3VG7A

Structure of human lfabp at high resolution from s-sad
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
b'SSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, liver
publication title Utility of anion and cation combinations for phasing of protein structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3vg7A00
1FE3A 2LBVA 1SY3A 1ERXA 2R73A 3ELZA 4I3DA 3EYCA 2FTBA 2A0AA 4AYHA 4IMOA 2R74A 4YGZA 1DZKA 1S2PA 4XMCA 2POAA 4ZJ0A 1EPAA 4ZHHA 1CBIA 2AT5X 2AT0X 1O1VA 2OVDA 4A1HA 3BLGA 2FR3A 4YKOA 1KT7A 1SY0A 3FA6A 4IMNA 1AVGI 2HLVA 2XSTA 5F6ZA 4ARHA 5DPQA 2NP1A 2Q4NA 5H8TA 1U0XA 2RCTA 2JOZA 1SXWA 1BRPA 4Y0RA 5EEDA 2O62A 2GC9A 4ZR2A 5FFHA 2KT4B 4YCHA 4YFQA 3BX7A 1GT3A 4IB8A 4ORYA 1A3YA 5C0NA 3CBSA 4TQ2A 2OFRX 2L9CA 5LJEA 1MVGA 1HMRA 1LICA 2LB6A 4TJZA 4XMFA 2QO4A 5LJGA 3CBCA 2RCQA 4AZQA 3U9PC 2ANSA 3FMZA 1PMPA 1KT5A 1UREA 5IO5A 2OVEA 1B4MA 2IFBA 2QOSC 3I0AA 4LKTA 1YWAA 2PY1A 3L4RA 1ZNKA 2WWPA 3O22A 1QFTA 4EDEA 1UZ2X 2QO5A 2YG2A 3JSQA 2NNEA 3O2YA 1IIUA 1S44A 4AZPA 1ADLA 1AB0A 5F6BA 2G7BA 3P6DA 3JS1A 2CBSA 1BBPA 3EM0A 1CBRA 4ALOA 1KT4A 1N0SA 1TVQA 2RD7C 5D4AA 4XMDA 1FELA 1X8QA 3UEWA 5K06A 1QQSA 1VPRA 2Q39A 1NP1A 1BSQA 3PP6A 2NNDA 2MO5A 1EIIA 1X71A 1EXSA 3B2LA 2Q9SA 1KQXA 1GM6A 1O1UA 5LJBA 2WR6A 5HAEA 1JYJA 1LFOA 3TGCA 3D97A 5HWZA 1U17A 4QGWA 5LKEA 5EDCA 4AZRA 2G78A 4O9SA 4OS8A 4ZHCA 2A3FX 1GXAA 5F1EA 4KIIA 1GX8A 1KZWA 2FS7A 3DTQA 2R56A 4NNTA 2JU8A 3BU1A 4UU2A 3CQNA 4M7MA 1GT4A 2HNXA 5IO7A 2HMBA 3NADA 4YMYA 3RSWA 1BRQA 1IKEA 5D45A 2XKLA 3VG2A 1EIOA 4HPAA 4WBKA 1ICNA 1EW3A 2QO6A 1X8PA 4M6SA 1L6MA 4OS0A 5EPQA 1IKJA 1LPJA 3WJCA 4D6AA 2RA6A 1T68X 5HTDA 4BVMA 5D47A 4AZNA 3EBKA 3WVMA 4K19A 1MX7A 3HWEA 4EXZA 2W2BA 4NLIA 4QAEA 3FLLA 2AKQA 3FENA 4ZHFA 1MUPA 4GNYA 1DF3A 4MVIA 1H91A 1ML7A 1T0VA 2QM9A 4QGXA 4GNWA 3G7XA 3KFHA 3TGAA 5L8NA 4TKJA 5AQ6A 3NPOA 4YDAA 2FRSA 1BM5A 5EDBA 1P6PA 3KFFA 2Q2PA 4NYQA 3P6CA 1QY2A 3PH5A 3QKGA 1TOWA 5BVSA 4AW8A 3P6EA 4A8ZA 1GT5A 1IW2A 5LJKA 1YIVA 1BJ7A 1OEEA 4AZOA 3WJDA 4YFRA 1JZUA 1B0OA 2JN3A 4TKHA 4ZH9A 1ZNDA 3PEDA 5BVTA 1E06A 4A1YA 2WEXA 1TXLA 1BEBA 1CBSA 1NP4A 1QWDA 2WUTA 5LJCA 4WFUA 5B29A 1JJXA 3P6GA 4LKPA 3B2IA 4BQUA 4YCEA 3APXA 3OJYC 1I06A 1XKIA 1FEMA 1ICMA 5LJHA 2CM4A 2WSJA 2WQ9A 1KGLA 2G79A 2ACOA 3CR6A 4RUNA 1QY0A 1GKAB 1X8UA 4NLJA 1DC9A 3WJEA 5HCEC 4N7DA 4YBPA 2W2FA 4QYNA 3D95A 5JR8A 2LFOA 1SY2A 4EEJA 2CM9A 3STNA 1YUPA 5HCCC 1VYFA 3IA8A 3IFBA 2ALLX 2LKKA 5LKFA 4OS3A 3I17A 2AT6X 2AT3X 2GJ5A 1YP6A 3STMX 1E02A 1VYGA 3D96A 4NP1A 2CZTA 1KQWA 4EFGA 1XCAA 1BSOA 3FEKA 3NQ3A 1CBQA 1OPBA 3HK1A 3TZSA 1ZRYA 5EZ2A 1KOIA 3C78X 5F58A 4GETA 3U03A 4DQ3A 1JJJA 3HWFA 3FR5A 2OFMX 1QFVA 3SAOA 1FENA 1IFCA 3FA7A 4GE1A 1U18A 2HYSA 5B27A 2OVAA 1SY1A 5LJDA 2KTDA 1YWDA 4HPBA 3F8AA 4DQ4A 5H9AA 3O19A 4QZTA 2MM3A 4MVLA 2A2GA 2L5PA 3FEPA 1GX9A 4ZFXA 1PBOA 1B56A 3HWDA 1SA8A 3Q6LA 1E00A 2FLJA 2MJIA 5FENA 4TKBA 1ZNLA 1O8VA 5KICA 1KXOA 1OEJA 3ZQ3A 3CWKA 2HZQA 3AKMA 1YP7A 3KZAA 1A2DA 3C76X 5HZ8A 4YGGA 1HMTA 1IFBA 4BOEA 2DM5A 2P8GA 3F9DA 4Y0PA 2E4JA 3TGBA 4LZVA 2JU7A 1HN2A 1ALBA 4YH0A 4ORRA 1LKEA 5D48A 5CE4A 5F7GA 1DFVA 2EU7X 3ZUIA 3P6HA 4Y0SA 2A13A 4N7CA 3UEUA 2AT8X 2K62A 1ACDA 2X45A 5HBSA 4QZUA 3WXQA 4IAWA 1A57A 5HCDC 3NP1A 4OMWA 3NX2A 4Y0QA 3FELA 5HZ9A 3PPTA 1JYDA 1QABE 3ELXA 4XMEA 4ZHDA 4ZGUA 2AL0X 4HFOA 1RLBE 2WQAE 4CK4A 4XMGA 4GKCA 5H9LA 3K3LA 4OMXA 1G85A 3CQRA 4YGHA 1CJ5A 2BLGA 3GAQA 4UU3A 2FT9A 1BSYA 1LIBA 1NGLA 3FA8A 1BWYA 4YKMA 3S26A 3U0DA 3FW4A 4ZCBA 1HBPA 3EMMA 2Q2MA 1DZMA 4GH7A 5DG4A 1OEKA 1MX8A 1G5WA 1R0UA 1I4UA 2JU3A 3P6FA 3EBWA 1D2UA 4ORUA 3UEXA 4QGVA 3FR4A 1YWBA 5H9KA 2L68A 1EQDA 1LNMA 3APWA 3VG3A 4ORXA 1G7NA 5D8JA 3KFIA 1HQPA 1DZJA 1S7DA 4IB9A 5IO6A 1X8NA 3VG5A 1TOUA 5L8OA 4LZUA 5FAZA 2GTFX 1LIDA 3BU9A 3MBTA 2AH7X 1KZXA 1KT3A 1G74A 3TF6A 1B8EA 4I9SA 1AQBA 2AMMX 1LF7A 3BDRA 4QYPA 3STKA 4GRJA 1E5PA 1EPBA 1ZNEA 2CZUA 1SXUA 3AKNA 3ZUOA 3PECA 3APVA 3WJBA 4TNNA 3KQ0A 1OBQA 4PSQA 1PEEA 2L67A 1I05A 3WJGA 4ODDA 4YBUA 3WJFA 1A18A 3BY0A 3PH6A 4MVKA 1HMSA 3FR2A 4ALBA 4ES7A 3C77X 2WEWA 1AELA 4I3CA 1ZNGA 2HZRA 1TW4A 5HTEA 1OPAA 3T1DA 1LIFA 3DSZA 3FIQA 3BS2A 1D3SA 3VG7A 3BRNA 2CBRA 1LIEA 2F73A 3KFGA 5EEEA 3RZYA 3VG6A 2LBAA 2ACPX 1JV4A 4R0BA 1ERBA 1MDCA 1SXXA 1Z24A 3UEVA 3FW5A 1EALA 5KHPA 1RBPA 2NNQA 1OBUA 4ZHGA 5HZ6A 1GKAA 1I04A 4I9RA 4HPCA 1X8OA 2W2AA 3FA9A 4IB7A 5HA1A 4IAXA 4XMHA 4NYRA 1OBPA 4A60A 1QG5A 3MVFA 2OZQA 3NQ9A 1T8VA 2N93A 1KT6A 2ASNX 1DV9A 2RQ0A 1EUOA 4IBAA 1FTPA 3B2KA 4YFPA 5KIDA 1PM1X 5HZQA 3B2JA 4NNSA 2FR2A 3NR3A 4ORWA 4IB6A 3CMPA 5BVQA 4ORSA 1HBQA 4ZH6A 4D6BA 1ZNHA 1X89A 4TLJA 5H9NA 3WBGA 3BX8A 3APUA 3NX1A 2X46A 4WFVA 5HA0A 2FS6A 4HPDA 1DZPA 1GT1A 3BSZE 3B2HA 1GGLA 2FWVA 1SXYA 3HWGA 2K23A 1YWCA 5HZ5A 4AZMA 1QY1A 4YDBA 3VG4A 2A2UA 1JBHA 1CRBA 1FDQA 4RUUA 4I3BA 1BLRA 5L8IA
chains in the Genus database with same CATH superfamily
5IRAA 1FE3A 1SWLA 2DJGA 4OELA 1SY3A 2LBVA 2FKJA 1ERXA 2R73A 3ZZVA 1JJUA 3ELZA 4LQZA 4I3DA 3EYCA 5JD2A 2OY7A 2BS6A 2A5CA 2FTBA 2A0AA 4AYHA 4IMOA 2R74A 5K68A 3D9WA 4YGZA 4U8UM 1DZKA 1S2PA 1SRGA 2MF6A 2X8SA 1NC9A 2POAA 4XMCA 4ZJ0A 1DF8A 1EPAA 3X00A 4ZHHA 1CBIA 2AT5X 2AT0X 1O1VA 2OVDA 4A1HA 1N9MA 2BS5A 3PDFA 3BLGA 4JNJA 2FR3A 2GTLN 2IZDB 1SMPI 1KT7A 1SY0A 2Y3EA 3FA6A 4IMNA 1AVGI 2HLVA 2XSTA 4YKOA 5F6ZA 4ARHA 5DPQA 2MHDA 2NP1A 4CDEA 2Q4NA 5H8TA 1U0XA 4I6SA 1STSB 2RCTA 2JOZA 2X55A 1SWUA 1SXWA 2IZCB 1I9HA 1VWAB 2OF9A 2OFBA 1SWRA 4KCAA 4L3RA 3ZW0A 1BRPA 4Y0RA 5EEDA 2O62A 2GC9A 2RTOB 4ZR2A 5FFHA 2KT4B 1K3BA 4O4SA 4YCHA 4YFQA 3BX7A 1Y55X 1AVDA 3P24A 1GT3A 4IB8A 4I60A 1SWQA 1WUBA 3RDUA 4ORYA 5FQ6E 2FHNX 1A3YA 4B55A 5C0NA 3CBSA 3SOTA 4TQ2A 2OFRX 2L9CA 5LJEA 1MVGA 1HMRA 1LICA 2LB6A 2OF8A 4TJZA 2FKGA 4COTA 1KL5A 4XMFA 2QO4A 5LJGA 4MVEA 3WZQA 1Y0GA 3CBCA 5B3MO 2RCQA 4AZQA 3U9PC 2ANSA 3FMZA 1PMPA 1KT5A 1UREA 5IO5A 2IZIA 2OVEA 4GUZA 1MK5A 1B4MA 2IFBA 2QOSC 3I0AA 3PQUA 1YWAA 2KW1A 2PY1A 1ZNKA 2WWPA 3L4RA 3O22A 1RXJA 1QFTA 4EDEA 1UZ2X 2OFAA 4BX6A 2QO5A 2YG2A 3JSQA 3RKGA 2CAMA 2NNEA 3O2YA 1IIUA 1S44A 1W5RA 2A8GA 4AZPA 1ADLA 2QMIA 3RDMA 1AB0A 1SLFB 2G7BA 5F6BA 3P6DA 3JS1A 2CBSA 1LCWA 1BBPA 3EM0A 1CBRA 1VWBB 4ALOA 1KT4A 1N0SA 1TVQA 2RD7C 5D4AA 4XMDA 3ZWEA 4CDDA 2RTEB 1KL4A 1FELA 1X8QA 1LDOA 3RE6A 3UEWA 4CPEA 1LUQA 5K06A 1QQSA 1VPRA 2X8TA 5K67A 2Q39A 1NP1A 1EIOA 1BSQA 3PP6A 2NNDA 2MO5A 2GTLO 1EIIA 3LHNA 1X71A 1EXSA 5FQ8E 3CKFA 3B2LA 1KQXA 1GM6A 1O1UA 2Q9SA 5LJBA 2WR6A 2YMSA 1RSTB 1UYOX 5HAEA 1JYJA 1LFOA 4WHIA 3TGCA 3D97A 3T2XA 5HWZA 1U17A 4QGWA 5LKEA 4DCBA 2AF5A 4GJSA 5EDCA 1KFFA 4U3QA 4AZRA 2G78A 4O9SA 4OS8A 5CHKA 4ZHCA 4KT5A 2A3FX 1GXAA 3FDCA 1SREA 5F1EA 4KIIA 1GX8A 1KZWA 2FS7A 3DTQA 4GGTA 3WYPA 2R56A 4NNTA 2X32A 2JU8A 3BU1A 4UU2A 3CQNA 2VDFA 4M7MA 2IZJA 1GT4A 1RAVA 1SWSA 2HNXA 3EC5A 3NQKA 1VWQB 5IO7A 2HMBA 3NADA 3T2WA 4YMYA 2MWHA 3RSWA 2IZHB 1BRQA 1IKEA 4ID2A 4O4OA 5D45A 2XKLA 3VG2A 5B11O 2RTNB 4HPAA 4WBKA 1ICNA 1EW3A 4Z2OA 2QO6A 1X8PA 4M6SA 1L6MA 2Y32A 4OS0A 5EPQA 1IKJA 1LPJA 5AEOA 3WJCA 4D6AA 2RA6A 1T68X 5HTDA 4BVMA 5D47A 1VWFB 4AZNA 3EBKA 3WVMA 4K19A 1MX7A 3HWEA 4GDAA 4PJ2A 4U8UN 3VHIA 4EXZA 5HCCC 1LCZA 2W2BA 4NLIA 3FLLA 4QAEA 2AKQA 3FENA 4ZHFA 1HXZA 2GH7A 1MUPA 2RTIB 4GNYA 1DF3A 2OY1O 3RY1A 4MVIA 4CDCA 1H91A 2F01A 3RDOA 1ML7A 1T0VA 2QM9A 4QGXA 4GNWA 2UZ2A 3G7XA 1SLEB 3KFHA 3TGAA 5L8NA 4TKJA 5AQ6A 3EW2A 3NPOA 4YDAA 2FRSA 2RTPB 1BM5A 5EDBA 1P6PA 3KFFA 2LA7A 1Y9TA 2Q2PA 1VWLB 3P6CA 4NYQA 4BGFA 1QY2A 3PH5A 1WBIA 3QKGA 4CPIA 1TOWA 5BVSA 4AW8A 1GX3A 3P6EA 3SZIA 3RWXA 1GT5A 1IW2A 4A8ZA 5LJKA 1YIVA 1BJ7A 1OEEA 2RTKA 3WJDA 4AZOA 1VWNB 3RBYA 3OE3A 4YFRA 5AJBA 1JZUA 4MISA 4GJVA 2JW1A 1B0OA 2JN3A 4TKHA 4ZH9A 1ZNDA 3PEDA 5BVTA 1E06A 1SLGB 1VWEB 1Y9LA 4A1YA 2WEXA 3ZW1B 1TXLA 1BEBA 1CBSA 1NP4A 1QWDA 2WUTA 1VWHB 3F6ZB 2BHVA 4IABA 4WFUA 5B29A 3P6GA 5LJCA 1JJXA 4Z2VA 4LKPA 3B2IA 1VWKB 3ZW2A 4GK9A 4BQUA 5IRWA 3LTWA 4YCEA 2QCBA 3APXA 3OJYC 4QRLA 5AJCA 1I06A 1XKIA 4BX5B 2KTSA 3H3IA 4BX7B 1VYOA 1FEMA 1ICMA 5LJHA 2CM4A 2WSJA 2IZGB 2RTAA 2WQ9A 1KGLA 3MX7A 4HWMA 2G79A 2ACOA 3CR6A 1UYNX 3D4RA 4QNIA 4RUNA 1QY0A 1GKAB 1SWDA 1X8UA 2QOMA 2X4MA 1DC9A 4GDZA 4NLJA 5HCEC 4N7DA 3WJEA 4YBPA 2X34A 2W2FA 4QYNA 3D95A 1Y53X 5JR8A 3E3CA 2LFOA 1SY2A 3LV4A 1RSUB 2CM9A 2RTMA 1YUPA 3P02A 4U8UO 1N7YA 3STNA 4EEJA 1VYFA 3IA8A 3IFBA 1SWFA 1SRFA 2ALLX 2LKKA 4OS3A 5LKFA 3I17A 3UAQA 4FGIB 2AT6X 2AT3X 2GJ5A 1YP6A 3MM0A 3STMX 1E02A 1VYGA 2AVIA 2GTLM 2IZAA 3D96A 4NP1A 2CZTA 1KQWA 4QQ1A 1W4TA 1XCAA 1BSOA 2C1QA 4EFGA 5BYPA 3FEKA 1VWIB 3NQ3A 5CYBA 1CBQA 1OPBA 3HK1A 3TZSA 1ZRYA 5EZ2A 1KOIA 3C78X 3HOEA 4GETA 5F58A 3U03A 4DQ3A 1VWOB 3HWFA 1JJJA 4NV7A 4Y59A 2RTGB 2OFMX 3FR5A 1QFVA 3SAOA 4O3WA 4O4XA 2C4IA 1FENA 1IFCA 3FA7A 4GE1A 2OL8O 1SWAA 1U18A 2HYSA 1SWNA 4Y5DA 5B27A 4EQAC 2OVAA 1SY1A 2WPUA 2KTDA 5LJDA 3WYQA 1YWDA 4HPBA 3F8AA 4DQ4A 5H9AA 3O19A 4QZTA 2MM3A 4MVLA 2A2GA 1W6FA 2L5PA 3AUMO 3FEPA 3ZW1A 4DNEA 4CV7A 1GX9A 4ZFXA 3RE5A 1PBOA 1B56A 3HWDA 1SA8A 4CPFA 2FGSA 2Y3FA 3Q6LA 2KD2A 1E00A 2FLJA 2MJIA 4FBVA 5FENA 4TKBA 1ZNLA 1O8VA 5L3YA 5KICA 1KXOA 1OEJA 4BX5A 3ZQ3A 3CWKA 2HZQA 1JQPA 3AKMA 3VE1A 4U9CA 1YP7A 3KZAA 1STRB 1A2DA 1LDQA 3C76X 5HZ8A 4O3ZA 2OYBO 3WZOA 3OD9A 4YGGA 1HMTA 1IFBA 4O4UA 4BOEA 2DM5A 1MM9A 2P8GA 3F9DA 2E4JA 4Y0PA 5B2AO 3RY2A 3TGBA 4LZVA 2JU7A 3SLTA 1HN2A 1ALBA 3PK2A 4YH0A 1N9YA 4I95A 4ORRA 1LKEA 4FQBB 5D48A 5CE4A 5F7GA 1SWTA 3FYFA 4Z6JA 3GE2A 1DFVA 2EU7X 4U46A 3S60A 4EKVA 3ZUIA 3P6HA 1VWCB 2ZAGA 3N91A 4Y0SA 3ZW0B 2A13A 4N7CA 1VWPB 2DJFA 3UEUA 2AT8X 2K62A 4CSBA 1ACDA 2G5LA 2X45A 5HBSA 4QZUA 3WXQA 4IAWA 1A57A 1PTSA 5HCDC 3NP1A 4OMWA 1MOYA 3NX2A 4Y0QA 2M4LA 3FELA 4ZGFA 2RTFB 4O49A 5HZ9A 4BBOA 4CPHB 5B5GA 3PPTA 1JYDA 2OVSA 1QABE 3PQSA 2ZAIA 3ELXA 4C5PA 4XMEA 1EI5A 1VWJB 4ZGUA 2AL0X 2OL7A 4ZHDA 4HFOA 5B10O 1RLBE 2WQAE 4CK4A 4XMGA 4GKCA 5H9LA 3KVNA 1SWPA 1IJ8A 2PI3O 3K3LA 4OMXA 3V8UA 4GZVA 1G85A 2OY8A 3CQRA 3FIDA 4YGHA 2BLGA 3GAQA 3HOLA 4UU3A 2IZKA 1KL3A 1BSYA 2FT9A 1CJ5A 1LIBA 1NGLA 4FBOA 4BX6B 3FA8A 2OY5O 1BWYA 4YKMA 3S26A 4BCSA 1SRIA 3U0DA 3FW4A 1RXKA 1HBPA 4ZCBA 3HTYA 3EMMA 2Q2MA 1DZMA 1HQQA 4GH7A 3SZJA 2I5VO 1OEKA 5DG4A 1MX8A 1NBXA 1STPA 4NW4A 1PBYA 3SLJA 1G5WA 4GD9A 1R0UA 1I4UA 1SWCA 5IXGA 2JU3A 2ZSCA 3P6FA 3EBWA 1D2UA 4Z28A 2BC3A 4ORUA 3UEXA 4QGVA 3FR4A 1YWBA 5H9KA 2FHLA 2UYWA 3SLOA 1NQNA 1OSPO 4CDFA 2L68A 1EQDA 2X56A 1LNMA 3VU1A 3APWA 3VG3A 4NV8A 4ORXA 3HPEA 1G7NA 1SLDB 2RTDB 3AEHA 3KFIA 1HQPA 5D8JA 1DZJA 1S7DA 1LELA 3NBXX 4IB9A 5IO6A 1X8NA 3VG5A 1TOUA 5L8OA 3EW1A 4LZUA 5FAZA 2GTFX 3S5VA 4JO6A 1LIDA 3BU9A 3MBTA 1RXHA 2AH7X 1JIWI 3T6LA 1KZXA 1KT3A 4KH8A 2JMBA 1G74A 3WOVA 5F2BA 4OEMA 3TF6A 1B8EA 4I9SA 1AQBA 3CKGA 1VWRB 2AMMX 1K24A 1LF7A 3BDRA 1SWHA 1AVEA 5FQ7E 3RDSA 1SRJA 4QYPA 3STKA 4GRJA 2RTJA 1E5PA 3WZPA 4CPHA 1EPBA 1ZNEA 1SWGA 2CZUA 1SXUA 3AKNA 3VGWA 3PECA 3ZUOA 3APVA 3WJBA 4TNNA 2RTHB 5B5FA 2IZFB 3T6FA 3KQ0A 1OBQA 4PSQA 1PEEA 2L67A 1I05A 3WJGA 4ODDA 4YBUA 3WJFA 1A18A 4BJ8A 1LCVA 2RTBB 3BY0A 1SWBA 3PH6A 1HMSA 3FR2A 4MVKA 4ALBA 4Z2PA 4O3XB 3VE2A 4ES7A 1N4JA 5CSEA 3C77X 2WEWA 1AELA 2C1SA 2OL6O 4I3CA 4INNA 1ZNGA 2HZRA 1TW4A 2RTLA 4MIRA 1OPAA 5HTEA 3T1DA 1LIFA 3DSZA 3FIQA 3BS2A 1D3SA 1SRHA 2RTQB 3VG7A 2JGSA 3BRNA 3VHMA 3SZHA 2CBRA 1LIEA 3VHHA 1Y52X 2F73A 3KFGA 5EEEA 3RZYA 3VG6A 2LBAA 2ACPX 1VWMB 1JV4A 4R0BA 1ERBA 1MDCA 1SXXA 3Q34A 1Z24A 2F09A 2Z4IA 3FW5A 3OBLA 4JGLA 4MEEA 4ON1A 3UEVA 4BX7A 1RBPA 4YVBA 5KHPA 1EALA 2NNQA 1OBUA 4ZHGA 4GGRA 5HZ6A 2A5BA 1GKAA 1I04A 4I9RA 1E2TA 4HPCA 1X8OA 2W2AA 3FA9A 4IB7A 5HA1A 4IAXA 2BT9A 4NYRA 2I5ZO 4XMHA 4FBRA 1OBPA 2VFBA 1JMXA 2X8FA 2RTRB 4A60A 1QG5A 3S5XA 2RN4A 3MVFA 1HY2A 1MEPA 2OZQA 3NQ9A 1SWJA 1T8VA 2N93A 1KT6A 2ASNX 4GGZA 1DV9A 2RQ0A 1EUOA 1VWGB 2G8CO 1JMZA 4IBAA 3VPJE 2IZBA 1FTPA 3B2KA 2IZLB 4YFPA 5KIDA 1PM1X 4OKAA 3JQOA 3B2JA 4NNSA 5HZQA 2FR2A 2HKDA 1HXLA 2RTCB 3NR3A 1FJ1E 4LKTA 1SWOA 4IB6A 1SWEA 4L1NA 3CMPA 4ORWA 5BVQA 3RDQA 4Z27A 4ORSA 1HBQA 4ZH6A 4D6BA 1I78A 1ZNHA 1X89A 4IRWA 4TLJA 4KC7A 5H9NA 1VWDB 3BX8A 3QQ2A 3WBGA 3WZNA 4KC8A 1NDJA 3APUA 3NX1A 4JHQA 2X46A 4ML7B 2VFCA 3MG5A 1SWKA 4WFVA 2Z4HA 5HA0A 2FS6A 4HPDA 1DZPA 1GT1A 4O3YA 3BSZE 3B2HA 1GGLA 2FWVA 2BSZA 1SXYA 3HWGA 2K23A 1YWCA 2IZEB 5HZ5A 4AZMA 1QY1A 1N43A 4YDBA 3VG4A 1NQMA 3RDXA 5IRUA 2A2UA 1JBHA 1CRBA 4GU8A 1FDQA 4RUUA 3ZI8A 4I3BA 1BLRA 5L8IA
chains in the Genus database with same CATH topology
1FE3A 2LBVA 1SY3A 1ERXA 2R73A 3ZZVA 3ELZA 4LQZA 4I3DA 3EYCA 2BS6A 2FTBA 2A0AA 4AYHA 4IMOA 2R74A 4YGZA 4U8UM 1DZKA 1S2PA 2X8SA 4XMCA 2POAA 4ZJ0A 1EPAA 4ZHHA 1CBIA 2AT5X 2AT0X 1O1VA 2OVDA 4A1HA 2BS5A 3BLGA 2FR3A 2GTLN 1SMPI 1KT7A 1SY0A 3FA6A 4IMNA 4YKOA 1AVGI 2HLVA 2XSTA 5F6ZA 4ARHA 5DPQA 2MHDA 2NP1A 2Q4NA 5H8TA 1U0XA 4I6SA 2RCTA 2JOZA 1SXWA 4L3RA 3ZW0A 4KCAA 1BRPA 4Y0RA 5EEDA 2O62A 2GC9A 4ZR2A 5FFHA 2KT4B 4O4SA 4YCHA 4YFQA 3BX7A 3P24A 1GT3A 4IB8A 4ORYA 5FQ6E 1A3YA 5C0NA 3CBSA 3SOTA 4TQ2A 2OFRX 2L9CA 5LJEA 1MVGA 1HMRA 1LICA 2LB6A 4TJZA 4COTA 4XMFA 2QO4A 5LJGA 4MVEA 3CBCA 2RCQA 4AZQA 3U9PC 2ANSA 3FMZA 1PMPA 1KT5A 1UREA 5IO5A 2OVEA 1B4MA 2IFBA 2QOSC 3I0AA 3PQUA 1YWAA 2KW1A 2PY1A 1ZNKA 2WWPA 3L4RA 3O22A 4LKTA 1QFTA 4EDEA 1UZ2X 2QO5A 2YG2A 3JSQA 3RKGA 2NNEA 3O2YA 1IIUA 1S44A 4AZPA 1ADLA 2QMIA 1AB0A 5F6BA 2G7BA 3P6DA 3JS1A 2CBSA 1BBPA 3EM0A 1CBRA 4ALOA 1KT4A 1N0SA 1TVQA 2RD7C 5D4AA 4XMDA 3ZWEA 1FELA 1X8QA 3UEWA 5K06A 1QQSA 1VPRA 2X8TA 2Q39A 1NP1A 1BSQA 3PP6A 2NNDA 2MO5A 2GTLO 1EIIA 3LHNA 1X71A 1EXSA 5FQ8E 3B2LA 1KQXA 1GM6A 1O1UA 2Q9SA 5LJBA 2WR6A 2YMSA 5HAEA 1JYJA 1LFOA 4WHIA 3TGCA 3D97A 5HWZA 1U17A 4QGWA 5LKEA 5EDCA 4U3QA 4AZRA 2G78A 4O9SA 4OS8A 4ZHCA 4KT5A 2A3FX 1GXAA 5F1EA 4KIIA 1GX8A 1KZWA 2FS7A 3DTQA 2R56A 4NNTA 2JU8A 3BU1A 4UU2A 3CQNA 4M7MA 1GT4A 2HNXA 3NQKA 5IO7A 2HMBA 3NADA 4YMYA 2MWHA 3RSWA 1BRQA 1IKEA 4ID2A 4O4OA 5D45A 2XKLA 3VG2A 1EIOA 4HPAA 4WBKA 1ICNA 1EW3A 2QO6A 1X8PA 4M6SA 1L6MA 4OS0A 5EPQA 5AEOA 1IKJA 1LPJA 3WJCA 4D6AA 2RA6A 1T68X 5HTDA 4BVMA 5D47A 4AZNA 3EBKA 3WVMA 4K19A 1MX7A 3HWEA 4PJ2A 4U8UN 4EXZA 2W2BA 4NLIA 4QAEA 3FLLA 2AKQA 3FENA 4ZHFA 1MUPA 4GNYA 1DF3A 4MVIA 1H91A 1ML7A 1T0VA 2QM9A 4QGXA 4GNWA 3G7XA 3KFHA 3TGAA 5L8NA 4TKJA 5AQ6A 3NPOA 4YDAA 2FRSA 1BM5A 5EDBA 1P6PA 3KFFA 2LA7A 1Y9TA 2Q2PA 4NYQA 3P6CA 1QY2A 3PH5A 3QKGA 1TOWA 5BVSA 4AW8A 3P6EA 3RWXA 1GT5A 1IW2A 4A8ZA 5LJKA 1YIVA 1BJ7A 1OEEA 4AZOA 3WJDA 4YFRA 3RBYA 3OE3A 5AJBA 1JZUA 4MISA 2JW1A 1B0OA 2JN3A 4TKHA 4ZH9A 1ZNDA 3PEDA 5BVTA 1E06A 1Y9LA 4A1YA 2WEXA 3ZW1B 1TXLA 1BEBA 1CBSA 1NP4A 1QWDA 2WUTA 3F6ZB 4IABA 2BHVA 4WFUA 5B29A 5LJCA 3P6GA 1JJXA 4LKPA 3B2IA 3ZW2A 4GK9A 4BQUA 4YCEA 3APXA 3OJYC 4QRLA 5AJCA 1I06A 1XKIA 2KTSA 3H3IA 1FEMA 1ICMA 5LJHA 2CM4A 2WSJA 2WQ9A 1KGLA 3MX7A 4HWMA 2G79A 2ACOA 3CR6A 3D4RA 4QNIA 4RUNA 1QY0A 1GKAB 1X8UA 4GDZA 4NLJA 1DC9A 3WJEA 5HCEC 4N7DA 4YBPA 2W2FA 4QYNA 3D95A 5JR8A 3E3CA 2LFOA 1SY2A 3LV4A 4EEJA 2CM9A 3P02A 1YUPA 4U8UO 3STNA 5HCCC 1VYFA 3IA8A 3IFBA 2ALLX 2LKKA 5LKFA 4OS3A 3I17A 3UAQA 4FGIB 2AT6X 2AT3X 2GJ5A 1YP6A 3STMX 1E02A 1VYGA 3D96A 2GTLM 4NP1A 2CZTA 1KQWA 4QQ1A 1XCAA 4EFGA 1BSOA 5BYPA 3FEKA 3NQ3A 5CYBA 1CBQA 1OPBA 3HK1A 3TZSA 1ZRYA 5EZ2A 1KOIA 3C78X 3HOEA 4GETA 5F58A 3U03A 4DQ3A 1JJJA 3HWFA 3FR5A 2OFMX 1QFVA 3SAOA 4O3WA 4O4XA 1FENA 1IFCA 3FA7A 4GE1A 1U18A 2HYSA 4EQAC 5B27A 2OVAA 1SY1A 5LJDA 2KTDA 1YWDA 4HPBA 3F8AA 4DQ4A 5H9AA 3O19A 4QZTA 2MM3A 4MVLA 2A2GA 2L5PA 3FEPA 3ZW1A 1GX9A 4ZFXA 1PBOA 1B56A 3HWDA 1SA8A 3Q6LA 2KD2A 1E00A 2FLJA 2MJIA 4FBVA 5FENA 4TKBA 1ZNLA 1O8VA 5KICA 1KXOA 1OEJA 3ZQ3A 3CWKA 2HZQA 3AKMA 3VE1A 4U9CA 1YP7A 3KZAA 1A2DA 3C76X 5HZ8A 4O3ZA 3OD9A 4YGGA 1HMTA 1IFBA 4O4UA 4BOEA 2DM5A 2P8GA 3F9DA 4Y0PA 2E4JA 3TGBA 4LZVA 2JU7A 1HN2A 1ALBA 4YH0A 4I95A 4ORRA 1LKEA 4FQBB 5D48A 5CE4A 5F7GA 3FYFA 3GE2A 1DFVA 2EU7X 3S60A 3ZUIA 3P6HA 2ZAGA 3N91A 4Y0SA 3ZW0B 2A13A 4N7CA 3UEUA 2AT8X 2K62A 4CSBA 1ACDA 2X45A 5HBSA 4QZUA 3WXQA 4IAWA 1A57A 5HCDC 3NP1A 4OMWA 4ZGFA 3NX2A 4Y0QA 2M4LA 3FELA 4O49A 5HZ9A 3PPTA 1JYDA 2OVSA 1QABE 3PQSA 2ZAIA 3ELXA 4XMEA 1EI5A 4ZGUA 4ZHDA 2AL0X 4HFOA 1RLBE 2WQAE 4CK4A 4XMGA 4GKCA 5H9LA 3K3LA 4OMXA 3V8UA 4GZVA 1G85A 3CQRA 4YGHA 1CJ5A 2BLGA 3GAQA 3HOLA 4UU3A 2FT9A 1BSYA 1LIBA 1NGLA 4FBOA 3FA8A 1BWYA 4YKMA 3S26A 3U0DA 3FW4A 4ZCBA 1HBPA 3HTYA 3EMMA 2Q2MA 1DZMA 4GH7A 5DG4A 1OEKA 1MX8A 4NW4A 1G5WA 1R0UA 1I4UA 2JU3A 3P6FA 3EBWA 1D2UA 4ORUA 3UEXA 4QGVA 3FR4A 1YWBA 5H9KA 2L68A 1EQDA 1LNMA 3VU1A 3APWA 3VG3A 4ORXA 1G7NA 5D8JA 3KFIA 1HQPA 1DZJA 1S7DA 3NBXX 4IB9A 5IO6A 1X8NA 3VG5A 1TOUA 5L8OA 4LZUA 5FAZA 2GTFX 3S5VA 1LIDA 3BU9A 3MBTA 2AH7X 1JIWI 1KZXA 1KT3A 4KH8A 2JMBA 1G74A 3WOVA 3TF6A 1B8EA 4I9SA 1AQBA 2AMMX 1LF7A 3BDRA 5FQ7E 4QYPA 3STKA 4GRJA 1E5PA 1EPBA 1ZNEA 2CZUA 1SXUA 3AKNA 3ZUOA 3PECA 4CV7A 3APVA 3WJBA 4TNNA 3KQ0A 1OBQA 4PSQA 1PEEA 2L67A 1I05A 3WJGA 4ODDA 4YBUA 3WJFA 1A18A 3BY0A 3PH6A 4MVKA 1HMSA 3FR2A 4ALBA 4O3XB 3VE2A 4ES7A 3C77X 2WEWA 1AELA 4I3CA 4INNA 1ZNGA 2HZRA 1TW4A 4MIRA 5HTEA 1OPAA 3T1DA 1LIFA 3DSZA 3FIQA 3BS2A 1D3SA 3VG7A 3BRNA 2CBRA 1LIEA 2F73A 3KFGA 5EEEA 3RZYA 3VG6A 2LBAA 2ACPX 1JV4A 4R0BA 1ERBA 1MDCA 1SXXA 1Z24A 2F09A 2Z4IA 3FW5A 3OBLA 4JGLA 4ON1A 3UEVA 5KHPA 1EALA 1RBPA 2NNQA 1OBUA 4ZHGA 5HZ6A 1GKAA 1I04A 4I9RA 4HPCA 1X8OA 2W2AA 3FA9A 4IB7A 5HA1A 4IAXA 2BT9A 4NYRA 4XMHA 4FBRA 1OBPA 2X8FA 4A60A 1QG5A 3S5XA 2RN4A 3MVFA 2OZQA 3NQ9A 1T8VA 2N93A 1KT6A 2ASNX 1DV9A 2RQ0A 1EUOA 4IBAA 3VPJE 1FTPA 3B2KA 4YFPA 5KIDA 1PM1X 5HZQA 3JQOA 3B2JA 4NNSA 2FR2A 3NR3A 4ORWA 4IB6A 4L1NA 3CMPA 5BVQA 4ORSA 1HBQA 4ZH6A 4D6BA 1ZNHA 1X89A 4TLJA 4KC7A 5H9NA 3WBGA 3BX8A 4KC8A 3APUA 3NX1A 2X46A 4ML7B 4WFVA 2Z4HA 5HA0A 2FS6A 4HPDA 1DZPA 1GT1A 4O3YA 3BSZE 3B2HA 1GGLA 2FWVA 1SXYA 3HWGA 2K23A 1YWCA 5HZ5A 4AZMA 1QY1A 4YDBA 3VG4A 2A2UA 1JBHA 1CRBA 4GU8A 1FDQA 4RUUA 3ZI8A 4I3BA 1BLRA 5L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FE3 A;  2LBV A;  1SY3 A;  1ERX A;  2R73 A;  3ELZ A;  4I3D A;  3EYC A;  2FTB A;  2A0A A;  4AYH A;  4IMO A;  2R74 A;  4YGZ A;  1DZK A;  1S2P A;  4XMC A;  2POA A;  4ZJ0 A;  1EPA A;  4ZHH A;  1CBI A;  2AT5 X;  2AT0 X;  1O1V A;  2OVD A;  4A1H A;  3BLG A;  2FR3 A;  4YKO A;  1KT7 A;  1SY0 A;  3FA6 A;  4IMN A;  1AVG I;  2HLV A;  2XST A;  5F6Z A;  4ARH A;  5DPQ A;  2NP1 A;  2Q4N A;  5H8T A;  1U0X A;  2RCT A;  2JOZ A;  1SXW A;  1BRP A;  4Y0R A;  5EED A;  2O62 A;  2GC9 A;  4ZR2 A;  5FFH A;  2KT4 B;  4YCH A;  4YFQ A;  3BX7 A;  1GT3 A;  4IB8 A;  4ORY A;  1A3Y A;  5C0N A;  3CBS A;  4TQ2 A;  2OFR X;  2L9C A;  5LJE A;  1MVG A;  1HMR A;  1LIC A;  2LB6 A;  4TJZ A;  4XMF A;  2QO4 A;  5LJG A;  3CBC A;  2RCQ A;  4AZQ A;  3U9P C;  2ANS A;  3FMZ A;  1PMP A;  1KT5 A;  1URE A;  5IO5 A;  2OVE A;  1B4M A;  2IFB A;  2QOS C;  3I0A A;  4LKT A;  1YWA A;  2PY1 A;  3L4R A;  1ZNK A;  2WWP A;  3O22 A;  1QFT A;  4EDE A;  1UZ2 X;  2QO5 A;  2YG2 A;  3JSQ A;  2NNE A;  3O2Y A;  1IIU A;  1S44 A;  4AZP A;  1ADL A;  1AB0 A;  5F6B A;  2G7B A;  3P6D A;  3JS1 A;  2CBS A;  1BBP A;  3EM0 A;  1CBR A;  4ALO A;  1KT4 A;  1N0S A;  1TVQ A;  2RD7 C;  5D4A A;  4XMD A;  1FEL A;  1X8Q A;  3UEW A;  5K06 A;  1QQS A;  1VPR A;  2Q39 A;  1NP1 A;  1BSQ A;  3PP6 A;  2NND A;  2MO5 A;  1EII A;  1X71 A;  1EXS A;  3B2L A;  2Q9S A;  1KQX A;  1GM6 A;  1O1U A;  5LJB A;  2WR6 A;  5HAE A;  1JYJ A;  1LFO A;  3TGC A;  3D97 A;  5HWZ A;  1U17 A;  4QGW A;  5LKE A;  5EDC A;  4AZR A;  2G78 A;  4O9S A;  4OS8 A;  4ZHC A;  2A3F X;  1GXA A;  5F1E A;  4KII A;  1GX8 A;  1KZW A;  2FS7 A;  3DTQ A;  2R56 A;  4NNT A;  2JU8 A;  3BU1 A;  4UU2 A;  3CQN A;  4M7M A;  1GT4 A;  2HNX A;  5IO7 A;  2HMB A;  3NAD A;  4YMY A;  3RSW A;  1BRQ A;  1IKE A;  5D45 A;  2XKL A;  3VG2 A;  1EIO A;  4HPA A;  4WBK A;  1ICN A;  1EW3 A;  2QO6 A;  1X8P A;  4M6S A;  1L6M A;  4OS0 A;  5EPQ A;  1IKJ A;  1LPJ A;  3WJC A;  4D6A A;  2RA6 A;  1T68 X;  5HTD A;  4BVM A;  5D47 A;  4AZN A;  3EBK A;  3WVM A;  4K19 A;  1MX7 A;  3HWE A;  4EXZ A;  2W2B A;  4NLI A;  4QAE A;  3FLL A;  2AKQ A;  3FEN A;  4ZHF A;  1MUP A;  4GNY A;  1DF3 A;  4MVI A;  1H91 A;  1ML7 A;  1T0V A;  2QM9 A;  4QGX A;  4GNW A;  3G7X A;  3KFH A;  3TGA A;  5L8N A;  4TKJ A;  5AQ6 A;  3NPO A;  4YDA A;  2FRS A;  1BM5 A;  5EDB A;  1P6P A;  3KFF A;  2Q2P A;  4NYQ A;  3P6C A;  1QY2 A;  3PH5 A;  3QKG A;  1TOW A;  5BVS A;  4AW8 A;  3P6E A;  4A8Z A;  1GT5 A;  1IW2 A;  5LJK A;  1YIV A;  1BJ7 A;  1OEE A;  4AZO A;  3WJD A;  4YFR A;  1JZU A;  1B0O A;  2JN3 A;  4TKH A;  4ZH9 A;  1ZND A;  3PED A;  5BVT A;  1E06 A;  4A1Y A;  2WEX A;  1TXL A;  1BEB A;  1CBS A;  1NP4 A;  1QWD A;  2WUT A;  5LJC A;  4WFU A;  5B29 A;  1JJX A;  3P6G A;  4LKP A;  3B2I A;  4BQU A;  4YCE A;  3APX A;  3OJY C;  1I06 A;  1XKI A;  1FEM A;  1ICM A;  5LJH A;  2CM4 A;  2WSJ A;  2WQ9 A;  1KGL A;  2G79 A;  2ACO A;  3CR6 A;  4RUN A;  1QY0 A;  1GKA B;  1X8U A;  4NLJ A;  1DC9 A;  3WJE A;  5HCE C;  4N7D A;  4YBP A;  2W2F A;  4QYN A;  3D95 A;  5JR8 A;  2LFO A;  1SY2 A;  4EEJ A;  2CM9 A;  3STN A;  1YUP A;  5HCC C;  1VYF A;  3IA8 A;  3IFB A;  2ALL X;  2LKK A;  5LKF A;  4OS3 A;  3I17 A;  2AT6 X;  2AT3 X;  2GJ5 A;  1YP6 A;  3STM X;  1E02 A;  1VYG A;  3D96 A;  4NP1 A;  2CZT A;  1KQW A;  4EFG A;  1XCA A;  1BSO A;  3FEK A;  3NQ3 A;  1CBQ A;  1OPB A;  3HK1 A;  3TZS A;  1ZRY A;  5EZ2 A;  1KOI A;  3C78 X;  5F58 A;  4GET A;  3U03 A;  4DQ3 A;  1JJJ A;  3HWF A;  3FR5 A;  2OFM X;  1QFV A;  3SAO A;  1FEN A;  1IFC A;  3FA7 A;  4GE1 A;  1U18 A;  2HYS A;  5B27 A;  2OVA A;  1SY1 A;  5LJD A;  2KTD A;  1YWD A;  4HPB A;  3F8A A;  4DQ4 A;  5H9A A;  3O19 A;  4QZT A;  2MM3 A;  4MVL A;  2A2G A;  2L5P A;  3FEP A;  1GX9 A;  4ZFX A;  1PBO A;  1B56 A;  3HWD A;  1SA8 A;  3Q6L A;  1E00 A;  2FLJ A;  2MJI A;  5FEN A;  4TKB A;  1ZNL A;  1O8V A;  5KIC A;  1KXO A;  1OEJ A;  3ZQ3 A;  3CWK A;  2HZQ A;  3AKM A;  1YP7 A;  3KZA A;  1A2D A;  3C76 X;  5HZ8 A;  4YGG A;  1HMT A;  1IFB A;  4BOE A;  2DM5 A;  2P8G A;  3F9D A;  4Y0P A;  2E4J A;  3TGB A;  4LZV A;  2JU7 A;  1HN2 A;  1ALB A;  4YH0 A;  4ORR A;  1LKE A;  5D48 A;  5CE4 A;  5F7G A;  1DFV A;  2EU7 X;  3ZUI A;  3P6H A;  4Y0S A;  2A13 A;  4N7C A;  3UEU A;  2AT8 X;  2K62 A;  1ACD A;  2X45 A;  5HBS A;  4QZU A;  3WXQ A;  4IAW A;  1A57 A;  5HCD C;  3NP1 A;  4OMW A;  3NX2 A;  4Y0Q A;  3FEL A;  5HZ9 A;  3PPT A;  1JYD A;  1QAB E;  3ELX A;  4XME A;  4ZHD A;  4ZGU A;  2AL0 X;  4HFO A;  1RLB E;  2WQA E;  4CK4 A;  4XMG A;  4GKC A;  5H9L A;  3K3L A;  4OMX A;  1G85 A;  3CQR A;  4YGH A;  1CJ5 A;  2BLG A;  3GAQ A;  4UU3 A;  2FT9 A;  1BSY A;  1LIB A;  1NGL A;  3FA8 A;  1BWY A;  4YKM A;  3S26 A;  3U0D A;  3FW4 A;  4ZCB A;  1HBP A;  3EMM A;  2Q2M A;  1DZM A;  4GH7 A;  5DG4 A;  1OEK A;  1MX8 A;  1G5W A;  1R0U A;  1I4U A;  2JU3 A;  3P6F A;  3EBW A;  1D2U A;  4ORU A;  3UEX A;  4QGV A;  3FR4 A;  1YWB A;  5H9K A;  2L68 A;  1EQD A;  1LNM A;  3APW A;  3VG3 A;  4ORX A;  1G7N A;  5D8J A;  3KFI A;  1HQP A;  1DZJ A;  1S7D A;  4IB9 A;  5IO6 A;  1X8N A;  3VG5 A;  1TOU A;  5L8O A;  4LZU A;  5FAZ A;  2GTF X;  1LID A;  3BU9 A;  3MBT A;  2AH7 X;  1KZX A;  1KT3 A;  1G74 A;  3TF6 A;  1B8E A;  4I9S A;  1AQB A;  2AMM X;  1LF7 A;  3BDR A;  4QYP A;  3STK A;  4GRJ A;  1E5P A;  1EPB A;  1ZNE A;  2CZU A;  1SXU A;  3AKN A;  3ZUO A;  3PEC A;  3APV A;  3WJB A;  4TNN A;  3KQ0 A;  1OBQ A;  4PSQ A;  1PEE A;  2L67 A;  1I05 A;  3WJG A;  4ODD A;  4YBU A;  3WJF A;  1A18 A;  3BY0 A;  3PH6 A;  4MVK A;  1HMS A;  3FR2 A;  4ALB A;  4ES7 A;  3C77 X;  2WEW A;  1AEL A;  4I3C A;  1ZNG A;  2HZR A;  1TW4 A;  5HTE A;  1OPA A;  3T1D A;  1LIF A;  3DSZ A;  3FIQ A;  3BS2 A;  1D3S A;  3VG7 A;  3BRN A;  2CBR A;  1LIE A;  2F73 A;  3KFG A;  5EEE A;  3RZY A;  3VG6 A;  2LBA A;  2ACP X;  1JV4 A;  4R0B A;  1ERB A;  1MDC A;  1SXX A;  1Z24 A;  3UEV A;  3FW5 A;  1EAL A;  5KHP A;  1RBP A;  2NNQ A;  1OBU A;  4ZHG A;  5HZ6 A;  1GKA A;  1I04 A;  4I9R A;  4HPC A;  1X8O A;  2W2A A;  3FA9 A;  4IB7 A;  5HA1 A;  4IAX A;  4XMH A;  4NYR A;  1OBP A;  4A60 A;  1QG5 A;  3MVF A;  2OZQ A;  3NQ9 A;  1T8V A;  2N93 A;  1KT6 A;  2ASN X;  1DV9 A;  2RQ0 A;  1EUO A;  4IBA A;  1FTP A;  3B2K A;  4YFP A;  5KID A;  1PM1 X;  5HZQ A;  3B2J A;  4NNS A;  2FR2 A;  3NR3 A;  4ORW A;  4IB6 A;  3CMP A;  5BVQ A;  4ORS A;  1HBQ A;  4ZH6 A;  4D6B A;  1ZNH A;  1X89 A;  4TLJ A;  5H9N A;  3WBG A;  3BX8 A;  3APU A;  3NX1 A;  2X46 A;  4WFV A;  5HA0 A;  2FS6 A;  4HPD A;  1DZP A;  1GT1 A;  3BSZ E;  3B2H A;  1GGL A;  2FWV A;  1SXY A;  3HWG A;  2K23 A;  1YWC A;  5HZ5 A;  4AZM A;  1QY1 A;  4YDB A;  3VG4 A;  2A2U A;  1JBH A;  1CRB A;  1FDQ A;  4RUU A;  4I3B A;  1BLR A;  5L8I A; 
#chains in the Genus database with same CATH topology
 5IRA A;  1FE3 A;  1SWL A;  2DJG A;  4OEL A;  1SY3 A;  2LBV A;  2FKJ A;  1ERX A;  2R73 A;  3ZZV A;  1JJU A;  3ELZ A;  4LQZ A;  4I3D A;  3EYC A;  5JD2 A;  2OY7 A;  2BS6 A;  2A5C A;  2FTB A;  2A0A A;  4AYH A;  4IMO A;  2R74 A;  5K68 A;  3D9W A;  4YGZ A;  4U8U M;  1DZK A;  1S2P A;  1SRG A;  2MF6 A;  2X8S A;  1NC9 A;  2POA A;  4XMC A;  4ZJ0 A;  1DF8 A;  1EPA A;  3X00 A;  4ZHH A;  1CBI A;  2AT5 X;  2AT0 X;  1O1V A;  2OVD A;  4A1H A;  1N9M A;  2BS5 A;  3PDF A;  3BLG A;  4JNJ A;  2FR3 A;  2GTL N;  2IZD B;  1SMP I;  1KT7 A;  1SY0 A;  2Y3E A;  3FA6 A;  4IMN A;  1AVG I;  2HLV A;  2XST A;  4YKO A;  5F6Z A;  4ARH A;  5DPQ A;  2MHD A;  2NP1 A;  4CDE A;  2Q4N A;  5H8T A;  1U0X A;  4I6S A;  1STS B;  2RCT A;  2JOZ A;  2X55 A;  1SWU A;  1SXW A;  2IZC B;  1I9H A;  1VWA B;  2OF9 A;  2OFB A;  1SWR A;  4KCA A;  4L3R A;  3ZW0 A;  1BRP A;  4Y0R A;  5EED A;  2O62 A;  2GC9 A;  2RTO B;  4ZR2 A;  5FFH A;  2KT4 B;  1K3B A;  4O4S A;  4YCH A;  4YFQ A;  3BX7 A;  1Y55 X;  1AVD A;  3P24 A;  1GT3 A;  4IB8 A;  4I60 A;  1SWQ A;  1WUB A;  3RDU A;  4ORY A;  5FQ6 E;  2FHN X;  1A3Y A;  4B55 A;  5C0N A;  3CBS A;  3SOT A;  4TQ2 A;  2OFR X;  2L9C A;  5LJE A;  1MVG A;  1HMR A;  1LIC A;  2LB6 A;  2OF8 A;  4TJZ A;  2FKG A;  4COT A;  1KL5 A;  4XMF A;  2QO4 A;  5LJG A;  4MVE A;  3WZQ A;  1Y0G A;  3CBC A;  5B3M O;  2RCQ A;  4AZQ A;  3U9P C;  2ANS A;  3FMZ A;  1PMP A;  1KT5 A;  1URE A;  5IO5 A;  2IZI A;  2OVE A;  4GUZ A;  1MK5 A;  1B4M A;  2IFB A;  2QOS C;  3I0A A;  3PQU A;  1YWA A;  2KW1 A;  2PY1 A;  1ZNK A;  2WWP A;  3L4R A;  3O22 A;  1RXJ A;  1QFT A;  4EDE A;  1UZ2 X;  2OFA A;  4BX6 A;  2QO5 A;  2YG2 A;  3JSQ A;  3RKG A;  2CAM A;  2NNE A;  3O2Y A;  1IIU A;  1S44 A;  1W5R A;  2A8G A;  4AZP A;  1ADL A;  2QMI A;  3RDM A;  1AB0 A;  1SLF B;  2G7B A;  5F6B A;  3P6D A;  3JS1 A;  2CBS A;  1LCW A;  1BBP A;  3EM0 A;  1CBR A;  1VWB B;  4ALO A;  1KT4 A;  1N0S A;  1TVQ A;  2RD7 C;  5D4A A;  4XMD A;  3ZWE A;  4CDD A;  2RTE B;  1KL4 A;  1FEL A;  1X8Q A;  1LDO A;  3RE6 A;  3UEW A;  4CPE A;  1LUQ A;  5K06 A;  1QQS A;  1VPR A;  2X8T A;  5K67 A;  2Q39 A;  1NP1 A;  1EIO A;  1BSQ A;  3PP6 A;  2NND A;  2MO5 A;  2GTL O;  1EII A;  3LHN A;  1X71 A;  1EXS A;  5FQ8 E;  3CKF A;  3B2L A;  1KQX A;  1GM6 A;  1O1U A;  2Q9S A;  5LJB A;  2WR6 A;  2YMS A;  1RST B;  1UYO X;  5HAE A;  1JYJ A;  1LFO A;  4WHI A;  3TGC A;  3D97 A;  3T2X A;  5HWZ A;  1U17 A;  4QGW A;  5LKE A;  4DCB A;  2AF5 A;  4GJS A;  5EDC A;  1KFF A;  4U3Q A;  4AZR A;  2G78 A;  4O9S A;  4OS8 A;  5CHK A;  4ZHC A;  4KT5 A;  2A3F X;  1GXA A;  3FDC A;  1SRE A;  5F1E A;  4KII A;  1GX8 A;  1KZW A;  2FS7 A;  3DTQ A;  4GGT A;  3WYP A;  2R56 A;  4NNT A;  2X32 A;  2JU8 A;  3BU1 A;  4UU2 A;  3CQN A;  2VDF A;  4M7M A;  2IZJ A;  1GT4 A;  1RAV A;  1SWS A;  2HNX A;  3EC5 A;  3NQK A;  1VWQ B;  5IO7 A;  2HMB A;  3NAD A;  3T2W A;  4YMY A;  2MWH A;  3RSW A;  2IZH B;  1BRQ A;  1IKE A;  4ID2 A;  4O4O A;  5D45 A;  2XKL A;  3VG2 A;  5B11 O;  2RTN B;  4HPA A;  4WBK A;  1ICN A;  1EW3 A;  4Z2O A;  2QO6 A;  1X8P A;  4M6S A;  1L6M A;  2Y32 A;  4OS0 A;  5EPQ A;  1IKJ A;  1LPJ A;  5AEO A;  3WJC A;  4D6A A;  2RA6 A;  1T68 X;  5HTD A;  4BVM A;  5D47 A;  1VWF B;  4AZN A;  3EBK A;  3WVM A;  4K19 A;  1MX7 A;  3HWE A;  4GDA A;  4PJ2 A;  4U8U N;  3VHI A;  4EXZ A;  5HCC C;  1LCZ A;  2W2B A;  4NLI A;  3FLL A;  4QAE A;  2AKQ A;  3FEN A;  4ZHF A;  1HXZ A;  2GH7 A;  1MUP A;  2RTI B;  4GNY A;  1DF3 A;  2OY1 O;  3RY1 A;  4MVI A;  4CDC A;  1H91 A;  2F01 A;  3RDO A;  1ML7 A;  1T0V A;  2QM9 A;  4QGX A;  4GNW A;  2UZ2 A;  3G7X A;  1SLE B;  3KFH A;  3TGA A;  5L8N A;  4TKJ A;  5AQ6 A;  3EW2 A;  3NPO A;  4YDA A;  2FRS A;  2RTP B;  1BM5 A;  5EDB A;  1P6P A;  3KFF A;  2LA7 A;  1Y9T A;  2Q2P A;  1VWL B;  3P6C A;  4NYQ A;  4BGF A;  1QY2 A;  3PH5 A;  1WBI A;  3QKG A;  4CPI A;  1TOW A;  5BVS A;  4AW8 A;  1GX3 A;  3P6E A;  3SZI A;  3RWX A;  1GT5 A;  1IW2 A;  4A8Z A;  5LJK A;  1YIV A;  1BJ7 A;  1OEE A;  2RTK A;  3WJD A;  4AZO A;  1VWN B;  3RBY A;  3OE3 A;  4YFR A;  5AJB A;  1JZU A;  4MIS A;  4GJV A;  2JW1 A;  1B0O A;  2JN3 A;  4TKH A;  4ZH9 A;  1ZND A;  3PED A;  5BVT A;  1E06 A;  1SLG B;  1VWE B;  1Y9L A;  4A1Y A;  2WEX A;  3ZW1 B;  1TXL A;  1BEB A;  1CBS A;  1NP4 A;  1QWD A;  2WUT A;  1VWH B;  3F6Z B;  2BHV A;  4IAB A;  4WFU A;  5B29 A;  3P6G A;  5LJC A;  1JJX A;  4Z2V A;  4LKP A;  3B2I A;  1VWK B;  3ZW2 A;  4GK9 A;  4BQU A;  5IRW A;  3LTW A;  4YCE A;  2QCB A;  3APX A;  3OJY C;  4QRL A;  5AJC A;  1I06 A;  1XKI A;  4BX5 B;  2KTS A;  3H3I A;  4BX7 B;  1VYO A;  1FEM A;  1ICM A;  5LJH A;  2CM4 A;  2WSJ A;  2IZG B;  2RTA A;  2WQ9 A;  1KGL A;  3MX7 A;  4HWM A;  2G79 A;  2ACO A;  3CR6 A;  1UYN X;  3D4R A;  4QNI A;  4RUN A;  1QY0 A;  1GKA B;  1SWD A;  1X8U A;  2QOM A;  2X4M A;  1DC9 A;  4GDZ A;  4NLJ A;  5HCE C;  4N7D A;  3WJE A;  4YBP A;  2X34 A;  2W2F A;  4QYN A;  3D95 A;  1Y53 X;  5JR8 A;  3E3C A;  2LFO A;  1SY2 A;  3LV4 A;  1RSU B;  2CM9 A;  2RTM A;  1YUP A;  3P02 A;  4U8U O;  1N7Y A;  3STN A;  4EEJ A;  1VYF A;  3IA8 A;  3IFB A;  1SWF A;  1SRF A;  2ALL X;  2LKK A;  4OS3 A;  5LKF A;  3I17 A;  3UAQ A;  4FGI B;  2AT6 X;  2AT3 X;  2GJ5 A;  1YP6 A;  3MM0 A;  3STM X;  1E02 A;  1VYG A;  2AVI A;  2GTL M;  2IZA A;  3D96 A;  4NP1 A;  2CZT A;  1KQW A;  4QQ1 A;  1W4T A;  1XCA A;  1BSO A;  2C1Q A;  4EFG A;  5BYP A;  3FEK A;  1VWI B;  3NQ3 A;  5CYB A;  1CBQ A;  1OPB A;  3HK1 A;  3TZS A;  1ZRY A;  5EZ2 A;  1KOI A;  3C78 X;  3HOE A;  4GET A;  5F58 A;  3U03 A;  4DQ3 A;  1VWO B;  3HWF A;  1JJJ A;  4NV7 A;  4Y59 A;  2RTG B;  2OFM X;  3FR5 A;  1QFV A;  3SAO A;  4O3W A;  4O4X A;  2C4I A;  1FEN A;  1IFC A;  3FA7 A;  4GE1 A;  2OL8 O;  1SWA A;  1U18 A;  2HYS A;  1SWN A;  4Y5D A;  5B27 A;  4EQA C;  2OVA A;  1SY1 A;  2WPU A;  2KTD A;  5LJD A;  3WYQ A;  1YWD A;  4HPB A;  3F8A A;  4DQ4 A;  5H9A A;  3O19 A;  4QZT A;  2MM3 A;  4MVL A;  2A2G A;  1W6F A;  2L5P A;  3AUM O;  3FEP A;  3ZW1 A;  4DNE A;  4CV7 A;  1GX9 A;  4ZFX A;  3RE5 A;  1PBO A;  1B56 A;  3HWD A;  1SA8 A;  4CPF A;  2FGS A;  2Y3F A;  3Q6L A;  2KD2 A;  1E00 A;  2FLJ A;  2MJI A;  4FBV A;  5FEN A;  4TKB A;  1ZNL A;  1O8V A;  5L3Y A;  5KIC A;  1KXO A;  1OEJ A;  4BX5 A;  3ZQ3 A;  3CWK A;  2HZQ A;  1JQP A;  3AKM A;  3VE1 A;  4U9C A;  1YP7 A;  3KZA A;  1STR B;  1A2D A;  1LDQ A;  3C76 X;  5HZ8 A;  4O3Z A;  2OYB O;  3WZO A;  3OD9 A;  4YGG A;  1HMT A;  1IFB A;  4O4U A;  4BOE A;  2DM5 A;  1MM9 A;  2P8G A;  3F9D A;  2E4J A;  4Y0P A;  5B2A O;  3RY2 A;  3TGB A;  4LZV A;  2JU7 A;  3SLT A;  1HN2 A;  1ALB A;  3PK2 A;  4YH0 A;  1N9Y A;  4I95 A;  4ORR A;  1LKE A;  4FQB B;  5D48 A;  5CE4 A;  5F7G A;  1SWT A;  3FYF A;  4Z6J A;  3GE2 A;  1DFV A;  2EU7 X;  4U46 A;  3S60 A;  4EKV A;  3ZUI A;  3P6H A;  1VWC B;  2ZAG A;  3N91 A;  4Y0S A;  3ZW0 B;  2A13 A;  4N7C A;  1VWP B;  2DJF A;  3UEU A;  2AT8 X;  2K62 A;  4CSB A;  1ACD A;  2G5L A;  2X45 A;  5HBS A;  4QZU A;  3WXQ A;  4IAW A;  1A57 A;  1PTS A;  5HCD C;  3NP1 A;  4OMW A;  1MOY A;  3NX2 A;  4Y0Q A;  2M4L A;  3FEL A;  4ZGF A;  2RTF B;  4O49 A;  5HZ9 A;  4BBO A;  4CPH B;  5B5G A;  3PPT A;  1JYD A;  2OVS A;  1QAB E;  3PQS A;  2ZAI A;  3ELX A;  4C5P A;  4XME A;  1EI5 A;  1VWJ B;  4ZGU A;  2AL0 X;  2OL7 A;  4ZHD A;  4HFO A;  5B10 O;  1RLB E;  2WQA E;  4CK4 A;  4XMG A;  4GKC A;  5H9L A;  3KVN A;  1SWP A;  1IJ8 A;  2PI3 O;  3K3L A;  4OMX A;  3V8U A;  4GZV A;  1G85 A;  2OY8 A;  3CQR A;  3FID A;  4YGH A;  2BLG A;  3GAQ A;  3HOL A;  4UU3 A;  2IZK A;  1KL3 A;  1BSY A;  2FT9 A;  1CJ5 A;  1LIB A;  1NGL A;  4FBO A;  4BX6 B;  3FA8 A;  2OY5 O;  1BWY A;  4YKM A;  3S26 A;  4BCS A;  1SRI A;  3U0D A;  3FW4 A;  1RXK A;  1HBP A;  4ZCB A;  3HTY A;  3EMM A;  2Q2M A;  1DZM A;  1HQQ A;  4GH7 A;  3SZJ A;  2I5V O;  1OEK A;  5DG4 A;  1MX8 A;  1NBX A;  1STP A;  4NW4 A;  1PBY A;  3SLJ A;  1G5W A;  4GD9 A;  1R0U A;  1I4U A;  1SWC A;  5IXG A;  2JU3 A;  2ZSC A;  3P6F A;  3EBW A;  1D2U A;  4Z28 A;  2BC3 A;  4ORU A;  3UEX A;  4QGV A;  3FR4 A;  1YWB A;  5H9K A;  2FHL A;  2UYW A;  3SLO A;  1NQN A;  1OSP O;  4CDF A;  2L68 A;  1EQD A;  2X56 A;  1LNM A;  3VU1 A;  3APW A;  3VG3 A;  4NV8 A;  4ORX A;  3HPE A;  1G7N A;  1SLD B;  2RTD B;  3AEH A;  3KFI A;  1HQP A;  5D8J A;  1DZJ A;  1S7D A;  1LEL A;  3NBX X;  4IB9 A;  5IO6 A;  1X8N A;  3VG5 A;  1TOU A;  5L8O A;  3EW1 A;  4LZU A;  5FAZ A;  2GTF X;  3S5V A;  4JO6 A;  1LID A;  3BU9 A;  3MBT A;  1RXH A;  2AH7 X;  1JIW I;  3T6L A;  1KZX A;  1KT3 A;  4KH8 A;  2JMB A;  1G74 A;  3WOV A;  5F2B A;  4OEM A;  3TF6 A;  1B8E A;  4I9S A;  1AQB A;  3CKG A;  1VWR B;  2AMM X;  1K24 A;  1LF7 A;  3BDR A;  1SWH A;  1AVE A;  5FQ7 E;  3RDS A;  1SRJ A;  4QYP A;  3STK A;  4GRJ A;  2RTJ A;  1E5P A;  3WZP A;  4CPH A;  1EPB A;  1ZNE A;  1SWG A;  2CZU A;  1SXU A;  3AKN A;  3VGW A;  3PEC A;  3ZUO A;  3APV A;  3WJB A;  4TNN A;  2RTH B;  5B5F A;  2IZF B;  3T6F A;  3KQ0 A;  1OBQ A;  4PSQ A;  1PEE A;  2L67 A;  1I05 A;  3WJG A;  4ODD A;  4YBU A;  3WJF A;  1A18 A;  4BJ8 A;  1LCV A;  2RTB B;  3BY0 A;  1SWB A;  3PH6 A;  1HMS A;  3FR2 A;  4MVK A;  4ALB A;  4Z2P A;  4O3X B;  3VE2 A;  4ES7 A;  1N4J A;  5CSE A;  3C77 X;  2WEW A;  1AEL A;  2C1S A;  2OL6 O;  4I3C A;  4INN A;  1ZNG A;  2HZR A;  1TW4 A;  2RTL A;  4MIR A;  1OPA A;  5HTE A;  3T1D A;  1LIF A;  3DSZ A;  3FIQ A;  3BS2 A;  1D3S A;  1SRH A;  2RTQ B;  3VG7 A;  2JGS A;  3BRN A;  3VHM A;  3SZH A;  2CBR A;  1LIE A;  3VHH A;  1Y52 X;  2F73 A;  3KFG A;  5EEE A;  3RZY A;  3VG6 A;  2LBA A;  2ACP X;  1VWM B;  1JV4 A;  4R0B A;  1ERB A;  1MDC A;  1SXX A;  3Q34 A;  1Z24 A;  2F09 A;  2Z4I A;  3FW5 A;  3OBL A;  4JGL A;  4MEE A;  4ON1 A;  3UEV A;  4BX7 A;  1RBP A;  4YVB A;  5KHP A;  1EAL A;  2NNQ A;  1OBU A;  4ZHG A;  4GGR A;  5HZ6 A;  2A5B A;  1GKA A;  1I04 A;  4I9R A;  1E2T A;  4HPC A;  1X8O A;  2W2A A;  3FA9 A;  4IB7 A;  5HA1 A;  4IAX A;  2BT9 A;  4NYR A;  2I5Z O;  4XMH A;  4FBR A;  1OBP A;  2VFB A;  1JMX A;  2X8F A;  2RTR B;  4A60 A;  1QG5 A;  3S5X A;  2RN4 A;  3MVF A;  1HY2 A;  1MEP A;  2OZQ A;  3NQ9 A;  1SWJ A;  1T8V A;  2N93 A;  1KT6 A;  2ASN X;  4GGZ A;  1DV9 A;  2RQ0 A;  1EUO A;  1VWG B;  2G8C O;  1JMZ A;  4IBA A;  3VPJ E;  2IZB A;  1FTP A;  3B2K A;  2IZL B;  4YFP A;  5KID A;  1PM1 X;  4OKA A;  3JQO A;  3B2J A;  4NNS A;  5HZQ A;  2FR2 A;  2HKD A;  1HXL A;  2RTC B;  3NR3 A;  1FJ1 E;  4LKT A;  1SWO A;  4IB6 A;  1SWE A;  4L1N A;  3CMP A;  4ORW A;  5BVQ A;  3RDQ A;  4Z27 A;  4ORS A;  1HBQ A;  4ZH6 A;  4D6B A;  1I78 A;  1ZNH A;  1X89 A;  4IRW A;  4TLJ A;  4KC7 A;  5H9N A;  1VWD B;  3BX8 A;  3QQ2 A;  3WBG A;  3WZN A;  4KC8 A;  1NDJ A;  3APU A;  3NX1 A;  4JHQ A;  2X46 A;  4ML7 B;  2VFC A;  3MG5 A;  1SWK A;  4WFV A;  2Z4H A;  5HA0 A;  2FS6 A;  4HPD A;  1DZP A;  1GT1 A;  4O3Y A;  3BSZ E;  3B2H A;  1GGL A;  2FWV A;  2BSZ A;  1SXY A;  3HWG A;  2K23 A;  1YWC A;  2IZE B;  5HZ5 A;  4AZM A;  1QY1 A;  1N43 A;  4YDB A;  3VG4 A;  1NQM A;  3RDX A;  5IRU A;  2A2U A;  1JBH A;  1CRB A;  4GU8 A;  1FDQ A;  4RUU A;  3ZI8 A;  4I3B A;  1BLR A;  5L8I A; 
#chains in the Genus database with same CATH homology
 1FE3 A;  2LBV A;  1SY3 A;  1ERX A;  2R73 A;  3ZZV A;  3ELZ A;  4LQZ A;  4I3D A;  3EYC A;  2BS6 A;  2FTB A;  2A0A A;  4AYH A;  4IMO A;  2R74 A;  4YGZ A;  4U8U M;  1DZK A;  1S2P A;  2X8S A;  4XMC A;  2POA A;  4ZJ0 A;  1EPA A;  4ZHH A;  1CBI A;  2AT5 X;  2AT0 X;  1O1V A;  2OVD A;  4A1H A;  2BS5 A;  3BLG A;  2FR3 A;  2GTL N;  1SMP I;  1KT7 A;  1SY0 A;  3FA6 A;  4IMN A;  4YKO A;  1AVG I;  2HLV A;  2XST A;  5F6Z A;  4ARH A;  5DPQ A;  2MHD A;  2NP1 A;  2Q4N A;  5H8T A;  1U0X A;  4I6S A;  2RCT A;  2JOZ A;  1SXW A;  4L3R A;  3ZW0 A;  4KCA A;  1BRP A;  4Y0R A;  5EED A;  2O62 A;  2GC9 A;  4ZR2 A;  5FFH A;  2KT4 B;  4O4S A;  4YCH A;  4YFQ A;  3BX7 A;  3P24 A;  1GT3 A;  4IB8 A;  4ORY A;  5FQ6 E;  1A3Y A;  5C0N A;  3CBS A;  3SOT A;  4TQ2 A;  2OFR X;  2L9C A;  5LJE A;  1MVG A;  1HMR A;  1LIC A;  2LB6 A;  4TJZ A;  4COT A;  4XMF A;  2QO4 A;  5LJG A;  4MVE A;  3CBC A;  2RCQ A;  4AZQ A;  3U9P C;  2ANS A;  3FMZ A;  1PMP A;  1KT5 A;  1URE A;  5IO5 A;  2OVE A;  1B4M A;  2IFB A;  2QOS C;  3I0A A;  3PQU A;  1YWA A;  2KW1 A;  2PY1 A;  1ZNK A;  2WWP A;  3L4R A;  3O22 A;  4LKT A;  1QFT A;  4EDE A;  1UZ2 X;  2QO5 A;  2YG2 A;  3JSQ A;  3RKG A;  2NNE A;  3O2Y A;  1IIU A;  1S44 A;  4AZP A;  1ADL A;  2QMI A;  1AB0 A;  5F6B A;  2G7B A;  3P6D A;  3JS1 A;  2CBS A;  1BBP A;  3EM0 A;  1CBR A;  4ALO A;  1KT4 A;  1N0S A;  1TVQ A;  2RD7 C;  5D4A A;  4XMD A;  3ZWE A;  1FEL A;  1X8Q A;  3UEW A;  5K06 A;  1QQS A;  1VPR A;  2X8T A;  2Q39 A;  1NP1 A;  1BSQ A;  3PP6 A;  2NND A;  2MO5 A;  2GTL O;  1EII A;  3LHN A;  1X71 A;  1EXS A;  5FQ8 E;  3B2L A;  1KQX A;  1GM6 A;  1O1U A;  2Q9S A;  5LJB A;  2WR6 A;  2YMS A;  5HAE A;  1JYJ A;  1LFO A;  4WHI A;  3TGC A;  3D97 A;  5HWZ A;  1U17 A;  4QGW A;  5LKE A;  5EDC A;  4U3Q A;  4AZR A;  2G78 A;  4O9S A;  4OS8 A;  4ZHC A;  4KT5 A;  2A3F X;  1GXA A;  5F1E A;  4KII A;  1GX8 A;  1KZW A;  2FS7 A;  3DTQ A;  2R56 A;  4NNT A;  2JU8 A;  3BU1 A;  4UU2 A;  3CQN A;  4M7M A;  1GT4 A;  2HNX A;  3NQK A;  5IO7 A;  2HMB A;  3NAD A;  4YMY A;  2MWH A;  3RSW A;  1BRQ A;  1IKE A;  4ID2 A;  4O4O A;  5D45 A;  2XKL A;  3VG2 A;  1EIO A;  4HPA A;  4WBK A;  1ICN A;  1EW3 A;  2QO6 A;  1X8P A;  4M6S A;  1L6M A;  4OS0 A;  5EPQ A;  5AEO A;  1IKJ A;  1LPJ A;  3WJC A;  4D6A A;  2RA6 A;  1T68 X;  5HTD A;  4BVM A;  5D47 A;  4AZN A;  3EBK A;  3WVM A;  4K19 A;  1MX7 A;  3HWE A;  4PJ2 A;  4U8U N;  4EXZ A;  2W2B A;  4NLI A;  4QAE A;  3FLL A;  2AKQ A;  3FEN A;  4ZHF A;  1MUP A;  4GNY A;  1DF3 A;  4MVI A;  1H91 A;  1ML7 A;  1T0V A;  2QM9 A;  4QGX A;  4GNW A;  3G7X A;  3KFH A;  3TGA A;  5L8N A;  4TKJ A;  5AQ6 A;  3NPO A;  4YDA A;  2FRS A;  1BM5 A;  5EDB A;  1P6P A;  3KFF A;  2LA7 A;  1Y9T A;  2Q2P A;  4NYQ A;  3P6C A;  1QY2 A;  3PH5 A;  3QKG A;  1TOW A;  5BVS A;  4AW8 A;  3P6E A;  3RWX A;  1GT5 A;  1IW2 A;  4A8Z A;  5LJK A;  1YIV A;  1BJ7 A;  1OEE A;  4AZO A;  3WJD A;  4YFR A;  3RBY A;  3OE3 A;  5AJB A;  1JZU A;  4MIS A;  2JW1 A;  1B0O A;  2JN3 A;  4TKH A;  4ZH9 A;  1ZND A;  3PED A;  5BVT A;  1E06 A;  1Y9L A;  4A1Y A;  2WEX A;  3ZW1 B;  1TXL A;  1BEB A;  1CBS A;  1NP4 A;  1QWD A;  2WUT A;  3F6Z B;  4IAB A;  2BHV A;  4WFU A;  5B29 A;  5LJC A;  3P6G A;  1JJX A;  4LKP A;  3B2I A;  3ZW2 A;  4GK9 A;  4BQU A;  4YCE A;  3APX A;  3OJY C;  4QRL A;  5AJC A;  1I06 A;  1XKI A;  2KTS A;  3H3I A;  1FEM A;  1ICM A;  5LJH A;  2CM4 A;  2WSJ A;  2WQ9 A;  1KGL A;  3MX7 A;  4HWM A;  2G79 A;  2ACO A;  3CR6 A;  3D4R A;  4QNI A;  4RUN A;  1QY0 A;  1GKA B;  1X8U A;  4GDZ A;  4NLJ A;  1DC9 A;  3WJE A;  5HCE C;  4N7D A;  4YBP A;  2W2F A;  4QYN A;  3D95 A;  5JR8 A;  3E3C A;  2LFO A;  1SY2 A;  3LV4 A;  4EEJ A;  2CM9 A;  3P02 A;  1YUP A;  4U8U O;  3STN A;  5HCC C;  1VYF A;  3IA8 A;  3IFB A;  2ALL X;  2LKK A;  5LKF A;  4OS3 A;  3I17 A;  3UAQ A;  4FGI B;  2AT6 X;  2AT3 X;  2GJ5 A;  1YP6 A;  3STM X;  1E02 A;  1VYG A;  3D96 A;  2GTL M;  4NP1 A;  2CZT A;  1KQW A;  4QQ1 A;  1XCA A;  4EFG A;  1BSO A;  5BYP A;  3FEK A;  3NQ3 A;  5CYB A;  1CBQ A;  1OPB A;  3HK1 A;  3TZS A;  1ZRY A;  5EZ2 A;  1KOI A;  3C78 X;  3HOE A;  4GET A;  5F58 A;  3U03 A;  4DQ3 A;  1JJJ A;  3HWF A;  3FR5 A;  2OFM X;  1QFV A;  3SAO A;  4O3W A;  4O4X A;  1FEN A;  1IFC A;  3FA7 A;  4GE1 A;  1U18 A;  2HYS A;  4EQA C;  5B27 A;  2OVA A;  1SY1 A;  5LJD A;  2KTD A;  1YWD A;  4HPB A;  3F8A A;  4DQ4 A;  5H9A A;  3O19 A;  4QZT A;  2MM3 A;  4MVL A;  2A2G A;  2L5P A;  3FEP A;  3ZW1 A;  1GX9 A;  4ZFX A;  1PBO A;  1B56 A;  3HWD A;  1SA8 A;  3Q6L A;  2KD2 A;  1E00 A;  2FLJ A;  2MJI A;  4FBV A;  5FEN A;  4TKB A;  1ZNL A;  1O8V A;  5KIC A;  1KXO A;  1OEJ A;  3ZQ3 A;  3CWK A;  2HZQ A;  3AKM A;  3VE1 A;  4U9C A;  1YP7 A;  3KZA A;  1A2D A;  3C76 X;  5HZ8 A;  4O3Z A;  3OD9 A;  4YGG A;  1HMT A;  1IFB A;  4O4U A;  4BOE A;  2DM5 A;  2P8G A;  3F9D A;  4Y0P A;  2E4J A;  3TGB A;  4LZV A;  2JU7 A;  1HN2 A;  1ALB A;  4YH0 A;  4I95 A;  4ORR A;  1LKE A;  4FQB B;  5D48 A;  5CE4 A;  5F7G A;  3FYF A;  3GE2 A;  1DFV A;  2EU7 X;  3S60 A;  3ZUI A;  3P6H A;  2ZAG A;  3N91 A;  4Y0S A;  3ZW0 B;  2A13 A;  4N7C A;  3UEU A;  2AT8 X;  2K62 A;  4CSB A;  1ACD A;  2X45 A;  5HBS A;  4QZU A;  3WXQ A;  4IAW A;  1A57 A;  5HCD C;  3NP1 A;  4OMW A;  4ZGF A;  3NX2 A;  4Y0Q A;  2M4L A;  3FEL A;  4O49 A;  5HZ9 A;  3PPT A;  1JYD A;  2OVS A;  1QAB E;  3PQS A;  2ZAI A;  3ELX A;  4XME A;  1EI5 A;  4ZGU A;  4ZHD A;  2AL0 X;  4HFO A;  1RLB E;  2WQA E;  4CK4 A;  4XMG A;  4GKC A;  5H9L A;  3K3L A;  4OMX A;  3V8U A;  4GZV A;  1G85 A;  3CQR A;  4YGH A;  1CJ5 A;  2BLG A;  3GAQ A;  3HOL A;  4UU3 A;  2FT9 A;  1BSY A;  1LIB A;  1NGL A;  4FBO A;  3FA8 A;  1BWY A;  4YKM A;  3S26 A;  3U0D A;  3FW4 A;  4ZCB A;  1HBP A;  3HTY A;  3EMM A;  2Q2M A;  1DZM A;  4GH7 A;  5DG4 A;  1OEK A;  1MX8 A;  4NW4 A;  1G5W A;  1R0U A;  1I4U A;  2JU3 A;  3P6F A;  3EBW A;  1D2U A;  4ORU A;  3UEX A;  4QGV A;  3FR4 A;  1YWB A;  5H9K A;  2L68 A;  1EQD A;  1LNM A;  3VU1 A;  3APW A;  3VG3 A;  4ORX A;  1G7N A;  5D8J A;  3KFI A;  1HQP A;  1DZJ A;  1S7D A;  3NBX X;  4IB9 A;  5IO6 A;  1X8N A;  3VG5 A;  1TOU A;  5L8O A;  4LZU A;  5FAZ A;  2GTF X;  3S5V A;  1LID A;  3BU9 A;  3MBT A;  2AH7 X;  1JIW I;  1KZX A;  1KT3 A;  4KH8 A;  2JMB A;  1G74 A;  3WOV A;  3TF6 A;  1B8E A;  4I9S A;  1AQB A;  2AMM X;  1LF7 A;  3BDR A;  5FQ7 E;  4QYP A;  3STK A;  4GRJ A;  1E5P A;  1EPB A;  1ZNE A;  2CZU A;  1SXU A;  3AKN A;  3ZUO A;  3PEC A;  4CV7 A;  3APV A;  3WJB A;  4TNN A;  3KQ0 A;  1OBQ A;  4PSQ A;  1PEE A;  2L67 A;  1I05 A;  3WJG A;  4ODD A;  4YBU A;  3WJF A;  1A18 A;  3BY0 A;  3PH6 A;  4MVK A;  1HMS A;  3FR2 A;  4ALB A;  4O3X B;  3VE2 A;  4ES7 A;  3C77 X;  2WEW A;  1AEL A;  4I3C A;  4INN A;  1ZNG A;  2HZR A;  1TW4 A;  4MIR A;  5HTE A;  1OPA A;  3T1D A;  1LIF A;  3DSZ A;  3FIQ A;  3BS2 A;  1D3S A;  3VG7 A;  3BRN A;  2CBR A;  1LIE A;  2F73 A;  3KFG A;  5EEE A;  3RZY A;  3VG6 A;  2LBA A;  2ACP X;  1JV4 A;  4R0B A;  1ERB A;  1MDC A;  1SXX A;  1Z24 A;  2F09 A;  2Z4I A;  3FW5 A;  3OBL A;  4JGL A;  4ON1 A;  3UEV A;  5KHP A;  1EAL A;  1RBP A;  2NNQ A;  1OBU A;  4ZHG A;  5HZ6 A;  1GKA A;  1I04 A;  4I9R A;  4HPC A;  1X8O A;  2W2A A;  3FA9 A;  4IB7 A;  5HA1 A;  4IAX A;  2BT9 A;  4NYR A;  4XMH A;  4FBR A;  1OBP A;  2X8F A;  4A60 A;  1QG5 A;  3S5X A;  2RN4 A;  3MVF A;  2OZQ A;  3NQ9 A;  1T8V A;  2N93 A;  1KT6 A;  2ASN X;  1DV9 A;  2RQ0 A;  1EUO A;  4IBA A;  3VPJ E;  1FTP A;  3B2K A;  4YFP A;  5KID A;  1PM1 X;  5HZQ A;  3JQO A;  3B2J A;  4NNS A;  2FR2 A;  3NR3 A;  4ORW A;  4IB6 A;  4L1N A;  3CMP A;  5BVQ A;  4ORS A;  1HBQ A;  4ZH6 A;  4D6B A;  1ZNH A;  1X89 A;  4TLJ A;  4KC7 A;  5H9N A;  3WBG A;  3BX8 A;  4KC8 A;  3APU A;  3NX1 A;  2X46 A;  4ML7 B;  4WFV A;  2Z4H A;  5HA0 A;  2FS6 A;  4HPD A;  1DZP A;  1GT1 A;  4O3Y A;  3BSZ E;  3B2H A;  1GGL A;  2FWV A;  1SXY A;  3HWG A;  2K23 A;  1YWC A;  5HZ5 A;  4AZM A;  1QY1 A;  4YDB A;  3VG4 A;  2A2U A;  1JBH A;  1CRB A;  4GU8 A;  1FDQ A;  4RUU A;  3ZI8 A;  4I3B A;  1BLR A;  5L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...