA 4EGZA 1SFEA 2BE5F 4ZYHA 4ZYGA 5HDGA 2HKOA 1YTYA 3BJ6A 1KYZA 1HKSA 2W24A 1J9IA 1EH8A 3TOAA 3LA2A 1T38A 1U6GA 2GXGA 2CW0F 3C1DA 3MCZA 5HS8A 4KN7X 2GZWA 1HSJA 5DCFA 2JTVA 1IXCA 2F5CA 2Z99A 2V1XA 1SD6A 1D8KA 4UUVA 3IRQA 2P8TA 2BYVE 3QRFF 3KP4A 4YG2F 1YW9A 3CUQA 2WV0A 2VONA 1P4XA 2DU9A 2FQ3A 1C0WA 1IN6A 2ZO4A 2EFQA 2XV4S 1FZPB 2P4WA 5F64A 1V4RA 3DPLC 2OAZA 3K1NA 2XROA 2YX7A 1IZ1A 2PEXA 2MLGA 1FP1D 3I53A 1P4WA 4P96A 1HW2A 3WTZA 2DAOA 3KFWX 1U5TC 1JXSA 2F5FA 1EV7A 2FU4A 3J80Z 1KYWA 1P2FA 1ON2A 3T5XA 3I5UA 4ZYEA 4RAZA 4KYWA 4BAYA 4LLLA 4EQQA 5DD4A 2E7WA 1KU3A 4I0BA 2D2WA 5CVUA 4ZZLA 3FHZA 1UFMA 4BHCA 3G3ZA 3WTVC 1PP8F 4BNCA 4E70A 4PDKA 1EH7A 1Z9CA 1XGOA 3MEXA 2STTA 4WXDA 2DT5A 1BBYA 1U2WA 1BI0A 3K0LA 1O3RA 4NQWA 4IJAA 5CJ9A 1PP7U 2UXXA 3QPHA 1H9TA 4AVPA 4IPAA 4GYGA 5BQTA 1FBUA 3WODF 4DNCA 3R4KA 1U5TB 4LB5A 2Z9OA 1ODDA 3L00A 3RKWA 1ULYA 3QPTA 2VBYA 5ILVA 4KICA 3FM3A 1WQ2A 4G6QA 3CUQB 2CWEA 3OOPA 4ASNA 1O3TA 3WTTC 1LQ1A 1XSXA 3E3VA 3MWMA 2MH9A 3EDPA 1D8JA 5HLIA 4Z2YA 1O3QA 1SMTA 3ZN0A 1ZGJA 2EA2A 2P6SA 1F5TA 1QQIA 3VOEA 2HS5A 2CO5A 2GWRA 1Z91A 5CVRA 1SAXA 3K9TA 3WTSC 1Q1HA 2NYXA 2CQKA 2E7XA 3HOSA 3KP7A 2EFWA 2EA4A 1I27A 3O6BB 3BROA 4I98B 2K7LA 3LWFA 3HOTA 5K5QA 3JTGA 3TOBA 5D6EA 4YFNF 3R0AA 3L2CA 3HTSB 2QUFA 1XDSA 1Z6RA 3JSOA 3SZTA 2L4MA 5BPIA 3U2RA 3GFIA 4M9SA 2O61A 1DUXC 4I0AA 4H0EA 2M1BA 2PQ8A 5EEGA 1XSVA 3BP8A 4HV6A 1BI2A 5H6QA 3KP2A 5K5RA 3MFKA 1ZRDA 1NHAA 4EGYA 3N4MA 3WG9A 1GXPA 4HX4A 2PFBA 2KJBA 4OIOF 2NRAC 2RDPA 4CHUA 1LVAA 1ZLJA 4MEXF 3CLOA 2HQRA 4FX0A 2JRTA 1LEAA 5A2QZ 1R58A 3VEPA 1W7PD 1XD7A 4M74A 3WE3A 3HSFA 1YLFA 1FSHA 2A6HF 2PI0A 2OQRA 1G6NA 2EB7A 3TGNA 1F9NA 3DEUA 4BH9A 4EJVA 2J5OA 3KP6A 1OR7A 4RB3C 1G3TA 3BWGA 4RB2C 4HF2A 2ZJ2A 4CO8A 1DP7P 1S6LA 2RN7A 3TO9A 5EEHA 4ENNA 2BEOA 3F21A 3DXJF 4KDPA 5IT3A 2FSWA 1SD5A 3LAJA 1W5SA 4ON0A 4LLNA 1Z1DA 1LDKB 1KQ9A 4M9ZA 2GXBA 1R36A 2V9VA 1OYIA 3ABUA 2PN6A 3FMRA 4UHTA 1G3WA 3RIRA 3TDUC 1B4AA 1RI7A 2GA2A 3ROUA 2LKPA 3F22A 5FB2A 4UVAA 3DV8A 2ZKZA 4KMUX 5DUIA 1RUOA 1O57A 3CO7C 1YW7A 4U88A 1I1GA 4F7ZA 4A0YA 4CYDA 2UXNA 2VOPA 2ZNYA 1GVJA 1ZH5A 3ZN1A 3SZPA 2EV6A 4NB5A 4EV0A 1ZAOA 1ZG5A 1XN7A 4ESBA 3HHGA 1CGPA 1XMKA 3K69A 1IW7F 3HRTA 2L01A 1K78B 4KT5C 3GFMA 4IXAA 2KJCA 5HOOA 4OIQF 5KK1A 5IT9Z 3LQQA 4YFXF 1U78A 1HKTA 2QQ9A 4IRIA 5BPDA 1TNTA 1T39A 1B59A 5LHHA 2HEOA 2WTEA 2CG4A 5BMZA 1HW5A 2HDCA 2CYYA 3SHFA 4Y15A 1DPUA 1J5YA 3I0TA 1IAWA 5D4RA 1GXQA 1W5TA 4HDUA 4GO1A 5LBQA 2DFIA 2BV6A 2XAHA 4WF2A 3C3WA 1R1TA 5DCMB 2A61A 3ULQB 3ML6A 4EJTA 2G7UA 2ZFWA 3E6DA 3RPQA 1MKMA 2V1DA 1TW3A 2L3DA 4KIBA 3LAPA 4KIFA 4XRFA 4U0YA 4A6DA 2JSCA 4HBLA 3N97A 1MZBA 1TQPA 2O6GE 2OQGA 5J6XA 1YO5C 3V8LA 4IRGA 1CF7A 4ETSA 4PGHA 4N9IA 1P92A 2P7CB 1KGSA 1B6AA 3MZYA 1FSEA 1IXRC 2FOKA 3HSRA 4S04A 2WWYA 3JAMZ 1R1UA 2DBBA 1F1ZA 3EYIA 2IA1A 1HBXG 3RTRA 1MDMA 2ESNA 2E1NA 2DQRA 1E17A 1USTA 4U0WA 4RB0A 3RPUA 2XKOA 1K7AA 4A6EA 4JBAA 4LK1F 4L18B 2NAZA 4WK8F 2RC4A 5FLXK 4WX9A 2P7VB 4BXUA 1XCBA 3TO6A 5DD8A 5DUKA 4MTEA 2MBFA 1MGTA 3IHUA 2AS5F 2EFNA 5AONA 2HZTA 2ZCWA 1B9NA 2QVOA 4KNYA 2GAUA 3GUDA 1FYLA 4I2OA 3WGHA 3MQ0A 3LFKA 4L9NA 3FF5A 4LJZF 3S2WA 2XAQA 4UV9A 2M8EA 4FT8A 1MJBA 2VODA 2HKXA 3IC7A 5L3GA 4O6JA 2ACJA 3SQNA 3ZMTA 3BPVA 2VC0A 3Q9SA 3H92A 2D1VA 3KEOA 1OMIA 1ON1A 4AIHA 5CYVA 1A04A 2H94A 2A69F 3M8EA 3HTUA 5DCMA 2JT1A 1BOAA 2Y75A 2YU3A 3DQVC 3F3XA 2HOEA 3RKYA 3WGIA 4CGZA 4BHBA 1TQIA 1B9MA 2XGXA 1HXDA 3HRMA 4PZJA 5DDGA 2EK5A 2A6EF 3V7CA 2FBHA 1ZHFA 2DTRA 4OIPF 1P4AA 3F23A 4WXCA 2EJRA 1T6SA 4B09A 2VE8A 3P9KA 3I71A 2PMUA 1JGSA 2IJLA 4IVNA 2K4JA 3KP5A 2Q0OA 2K02A 4HLXA 5ILSA 3WTXC 3V8JA 2STWA 4EM0B 1G3SA 3KETA 2YSRA 3ZPLA 1BI3A 1IN4A 2MC3A 1EH6A 2KIFA 1OKRA 1XGMA 1XMAA 1SD7A 2ZNZA 2QWWA 3WU1B 3ZMUA 2HYFA 2VT2A 3R6SA 2VE9A 1K78A 2EWNA 4RS8A 4A0XA 1S8NA 4AD9A 2MLKA 3IWZA 5AIPA 2WC2A 4G8XA 4GCVA 5TRDA 1J59A 4AIKA 2P6TA 2FEZA 5CVIA 5K1YA 3IRRA 3WTWC 4B8XA 1YYVA 3T0YA 4M6YA 2IP2A 4IF4A 2QBYB 3K2ZA 2QZ8A 4WWCA 4UVCA 5E1XA 5JI6A 3FX3A 4GXOA 4ENJA 3FMQA 4O5VA 4P55A 3M1EA 2M5WA 3RYPA 2DPUA 3COAC 2XVCA 4IHTA 4MHGA 3KE2A 1ZGAA 4U0VA 1KQ0A 5BS6A 3B02A 2Q8KA 1PUEE 5DEQA 3R0JA 4D0PA 5L3EA 5LGUA 4RGXA 4Y13A 1R00A 1W4MA 3TKYA 3BZ6A 4P5OA 4R8HA 3ZP5A 2LNBA 4HQEA 2HFHA 4G7OF 3CO6C 3B73A 3E6BA 5HDKA 3TQNA 4UVBA 3M9AA 2IA2A 2QM3A 3M8FA 4L9TA 3J80K 4CDGA 2KRFA 1K6OA 1CF7B 2JPBA 4OU0A 1Z6TA 4FHTA 1FPQA 4LK0F 1BC7C 4MEYF 3RI4A 3Q5FA 3DPTA 4OMYA 1FBSA 2DW4A 5LLQA 3R61A 4EM1A 2LSOA 3HUGA 2ZMEB 3I59B 5E17F 2L54A 1LB2A 1OYWA 2RNJA 5E1ZB 4EJOA 2K4BA 1FOKA 5AIQA 1RUNA 3EETA 4XSZF 1AWCA 3F72A 4EMSA 5D5UB 3V4GA 2V79A 1HKQA 2PLYA 2VN2A 5FLXZ 5E8GA 4ZYDA 4LLGF 4P9FA 1DDNA 2LF7A 1O7LA 3TO7A 2ESHA 3L09A 1S7OA 1ZG1A 1QGPA 1ONVA 4A12A 3ISPA 2AXLA 2X0LA 4YFKF 1TLHB 2KKOA 1UB9A 2ZBKA 3P9CA 4UNOA 3FXQA 2IRFG 3D0SA 4L9VA 2B0LA 4ENMA 2HQNA 3H3ZA 3L7WA 2KIUA 4HLYA 1T0FA 2JPCA 2LDUA 3KLOA 1FP2A 1STZA 1TTYA 3IKVA 4A2UA 4HYEA 2H6BA 1SMYF 5D8LB 4L9JA 3REOA 2IVMA 5DYMA 4AIJA 2G9WA 1ZLKA 3WU0A 3AAFA 3SXYA 3E97A 2NNYA 2NS0A 2YR2A 1UHMA 3CTAA 1QZYA 3LA7A 4HOBA 1PDNC 3SFZA 2FXAA 4M71A 4EVIA 3O3KA 2XAJA 1Z7UA 2Z3YA 5CVJA 2OZ6A 1BJAA 3GF2A 4P9UA 1IF1A 2FE3A 1P6RA 5A2QK 5L3DA 4LGWA 5E1WA 1AOYA 4M9XA 4BYYA 2VBXA 4WXHA 4RAYA 1UCRA 2RV8A 3C7JA 1T98A 4M72A 4HX7A 1WRJA 3QU6A 1S29A 2O8XA 3GXOA 3VFZA 5FO5A 5J8FA 5KVRA 1LDJA 1YG2A 1TNSA 5ERIA 4U7BA 4KMFA 1BIBA 1E2XA 3BJAA 1D5VA 3QP6A 2R3SA 3GZ5A 1IRFA 3MAJA 1GHCA 2O03A 1OYYA 2C6YA 3F6OA 1YS6A 3M7GA 5HDNA 2XIGA 3HIFA 1ZN2A 3T1BA 2QQBA 3BY6A 4DQ2A 1YIOA 3F8NA 2ZXJA 4I7HA 4U7DA 1HQCA 2PJPA 4CICA 3MZHA 1I1SA 1QO0D 3I58A 3FZVA 1XSDA 1TQMA 5LGNA 4HA8A 3KZYA 5D8KB 4L0YB 1XB4A 2CGPA 4R1HA 1XGSA 2M45A 4HW0A 5FFZA 3JTHA 4L5IA 2P5LC 2PMHA 3ERED 2DLLA 5CVVA 3U1DA 1DPRA 3HRSA 1D3YA 2DQLA 3IL2A 3F8FA 3RYRA 2GQQA 5FD5A 5LEKA 5ICGA 3ELKA 2BGCA 4Q48A 4XBFA 1J75A 3EYYA 3GX4X 4M73A 1MJ9A 2HTSA 2UZKA 2DI3A 5JFRA 2H6CA 2FMLA 1S7AA 1KU9A 3I59A 3ZMSA 5LEJA 2ADUA 4I01A 4LG0B 3V7SA 4I09A 5JR3A 4UXNA 1YS7A 1R7JA 3IWFA 3GEZA 1MJAA 4ENKA 2EV5A 2DK8A 3D5LA 1S3JA 2IPQX 4A5NA 1WSUA 2FF4A 3BJOA 1FT9A 3GLXA 1ZG3A 1I6XA 1Y0UA 1F4KA 1O7FA 1USSA 1ZRFA 3CUQC 4RB1A 2OD5A 1KU2A 2RVCA 2D45A 4I02A 1LDDA 5IT9K 1IN8A 2FA5A 3DKWA 5FD6A 3WE2A 1FBQA 4HV5A 4ZZDA 5HLHA 4PGGA 1W7PB 2HR3A 1YQAA 1MDMB 3C18A 5L3BA 2QBYA 2VBWA 5J8CA 2W57A 2IA0A 1HSTA 1R1VA 1LNWA 3KCCA 2LF8A 4RGRA 5DV5A 1K79A 3ZMDA 4KUMA 3FXUA 4KA4A 4Q4ZF 1G4DA 2IT0A 1J2XA 2ISYA 3E6CC 3J81Z 2NNNA 2PG4A 4N9HA 3NQOA 3IKTA 3R60A 4A5MA 4K2EA 2RQPA 5ICCA 4HF0A 3DF8A 3HYIA 4ZH4F 4KIGA 1JHHA 4G94A 1ZREA 4EJWA 4OMZA 4Q5SF 3E6MA 2YX4A 1ZARA 1IN5A 2ZMEA 2IW5A 3ZMVA 3I64A 2K27A 2PBIA 3GO5A 5F6FA 3J81K 4GGGA 2Z5UA 1SFUA 1R5GA 4ESJA 2OA4A 2HWVA 4HZFA 2Q2EA 1B1BA 1I5ZA 4G6DA 3FMSA 4TV7A 4A0ZA 1QNTA 2Y48A 3VODA 3LQRA 3ZMZA 2KIMA 1IXSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ECH A;  3FXR A;  2FBK A;  3K1M A;  3DP7 A;  2QQA A;  5L3F A;  2O0Y A;  4MTD A;  1JHF A;  1BN5 A;  2Z33 A;  1LEB A;  3K1P A;  3FM5 A;  1X3U A;  5D5W B;  4OOI A;  4HDV A;  5HLG A;  1KQ8 A;  2FMY A;  5FGM A;  1J0R A;  3BPX A;  5BOX A;  1ZRC A;  2XHK A;  2EFO A;  3NEU A;  2H09 A;  2EFP A;  4S05 A;  4IHS A;  3VB2 A;  1FWZ A;  5E18 F;  2F2E A;  3U9G A;  4WCG A;  5LRS A;  2Y0M A;  1IN7 A;  3WTU C;  3KEQ A;  2QYO A;  1BM9 A;  5D5X B;  2YPR A;  3GYH X;  2W85 A;  4OIR F;  5JHU A;  2E1C A;  1TW2 A;  4MQ9 F;  3GVA A;  4AWX B;  1XCV A;  3W6K B;  3WGG A;  5HS7 A;  1SD4 A;  2XAF A;  3HSE A;  1MD0 A;  4ESF A;  1KA8 A;  1FY7 A;  3I54 A;  4N0B A;  1FLI A;  2RKH A;  3QAH A;  3EQL F;  5H6R A;  4RGS A;  4OIN F;  2ISZ A;  3CUO A;  1W7P A;  4Q47 A;  4LD5 A;  5ILU A;  2FNA A;  5ICF A;  2XKP A;  3E5X A;  3O2P E;  3F6V A;  1J7K A;  1RNL A;  3KP3 A;  3P9I A;  3G73 A;  1FYM A;  5L3C A;  3HHH A;  1L0O C;  2K86 A;  4HX8 A;  2EV0 A;  1R5H A;  2QEN A;  2O3F A;  1XDU A;  2L02 A;  5F1R A;  3DFG A;  3T8R A;  2J5P A;  4LMY A;  5ICE A;  3T8T A;  2DO7 A;  3BOQ A;  1FYK A;  1WKM A;  4NHJ A;  4CZZ A;  4Y17 A;  3PQJ A;  3V7R A;  5LGT A;  4MGR A;  3KZZ A;  3P7N A;  2L4A A;  4EJU A;  2CSO A;  3E5Q A;  3H3U A;  2DPD A;  3JW4 A;  5LHI A;  2HYG D;  4HF1 A;  2P5K A;  1QPM A;  2F5D A;  3RKX A;  4BQA A;  3GW2 A;  4XLN F;  5LHG A;  3GFJ A;  3ECO A;  3HRU A;  2OBP A;  4LG0 A;  5E20 A;  2R7F A;  4MQV A;  2QLZ A;  3Q9V A;  2BBY A;  3LA3 A;  1OPC A;  2ELH A;  1QZZ A;  4PCQ A;  4RGU A;  2M87 A;  4BHP A;  4QWQ A;  4KFC A;  4HQM A;  1R23 A;  4XSX F;  4M6X A;  2ETH A;  2D1H A;  1WI9 A;  3L9F A;  3J7A O;  2DK5 A;  2VT3 A;  1KU7 A;  4LB6 B;  4EM2 A;  2HGC A;  2XAG A;  1BC8 C;  3BDD A;  4YII A;  4R79 A;  3GFL A;  2UWM A;  2W25 A;  1WWX A;  2A68 F;  1VTN C;  3LST A;  1YW8 A;  1H0M A;  2CFX A;  2COM A;  3PFI A;  3QP5 A;  4FX4 A;  1UHW A;  4LFU A;  2VBZ A;  4G9Y A;  3PQK A;  1FNN A;  2JZY A;  2VXZ A;  2A3S A;  3RDI A;  2V6C A;  5ED4 A;  3CJN A;  1YFH A;  2F5E A;  2FNP A;  1RZ4 A;  2RGV A;  2W84 A;  4L0Z B;  1QBJ A;  3FWE A;  1ZYR F;  3EUH A;  1R22 A;  3RJP A;  1BI1 A;  4JK1 X;  5D4S A;  3F8C A;  2FRH A;  5D6F A;  3NRV A;  2P5V A;  4JQF A;  5K5O A;  4QLC U;  1Z05 A;  2OU2 A;  4XLP F;  2A07 F;  2XRN A;  2A5Y B;  2H27 A;  4HAM A;  5FFX A;  2VOO A;  1H9G A;  2X4H A;  3W6J B;  1HW1 A;  1LJ9 A;  3V8K A;  2GIV A;  3I4P A;  3QU3 A;  2G7H A;  3JAM K;  5H20 A;  3GZ6 A;  2MA3 A;  1JE8 A;  5HS9 A;  3F8B A;  1SFX A;  1O3S A;  1U8R A;  1L3L A;  2M30 A;  4G7H F;  2HTJ A;  1RIO H;  2XUB A;  3QOP A;  4KN4 X;  2MD5 A;  1BIA A;  2TDX A;  1U5T A;  4UV8 A;  2FBI A;  4MNU A;  4YIF A;  4O3M A;  1V3F A;  5E8I A;  5JVT A;  3OV8 A;  3WTY C;  1U3E M;  5CLS A;  1TBX A;  3E5U A;  1FX7 A;  3ABT A;  3TDZ C;  4CXF A;  1REP C;  2MH2 A;  5D5V B;  2XAS A;  4G7Z F;  1IRG A;  5LRR A;  5TJJ A;  4GYI A;  4L5J A;  3GWZ A;  4IRH A;  3KLN A;  2R7D A;  1IUY A;  2GA1 A;  1G3Y A;  3CDH A;  1T2K A;  1FC3 A;  5HVQ C;  3F8M A;  6PAX A;  2OZU A;  1XGN A;  2VC1 A;  3ZQ7 A;  2V1U A;  3JSP A;  4EGZ A;  1SFE A;  2BE5 F;  4ZYH A;  4ZYG A;  5HDG A;  2HKO A;  1YTY A;  3BJ6 A;  1KYZ A;  1HKS A;  2W24 A;  1J9I A;  1EH8 A;  3TOA A;  3LA2 A;  1T38 A;  1U6G A;  2GXG A;  2CW0 F;  3C1D A;  3MCZ A;  5HS8 A;  4KN7 X;  2GZW A;  1HSJ A;  5DCF A;  2JTV A;  1IXC A;  2F5C A;  2Z99 A;  2V1X A;  1SD6 A;  1D8K A;  4UUV A;  3IRQ A;  2P8T A;  2BYV E;  3QRF F;  3KP4 A;  4YG2 F;  1YW9 A;  3CUQ A;  2WV0 A;  2VON A;  1P4X A;  2DU9 A;  2FQ3 A;  1C0W A;  1IN6 A;  2ZO4 A;  2EFQ A;  2XV4 S;  1FZP B;  2P4W A;  5F64 A;  1V4R A;  3DPL C;  2OAZ A;  3K1N A;  2XRO A;  2YX7 A;  1IZ1 A;  2PEX A;  2MLG A;  1FP1 D;  3I53 A;  1P4W A;  4P96 A;  1HW2 A;  3WTZ A;  2DAO A;  3KFW X;  1U5T C;  1JXS A;  2F5F A;  1EV7 A;  2FU4 A;  3J80 Z;  1KYW A;  1P2F A;  1ON2 A;  3T5X A;  3I5U A;  4ZYE A;  4RAZ A;  4KYW A;  4BAY A;  4LLL A;  4EQQ A;  5DD4 A;  2E7W A;  1KU3 A;  4I0B A;  2D2W A;  5CVU A;  4ZZL A;  3FHZ A;  1UFM A;  4BHC A;  3G3Z A;  3WTV C;  1PP8 F;  4BNC A;  4E70 A;  4PDK A;  1EH7 A;  1Z9C A;  1XGO A;  3MEX A;  2STT A;  4WXD A;  2DT5 A;  1BBY A;  1U2W A;  1BI0 A;  3K0L A;  1O3R A;  4NQW A;  4IJA A;  5CJ9 A;  1PP7 U;  2UXX A;  3QPH A;  1H9T A;  4AVP A;  4IPA A;  4GYG A;  5BQT A;  1FBU A;  3WOD F;  4DNC A;  3R4K A;  1U5T B;  4LB5 A;  2Z9O A;  1ODD A;  3L00 A;  3RKW A;  1ULY A;  3QPT A;  2VBY A;  5ILV A;  4KIC A;  3FM3 A;  1WQ2 A;  4G6Q A;  3CUQ B;  2CWE A;  3OOP A;  4ASN A;  1O3T A;  3WTT C;  1LQ1 A;  1XSX A;  3E3V A;  3MWM A;  2MH9 A;  3EDP A;  1D8J A;  5HLI A;  4Z2Y A;  1O3Q A;  1SMT A;  3ZN0 A;  1ZGJ A;  2EA2 A;  2P6S A;  1F5T A;  1QQI A;  3VOE A;  2HS5 A;  2CO5 A;  2GWR A;  1Z91 A;  5CVR A;  1SAX A;  3K9T A;  3WTS C;  1Q1H A;  2NYX A;  2CQK A;  2E7X A;  3HOS A;  3KP7 A;  2EFW A;  2EA4 A;  1I27 A;  3O6B B;  3BRO A;  4I98 B;  2K7L A;  3LWF A;  3HOT A;  5K5Q A;  3JTG A;  3TOB A;  5D6E A;  4YFN F;  3R0A A;  3L2C A;  3HTS B;  2QUF A;  1XDS A;  1Z6R A;  3JSO A;  3SZT A;  2L4M A;  5BPI A;  3U2R A;  3GFI A;  4M9S A;  2O61 A;  1DUX C;  4I0A A;  4H0E A;  2M1B A;  2PQ8 A;  5EEG A;  1XSV A;  3BP8 A;  4HV6 A;  1BI2 A;  5H6Q A;  3KP2 A;  5K5R A;  3MFK A;  1ZRD A;  1NHA A;  4EGY A;  3N4M A;  3WG9 A;  1GXP A;  4HX4 A;  2PFB A;  2KJB A;  4OIO F;  2NRA C;  2RDP A;  4CHU A;  1LVA A;  1ZLJ A;  4MEX F;  3CLO A;  2HQR A;  4FX0 A;  2JRT A;  1LEA A;  5A2Q Z;  1R58 A;  3VEP A;  1W7P D;  1XD7 A;  4M74 A;  3WE3 A;  3HSF A;  1YLF A;  1FSH A;  2A6H F;  2PI0 A;  2OQR A;  1G6N A;  2EB7 A;  3TGN A;  1F9N A;  3DEU A;  4BH9 A;  4EJV A;  2J5O A;  3KP6 A;  1OR7 A;  4RB3 C;  1G3T A;  3BWG A;  4RB2 C;  4HF2 A;  2ZJ2 A;  4CO8 A;  1DP7 P;  1S6L A;  2RN7 A;  3TO9 A;  5EEH A;  4ENN A;  2BEO A;  3F21 A;  3DXJ F;  4KDP A;  5IT3 A;  2FSW A;  1SD5 A;  3LAJ A;  1W5S A;  4ON0 A;  4LLN A;  1Z1D A;  1LDK B;  1KQ9 A;  4M9Z A;  2GXB A;  1R36 A;  2V9V A;  1OYI A;  3ABU A;  2PN6 A;  3FMR A;  4UHT A;  1G3W A;  3RIR A;  3TDU C;  1B4A A;  1RI7 A;  2GA2 A;  3ROU A;  2LKP A;  3F22 A;  5FB2 A;  4UVA A;  3DV8 A;  2ZKZ A;  4KMU X;  5DUI A;  1RUO A;  1O57 A;  3CO7 C;  1YW7 A;  4U88 A;  1I1G A;  4F7Z A;  4A0Y A;  4CYD A;  2UXN A;  2VOP A;  2ZNY A;  1GVJ A;  1ZH5 A;  3ZN1 A;  3SZP A;  2EV6 A;  4NB5 A;  4EV0 A;  1ZAO A;  1ZG5 A;  1XN7 A;  4ESB A;  3HHG A;  1CGP A;  1XMK A;  3K69 A;  1IW7 F;  3HRT A;  2L01 A;  1K78 B;  4KT5 C;  3GFM A;  4IXA A;  2KJC A;  5HOO A;  4OIQ F;  5KK1 A;  5IT9 Z;  3LQQ A;  4YFX F;  1U78 A;  1HKT A;  2QQ9 A;  4IRI A;  5BPD A;  1TNT A;  1T39 A;  1B59 A;  5LHH A;  2HEO A;  2WTE A;  2CG4 A;  5BMZ A;  1HW5 A;  2HDC A;  2CYY A;  3SHF A;  4Y15 A;  1DPU A;  1J5Y A;  3I0T A;  1IAW A;  5D4R A;  1GXQ A;  1W5T A;  4HDU A;  4GO1 A;  5LBQ A;  2DFI A;  2BV6 A;  2XAH A;  4WF2 A;  3C3W A;  1R1T A;  5DCM B;  2A61 A;  3ULQ B;  3ML6 A;  4EJT A;  2G7U A;  2ZFW A;  3E6D A;  3RPQ A;  1MKM A;  2V1D A;  1TW3 A;  2L3D A;  4KIB A;  3LAP A;  4KIF A;  4XRF A;  4U0Y A;  4A6D A;  2JSC A;  4HBL A;  3N97 A;  1MZB A;  1TQP A;  2O6G E;  2OQG A;  5J6X A;  1YO5 C;  3V8L A;  4IRG A;  1CF7 A;  4ETS A;  4PGH A;  4N9I A;  1P92 A;  2P7C B;  1KGS A;  1B6A A;  3MZY A;  1FSE A;  1IXR C;  2FOK A;  3HSR A;  4S04 A;  2WWY A;  3JAM Z;  1R1U A;  2DBB A;  1F1Z A;  3EYI A;  2IA1 A;  1HBX G;  3RTR A;  1MDM A;  2ESN A;  2E1N A;  2DQR A;  1E17 A;  1UST A;  4U0W A;  4RB0 A;  3RPU A;  2XKO A;  1K7A A;  4A6E A;  4JBA A;  4LK1 F;  4L18 B;  2NAZ A;  4WK8 F;  2RC4 A;  5FLX K;  4WX9 A;  2P7V B;  4BXU A;  1XCB A;  3TO6 A;  5DD8 A;  5DUK A;  4MTE A;  2MBF A;  1MGT A;  3IHU A;  2AS5 F;  2EFN A;  5AON A;  2HZT A;  2ZCW A;  1B9N A;  2QVO A;  4KNY A;  2GAU A;  3GUD A;  1FYL A;  4I2O A;  3WGH A;  3MQ0 A;  3LFK A;  4L9N A;  3FF5 A;  4LJZ F;  3S2W A;  2XAQ A;  4UV9 A;  2M8E A;  4FT8 A;  1MJB A;  2VOD A;  2HKX A;  3IC7 A;  5L3G A;  4O6J A;  2ACJ A;  3SQN A;  3ZMT A;  3BPV A;  2VC0 A;  3Q9S A;  3H92 A;  2D1V A;  3KEO A;  1OMI A;  1ON1 A;  4AIH A;  5CYV A;  1A04 A;  2H94 A;  2A69 F;  3M8E A;  3HTU A;  5DCM A;  2JT1 A;  1BOA A;  2Y75 A;  2YU3 A;  3DQV C;  3F3X A;  2HOE A;  3RKY A;  3WGI A;  4CGZ A;  4BHB A;  1TQI A;  1B9M A;  2XGX A;  1HXD A;  3HRM A;  4PZJ A;  5DDG A;  2EK5 A;  2A6E F;  3V7C A;  2FBH A;  1ZHF A;  2DTR A;  4OIP F;  1P4A A;  3F23 A;  4WXC A;  2EJR A;  1T6S A;  4B09 A;  2VE8 A;  3P9K A;  3I71 A;  2PMU A;  1JGS A;  2IJL A;  4IVN A;  2K4J A;  3KP5 A;  2Q0O A;  2K02 A;  4HLX A;  5ILS A;  3WTX C;  3V8J A;  2STW A;  4EM0 B;  1G3S A;  3KET A;  2YSR A;  3ZPL A;  1BI3 A;  1IN4 A;  2MC3 A;  1EH6 A;  2KIF A;  1OKR A;  1XGM A;  1XMA A;  1SD7 A;  2ZNZ A;  2QWW A;  3WU1 B;  3ZMU A;  2HYF A;  2VT2 A;  3R6S A;  2VE9 A;  1K78 A;  2EWN A;  4RS8 A;  4A0X A;  1S8N A;  4AD9 A;  2MLK A;  3IWZ A;  5AIP A;  2WC2 A;  4G8X A;  4GCV A;  5TRD A;  1J59 A;  4AIK A;  2P6T A;  2FEZ A;  5CVI A;  5K1Y A;  3IRR A;  3WTW C;  4B8X A;  1YYV A;  3T0Y A;  4M6Y A;  2IP2 A;  4IF4 A;  2QBY B;  3K2Z A;  2QZ8 A;  4WWC A;  4UVC A;  5E1X A;  5JI6 A;  3FX3 A;  4GXO A;  4ENJ A;  3FMQ A;  4O5V A;  4P55 A;  3M1E A;  2M5W A;  3RYP A;  2DPU A;  3COA C;  2XVC A;  4IHT A;  4MHG A;  3KE2 A;  1ZGA A;  4U0V A;  1KQ0 A;  5BS6 A;  3B02 A;  2Q8K A;  1PUE E;  5DEQ A;  3R0J A;  4D0P A;  5L3E A;  5LGU A;  4RGX A;  4Y13 A;  1R00 A;  1W4M A;  3TKY A;  3BZ6 A;  4P5O A;  4R8H A;  3ZP5 A;  2LNB A;  4HQE A;  2HFH A;  4G7O F;  3CO6 C;  3B73 A;  3E6B A;  5HDK A;  3TQN A;  4UVB A;  3M9A A;  2IA2 A;  2QM3 A;  3M8F A;  4L9T A;  3J80 K;  4CDG A;  2KRF A;  1K6O A;  1CF7 B;  2JPB A;  4OU0 A;  1Z6T A;  4FHT A;  1FPQ A;  4LK0 F;  1BC7 C;  4MEY F;  3RI4 A;  3Q5F A;  3DPT A;  4OMY A;  1FBS A;  2DW4 A;  5LLQ A;  3R61 A;  4EM1 A;  2LSO A;  3HUG A;  2ZME B;  3I59 B;  5E17 F;  2L54 A;  1LB2 A;  1OYW A;  2RNJ A;  5E1Z B;  4EJO A;  2K4B A;  1FOK A;  5AIQ A;  1RUN A;  3EET A;  4XSZ F;  1AWC A;  3F72 A;  4EMS A;  5D5U B;  3V4G A;  2V79 A;  1HKQ A;  2PLY A;  2VN2 A;  5FLX Z;  5E8G A;  4ZYD A;  4LLG F;  4P9F A;  1DDN A;  2LF7 A;  1O7L A;  3TO7 A;  2ESH A;  3L09 A;  1S7O A;  1ZG1 A;  1QGP A;  1ONV A;  4A12 A;  3ISP A;  2AXL A;  2X0L A;  4YFK F;  1TLH B;  2KKO A;  1UB9 A;  2ZBK A;  3P9C A;  4UNO A;  3FXQ A;  2IRF G;  3D0S A;  4L9V A;  2B0L A;  4ENM A;  2HQN A;  3H3Z A;  3L7W A;  2KIU A;  4HLY A;  1T0F A;  2JPC A;  2LDU A;  3KLO A;  1FP2 A;  1STZ A;  1TTY A;  3IKV A;  4A2U A;  4HYE A;  2H6B A;  1SMY F;  5D8L B;  4L9J A;  3REO A;  2IVM A;  5DYM A;  4AIJ A;  2G9W A;  1ZLK A;  3WU0 A;  3AAF A;  3SXY A;  3E97 A;  2NNY A;  2NS0 A;  2YR2 A;  1UHM A;  3CTA A;  1QZY A;  3LA7 A;  4HOB A;  1PDN C;  3SFZ A;  2FXA A;  4M71 A;  4EVI A;  3O3K A;  2XAJ A;  1Z7U A;  2Z3Y A;  5CVJ A;  2OZ6 A;  1BJA A;  3GF2 A;  4P9U A;  1IF1 A;  2FE3 A;  1P6R A;  5A2Q K;  5L3D A;  4LGW A;  5E1W A;  1AOY A;  4M9X A;  4BYY A;  2VBX A;  4WXH A;  4RAY A;  1UCR A;  2RV8 A;  3C7J A;  1T98 A;  4M72 A;  4HX7 A;  1WRJ A;  3QU6 A;  1S29 A;  2O8X A;  3GXO A;  3VFZ A;  5FO5 A;  5J8F A;  5KVR A;  1LDJ A;  1YG2 A;  1TNS A;  5ERI A;  4U7B A;  4KMF A;  1BIB A;  1E2X A;  3BJA A;  1D5V A;  3QP6 A;  2R3S A;  3GZ5 A;  1IRF A;  3MAJ A;  1GHC A;  2O03 A;  1OYY A;  2C6Y A;  3F6O A;  1YS6 A;  3M7G A;  5HDN A;  2XIG A;  3HIF A;  1ZN2 A;  3T1B A;  2QQB A;  3BY6 A;  4DQ2 A;  1YIO A;  3F8N A;  2ZXJ A;  4I7H A;  4U7D A;  1HQC A;  2PJP A;  4CIC A;  3MZH A;  1I1S A;  1QO0 D;  3I58 A;  3FZV A;  1XSD A;  1TQM A;  5LGN A;  4HA8 A;  3KZY A;  5D8K B;  4L0Y B;  1XB4 A;  2CGP A;  4R1H A;  1XGS A;  2M45 A;  4HW0 A;  5FFZ A;  3JTH A;  4L5I A;  2P5L C;  2PMH A;  3ERE D;  2DLL A;  5CVV A;  3U1D A;  1DPR A;  3HRS A;  1D3Y A;  2DQL A;  3IL2 A;  3F8F A;  3RYR A;  2GQQ A;  5FD5 A;  5LEK A;  5ICG A;  3ELK A;  2BGC A;  4Q48 A;  4XBF A;  1J75 A;  3EYY A;  3GX4 X;  4M73 A;  1MJ9 A;  2HTS A;  2UZK A;  2DI3 A;  5JFR A;  2H6C A;  2FML A;  1S7A A;  1KU9 A;  3I59 A;  3ZMS A;  5LEJ A;  2ADU A;  4I01 A;  4LG0 B;  3V7S A;  4I09 A;  5JR3 A;  4UXN A;  1YS7 A;  1R7J A;  3IWF A;  3GEZ A;  1MJA A;  4ENK A;  2EV5 A;  2DK8 A;  3D5L A;  1S3J A;  2IPQ X;  4A5N A;  1WSU A;  2FF4 A;  3BJO A;  1FT9 A;  3GLX A;  1ZG3 A;  1I6X A;  1Y0U A;  1F4K A;  1O7F A;  1USS A;  1ZRF A;  3CUQ C;  4RB1 A;  2OD5 A;  1KU2 A;  2RVC A;  2D45 A;  4I02 A;  1LDD A;  5IT9 K;  1IN8 A;  2FA5 A;  3DKW A;  5FD6 A;  3WE2 A;  1FBQ A;  4HV5 A;  4ZZD A;  5HLH A;  4PGG A;  1W7P B;  2HR3 A;  1YQA A;  1MDM B;  3C18 A;  5L3B A;  2QBY A;  2VBW A;  5J8C A;  2W57 A;  2IA0 A;  1HST A;  1R1V A;  1LNW A;  3KCC A;  2LF8 A;  4RGR A;  5DV5 A;  1K79 A;  3ZMD A;  4KUM A;  3FXU A;  4KA4 A;  4Q4Z F;  1G4D A;  2IT0 A;  1J2X A;  2ISY A;  3E6C C;  3J81 Z;  2NNN A;  2PG4 A;  4N9H A;  3NQO A;  3IKT A;  3R60 A;  4A5M A;  4K2E A;  2RQP A;  5ICC A;  4HF0 A;  3DF8 A;  3HYI A;  4ZH4 F;  4KIG A;  1JHH A;  4G94 A;  1ZRE A;  4EJW A;  4OMZ A;  4Q5S F;  3E6M A;  2YX4 A;  1ZAR A;  1IN5 A;  2ZME A;  2IW5 A;  3ZMV A;  3I64 A;  2K27 A;  2PBI A;  3GO5 A;  5F6F A;  3J81 K;  4GGG A;  2Z5U A;  1SFU A;  1R5G A;  4ESJ A;  2OA4 A;  2HWV A;  4HZF A;  2Q2E A;  1B1B A;  1I5Z A;  4G6D A;  3FMS A;  4TV7 A;  4A0Z A;  1QNT A;  2Y48 A;  3VOD A;  3LQR A;  3ZMZ A;  2KIM A;  1IXS B; 
#chains in the Genus database with same CATH topology
 2PMZ N;  3ECH A;  3FXR A;  2FBK A;  3K10 A;  1T8I A;  3K1M A;  2R92 J;  4ZJZ A;  1IJW C;  3MKY B;  3DP7 A;  4BJ5 C;  2QQA A;  1H88 C;  5L3F A;  3EUA A;  2O0Y A;  4E7S A;  3H35 A;  1Y1V J;  3VYS B;  1E3O C;  4MTD A;  1TWC J;  1JHF A;  1BN5 A;  4CCK A;  3OIQ A;  4CH7 A;  5IY5 H;  2Z33 A;  2LLK A;  1JT6 A;  1LEB A;  3VSK A;  3A03 A;  1FTZ A;  5TIS C;  1ZQ3 P;  3K1P A;  3BLY A;  3FM5 A;  1X3U A;  3ZRG A;  2KLO A;  5D5W B;  4OOI A;  4HDV A;  3GCM A;  5HLG A;  1KQ8 A;  1MNE A;  5M5X J;  5M5Y J;  2ZME C;  2ZXI A;  2FMY A;  4XM3 A;  3HOZ J;  2MFZ A;  5FGM A;  4YRV A;  1J0R A;  2W1O A;  3BPX A;  1XG1 A;  3O8H A;  4I99 C;  3UNG C;  5BOX A;  2XHK A;  2EFO A;  1ZRC A;  3NEU A;  2CJJ A;  2H09 A;  2EFP A;  1IO2 A;  4S05 A;  4IHS A;  4F3Q A;  3VB2 A;  1FWZ A;  2ID3 A;  1WJC A;  3OMY A;  2ZJQ F;  3OS1 A;  5E18 F;  2F2E A;  3G4S I;  3U9G A;  4WCG A;  5LRS A;  2OF7 A;  2Y0M A;  2XC7 A;  1IN7 A;  3WTU C;  3KEQ A;  2QYO A;  1BM9 A;  5D5X B;  4AC0 A;  2YPR A;  3GYH X;  2W85 A;  4OIR F;  1MH3 A;  5JHU A;  1OR7 C;  4XLA A;  2E1C A;  2BHY A;  1TW2 A;  4MQ9 F;  1JUP A;  3DTK A;  3GVA A;  2QSG X;  4AWX B;  5EZH A;  1XCV A;  3W6K B;  3WGG A;  2K3F A;  5HS7 A;  1SD4 A;  4CCJ A;  3UKG A;  2XAF A;  3HSE A;  2VB6 A;  2L0K A;  1MD0 A;  3D5S C;  3DCF A;  4ESF A;  2EBI A;  4Y7N J;  3K4K A;  3U21 A;  3I9V 2;  1KA8 A;  1FY7 A;  3I54 A;  4N0B A;  5IYB J;  1FLI A;  2RKH A;  3QAH A;  2CUJ A;  3EQL F;  5H6R A;  4RGS A;  3BTI A;  3IV5 A;  4OIN F;  4X1E A;  2ISZ A;  3CUO A;  5HLT A;  3CF5 F;  1W7P A;  5FKN A;  2D5V A;  5JHF A;  4Q47 A;  4E7Z A;  1LKX A;  4LD5 A;  4JOM A;  3QOD A;  4FET A;  2Y9Y A;  1V54 H;  3S32 A;  5ILU A;  2Y0S N;  2FNA A;  5ICF A;  3OYJ A;  2XKP A;  3E5X A;  3ASN H;  3O2P E;  5HNF A;  1R4N B;  3IP4 B;  1R5I D;  1BOB A;  3DEE A;  5FJ8 J;  3CP8 A;  3CF2 A;  3F6V A;  5IYC J;  5M5W J;  1J7K A;  1RNL A;  2X9D A;  3KP3 A;  3P9I A;  5EYR A;  3AL0 C;  3G73 A;  2JN6 A;  4PFP A;  1FYM A;  5L3C A;  3K6G A;  1T33 A;  3HHH A;  3JRG A;  3MVP A;  2CQQ A;  3LSR A;  1L0O C;  1N78 A;  2XGD A;  2K86 A;  3A0H C;  3G1M A;  4HX8 A;  4L5E A;  1R6R A;  2HXI A;  4UUT A;  2QF7 A;  2EV0 A;  3A01 B;  1R5H A;  2QEN A;  2ZB9 A;  3DWL E;  4HNT A;  3JCU C;  2O3F A;  1QA6 A;  1XDU A;  2DA4 A;  4P1W A;  2L02 A;  2CU7 A;  5F1R A;  3LMM A;  3DLL F;  2DN0 A;  3DFG A;  4D9J A;  2V6E A;  3T8R A;  4II3 A;  1VQ5 I;  2J5P A;  4LMY A;  5ICE A;  3T8T A;  3K2A A;  1Z67 A;  2DO7 A;  3BOQ A;  4PSW A;  2CRG A;  1PUF B;  4BJ6 C;  1FYK A;  1WKM A;  4NHJ A;  2L9R A;  4CZZ A;  5EGO B;  1S5L C;  3OSF A;  4Y17 A;  3PQJ A;  3V7R A;  4F91 B;  3OIP A;  5LGT A;  4MGR A;  3KZZ A;  5CKT A;  3P7N A;  2QKM B;  5M3M J;  2R7W A;  2L4A A;  1X2M A;  1VI0 A;  4EJU A;  2CSO A;  2DTZ A;  3E5Q A;  5B1A H;  3H3U A;  1ACI A;  2L5Q A;  4XON A;  2DPD A;  2BY1 A;  3LSG A;  3JW4 A;  3NAR A;  2R7T A;  2YU9 J;  2MYS A;  2YS9 A;  5LHI A;  4BDY A;  1APL C;  2PJR B;  4DYQ A;  2HYG D;  4HF1 A;  2P5K A;  2NVU B;  3H9Q A;  1QPM A;  3ZQG A;  2F5D A;  3RKX A;  4HEA 2;  4BQA A;  3GW2 A;  4XLN F;  5J4V A;  2X48 A;  3D5R C;  2WAQ A;  3FK6 A;  2N8G A;  4C2M J;  5LHG A;  3GFJ A;  3ECO A;  4IQ4 A;  3CCY A;  2F4I A;  3HRU A;  2E2I J;  2E36 A;  2OBP A;  4LG0 A;  3GTG J;  5E20 A;  4XID A;  2R7F A;  4MQV A;  2M4K A;  3CCU I;  2QLZ A;  2VL8 A;  3HM5 A;  3Q9V A;  3S17 J;  4ITV A;  1TWF J;  2BBY A;  2CUZ A;  3LA3 A;  1OPC A;  2CQ7 A;  2NVX J;  2ELH A;  1QZZ A;  2HPI A;  3BCA A;  1DU0 A;  4PCQ A;  2Y31 A;  4RGU A;  1MBE A;  2M87 A;  4BHP A;  3BC8 A;  4J01 A;  2DOD A;  4QWQ A;  4KFC A;  4HQM A;  3ABM H;  4E6K G;  2H8R A;  1R23 A;  4XSX F;  4M6X A;  4JX4 A;  4XKB A;  5EZG A;  2ETH A;  3WU2 C;  1ZR4 A;  2D1H A;  1WI9 A;  3MN2 A;  3S14 J;  3L9F A;  3J7A O;  3DTI A;  2DK5 A;  2VT3 A;  2OC6 A;  2Y9Z A;  1RC9 A;  2XRL A;  3K4N A;  4LB6 B;  4EM2 A;  1KU7 A;  1YX3 A;  2I8D A;  2HGC A;  2XAG A;  5GAE J;  1H89 C;  1Z77 A;  2COB A;  2XPU A;  1BC8 C;  4XLH A;  4KIT B;  2XF5 A;  3BDD A;  4JX6 A;  4LIU A;  4IHY A;  3P5J A;  4YII A;  1OCO H;  4R79 A;  1WVR A;  3GFL A;  2UWM A;  3M8J A;  2W25 A;  3MZ8 A;  4PJL A;  5IYD J;  1WWX A;  2A68 F;  2K3P A;  5DS9 A;  3CCV I;  1I6H J;  1VTN C;  4DBQ A;  3LST A;  5JLX A;  4XQF A;  1ITY A;  1YW8 A;  1Z3X A;  1MW7 A;  3PIO F;  1H0M A;  2CFX A;  2COM A;  3PFI A;  3KPH A;  3S1M J;  3QP5 A;  1D5Y A;  4FX4 A;  1SVO A;  1UHW A;  4LFU A;  2VBZ A;  4G9Y A;  4MO7 A;  3PQK A;  5EGO A;  5JVG F;  3G1O A;  3VDX A;  1FNN A;  4M3E A;  3CJQ B;  2JZY A;  1A36 A;  4XMY A;  2VXZ A;  2A3S A;  1LFU P;  3RDI A;  5IOZ A;  3UR3 C;  2IBD A;  2V6C A;  5FRO A;  3OYH A;  1VQN I;  5ED4 A;  1AHD P;  2VQG A;  3CJN A;  1YFH A;  3PNV A;  2K85 A;  4BBR J;  2X85 A;  2DYR H;  4QIW N;  2F5E A;  2FNP A;  1RZ4 A;  2RGV A;  2W84 A;  4L0Z B;  2JRM A;  1Y8Q B;  5F27 A;  1QBJ A;  3FWE A;  1ZYR F;  3EUH A;  1R22 A;  3RJP A;  2AQE A;  2WB1 A;  3OR2 C;  2E2J J;  5LFA A;  1BI1 A;  3B6A A;  1ETX A;  3ESW B;  4JK1 X;  4QTR A;  4NNJ A;  5D4S A;  3F8C A;  1VFC A;  2CS3 A;  2FRH A;  3CLQ A;  5D6F A;  1GUU A;  3NRV A;  3N05 A;  2P5V A;  5FRN A;  4JQF A;  3QWL A;  2HYJ A;  5K5O A;  2R5Y B;  4QPQ A;  4QLC U;  1HF0 A;  4Y4R A;  1Z05 A;  2OU2 A;  3M4O J;  4XLP F;  4RM3 A;  5J47 A;  2XRN A;  2A07 F;  1K4T A;  3RSN A;  4C2T A;  1VQ4 I;  2A5Y B;  2H27 A;  1IUF A;  3GTQ J;  1E0E A;  4HAM A;  5FFX A;  3CC7 I;  2VOO A;  1H9G A;  1NG7 A;  3W2A A;  2GBY A;  1SAU A;  2X4H A;  3W6J B;  1HW1 A;  2B9S A;  1LJ9 A;  3V8K A;  1A5J A;  1Z0X A;  2GIV A;  3I4P A;  4XKV A;  3QU3 A;  2G7H A;  3JAM K;  5H20 A;  3GZ6 A;  2MA3 A;  3S15 J;  2DA2 A;  1JE8 A;  5HS9 A;  2R7Q A;  3F8B A;  2E5Z A;  3V42 A;  1RKW A;  2MGQ A;  1D1C A;  1BW5 A;  2JVH A;  1SFX A;  1XX5 A;  3LSJ A;  4YIR X;  1O3S A;  2DOF A;  3AKZ A;  2CUE A;  1U8R A;  1ZTR A;  2O9L A;  1L3L A;  1ETV A;  2BZT A;  2M30 A;  2VXD A;  4G7H F;  4IL6 C;  1MIJ A;  2HTJ A;  1TWH J;  1RIO H;  4Y33 A;  4A3K J;  3TW6 A;  1JKO C;  2IAI A;  3L2W A;  2LD5 A;  5B5E C;  4D1Q A;  4F92 B;  2BY3 A;  1SFO J;  2DMP A;  3Q0U A;  2XUB A;  1WJE A;  1X1C A;  3QOP A;  4KN4 X;  2MD5 A;  1BIA A;  2TDX A;  1U5T A;  4UV8 A;  3ZQH A;  3RCO A;  4E7H A;  2FBI A;  4MNU A;  2BHZ A;  1I50 J;  4ANJ A;  4XRM A;  4YIF A;  4O3M A;  2EIM H;  2JA2 A;  5GTH C;  2XDV A;  2R7V A;  2LC2 A;  2OUM A;  1BR2 A;  1V3F A;  5E8I A;  5JVT A;  1XC5 A;  3OV8 A;  3WTY C;  3PUF A;  4Y3O A;  1X19 A;  3OYD A;  3BT9 A;  1U3E M;  5CLS A;  1TBX A;  3E5U A;  2HOA A;  1FX7 A;  4AU7 A;  3QPS A;  4B4C A;  3VWB A;  3FIS A;  3SDB A;  2HDW A;  3GTJ J;  3PO3 J;  2VAS A;  3ABT A;  3TDZ C;  4B47 A;  3OS2 A;  4CXF A;  4BY1 J;  1MMD A;  4I76 A;  3M07 A;  3CDL A;  3G1L A;  1D1B A;  1REP C;  2MH2 A;  2IXS A;  3HPH A;  5D5V B;  4E4H A;  3HOW J;  5CPR B;  2XAS A;  4G7Z F;  1IRG A;  5LRR A;  5TJJ A;  1R4M B;  2M34 A;  4GYI A;  1WJF A;  1ENH A;  4L5J A;  3F0C A;  1Z21 A;  3GWZ A;  4IRH A;  3VPR A;  1EF4 A;  1YOV B;  3AFH A;  2R7D A;  3KLN A;  4B48 A;  1IUY A;  2GA1 A;  2M3A A;  4DGW B;  1G3Y A;  2A05 A;  3CDH A;  1T2K A;  2M0C A;  1FC3 A;  2VPR A;  2V1N A;  3F8M A;  3S93 A;  5HVQ C;  6PAX A;  2OZU A;  1XGN A;  2VC1 A;  1X1P A;  4S0H B;  4MFD A;  2X6X A;  3FBN B;  1LE8 B;  3ZQ7 A;  2V1U A;  3LNQ A;  3JSP A;  4EGZ A;  1SFE A;  3SDG A;  1EJ9 A;  3KX2 A;  3OIO A;  2ELK A;  2M8G X;  3H5N A;  4A3G J;  2BE5 F;  4ZYH A;  4ZYG A;  2VUM J;  2K9N A;  5HDG A;  2HKO A;  4NC7 A;  3BJ6 A;  1KYZ A;  1KZH A;  3EPZ A;  3CCQ I;  3OSG A;  1HKS A;  1YTY A;  2W24 A;  3SYT A;  1FEX A;  1J9I A;  1EH8 A;  2DOA A;  3LA2 A;  3TOA A;  1T38 A;  1U6G A;  3E7L A;  2GXG A;  2CW0 F;  3OYN A;  3KYD B;  3BR0 A;  3C1D A;  3MCZ A;  2LP0 A;  5HS8 A;  1EA3 A;  1LPQ A;  4KN7 X;  3H0D A;  2GZW A;  2KP6 A;  4OAY A;  1HSJ A;  2PJR A;  2HXO A;  2NOG A;  4CCM A;  4E7J A;  4XN0 A;  1WJA A;  2V4J C;  3K4M A;  5DCF A;  4C3J J;  5IP9 J;  2JTV A;  1IXC A;  2F5C A;  5F04 A;  2Z99 A;  2V1X A;  3CMY A;  1VQ8 I;  3IH4 A;  5GP9 A;  2WA0 A;  4M3F A;  2RRE A;  1SD6 A;  4RLQ A;  1D8K A;  1K6Y A;  3LSI A;  3W2W A;  4UUV A;  1T56 A;  1YX5 A;  2I10 A;  3IRQ A;  3S16 J;  2P8T A;  2BYV E;  3QRF F;  1ERD A;  4BY7 J;  3K4L A;  3QQA A;  4E7I A;  3IH2 A;  3WHB A;  2M7B A;  1SEU A;  1OFC X;  3KP4 A;  4YG2 F;  1YW9 A;  3CUQ A;  2JUG A;  1S72 I;  2WV0 A;  3DU5 A;  4XKW A;  1P4X A;  1D0Z A;  2KZG A;  2DU9 A;  4YEL A;  2R5Z A;  2VON A;  2FQ3 A;  3TP3 A;  1C0W A;  1IN6 A;  2ZO4 A;  2EFQ A;  3J7Y J;  4A3C J;  1ZKG A;  2XV4 S;  3OL4 A;  1FZP B;  2P4W A;  4IHW A;  3JRD A;  5F64 A;  2VQL A;  1V4R A;  2LTP A;  3DPL C;  2OAZ A;  3K1N A;  2XRO A;  2K9Q A;  2YX7 A;  2ECC A;  4XL9 A;  1IZ1 A;  2PEX A;  2MLG A;  2HNH A;  3TL4 X;  3BG9 A;  2XGE A;  1FP1 D;  3I53 A;  3CCR I;  1P4W A;  4P96 A;  4BXF A;  1U8B A;  3OYE A;  1HW2 A;  3A0B C;  2DT7 B;  3WTZ A;  2DAO A;  3KFW X;  1U5T C;  1WJD A;  4CYC A;  1X58 A;  1JXS A;  2F5F A;  1EV7 A;  3L1P A;  1ETY A;  2FU4 A;  5B66 C;  2HZD A;  3J80 Z;  1KYW A;  1P2F A;  2V7F A;  1ON2 A;  1X3W B;  3T5X A;  2B63 J;  3I5U A;  2HQA A;  2XB5 A;  3A2K A;  4ZYE A;  3DEW A;  4RAZ A;  1JKR C;  2DMU A;  2R7U A;  4E7K A;  1FOW A;  1JGG A;  4KYW A;  1Y0N A;  2FX0 A;  4DYR A;  3MKW B;  4BAY A;  2R4G A;  4LLL A;  4EQQ A;  5DD4 A;  1KON A;  3FHN A;  4Y52 J;  3ABK H;  4D7M A;  2E7W A;  1KU3 A;  4I0B A;  2D2W A;  2XAU A;  5CVU A;  1DGW Y;  4ZZL A;  3FHZ A;  1G8X A;  1UFM A;  3OYM A;  4BHC A;  1O4X A;  1XTA A;  3G3Z A;  4A3L J;  2H1L A;  3WTV C;  3H1C A;  3TP0 A;  2QCO A;  5GPC A;  3K4C A;  1PP8 F;  4E70 A;  4BNC A;  4PDK A;  1EH7 A;  1Z9C A;  1XGO A;  4XLE A;  3H9G A;  3JRE A;  1UAA A;  3RZO J;  3MEX A;  2STT A;  4WXD A;  2DT5 A;  3HEF A;  3L2V A;  1BBY A;  1U2W A;  1GT0 C;  1BI0 A;  5IP6 A;  3K0L A;  3NAU A;  3HUG B;  3GTL J;  4M3G A;  1O3R A;  4NQW A;  4IJA A;  5CJ9 A;  1PP7 U;  2UXX A;  3OS0 A;  3QPH A;  1H9T A;  4AVP A;  4HNV A;  4IPA A;  4GYG A;  5BQT A;  1VQP I;  4F55 A;  1FBU A;  3WOD F;  4CSW A;  4DNC A;  3R4K A;  1U5T B;  4LB5 A;  4GFB A;  1FIP A;  4ZDO A;  2Z9O A;  1ODD A;  2FJ1 A;  3L00 A;  2HDD A;  1DGR M;  3HG9 A;  4UUS A;  1OIS A;  3RKW A;  2ZJR F;  1ULY A;  2L9V A;  3PJR A;  3QPT A;  2VBY A;  5ILV A;  2VLA A;  4KIC A;  2LRE A;  2DMQ A;  1UHS A;  3FM3 A;  1WJ5 A;  1WQ2 A;  4G6Q A;  3CUQ B;  2CWE A;  4D5C A;  3OOP A;  4ASN A;  1O3T A;  4KIS A;  4CUG A;  3WTT C;  3C2B A;  2NVY J;  4AM3 A;  1LQ1 A;  1XSX A;  2V9P A;  3E3V A;  3MWM A;  5GPA A;  2BVL A;  2MH9 A;  2DA5 A;  3EDP A;  1V5G A;  1D8J A;  5HLI A;  4BJT A;  3W3C A;  1ETK A;  4Z2Y A;  1O3Q A;  3CP2 A;  1HLV A;  1SMT A;  3ZN0 A;  3I4M J;  1ZGJ A;  1VF9 A;  3GME A;  2EA2 A;  2P6S A;  1WHU A;  1F5T A;  1QQI A;  2M2E A;  2WB1 N;  3VOE A;  3VYT B;  5F0H A;  4A93 J;  2LBF B;  2HS5 A;  2CO5 A;  3HKZ A;  2GWR A;  1Z91 A;  5CVR A;  4A3E J;  3K9T A;  1SAX A;  2CV2 A;  3WTS C;  5EF6 A;  1Q1H A;  2NYX A;  1Y39 A;  2CQK A;  4M6V A;  2E7X A;  2ECB A;  3ZXS A;  3KP7 A;  3HOS A;  2MAB A;  1ZR2 A;  1PJR A;  2EFW A;  3S8P A;  4LIV A;  2EA4 A;  2O8K A;  4HRI A;  2JA7 J;  1I27 A;  3O6B B;  4FCY A;  3BRO A;  4I98 B;  2K7L A;  1IRZ A;  2NVT J;  3LWF A;  3HDD A;  3RQ4 A;  3HOT A;  3QYB A;  1MH4 A;  5K5Q A;  2DA7 A;  3JTG A;  3TOB A;  5D6E A;  4YFN F;  3O8G A;  1R9T J;  3R0A A;  3L2C A;  3S2H J;  4XLC A;  4AID A;  3HTS B;  2QUF A;  2EZH A;  3BR3 A;  1XDS A;  2BXY A;  2CUF A;  2HU9 A;  1HDD C;  1Z6R A;  3JSO A;  3SZT A;  2CV1 A;  2L4M A;  5BPI A;  3U2R A;  4XOP A;  1TC3 C;  3A1Y A;  3X2Q H;  3GFI A;  4ABZ A;  4M9S A;  2O61 A;  1DUX C;  2ICW G;  2W48 A;  4IEJ A;  4I0A A;  4H0E A;  4CYC B;  2M1B A;  2PQ8 A;  4G6T B;  5GAH J;  5K7F A;  5EEG A;  1XSV A;  3BP8 A;  4A3B J;  4HV6 A;  1BI2 A;  2GIZ A;  5H6Q A;  3KP2 A;  5K5R A;  3U1K A;  2FD5 A;  4W97 A;  3QPL A;  5FLM J;  3MFK A;  2X1D A;  1ZRD A;  4QPO A;  1NHA A;  4EGY A;  3N4M A;  3WG9 A;  1GXP A;  3ZQL A;  4HX4 A;  2PFB A;  2KJB A;  4OIO F;  1GVD A;  1UZC A;  2NRA C;  2RDP A;  3S3N A;  4CHU A;  1LVA A;  1ZLJ A;  4MEX F;  3CLO A;  2HQR A;  3KZI C;  4NDL A;  2E35 A;  2F4O B;  3PNT A;  4XK4 A;  3RQI A;  4FX0 A;  3FKJ A;  4M3B A;  4LOC A;  2JRT A;  1S7E A;  1LEA A;  5A2Q Z;  4MLO A;  1VQ6 I;  1UMQ A;  1R58 A;  2VKD A;  3VEP A;  3I55 I;  1W7P D;  1XD7 A;  3CJR B;  4M74 A;  3WE3 A;  3HSF A;  1YLF A;  1FSH A;  3G71 I;  2A6H F;  2PI0 A;  2OQR A;  2OCC H;  1G6N A;  2EB7 A;  5E3N A;  2EIJ H;  2ME6 A;  3TGN A;  3RZD J;  1F9N A;  3BZK A;  3DEU A;  4C30 A;  3SFI A;  4BH9 A;  3CES A;  4EJV A;  2J5O A;  3KP6 A;  1OR7 A;  4RB3 C;  1G3T A;  3ZQQ A;  3BWG A;  4RB2 C;  4HF2 A;  2XGC A;  2ZJ2 A;  1S6L A;  4CO8 A;  2Y30 A;  1DP7 P;  2RN7 A;  3H5R A;  2DDB A;  2WBM A;  3TO9 A;  1MMG A;  2LYC A;  3W2V A;  4XOR A;  5EEH A;  4DIQ A;  4IX7 A;  4ENN A;  2BEO A;  3LSH A;  3PNY A;  2UUZ A;  3L2R A;  3DXJ F;  4JX5 A;  3F21 A;  2M7A A;  1WH7 A;  1H8A C;  4KDP A;  5IT3 A;  4XLF A;  3DTE A;  1PVE A;  2FSW A;  3K4B A;  1YJN I;  1V5E A;  3L2U A;  1SD5 A;  3LAJ A;  1QPI A;  1W5S A;  4ON0 A;  4LLN A;  1BW6 A;  4D7N A;  1Z1D A;  1QU3 A;  1LDK B;  5KCM A;  1B72 A;  2E34 A;  1KQ9 A;  4M9Z A;  2GXB A;  1JT0 A;  1R36 A;  2V9V A;  1W0T A;  5EEA A;  1IV8 A;  1OYI A;  3ABU A;  2PN6 A;  2ZSH B;  3FMR A;  4UHT A;  2JA8 J;  4GRI A;  4Z6Y A;  1GV2 A;  3OYG A;  3DBH B;  1G3W A;  3RIR A;  2ME0 A;  4RLF A;  3TDU C;  4AVZ A;  3WG7 H;  5CQE A;  1B4A A;  2DCE A;  4FQG A;  4IOA F;  2JSP A;  2HVS A;  3I4N J;  1RI7 A;  2GA2 A;  3ROU A;  2LKP A;  3F22 A;  2X6O A;  1FIA A;  4HPQ A;  4UVA A;  2TRT A;  3DV8 A;  4EEF G;  5FB2 A;  2CV0 A;  2ZKZ A;  3PUB A;  4KMU X;  5DUI A;  1RUO A;  1O57 A;  3CO7 C;  1YW7 A;  2JWT A;  4B44 A;  4U88 A;  1I1G A;  3ZCO A;  4F7Z A;  3SEQ A;  4G12 A;  2F48 A;  4A0Y A;  4CYD A;  2UXN A;  4UB8 C;  2E1M C;  2VOP A;  2ZNY A;  4DZP A;  1GVJ A;  1ZH5 A;  3ZN1 A;  3SZP A;  4XOT A;  2EV6 A;  4NB5 A;  2R93 J;  1GV5 A;  4NC6 A;  2X1C A;  4EV0 A;  1ZAO A;  4C9Y A;  2GOX B;  1ZG5 A;  1XN7 A;  4LIT A;  3SEZ A;  4ESB A;  3HHG A;  1CGP A;  1W0U A;  3FXJ A;  1XMK A;  3K69 A;  1IW7 F;  3HRT A;  1WPK A;  2L01 A;  3BTC A;  1K78 B;  1T0F C;  4KT5 C;  3GFM A;  4NC8 A;  4E7L A;  4IXA A;  2KJC A;  5HOO A;  4OIQ F;  1X3Z B;  2IS2 A;  5KK1 A;  2QQ8 A;  5KAI C;  3HBL A;  5FKO A;  5IT9 Z;  3LQQ A;  2O7O A;  4YFX F;  1U78 A;  1TZL A;  3OYI A;  1HKT A;  2DOE A;  1W5C C;  1YE9 A;  2QQ9 A;  5BPD A;  4IRI A;  1TNT A;  3HGY A;  2DA1 A;  1B59 A;  1T39 A;  2GLO A;  5LHH A;  2HEO A;  3DLA A;  3CME I;  1B8I A;  2WTE A;  2CG4 A;  2VI6 A;  5BMZ A;  1HW5 A;  2HDC A;  2CYY A;  3SHF A;  3KEY A;  3JRF A;  2CQN A;  2VKV A;  4H4K C;  2VJJ A;  2H8W A;  3Q3S A;  1YIJ I;  4Y15 A;  4OWR B;  1MBG A;  1DPU A;  2LRD A;  1J5Y A;  3DU6 A;  3Q0W A;  3I0T A;  5C44 J;  4EAT A;  1IAW A;  5D4R A;  5IOY A;  1GXQ A;  2MW8 A;  1W5T A;  2JQ7 A;  4HDU A;  2KRH A;  4GO1 A;  5GTI C;  3S1N J;  3JR9 A;  2DJN A;  2X51 A;  2R5Z B;  5LBQ A;  1UJ8 A;  2DFI A;  1K61 A;  2KFD A;  2BV6 A;  2XAH A;  4WF2 A;  3C3W A;  1R1T A;  5DCM B;  2A61 A;  3ULQ B;  4XRS A;  3ML6 A;  2BW3 A;  4EJT A;  2NS8 A;  2G7U A;  3NWT A;  2ZFW A;  3G6E I;  4QSH A;  3E6D A;  1A35 A;  3RPQ A;  4JP0 A;  1MKM A;  2XF6 A;  2V1D A;  3CCJ I;  1WGX A;  1TW3 A;  2L3D A;  4KIB A;  3LAP A;  4KIF A;  4X6A J;  4XRF A;  4A3M J;  4U0Y A;  4A6D A;  2JSC A;  4HBL A;  3N97 A;  4PK4 A;  3GTP J;  1MZB A;  2KPM A;  1TQP A;  2O6G E;  2OQG A;  2NS7 A;  1HOM A;  5F0C A;  2XPW A;  5J6X A;  1YO5 C;  3V8L A;  1ZK8 A;  2VKH A;  4IRG A;  1NTC A;  3S1R J;  1CF7 A;  2DYS H;  4ETS A;  3AG3 H;  2AHQ A;  1JUS A;  1J09 A;  4PGH A;  5DM6 F;  2WV1 A;  4N9I A;  1P92 A;  4C2U A;  3SJM A;  1R49 A;  2DT6 A;  1XMX A;  3CCL I;  3PSI A;  4ZDL A;  2XF7 A;  5CQG A;  4CA0 A;  2P7C B;  1KGS A;  1T08 B;  3CMA I;  1B6A A;  2W82 A;  2OPT A;  3IAM 2;  3MZY A;  5F08 A;  2LK2 A;  1FSE A;  2W00 A;  1X4O A;  1ETO A;  1IXR C;  2FOK A;  3HSR A;  4V2F A;  4S04 A;  3A01 A;  2WWY A;  3JAM Z;  4IZZ A;  1AKH B;  1JKQ C;  3JRH A;  1R1U A;  2DBB A;  1F1Z A;  2EPF A;  3EYI A;  4JYK A;  4CCL A;  2BY0 A;  2IA1 A;  1HBX G;  5E3M A;  2K9L A;  2VJ4 A;  1DP3 A;  3CQZ J;  3RTR A;  4PFO A;  1YJ9 I;  1MDM A;  1IG7 A;  5IP7 J;  2ESN A;  2E1N A;  2DQR A;  2LY9 A;  2RQQ A;  1X1B A;  2P0W A;  1E17 A;  3EUH C;  3GTO J;  3MKL A;  1UST A;  4CCN A;  4U0W A;  4RB0 A;  3RPU A;  2XKO A;  3HJE A;  1K7A A;  4A6E A;  4JBA A;  2K5C A;  4LK1 F;  1G2H A;  2OV7 A;  2WY7 Q;  4L18 B;  2NAZ A;  4WK8 F;  3HZJ A;  1EKE A;  2L7M P;  2RC4 A;  5FLX K;  2QGU A;  5F0F A;  4WX9 A;  2HOS A;  2P7V B;  4BXU A;  1XCB A;  3TO6 A;  5DD8 A;  5DUK A;  2MG4 A;  4MTE A;  2MBF A;  1MGT A;  3IHU A;  4BU2 A;  2AS5 F;  2EFN A;  2Q2E B;  1VQO I;  5AON A;  2BOL A;  2ZFU A;  2LH9 A;  2EIL H;  1AKH A;  2HZT A;  1DU6 A;  2PX9 A;  3AG1 H;  1N25 A;  3FXM A;  4FTH A;  2ZCW A;  1B9N A;  2EQR A;  2QVO A;  4KNY A;  2KIQ A;  2GAU A;  3GUD A;  1Y56 A;  1FYL A;  4IHV A;  3WGH A;  4I2O A;  3M1C A;  1JTY A;  4BL0 B;  3MQ0 A;  3LFK A;  1ZGW A;  4L9N A;  3FF5 A;  4LJZ F;  3S2W A;  2BVM A;  2XAQ A;  3LSM A;  2LG4 A;  2EZI A;  4UV9 A;  2M8E A;  2P81 A;  4FT8 A;  1IDY A;  1MJB A;  1VND A;  3H0G J;  2VOD A;  5EJC A;  2HKX A;  4KJZ A;  9ANT A;  2MSY A;  3ZQI A;  3IC7 A;  3FIW A;  5L3G A;  4N4O B;  4O6J A;  2BW3 B;  3AG4 H;  2ACJ A;  3SQN A;  3GLL A;  4M3D A;  3I56 I;  3ZMT A;  2QEX I;  3K70 C;  3BPV A;  1NG6 A;  2VC0 A;  3HB9 A;  4DYC A;  3CCE I;  5J1U A;  2E60 A;  3Q9S A;  3HXL A;  3H92 A;  4U87 A;  2D1V A;  3KEO A;  2DXI A;  1OMI A;  1ON1 A;  1FJL A;  2QSH X;  2LKX A;  4AIH A;  5KNL A;  5CYV A;  4J19 A;  1A04 A;  1QVU A;  2H94 A;  4FAS D;  3K4J A;  1OQY A;  2HPM A;  2VIX A;  2A69 F;  3AG2 H;  3M8E A;  2Z2S B;  3HTU A;  4NUB A;  2CW7 A;  5DCM A;  1T95 A;  2JT1 A;  1BOA A;  1X4P A;  2Y75 A;  2R5Y A;  1SAN A;  2YU3 A;  3DQV C;  4UY8 I;  3VYR B;  2DDA A;  3F3X A;  2HOE A;  3RKY A;  3OYA A;  3WGI A;  4CGZ A;  3B6C A;  4BHB A;  1TQI A;  1B9M A;  3VYU B;  3TBI A;  2XGX A;  2CMP A;  1HXD A;  3HRM A;  4PZJ A;  5DDG A;  2EK5 A;  2A6E F;  1NK2 P;  3V7C A;  2FBH A;  1ZHF A;  2DTR A;  4OIP F;  1P4A A;  4PJJ A;  4J00 A;  2AXT C;  1W36 D;  2KZV A;  1QHH D;  2I5U A;  4WXC A;  3F23 A;  2EJR A;  1T6S A;  3CCM I;  3VSL A;  4B09 A;  2E71 A;  1SVL A;  2EH3 A;  2VE8 A;  3P9K A;  3H36 A;  2KT0 A;  3I71 A;  2PMU A;  4BQO A;  1JGS A;  1LFP A;  2IJL A;  2LR8 A;  4IVN A;  2K4J A;  2NVQ J;  2JUC A;  3EUK L;  3KP5 A;  2Q0O A;  2K02 A;  3HC7 A;  3OOU A;  4HLX A;  5ILS A;  3WTX C;  2Y69 H;  3BCB A;  3V8J A;  5GAD J;  3HOX J;  4EM0 B;  3OYC A;  1G3S A;  2GOM A;  4DW6 A;  2KMU A;  3KET A;  3OYF A;  1R71 A;  2YSR A;  4XIC A;  1XPX A;  3ZPL A;  1Q1V A;  4HNU A;  2VQC A;  1SC7 A;  4ZTJ A;  4BQQ A;  1BI3 A;  1IN4 A;  2OTJ I;  2MC3 A;  2VJ5 A;  3JRC A;  2IS1 A;  5IPA A;  1EH6 A;  3PM1 A;  2KIF A;  3BTJ A;  1OKR A;  1XGM A;  1XMA A;  1SD7 A;  2ZNZ A;  1X1A A;  2QWW A;  1N75 A;  2IGM A;  1K83 J;  5EDN A;  3C2H A;  1BR4 A;  1BL0 A;  4PJN A;  4ZDP A;  1RES A;  3WU1 B;  3ZMU A;  2JJ7 A;  4KT6 A;  1MMA A;  2HYF A;  1ZEL A;  2VT2 A;  3R6S A;  3OY9 A;  2VE9 A;  1K78 A;  2EWN A;  4RS8 A;  4RAF A;  4A0X A;  1S8N A;  2IEK A;  4AD9 A;  2MLK A;  1E3P A;  3IWZ A;  3NWS A;  5AIP A;  2WC2 A;  2X6W A;  2TCT A;  1RET A;  4G8X A;  4GCV A;  3DKY A;  1VQ9 I;  4RA2 A;  1JJ8 C;  5TRD A;  1J59 A;  2LY1 A;  4AIK A;  4B3X A;  1MMS A;  2P6T A;  2DFH A;  2FEZ A;  2A6T A;  1MMN A;  5CVI A;  3GZN B;  5K1Y A;  3IRR A;  3WTW C;  4B8X A;  5BNG A;  1YYV A;  2QSF X;  3T0Y A;  4M6Y A;  2IP2 A;  4IF4 A;  3A4C A;  3K2Z A;  4XNF A;  2QBY B;  1IC8 A;  2QZ8 A;  2IS4 A;  3CC2 I;  4UVC A;  5E1X A;  5TGT A;  5JI6 A;  3FX3 A;  4WWC A;  1BJZ A;  4GXO A;  3JRB A;  4ENJ A;  2JMW A;  4FE7 A;  3FMQ A;  3ZGK A;  2F5V A;  2OJE D;  4LG3 A;  4O5V A;  5C4X J;  3CD6 I;  4P55 A;  3M1E A;  2MD0 A;  5HNH A;  2M5W A;  3RYP A;  2DPU A;  1PYV A;  1MBJ A;  3COA C;  2E19 A;  2XVC A;  3GTM J;  4IHT A;  2JA6 J;  4MHG A;  3PL8 A;  3KE2 A;  1ZGA A;  2IGN A;  4C3I J;  4U0V A;  2W7N A;  1KQ0 A;  3LFU A;  5BS6 A;  1YHQ I;  4HG2 A;  3B02 A;  3BTL A;  2Q8K A;  1PUE E;  1WZ2 A;  5DEQ A;  3R0J A;  4D0P A;  1YI2 I;  4RMN A;  1OLT A;  5L3E A;  5LGU A;  3CCS I;  4RGX A;  4Y13 A;  1R00 A;  4IQJ A;  5B1B H;  4CCO A;  5E3L A;  2F6C A;  2GXA A;  1X1D A;  4MIM A;  1W4M A;  5F1J A;  2AQF A;  3TKY A;  3BZ6 A;  4P5O A;  4R8H A;  3ZP5 A;  4BE1 A;  4DOZ A;  2LNB A;  1M1E B;  3M3Y J;  2HI3 A;  4HQE A;  2XB0 X;  1ETQ A;  4YEJ A;  2KQR A;  3CZ6 A;  2HFH A;  1F36 A;  4IHX A;  4G7O F;  3CO6 C;  1YRN B;  1BR1 A;  1VZ0 A;  3B73 A;  3E6B A;  4BDZ A;  1OCT C;  5HDK A;  3TQN A;  1IGN A;  4UVB A;  1OCP A;  3M9A A;  4II2 A;  3KYC B;  2IA2 A;  2QM3 A;  2NXN B;  2MC4 A;  3BG7 A;  3FBI B;  3M8F A;  2V9K A;  4L9T A;  2Y0S A;  5FKL A;  5LD2 C;  3J80 K;  5E79 C;  4CDG A;  2KRF A;  1K6O A;  4V19 K;  1CF7 B;  2HVR A;  2JPB A;  3QYE A;  5C4J J;  4OU0 A;  3HKZ N;  1Z6T A;  4FHT A;  1FPQ A;  1SFK A;  2B7E A;  2L7Z A;  4LK0 F;  3IH3 A;  1BC7 C;  3ZQC A;  4MEY F;  3RI4 A;  3Q5F A;  3DPT A;  5J3L A;  1I3Q J;  4OMY A;  1FBS A;  2DW4 A;  1OJL A;  5LLQ A;  3R61 A;  5KAF C;  1LFB A;  5K7H A;  3Q0V A;  4ZTF A;  3BR6 A;  4ZC3 A;  3OR1 C;  4EM1 A;  2LSO A;  3HUG A;  2ZME B;  2RAE A;  2ID6 A;  3I59 B;  5E17 F;  2L54 A;  3LSK A;  3D1N I;  1LB2 A;  1U9O A;  1OYW A;  1HC8 A;  2KIS A;  2RNJ A;  1IV6 A;  4BGD A;  5E1Z B;  2JK3 A;  4BS9 A;  1X2N A;  4EJO A;  3GTK J;  2K4B A;  2DFE A;  1FOK A;  3S3O A;  5AIQ A;  1A31 A;  1AU7 A;  2W4S A;  3HOU J;  1RUN A;  3RKQ A;  3EET A;  1S9H A;  1MBK A;  1QVT A;  3BG3 A;  4XSZ F;  3H3V K;  1AWC A;  3F72 A;  4EMS A;  5D5U B;  4XN3 A;  5K7Z A;  3S1Q J;  3V4G A;  2V79 A;  1HKQ A;  2PLY A;  5J4Y A;  2VN2 A;  5FLX Z;  3PIP F;  5E8G A;  2QKL B;  4ZYD A;  3CJT B;  4BE2 A;  4V2G A;  4LLG F;  4P9F A;  1E3H A;  2LF7 A;  4DBR A;  1O7L A;  1DDN A;  3ASO H;  2KDO A;  3PO2 J;  3HGG A;  5E3O A;  3TO7 A;  5FRM A;  2ESH A;  5J1R A;  3L09 A;  3RPU D;  5GAG J;  1S7O A;  1ZG1 A;  3ONQ A;  2LOO A;  1QGP A;  1ONV A;  2V26 A;  5J1Y A;  4A12 A;  4DJA A;  2DA3 A;  3ISP A;  1B72 B;  1QHG A;  2HVQ A;  2AXL A;  1IRX A;  4BUP A;  2X0L A;  4YFK F;  1TLH B;  2KKO A;  2LMD A;  3J7A Y;  4I6Z A;  1UB9 A;  2ZBK A;  3P9C A;  4UNO A;  2ZXW H;  3FXQ A;  4HSR A;  1OCZ H;  1WCM J;  2IRF G;  3D0S A;  4L9V A;  2B0L A;  3BR2 A;  3MD2 A;  4ENM A;  3F9K A;  2KL4 A;  2HQN A;  2K9M A;  1JKP C;  3DPU A;  3H3Z A;  4RDU A;  3LSP A;  3L7W A;  1U0J A;  2FUG 2;  2KIU A;  4HLY A;  1RKT A;  1OCR H;  1T0F A;  2JPC A;  4PJ0 C;  4FIS A;  2LDU A;  5J40 A;  4RM2 A;  3KLO A;  3IAS 2;  3BZC A;  1FP2 A;  2LFB A;  4W1U A;  1NK3 P;  1STZ A;  1TTY A;  3IKV A;  1VQK I;  4A2U A;  2K40 A;  4HYE A;  3C2G A;  2CQX A;  2H6B A;  4IKF A;  3AL0 B;  1SMY F;  1TT0 A;  3ABL H;  1Z3Y A;  4L9J A;  5D8L B;  3REO A;  1RR8 C;  2IVM A;  4A3F J;  5DYM A;  2R7R A;  2G9W A;  4AIJ A;  2R7O A;  1ZLK A;  3WU0 A;  2ZJP F;  3AAF A;  1UG2 A;  1ORK A;  3E97 A;  3SXY A;  2LY2 A;  2AO9 A;  2HOT A;  2NNY A;  2NS0 A;  2YR2 A;  1UHM A;  2DMN A;  3CTA A;  1QZY A;  3LA7 A;  1GLN A;  1P7I A;  4N4N B;  4HOB A;  1PDN C;  3SFZ A;  2FXA A;  4M71 A;  3A02 A;  3CC4 I;  4X0G A;  4EVI A;  3JRA A;  3O3K A;  3E0J B;  4NQW B;  2XAJ A;  4BEH B;  1UEL B;  1Z7U A;  4AYB A;  2Z3Y A;  1RPW A;  4BKX A;  2GM4 A;  5H2F C;  5CVJ A;  1B8I B;  2VPL A;  2M9H A;  4HST A;  1VQ7 I;  2VQH A;  3SZG A;  5HOD A;  2EIK H;  2OZ6 A;  1YRN A;  3IUO A;  4RBO A;  1BJA A;  3GF2 A;  2L2O A;  2KDZ A;  1F43 A;  4P9U A;  1IF1 A;  2FE3 A;  1P6R A;  1WH5 A;  5A2Q K;  5EG0 A;  5L3D A;  4LGW A;  5E1W A;  2CW8 A;  2KHM A;  4MFE A;  1AOY A;  3LL7 A;  4M9X A;  4BYY A;  3ZR8 X;  2FOW A;  2VBX A;  2LBF A;  4WXH A;  3OYB A;  4RAY A;  1UCR A;  2UV1 A;  2RV8 A;  3C7J A;  2E2H J;  1T98 A;  1MND A;  4M72 A;  4HX7 A;  1WRJ A;  4F93 B;  1JTX A;  5KHD A;  4BAC A;  3QU6 A;  2WAF A;  1VQM I;  3L2Q A;  4PJM A;  3HOY J;  2L9N A;  1S29 A;  1QZE A;  2O8X A;  3TMO A;  3GXO A;  3VFZ A;  2L7F P;  5FO5 A;  5J8F A;  5KVR A;  1LDJ A;  1YG2 A;  1TNS A;  5ERI A;  4U7B A;  4KMF A;  1BIB A;  2Q1Z B;  3JRI A;  2ZXH A;  1E2X A;  3BJA A;  1D5V A;  2OCE A;  3HL2 A;  3QP6 A;  2STW A;  2R3S A;  3GZ5 A;  2XSD C;  4A3D J;  1IRF A;  2M4G A;  3MAJ A;  4AUX A;  1GHC A;  2O03 A;  3H9J A;  1OYY A;  3OYK A;  1MNM C;  2C6Y A;  1Y8R B;  3F6O A;  1YS6 A;  2EZK A;  2JA5 J;  1RRJ A;  3M7G A;  4AYB N;  5HDN A;  4RAG A;  1FOX A;  2XIG A;  3HIF A;  2DFF A;  1ZN2 A;  4C3H J;  2LKS A;  3T1B A;  2QQB A;  3BY6 A;  2WAQ N;  4DQ2 A;  2ELJ A;  2F4M B;  1YIO A;  3F8N A;  2VKE A;  2OTL I;  2ZXJ A;  4I7H A;  3FK7 A;  1U9N A;  3FXK A;  1G59 A;  4U7D A;  1HQC A;  2PJP A;  2CH0 A;  3DKX A;  1LE8 A;  4CIC A;  3MZH A;  1MBH A;  1I1S A;  1IDZ A;  2FQ4 A;  1QO0 D;  3G2B A;  3I58 A;  5JLW A;  2XSJ C;  3FZV A;  1XSD A;  4B1R A;  1TQM A;  1I3A A;  5LGN A;  4HA8 A;  3KZY A;  2Y2Z A;  1JJ6 C;  2IGO A;  5D8K B;  4L0Y B;  3S2D J;  1XB4 A;  4IO9 F;  4R1H A;  5FFZ A;  1XGS A;  2M45 A;  4HW0 A;  2CGP A;  1WI3 A;  3JTH A;  3OL3 A;  4B3A A;  4L5I A;  2P5L C;  2EIN H;  2PMH A;  2WAE A;  2R7X A;  4F52 A;  3ERE D;  2DLL A;  2R0Q C;  5CVV A;  2H1K A;  3U1D A;  1DPR A;  3HRS A;  2L9S A;  1D3Y A;  2DQL A;  3IL2 A;  3MKZ A;  1Y6I A;  3F8F A;  3RYR A;  2LVS A;  2GQQ A;  5FD5 A;  2DA6 A;  3TW7 A;  5LEK A;  5ICG A;  3ELK A;  2BGC A;  4Q48 A;  3I3L A;  4XBF A;  4UB6 C;  1A6I A;  1POG A;  1J75 A;  3EYY A;  3GX4 X;  3H5A A;  3FXO A;  1MJ9 A;  4M73 A;  3DBR B;  2ZC2 A;  3PFY A;  1YJW I;  4FE4 A;  1TP4 A;  1JUM A;  2HTS A;  3TED A;  1HCR A;  2Z1D A;  2UZK A;  5M3F J;  2DI3 A;  5JFR A;  1YIT I;  1FMW A;  3BG6 A;  5FKM A;  4DZJ A;  2H6C A;  3GBG A;  2FML A;  1S7A A;  1LUJ B;  2BXZ A;  1D1A A;  1KU9 A;  5FLV A;  1I39 A;  1FOY A;  3I59 A;  1WFX A;  2YUS A;  3ZMS A;  5LEJ A;  2ADU A;  2E1M B;  4I01 A;  4LG0 B;  1MBF A;  4B43 A;  2X6Y A;  3V7S A;  2BY2 A;  4I09 A;  3K70 D;  5JR3 A;  2DMT A;  4UXN A;  1YS7 A;  1R7J A;  3IWF A;  3E1S A;  3GEZ A;  2G0E A;  1MJA A;  4ENK A;  2EV5 A;  2DK8 A;  3D5L A;  1TWA J;  3BG5 A;  1S3J A;  2IPQ X;  3CDI A;  4A5N A;  3ZOB A;  1WSU A;  1MSF C;  3WHC A;  4A69 C;  2FF4 A;  1SVM A;  3BJO A;  1FT9 A;  3GLX A;  3OWT A;  4NBQ A;  3PSF A;  1ZG3 A;  4D5F A;  2E1O A;  1I6X A;  1Y0U A;  1F4K A;  4BQN A;  1HA8 A;  1O7F A;  1USS A;  1ZRF A;  1K4S A;  3CUQ C;  1Y1W J;  4BXX J;  4RB1 A;  2M0M A;  1W1W E;  2OD5 A;  1KU2 A;  2RVC A;  3FXL A;  1CQT A;  2A5W A;  1PUF A;  2D45 A;  3CMM A;  4I02 A;  2O5R A;  3QOE A;  1LDD A;  1D0Y A;  4BBS J;  5IT9 K;  5B3S H;  3BQY A;  3FKI J;  1IN8 A;  2FA5 A;  3DKW A;  3FDY A;  3ZQF A;  5FD6 A;  3KYL A;  3WE2 A;  5DTD A;  1FBQ A;  4HV5 A;  4ZZD A;  5HLH A;  4PGG A;  1A6Q A;  1W7P B;  2HR3 A;  1YQA A;  1MDM B;  3C18 A;  2L7K A;  4A3J J;  5L3B A;  2QBY A;  2VBW A;  5J8C A;  2W57 A;  3OYL A;  5EG0 B;  4A3I J;  2IA0 A;  1DQU A;  2Z16 A;  1TL8 A;  1HST A;  1LVK A;  2IGK A;  2KRC A;  1R1V A;  2QA4 I;  3HOV J;  1LNW A;  3KCC A;  2LF8 A;  3DBL B;  3ERM A;  1ETW A;  3BQZ A;  4RGR A;  2R7Z J;  4BEH A;  2R7S A;  1V5F A;  5DV5 A;  1D0X A;  3MMY B;  4ZYA A;  1K79 A;  1TT5 B;  4CZC A;  3ZMD A;  4KUM A;  3FXU A;  4UUS B;  4KA4 A;  2E5N A;  4Q4Z F;  1G4D A;  2IS6 A;  4PUS A;  4XRS G;  2IT0 A;  1J2X A;  1Z7L A;  2DJI A;  2JVG A;  2ISY A;  3E6C C;  3J81 Z;  3HPG A;  2NNN A;  2PG4 A;  4N9H A;  1OCC H;  1UG0 A;  3NQO A;  3IKT A;  3R60 A;  4OAZ A;  3KIO A;  4A5M A;  3K7A J;  1N77 A;  4K2E A;  2RQP A;  2K9S A;  5ICC A;  1FMV A;  2CFO A;  4HF0 A;  5DM7 F;  3DF8 A;  3HYI A;  2VJI A;  5FKK A;  4ZH4 F;  1W36 C;  1JI8 A;  1P9Q C;  4PSX A;  2WAD A;  1JHH A;  1AA7 A;  3QYF A;  4KIG A;  1TWG J;  3J7Z I;  4G94 A;  1ZRE A;  4EJW A;  4OMZ A;  4Q5S F;  3E6M A;  3BR5 A;  2YX4 A;  4BE0 A;  1FTT A;  1VQL I;  1ZAR A;  2ZME A;  1IN5 A;  2IW5 A;  3ZMV A;  1P7J A;  2RNG A;  4XKC A;  4XR6 A;  3I64 A;  1WJB A;  2K27 A;  1XS9 A;  1GDT A;  2PBI A;  2ZSI B;  3GO5 A;  5F6F A;  3J81 K;  1NH3 A;  4GGG A;  2XPV A;  2Z5U A;  1RR7 A;  1SFU A;  2PMZ A;  1R5G A;  5C3E J;  1QRY A;  3W6V A;  4ESJ A;  1MSE C;  2OA4 A;  1BA5 A;  2EZL A;  2HWV A;  4IOC F;  3LOC A;  2WY8 Q;  4HZF A;  2Q2E A;  3S3M A;  1B1B A;  1I5Z A;  4G6D A;  3FMS A;  4TV7 A;  4A0Z A;  1HDP A;  1QNT A;  2HQ5 A;  1V55 H;  2Y48 A;  3VOD A;  3LQR A;  4GDF A;  2X1E A;  3ZMZ A;  2KIM A;  1IXS B;  3BR1 A;  2NOJ B; 
#chains in the Genus database with same CATH homology
 3ECH A;  3FXR A;  2FBK A;  3K1M A;  3DP7 A;  2QQA A;  5L3F A;  2O0Y A;  4MTD A;  1JHF A;  1BN5 A;  2Z33 A;  1LEB A;  3K1P A;  3FM5 A;  1X3U A;  5D5W B;  4OOI A;  4HDV A;  5HLG A;  1KQ8 A;  2FMY A;  5FGM A;  1J0R A;  3BPX A;  5BOX A;  1ZRC A;  2XHK A;  2EFO A;  3NEU A;  2H09 A;  2EFP A;  4S05 A;  4IHS A;  3VB2 A;  1FWZ A;  5E18 F;  2F2E A;  3U9G A;  4WCG A;  5LRS A;  2Y0M A;  1IN7 A;  3WTU C;  3KEQ A;  2QYO A;  1BM9 A;  5D5X B;  2YPR A;  3GYH X;  2W85 A;  4OIR F;  5JHU A;  2E1C A;  1TW2 A;  4MQ9 F;  3GVA A;  4AWX B;  1XCV A;  3W6K B;  3WGG A;  5HS7 A;  1SD4 A;  2XAF A;  3HSE A;  1MD0 A;  4ESF A;  1KA8 A;  1FY7 A;  3I54 A;  4N0B A;  1FLI A;  2RKH A;  3QAH A;  3EQL F;  5H6R A;  4RGS A;  4OIN F;  2ISZ A;  3CUO A;  1W7P A;  4Q47 A;  4LD5 A;  5ILU A;  2FNA A;  5ICF A;  2XKP A;  3E5X A;  3O2P E;  3F6V A;  1J7K A;  1RNL A;  3KP3 A;  3P9I A;  3G73 A;  1FYM A;  5L3C A;  3HHH A;  1L0O C;  2K86 A;  4HX8 A;  2EV0 A;  1R5H A;  2QEN A;  2O3F A;  1XDU A;  2L02 A;  5F1R A;  3DFG A;  3T8R A;  2J5P A;  4LMY A;  5ICE A;  3T8T A;  2DO7 A;  3BOQ A;  1FYK A;  1WKM A;  4NHJ A;  4CZZ A;  4Y17 A;  3PQJ A;  3V7R A;  5LGT A;  4MGR A;  3KZZ A;  3P7N A;  2L4A A;  4EJU A;  2CSO A;  3E5Q A;  3H3U A;  2DPD A;  3JW4 A;  5LHI A;  2HYG D;  4HF1 A;  2P5K A;  1QPM A;  2F5D A;  3RKX A;  4BQA A;  3GW2 A;  4XLN F;  5LHG A;  3GFJ A;  3ECO A;  3HRU A;  2OBP A;  4LG0 A;  5E20 A;  2R7F A;  4MQV A;  2QLZ A;  3Q9V A;  2BBY A;  3LA3 A;  1OPC A;  2ELH A;  1QZZ A;  4PCQ A;  4RGU A;  2M87 A;  4BHP A;  4QWQ A;  4KFC A;  4HQM A;  1R23 A;  4XSX F;  4M6X A;  2ETH A;  2D1H A;  1WI9 A;  3L9F A;  3J7A O;  2DK5 A;  2VT3 A;  1KU7 A;  4LB6 B;  4EM2 A;  2HGC A;  2XAG A;  1BC8 C;  3BDD A;  4YII A;  4R79 A;  3GFL A;  2UWM A;  2W25 A;  1WWX A;  2A68 F;  1VTN C;  3LST A;  1YW8 A;  1H0M A;  2CFX A;  2COM A;  3PFI A;  3QP5 A;  4FX4 A;  1UHW A;  4LFU A;  2VBZ A;  4G9Y A;  3PQK A;  1FNN A;  2JZY A;  2VXZ A;  2A3S A;  3RDI A;  2V6C A;  5ED4 A;  3CJN A;  1YFH A;  2F5E A;  2FNP A;  1RZ4 A;  2RGV A;  2W84 A;  4L0Z B;  1QBJ A;  3FWE A;  1ZYR F;  3EUH A;  1R22 A;  3RJP A;  1BI1 A;  4JK1 X;  5D4S A;  3F8C A;  2FRH A;  5D6F A;  3NRV A;  2P5V A;  4JQF A;  5K5O A;  4QLC U;  1Z05 A;  2OU2 A;  4XLP F;  2A07 F;  2XRN A;  2A5Y B;  2H27 A;  4HAM A;  5FFX A;  2VOO A;  1H9G A;  2X4H A;  3W6J B;  1HW1 A;  1LJ9 A;  3V8K A;  2GIV A;  3I4P A;  3QU3 A;  2G7H A;  3JAM K;  5H20 A;  3GZ6 A;  2MA3 A;  1JE8 A;  5HS9 A;  3F8B A;  1SFX A;  1O3S A;  1U8R A;  1L3L A;  2M30 A;  4G7H F;  2HTJ A;  1RIO H;  2XUB A;  3QOP A;  4KN4 X;  2MD5 A;  1BIA A;  2TDX A;  1U5T A;  4UV8 A;  2FBI A;  4MNU A;  4YIF A;  4O3M A;  1V3F A;  5E8I A;  5JVT A;  3OV8 A;  3WTY C;  1U3E M;  5CLS A;  1TBX A;  3E5U A;  1FX7 A;  3ABT A;  3TDZ C;  4CXF A;  1REP C;  2MH2 A;  5D5V B;  2XAS A;  4G7Z F;  1IRG A;  5LRR A;  5TJJ A;  4GYI A;  4L5J A;  3GWZ A;  4IRH A;  3KLN A;  2R7D A;  1IUY A;  2GA1 A;  1G3Y A;  3CDH A;  1T2K A;  1FC3 A;  5HVQ C;  3F8M A;  6PAX A;  2OZU A;  1XGN A;  2VC1 A;  3ZQ7 A;  2V1U A;  3JSP A;  4EGZ A;  1SFE A;  2BE5 F;  4ZYH A;  4ZYG A;  5HDG A;  2HKO A;  1YTY A;  3BJ6 A;  1KYZ A;  1HKS A;  2W24 A;  1J9I A;  1EH8 A;  3TOA A;  3LA2 A;  1T38 A;  1U6G A;  2GXG A;  2CW0 F;  3C1D A;  3MCZ A;  5HS8 A;  4KN7 X;  2GZW A;  1HSJ A;  5DCF A;  2JTV A;  1IXC A;  2F5C A;  2Z99 A;  2V1X A;  1SD6 A;  1D8K A;  4UUV A;  3IRQ A;  2P8T A;  2BYV E;  3QRF F;  3KP4 A;  4YG2 F;  1YW9 A;  3CUQ A;  2WV0 A;  2VON A;  1P4X A;  2DU9 A;  2FQ3 A;  1C0W A;  1IN6 A;  2ZO4 A;  2EFQ A;  2XV4 S;  1FZP B;  2P4W A;  5F64 A;  1V4R A;  3DPL C;  2OAZ A;  3K1N A;  2XRO A;  2YX7 A;  1IZ1 A;  2PEX A;  2MLG A;  1FP1 D;  3I53 A;  1P4W A;  4P96 A;  1HW2 A;  3WTZ A;  2DAO A;  3KFW X;  1U5T C;  1JXS A;  2F5F A;  1EV7 A;  2FU4 A;  3J80 Z;  1KYW A;  1P2F A;  1ON2 A;  3T5X A;  3I5U A;  4ZYE A;  4RAZ A;  4KYW A;  4BAY A;  4LLL A;  4EQQ A;  5DD4 A;  2E7W A;  1KU3 A;  4I0B A;  2D2W A;  5CVU A;  4ZZL A;  3FHZ A;  1UFM A;  4BHC A;  3G3Z A;  3WTV C;  1PP8 F;  4BNC A;  4E70 A;  4PDK A;  1EH7 A;  1Z9C A;  1XGO A;  3MEX A;  2STT A;  4WXD A;  2DT5 A;  1BBY A;  1U2W A;  1BI0 A;  3K0L A;  1O3R A;  4NQW A;  4IJA A;  5CJ9 A;  1PP7 U;  2UXX A;  3QPH A;  1H9T A;  4AVP A;  4IPA A;  4GYG A;  5BQT A;  1FBU A;  3WOD F;  4DNC A;  3R4K A;  1U5T B;  4LB5 A;  2Z9O A;  1ODD A;  3L00 A;  3RKW A;  1ULY A;  3QPT A;  2VBY A;  5ILV A;  4KIC A;  3FM3 A;  1WQ2 A;  4G6Q A;  3CUQ B;  2CWE A;  3OOP A;  4ASN A;  1O3T A;  3WTT C;  1LQ1 A;  1XSX A;  3E3V A;  3MWM A;  2MH9 A;  3EDP A;  1D8J A;  5HLI A;  4Z2Y A;  1O3Q A;  1SMT A;  3ZN0 A;  1ZGJ A;  2EA2 A;  2P6S A;  1F5T A;  1QQI A;  3VOE A;  2HS5 A;  2CO5 A;  2GWR A;  1Z91 A;  5CVR A;  1SAX A;  3K9T A;  3WTS C;  1Q1H A;  2NYX A;  2CQK A;  2E7X A;  3HOS A;  3KP7 A;  2EFW A;  2EA4 A;  1I27 A;  3O6B B;  3BRO A;  4I98 B;  2K7L A;  3LWF A;  3HOT A;  5K5Q A;  3JTG A;  3TOB A;  5D6E A;  4YFN F;  3R0A A;  3L2C A;  3HTS B;  2QUF A;  1XDS A;  1Z6R A;  3JSO A;  3SZT A;  2L4M A;  5BPI A;  3U2R A;  3GFI A;  4M9S A;  2O61 A;  1DUX C;  4I0A A;  4H0E A;  2M1B A;  2PQ8 A;  5EEG A;  1XSV A;  3BP8 A;  4HV6 A;  1BI2 A;  5H6Q A;  3KP2 A;  5K5R A;  3MFK A;  1ZRD A;  1NHA A;  4EGY A;  3N4M A;  3WG9 A;  1GXP A;  4HX4 A;  2PFB A;  2KJB A;  4OIO F;  2NRA C;  2RDP A;  4CHU A;  1LVA A;  1ZLJ A;  4MEX F;  3CLO A;  2HQR A;  4FX0 A;  2JRT A;  1LEA A;  5A2Q Z;  1R58 A;  3VEP A;  1W7P D;  1XD7 A;  4M74 A;  3WE3 A;  3HSF A;  1YLF A;  1FSH A;  2A6H F;  2PI0 A;  2OQR A;  1G6N A;  2EB7 A;  3TGN A;  1F9N A;  3DEU A;  4BH9 A;  4EJV A;  2J5O A;  3KP6 A;  1OR7 A;  4RB3 C;  1G3T A;  3BWG A;  4RB2 C;  4HF2 A;  2ZJ2 A;  4CO8 A;  1DP7 P;  1S6L A;  2RN7 A;  3TO9 A;  5EEH A;  4ENN A;  2BEO A;  3F21 A;  3DXJ F;  4KDP A;  5IT3 A;  2FSW A;  1SD5 A;  3LAJ A;  1W5S A;  4ON0 A;  4LLN A;  1Z1D A;  1LDK B;  1KQ9 A;  4M9Z A;  2GXB A;  1R36 A;  2V9V A;  1OYI A;  3ABU A;  2PN6 A;  3FMR A;  4UHT A;  1G3W A;  3RIR A;  3TDU C;  1B4A A;  1RI7 A;  2GA2 A;  3ROU A;  2LKP A;  3F22 A;  5FB2 A;  4UVA A;  3DV8 A;  2ZKZ A;  4KMU X;  5DUI A;  1RUO A;  1O57 A;  3CO7 C;  1YW7 A;  4U88 A;  1I1G A;  4F7Z A;  4A0Y A;  4CYD A;  2UXN A;  2VOP A;  2ZNY A;  1GVJ A;  1ZH5 A;  3ZN1 A;  3SZP A;  2EV6 A;  4NB5 A;  4EV0 A;  1ZAO A;  1ZG5 A;  1XN7 A;  4ESB A;  3HHG A;  1CGP A;  1XMK A;  3K69 A;  1IW7 F;  3HRT A;  2L01 A;  1K78 B;  4KT5 C;  3GFM A;  4IXA A;  2KJC A;  5HOO A;  4OIQ F;  5KK1 A;  5IT9 Z;  3LQQ A;  4YFX F;  1U78 A;  1HKT A;  2QQ9 A;  4IRI A;  5BPD A;  1TNT A;  1T39 A;  1B59 A;  5LHH A;  2HEO A;  2WTE A;  2CG4 A;  5BMZ A;  1HW5 A;  2HDC A;  2CYY A;  3SHF A;  4Y15 A;  1DPU A;  1J5Y A;  3I0T A;  1IAW A;  5D4R A;  1GXQ A;  1W5T A;  4HDU A;  4GO1 A;  5LBQ A;  2DFI A;  2BV6 A;  2XAH A;  4WF2 A;  3C3W A;  1R1T A;  5DCM B;  2A61 A;  3ULQ B;  3ML6 A;  4EJT A;  2G7U A;  2ZFW A;  3E6D A;  3RPQ A;  1MKM A;  2V1D A;  1TW3 A;  2L3D A;  4KIB A;  3LAP A;  4KIF A;  4XRF A;  4U0Y A;  4A6D A;  2JSC A;  4HBL A;  3N97 A;  1MZB A;  1TQP A;  2O6G E;  2OQG A;  5J6X A;  1YO5 C;  3V8L A;  4IRG A;  1CF7 A;  4ETS A;  4PGH A;  4N9I A;  1P92 A;  2P7C B;  1KGS A;  1B6A A;  3MZY A;  1FSE A;  1IXR C;  2FOK A;  3HSR A;  4S04 A;  2WWY A;  3JAM Z;  1R1U A;  2DBB A;  1F1Z A;  3EYI A;  2IA1 A;  1HBX G;  3RTR A;  1MDM A;  2ESN A;  2E1N A;  2DQR A;  1E17 A;  1UST A;  4U0W A;  4RB0 A;  3RPU A;  2XKO A;  1K7A A;  4A6E A;  4JBA A;  4LK1 F;  4L18 B;  2NAZ A;  4WK8 F;  2RC4 A;  5FLX K;  4WX9 A;  2P7V B;  4BXU A;  1XCB A;  3TO6 A;  5DD8 A;  5DUK A;  4MTE A;  2MBF A;  1MGT A;  3IHU A;  2AS5 F;  2EFN A;  5AON A;  2HZT A;  2ZCW A;  1B9N A;  2QVO A;  4KNY A;  2GAU A;  3GUD A;  1FYL A;  4I2O A;  3WGH A;  3MQ0 A;  3LFK A;  4L9N A;  3FF5 A;  4LJZ F;  3S2W A;  2XAQ A;  4UV9 A;  2M8E A;  4FT8 A;  1MJB A;  2VOD A;  2HKX A;  3IC7 A;  5L3G A;  4O6J A;  2ACJ A;  3SQN A;  3ZMT A;  3BPV A;  2VC0 A;  3Q9S A;  3H92 A;  2D1V A;  3KEO A;  1OMI A;  1ON1 A;  4AIH A;  5CYV A;  1A04 A;  2H94 A;  2A69 F;  3M8E A;  3HTU A;  5DCM A;  2JT1 A;  1BOA A;  2Y75 A;  2YU3 A;  3DQV C;  3F3X A;  2HOE A;  3RKY A;  3WGI A;  4CGZ A;  4BHB A;  1TQI A;  1B9M A;  2XGX A;  1HXD A;  3HRM A;  4PZJ A;  5DDG A;  2EK5 A;  2A6E F;  3V7C A;  2FBH A;  1ZHF A;  2DTR A;  4OIP F;  1P4A A;  3F23 A;  4WXC A;  2EJR A;  1T6S A;  4B09 A;  2VE8 A;  3P9K A;  3I71 A;  2PMU A;  1JGS A;  2IJL A;  4IVN A;  2K4J A;  3KP5 A;  2Q0O A;  2K02 A;  4HLX A;  5ILS A;  3WTX C;  3V8J A;  2STW A;  4EM0 B;  1G3S A;  3KET A;  2YSR A;  3ZPL A;  1BI3 A;  1IN4 A;  2MC3 A;  1EH6 A;  2KIF A;  1OKR A;  1XGM A;  1XMA A;  1SD7 A;  2ZNZ A;  2QWW A;  3WU1 B;  3ZMU A;  2HYF A;  2VT2 A;  3R6S A;  2VE9 A;  1K78 A;  2EWN A;  4RS8 A;  4A0X A;  1S8N A;  4AD9 A;  2MLK A;  3IWZ A;  5AIP A;  2WC2 A;  4G8X A;  4GCV A;  5TRD A;  1J59 A;  4AIK A;  2P6T A;  2FEZ A;  5CVI A;  5K1Y A;  3IRR A;  3WTW C;  4B8X A;  1YYV A;  3T0Y A;  4M6Y A;  2IP2 A;  4IF4 A;  2QBY B;  3K2Z A;  2QZ8 A;  4WWC A;  4UVC A;  5E1X A;  5JI6 A;  3FX3 A;  4GXO A;  4ENJ A;  3FMQ A;  4O5V A;  4P55 A;  3M1E A;  2M5W A;  3RYP A;  2DPU A;  3COA C;  2XVC A;  4IHT A;  4MHG A;  3KE2 A;  1ZGA A;  4U0V A;  1KQ0 A;  5BS6 A;  3B02 A;  2Q8K A;  1PUE E;  5DEQ A;  3R0J A;  4D0P A;  5L3E A;  5LGU A;  4RGX A;  4Y13 A;  1R00 A;  1W4M A;  3TKY A;  3BZ6 A;  4P5O A;  4R8H A;  3ZP5 A;  2LNB A;  4HQE A;  2HFH A;  4G7O F;  3CO6 C;  3B73 A;  3E6B A;  5HDK A;  3TQN A;  4UVB A;  3M9A A;  2IA2 A;  2QM3 A;  3M8F A;  4L9T A;  3J80 K;  4CDG A;  2KRF A;  1K6O A;  1CF7 B;  2JPB A;  4OU0 A;  1Z6T A;  4FHT A;  1FPQ A;  4LK0 F;  1BC7 C;  4MEY F;  3RI4 A;  3Q5F A;  3DPT A;  4OMY A;  1FBS A;  2DW4 A;  5LLQ A;  3R61 A;  4EM1 A;  2LSO A;  3HUG A;  2ZME B;  3I59 B;  5E17 F;  2L54 A;  1LB2 A;  1OYW A;  2RNJ A;  5E1Z B;  4EJO A;  2K4B A;  1FOK A;  5AIQ A;  1RUN A;  3EET A;  4XSZ F;  1AWC A;  3F72 A;  4EMS A;  5D5U B;  3V4G A;  2V79 A;  1HKQ A;  2PLY A;  2VN2 A;  5FLX Z;  5E8G A;  4ZYD A;  4LLG F;  4P9F A;  1DDN A;  2LF7 A;  1O7L A;  3TO7 A;  2ESH A;  3L09 A;  1S7O A;  1ZG1 A;  1QGP A;  1ONV A;  4A12 A;  3ISP A;  2AXL A;  2X0L A;  4YFK F;  1TLH B;  2KKO A;  1UB9 A;  2ZBK A;  3P9C A;  4UNO A;  3FXQ A;  2IRF G;  3D0S A;  4L9V A;  2B0L A;  4ENM A;  2HQN A;  3H3Z A;  3L7W A;  2KIU A;  4HLY A;  1T0F A;  2JPC A;  2LDU A;  3KLO A;  1FP2 A;  1STZ A;  1TTY A;  3IKV A;  4A2U A;  4HYE A;  2H6B A;  1SMY F;  5D8L B;  4L9J A;  3REO A;  2IVM A;  5DYM A;  4AIJ A;  2G9W A;  1ZLK A;  3WU0 A;  3AAF A;  3SXY A;  3E97 A;  2NNY A;  2NS0 A;  2YR2 A;  1UHM A;  3CTA A;  1QZY A;  3LA7 A;  4HOB A;  1PDN C;  3SFZ A;  2FXA A;  4M71 A;  4EVI A;  3O3K A;  2XAJ A;  1Z7U A;  2Z3Y A;  5CVJ A;  2OZ6 A;  1BJA A;  3GF2 A;  4P9U A;  1IF1 A;  2FE3 A;  1P6R A;  5A2Q K;  5L3D A;  4LGW A;  5E1W A;  1AOY A;  4M9X A;  4BYY A;  2VBX A;  4WXH A;  4RAY A;  1UCR A;  2RV8 A;  3C7J A;  1T98 A;  4M72 A;  4HX7 A;  1WRJ A;  3QU6 A;  1S29 A;  2O8X A;  3GXO A;  3VFZ A;  5FO5 A;  5J8F A;  5KVR A;  1LDJ A;  1YG2 A;  1TNS A;  5ERI A;  4U7B A;  4KMF A;  1BIB A;  1E2X A;  3BJA A;  1D5V A;  3QP6 A;  2R3S A;  3GZ5 A;  1IRF A;  3MAJ A;  1GHC A;  2O03 A;  1OYY A;  2C6Y A;  3F6O A;  1YS6 A;  3M7G A;  5HDN A;  2XIG A;  3HIF A;  1ZN2 A;  3T1B A;  2QQB A;  3BY6 A;  4DQ2 A;  1YIO A;  3F8N A;  2ZXJ A;  4I7H A;  4U7D A;  1HQC A;  2PJP A;  4CIC A;  3MZH A;  1I1S A;  1QO0 D;  3I58 A;  3FZV A;  1XSD A;  1TQM A;  5LGN A;  4HA8 A;  3KZY A;  5D8K B;  4L0Y B;  1XB4 A;  2CGP A;  4R1H A;  1XGS A;  2M45 A;  4HW0 A;  5FFZ A;  3JTH A;  4L5I A;  2P5L C;  2PMH A;  3ERE D;  2DLL A;  5CVV A;  3U1D A;  1DPR A;  3HRS A;  1D3Y A;  2DQL A;  3IL2 A;  3F8F A;  3RYR A;  2GQQ A;  5FD5 A;  5LEK A;  5ICG A;  3ELK A;  2BGC A;  4Q48 A;  4XBF A;  1J75 A;  3EYY A;  3GX4 X;  4M73 A;  1MJ9 A;  2HTS A;  2UZK A;  2DI3 A;  5JFR A;  2H6C A;  2FML A;  1S7A A;  1KU9 A;  3I59 A;  3ZMS A;  5LEJ A;  2ADU A;  4I01 A;  4LG0 B;  3V7S A;  4I09 A;  5JR3 A;  4UXN A;  1YS7 A;  1R7J A;  3IWF A;  3GEZ A;  1MJA A;  4ENK A;  2EV5 A;  2DK8 A;  3D5L A;  1S3J A;  2IPQ X;  4A5N A;  1WSU A;  2FF4 A;  3BJO A;  1FT9 A;  3GLX A;  1ZG3 A;  1I6X A;  1Y0U A;  1F4K A;  1O7F A;  1USS A;  1ZRF A;  3CUQ C;  4RB1 A;  2OD5 A;  1KU2 A;  2RVC A;  2D45 A;  4I02 A;  1LDD A;  5IT9 K;  1IN8 A;  2FA5 A;  3DKW A;  5FD6 A;  3WE2 A;  1FBQ A;  4HV5 A;  4ZZD A;  5HLH A;  4PGG A;  1W7P B;  2HR3 A;  1YQA A;  1MDM B;  3C18 A;  5L3B A;  2QBY A;  2VBW A;  5J8C A;  2W57 A;  2IA0 A;  1HST A;  1R1V A;  1LNW A;  3KCC A;  2LF8 A;  4RGR A;  5DV5 A;  1K79 A;  3ZMD A;  4KUM A;  3FXU A;  4KA4 A;  4Q4Z F;  1G4D A;  2IT0 A;  1J2X A;  2ISY A;  3E6C C;  3J81 Z;  2NNN A;  2PG4 A;  4N9H A;  3NQO A;  3IKT A;  3R60 A;  4A5M A;  4K2E A;  2RQP A;  5ICC A;  4HF0 A;  3DF8 A;  3HYI A;  4ZH4 F;  4KIG A;  1JHH A;  4G94 A;  1ZRE A;  4EJW A;  4OMZ A;  4Q5S F;  3E6M A;  2YX4 A;  1ZAR A;  1IN5 A;  2ZME A;  2IW5 A;  3ZMV A;  3I64 A;  2K27 A;  2PBI A;  3GO5 A;  5F6F A;  3J81 K;  4GGG A;  2Z5U A;  1SFU A;  1R5G A;  4ESJ A;  2OA4 A;  2HWV A;  4HZF A;  2Q2E A;  1B1B A;  1I5Z A;  4G6D A;  3FMS A;  4TV7 A;  4A0Z A;  1QNT A;  2Y48 A;  3VOD A;  3LQR A;  3ZMZ A;  2KIM A;  1IXS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...