3VGJA

Crystal of plasmodium falciparum tyrosyl-trna synthetase (pftyrrs)in complex with adenylate analog
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
353
structure length
353
Chain Sequence
EESKIEDVDKILNDILSISSECIQPDELRVKLLLKRKLICYDGFEPSGRMHIAQGLLKSIIVNKLTSNGCTFIFWIADWFAHLNNKMSGDLKKIKKVGSYFIEVWKSCGMNMENVQFLWASEEINKKPNEYWSLVLDISRSFNINRMKRCLKIMGRSEGEENYCSQILYPCMQCADIFFLNVDICQLGIDQRKVNMLAREYCDIKKIKKKPVILSHGMLPGLLEGQEKMSKSDENSAIFMDDSESDVNRKIKKAYCPPNVIENNPIYAYAKSIIFPSYNEFNLVRKEKNGGDKTYYTLQELEHDYVNGFIHPLDLKDNVAMYINKLLQPVRDHFQNNIEAKNLLNEIKKYKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosyl-tRNA synthetase, putative
publication title Malaria parasite tyrosyl-tRNA synthetase secretion triggers pro-inflammatory responses.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Ligase
total genus 135
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2011-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3vgjA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3vgjA01
3MLBA 2CV0A 4KKVA 1QJCA 4JZYA 2DR2A 2PZBA 1NUUA 3SZ3A 3LE8A 5EKDA 2D13A 1Q11A 1LW7A 4MULA 3SEQA 3CVWA 3Q10A 3CLUC 4QRDA 3P0HA 4BWVA 1U3CA 3FIUA 1G59A 1ZH0A 2A1UB 1IRXA 1R6XA 1T6ZA 5TGTA 4I6GA 3COYA 2J4DA 1J20A 5KCMA 1NYLA 4WNYA 4GU5A 5KHAA 2QUIA 3FY4A 3H9CA 3ZJVA 3X1MA 5IHXA 1JZQA 3INNA 3FH0A 4R2MA 3PNYA 4ZT4A 3AKZA 3CVYA 1QU2A 4CDMA 3DLAA 1JHDA 4MWEA 1M8GA 1P7PA 2JANA 1J09A 4I6JA 1NUPA 1M8FA 4QBTA 3SZGA 2ZUEA 3VRHA 3UC5A 1U0BB 4MW2A 5J58A 1TYCA 2YWBA 4MVCA 1O94C 1ZJWA 1U3DA 1EXDA 3IVXA 1N2IA 1GAXA 5LM3A 2QTNA 3ZXIA 1GN8A 1T6XA 2PIDA 4ZT3A 1TEZA 4GRIA 2QJFA 5HG0A 4A91A 1IQRA 2QJTA 2PZ8A 4HK4A 3VGJA 1WY5A 3CLUD 3QTTA 2JA2A 1N78A 1RQGA 3K32A 2EL7A 1WXHA 2J09A 2A88A 1M83A 2A7XA 5JBNA 1WXIA 2DEUA 1O96B 1YUNA 2Z09A 4L2IA 4MVWA 1NP7A 4KPUA 3GMIA 4EF6A 1O5TA 2QJOA 1IQ0A 3IMGA 3RBAA 2H2AA 3QTBA 3MUEA 2VTBA 1M1ZA 4MUIA 3CVUA 4NAHA 2XRYA 3G6KA 4YP5A 3PRHA 1VBKA 1WXFA 2DERA 4UZFA 2A1TR 4MW6A 3GUZA 1J70A 4EGAA 4F3RA 2HZ7A 1K4MA 1R6UA 2R5WA 2WQ6A 2NSYA 1OWNA 4ZCPA 3OTWA 1WQ3A 2B7LA 4DDHA 1WXEA 2C5SA 3D6UA 2WSIA 1YUMA 3DV2A 4EFKA 1NURA 1O94D 3L92A 4U63A 3RHSA 1VBMA 2TS1A 3GLVA 1TYBE 2E0IA 3CLRC 3OP1A 4MW0A 1GPMA 1WKBA 3A05A 3NV7A 5K0SA 2AZXA 3N8HA 1WQ4A 1JMVA 1Q77A 1NUTA 4Q16A 3C8ZA 4MW9A 1N2BA 2IJGX 4ND6A 1KQPA 4YP6A 1T9GR 4H3SA 1YI8A 1JEDA 1HYBA 4PY2A 3NBKA 3UMVA 2BYTA 3IMCA 2A1TS 1I6MA 1IHOA 1NSYA 1X6VA 2V0CA 2A86A 1F7UA 4ZT2A 1QRUA 4KR9A 1J1UA 1EFVB 4DLPA 1O6BA 1TQ8A 2JAXA 4CT0A 3FG9A 1KH2A 3X1KA 2CSXA 1EUQA 3CA8A 3ZGZA 5TEWA 4G6ZA 3ZUGA 1QRTA 5J5AA 3COVA 1QRSA 2VXOA 3PXUA 3LCJA 3AIIA 5TEVA 3H97A 4X0EA 2QUKA 1KP2A 3P0JA 3KT0A 1R6TA 4EG6A 3KFLA 4YBRA 1EFPB 4KR6A 4MUNA 3CLSC 4J76A 4OUDB 3E27A 3S3TA 2CYBA 4U8HA 3X1JA 2IP1A 1X8XA 5FO0A 1MAUA 1OWLA 1Y42X 1T9GS 1JEEA 3NBAA 3VU8A 4NAUA 3CVXA 1FYDA 1BS2A 4ARIA 2HMAA 4Q93A 1KORA 1ZUNA 5LFAA 1KH3A 3DPIA 3FI0A 1CT9A 1MOPA 3UOWA 3MXTA 3RK1A 3SEZA 3A2KA 4NZPA 5J59A 1I2DA 3UY4A 4ZCQA 1H1TA 4CDNA 1WXGA 2PZAA 4MW1A 3ZJUA 1NZJA 1JIIA 3DO8A 3Q4GA 2A4MA 1XNGA 1FFYA 3RFFA 2OQ2A 4RPIA 4HJRA 3COWA 1JECA 1YIAA 4XFJA 3BL5A 2GKSA 4JYZA 2BTEA 2WB2A 1MAWA 3TQIA 3G59A 1PFUA 4HPWA 4R0NA 2E89A 2OV4A 4MUJA 1SURA 3CR8A 3RK0A 1KAMA 3UK2A 3D6VA 4PBSA 1N2OA 4ZT7A 5H7XA 1H3NA 3AFHA 2A1UA 2X0KA 3PNVA 3H05A 3TZLA 1NI5A 2CV1A 3L93A 2GM3A 1M8JA 1K4KA 3FHJA 1O0CA 1LI5A 2X1LA 2PXHA 1MRZA 2V0GA 3ND6A 2X3FA 1N2JA 2CT8A 2E21A 4EG5A 1I6KA 5BNZA 4I6EA 1F7VA 2CYCA 1KQNA 3TQOA 4G5FA 5AHWA 4MWBA 1N75A 1U7DA 3LOQA 1PFYA 2DUMA 3IMEA 5DB4A 4EG4A 1JILA 1H3FA 4PBRA 1LI7A 1ILEA 2DXIA 2DPLA 1VBNA 4DDMA 1OWOA 2J5BA 1KP3A 2YWCA 4HJXA 3IVGA 3HV0A 3TZEA 4MLPA 3TS1A 3ZIUA 1MJHA 4QREA 2Z3VA 1OWPA 4NATA 4MW7A 1G8GA 3Q12A 1IVSA 1PFWA 4ZT6A 2HGZA 1XNHA 1GLNA 3A04A 3FOCA 5FNZA 3ILVA 4MUGA 2YXNA 1N2EA 1N1DA 3QE4A 3IUEA 4EG8A 1OWMA 2X1MA 1YIDA 1O96A 4S1OA 5DK4A 3HGMA 4MUKA 3ZXSA 2PG3A 3N2YA 1JZSA 4FZJA 4MAFA 2CUZA 1UFVA 1PG0A 2Z08A 1MC1A 3ND7A 4L2IB 4YMIA 3AL0C 4KPUB 4DE5A 3FWKA 3TNJA 3N05A 5HUHA 4ZCTA 3P0IA 4JXZA 4U7JA 4RUKA 3CLRD 4E1AA 1G8HA 1F4LA 2VTBB 4J75A 3IUBA 4EG3A 3AG6A 2RE8A 1N77A 2J08A 1TYAE 3G5AA 3RJZA 2RD2A 3I05A 1JIJA 1N2HA 2CFOA 1S4MA 1A8HA 1O95C 2I1LA 4ZCSA 5IJXA 3FETA 1DNPA 1NUQA 1KR2A 2O8VA 1OBCA 4XSVA 3F3MA 3MMXA 1V47A 3MLAA 3HL4A 3ND5A 1EE1A 4WSOA 1O97C 3SYTA 1JIKA 4OJMX 1G8FA 1IH8A 3H9BA 4XFDA 1GTRA 4EG7A 1EJ2A 1JGTA 1NUSA 1ZH6A 1PG2A 2QUJA 4UZEA 1ULHA 3A4IA 4ZCRA 1QQTA 2ZP1A 1IQUA 4ND7A 1MB2A 4NDAA 2DETA 3ZJTA 1I6LA 3IVCA 2O5RA 4CQNA 3IOCA 2GOYA 3ISJA 3H99A 4MVXA 1EUYA 1QNFA 2D5BA 1F9AA 1VL2A 4MW4A 1H3EA 4JXXA 1OBHA 5HUJA 3FNRA 1COZA 1KQOA 1T6YA 4K0RA 4MW5A 3P52A 1B6TA 1EFVA 3CLSD 2J07A 4F4HA 3PNBA 1J1ZA 5DASA 5LLTA 1K97A 4MUEA 2E18A 1M8KA 1XNJA 3COZA 2AKEA 4TS1A 1PFVA 1N2GA 4KR7A 2YY5A 1O95D 4AQ7A 1WJGA 5TS2A 5F23A 2CYAA 3HFJA 2CV2A 3K9WA 3CLTC 4YP7A 2G36A 4NX2A 3KT6A 1WZ2A 1O97D 1VLHA 3AG5A 1GZUA 1EFPA 3N9IA 1D2RA 1YULA 1KAQA 3HMQA 1TFUA 1J21A 3SP1A 4EG1A 3JXEA 3IOEA 1O0BA 2QUHA 4OUDA 1U7XA 3M5WA 4DJAA 2AG6A 4R2LA 5KWVA 2QTRA 4DDKA 5K0TA 3ELBA 1M8PA 2IELA 2H29A 4G5YA 1XJQA 2EJCA 3IDFA 1KH1A 4MWDA 1GTSA 4MUHA 1KKUA 4P2BA 3KT8A 1QU3A 2NZ2A 3IOBA 1MBZA 2PFSA 4K03A 2DLCX 2ZUFA 4MQ6A 4JFAA 4MUFA 5H16A 3IODA 5DEOA 1Q19A 4AS1A 1V8FA 2XRZA 1WOYA 2D54A 2QTMA 2A84A 1OD6A 4ZT5A 1MB9A 1Q15A 1K92A 4MWCA 4ARCA 1TYDE 3IH5A 3FDXA 3KT3A 3SDBA 3HZRA 2WQ7A 5FO1A 1IFXA 3CVVA 4DNXA 4MVYA 3CLTD 1QTQA 3U1VA 4PBTA 1N3LA
chains in the Genus database with same CATH superfamily
5E6RB 2EW1A 1UKVY 4CCSA 3RWBA 3IPYA 1RMYA 1IB6A 2H5JA 2OE2A 3PJDA 1USVA 1WRBA 2B2CA 1KQGA 3OE7A 3ISTA 3UT6A 3GP3A 4UDXX 2IXGA 1B0UA 1T2VA 2J9FB 3AR7A 4HUQA 4INJA 1NVMB 3N3AC 2RAVA 5DWQA 3VX4A 1Q16A 4LMAA 5HIKA 4FKBA 2VAMA 4QRDA 2O8DA 1L4LA 1S2LA 3X2SA 1L7QA 1CY8A 3NBMA 4A2QA 4DV3B 3Q72A 2WJ6A 1A9TA 2XVXA 3GH3A 1M2OA 1XZKA 4OB6A 3U3DA 2CMHA 3V1UA 5B1YA 4MRRA 3NP9A 4LNUB 2QGFA 3LBHA 4GU5A 1RYEA 2ESRA 3DTTA 2DJ5A 4JSYA 1TVMA 1R88A 1NMYA 2Y1XA 2ZRIA 3BMCB 3EAQA 1D2MA 5I3CA 2FV8A 4MGKR 3SZLA 2VP0A 1YTUA 4IH4A 5C3UA 1U3WA 1M8GA 1M3SA 2PYZA 4INOA 4PQEA 3TTSA 4R3NA 1N6PA 2ZQYA 3PVSA 2I67A 3K9CA 4S3MA 9LDTA 5DXJA 3KE8A 2NX2A 1K5GA 4YFYA 4TUYF 1CZUA 1XYGA 4CFSA 1QIJA 1IYZA 3F49S 4QEZA 3VRHA 1NVGA 1YB4A 3W8RA 4AP6A 2WWFA 1H9AA 1F3LA 1QKIA 4N0DA 3W9YA 4DTIA 1FBNA 1NVKA 5DSZA 3TB4A 3UAZA 2ZTHA 4DV7B 2BTQA 5EWJB 3W7AA 3BMNA 3R5HA 1YZ3A 1THGA 1UOQA 2OBLA 2DF8A 1AUXA 5EQDA 2PGOA 5A9RA 5CB8A 3TVYA 3W5CA 1WPGA 2PJRA 2FFAA 1UMBB 1Q1ZA 3I45A 3D9QX 1DAIA 1DOAA 4DDUA 3D8TA 5DGHA 3SLKA 5IJWA 3HCNA 3JQ8A 3A3NA 4GVLA 2G6BA 4PPYA 3OQJA 2ODAA 5C4IA 4A6DA 4BO8A 1RQGA 4HDSB 3VVMA 1CUCA 4CE6A 4HY3A 4NS4A 5LQDA 2HYIC 2A88A 1ESNA 2PPVA 5DMHA 4BLSA 4QLOA 1Q57A 1G2PA 1UWVA 1YUNA 4EX7A 4G2NA 1JR3D 4MVWA 1E6WA 1GWNA 1OZHA 1T2AA 1WIWA 1TC2A 1Y34E 4FCTA 4EYSA 4R01A 4TQAA 5H8WA 3GFVA 1GPNA 5UKDA 4LV5B 5TJHA 2ZRQA 2A0YA 3L1IA 2R60A 4BO3A 5B7PA 4ZO9A 3GL9A 4FK8A 4L51A 3VPFA 5EWLB 1K7XB 2VTKA 4V3CA 4HATA 2FJPA 4LY3A 4NAHA 4RQUA 1UJ6A 5LOVB 5K0LA 3B8EA 1ZH2A 2AWOA 1THTA 2QMHA 4EUEA 5KREA 2G40A 3IMKA 4OGGA 4I4TF 4OP3A 1UKCA 4PG8A 3KVOA 4EVIA 4OLAA 2Y1DA 3MGGA 4RVOA 1GUYA 4FUQA 1RLOA 2V7PA 4X93A 4ZCPA 4P80A 2IPNA 3SSNA 1I5EA 1T9CA 3D8HA 1WXEA 2EJWA 4CQLA 4CEIB 2A5FA 4FS8A 4TPKA 2SNIE 4ZOCA 1V35A 1XMVA 3D6UA 2X7HA 5EUQB 5I7FA 2P0YA 2JHFA 2FDXA 4H7PA 1WB9A 4JLBA 3M8KA 4G65A 4KI7A 1XRJA 4OIFA 3SR3A 2ZUCA 3HJRA 3ZWOA 2AIRA 3EVCA 2XZPA 3GB9A 2PANA 4B3GA 1QDLB 3C39A 1J97A 1KVTA 1VKRA 2AVDA 1GP2A 4A9AA 3GFSA 2OCXA 5DM0A 4HQ0A 4LOHA 1ZRMA 1ISFA 1E0DA 2CZCA 3I1FA 2D3TA 3PYXA 4NU5A 3TLZA 4X3CA 5DX8A 1T34A 2Q3CA 4MXDA 3LO8A 5AOBA 1AUVA 4HLUC 1D7OA 3ZN2A 2O8CB 1BXRA 1J0CA 3MS7A 1RZUA 2O2CA 3AFOA 2OYCA 2QG6A 4PZ9A 5LMCA 1SXQA 1U02A 1ZJ4A 4E08A 4PCVA 2ENUA 1I2ZA 2G1JA 2GM5A 2VJMB 4TLMB 4BCDA 1G1AA 1CUVA 2Q99A 2X22A 3X44A 5BW8A 4BEVA 4FSDA 1LI4A 3CZRA 3UMBA 1KKLA 3AJ8A 4TKVB 2OV2A 1AQLA 4AJJA 2RGGA 1IPHA 5AVSA 5K0BA 5BSEA 1Y7IA 1Z0JA 1OBVA 4RL4A 1RAAA 2UV8A 2H4JA 3TUJC 3P2YA 1QGUA 2XKAA 3GCDA 4MIEA 1MAVA 4KN8A 4C0LA 1HLGA 5A7HA 1ECCA 5KYVA 3PBKA 3R09A 2GH1A 2HMYB 3NWBA 5IAAA 3D1JA 4QLAA 3KZNA 3UATA 1W4BA 1HZZC 3LT1A 4R5MA 5SY6A 4BN4A 2IU6A 4Y7DA 5G0TA 4N6OA 5TEWA 5T6BA 4RTMA 3THWA 3WWOA 4O4IA 4Q9NA 1YA6A 2C9ZA 3U3RA 1OBFO 2GTIA 4PPNA 4LC0A 5FL7D 4Q7LA 3EXG2 4URZR 1E3MA 4TYNA 2ID4A 1A8PA 5IDVA 1KZHA 1TJPB 2VT2A 2ENWA 3G02A 2RARA 2CSUA 3VPHA 2YJZA 1TIPA 4Y30A 1NNI1 3IE1A 2HXGA 4YECA 4DA6A 3QKRB 3EMBA 3PLAE 4LJRA 3CNQS 1DBRA 1ZOIA 4OREX 1OXUA 4D9IA 1BEUB 1FPQA 2QA5A 2QG9A 2RGEA 1W76A 2JLAA 4L5BA 3UAXA 3VC3A 4MARA 4C7KA 4J76A 3FYTA 3H5WA 4YO7A 1XQXA 4U8HA 1V6CA 3AYXB 4XI9A 4UHCA 2RAFA 3TPCA 3BOSA 2VKTA 1KFKB 4I5EA 5JSZA 3JQGB 3IEIA 2JI9A 2OC9A 4RTQA 3F97A 2Q5JA 3HBLA 3LPAA 4QDJA 1FYDA 3PQEA 2RGXA 3I76A 1TAQA 5ESWA 5FA8A 1MZVA 1EFDN 2Q3BA 3EWAA 2XEXA 1KDPA 3FB4A 3TBHA 2D7JA 1O94A 3TN7A 4LQDA 1DWOA 2YTZA 5FBWB 2JJ1A 4RCYA 4RL6A 2G5GX 3L1HA 2JG3A 5LQNA 3EGWA 4JR1A 4D3YA 3Q2KA 2ZW9A 2JLWA 1JU9A 4WFJA 1VCMA 2YH2A 1JVBA 1GQSA 1V5FA 4YACA 4UPEA 1H2XA 3PFGA 1U99A 2R6DA 2HBYA 2GHTA 4PGHA 2IZ7A 1EZ4A 1KQ3A 9LDBA 2X1HA 2PIAA 2XR1A 5AW6A 5E1OA 1WXGA 1XVLA 5JEDA 2P6MA 4LBVA 3GQBA 4AVYA 1P39A 4RKQA 3LUFA 1QHGA 2WJHA 3A1WA 3W34A 4L7VA 2CUNA 1YMVA 2FWJA 1EWKA 2P1ZA 2NP6A 2W42A 2V65A 1IZ8A 1X7YA 2W6MA 3BUSA 3TFQA 2Q1YA 4MR7A 2UUAB 3NG1A 2H8GA 1CTQA 2OCYC 2G77B 4W5WA 3G2NA 3QIAA 2IDKA 4DXHA 3RRMA 4H7HA 2GBFA 5K3SA 1N0HA 1ISIA 3HU1A 1A71A 1AO3A 4XEUA 2O2XA 1IHYA 5IAGA 5DNDA 1QANA 1QHHB 4OHUA 4YMVA 1BMQA 2JI7A 2ZE6A 5GMOA 3U7EB 4IG4A 3OOWA 5IJZA 2I1WA 1E1QA 3DE6X 4UE6A 4A5OA 2OHIA 1PTJA 4B3HA 2ZJBA 1PR2A 4MVJE 3TSOA 3T9DA 2I80A 1DC8A 4RPHA 3TGLA 1PT9A 3AOGA 3EISA 3I9FA 5CLLA 3UKJA 1MC8A 1G5FA 3SC3A 3ZK9A 1Z0AA 5KTMA 3A36A 5C81A 5CP8A 1GADO 3AETB 4JJ6A 4R3WA 2NO4A 3K71B 3LWZA 4ZRNA 2WVHA 3HWRA 3PJFA 5FTNA 2WJAA 2DUUA 1IAQA 3T5MA 5KPJA 1G38A 4AMYA 3DEJA 3T9AA 3CO5A 1ECBA 2B25A 5HPYB 3WX0A 1I13A 4BNFA 3R77A 4CPDA 3PX7A 2PXHA 2VK8A 1TU3A 2H5IA 1C9EA 3S4YA 2RAPA 1AQ6A 5FWNA 3DJFA 5AVJA 1N6IA 3KETA 2XAAA 4X61A 1UKBA 4YXWA 2GVDC 1WU8A 5EMHA 4EEXA 2J32A 4ND8A 4F4JA 2CT8A 1SZPA 2GEDA 3T99A 4ZDIA 1J0EA 4RDCA 3MMZA 4JI3B 3BWMA 5ALKA 4GI2A 2CVFA 2PL3A 5E38A 1JZTA 3P97A 1XXHE 4YV7A 1MPXA 4KMMA 1YFLA 3EGXB 1G9XA 3NYQA 1N1MA 4EG4A 3TIVA 3GCGA 3FYDA 1VSUA 2BELA 2YV1A 4JNKA 4ZP1A 4TVKA 2YMLA 1KY5A 1UC8A 2OFXA 3OX3A 4HF7A 2R4QA 1OLSA 3GT7A 3H75A 3NC0C 1OU4A 2Q49A 4DLKA 4EI8A 4CEJB 1CJSA 3RHFA 4AWBA 2R2GA 4DCOA 5HKBA 1M54A 2DE0X 4RORA 5EL0A 3RJTA 2VSFA 1V41E 3I2KA 1OYYA 1U9CA 1XRMA 3P96A 1E66A 3HCWA 4P32A 5ERYA 5L3ZA 2H52A 4ISBA 1Z7WA 4M8NE 3CWCA 4DIUA 1EBUA 1T4GA 1X19A 5EUMA 1ZKMA 4NNOA 5CRIA 2ZUUA 3ZE8A 4LZJA 1K8ZB 1GG8A 3SICE 5A4AA 2CDAA 2FP4B 1Y98A 4GPEA 2ROQA 3AF5A 4UPVA 4BQQA 2OUKA 1H8ED 4GP9A 4NCNA 1NFRA 3AVXA 1GQFA 2B99A 1FFBA 1HFWA 4IQGA 4D1YA 1R8SA 1YQQA 4WZAA 5CA0A 3RSHA 2B5OA 3ZY2A 4A2CA 5EIXA 4L2IB 3CRVA 1XZDA 3H9JA 2QS9A 3QH4A 3VZSA 1T5IA 1V6SA 2QX9A 2W6QA 3BXZA 1P60A 3NRBA 1P5JA 1CF4A 1ZXLA 3NZEA 3EBPA 1U8FO 2AX3A 2ATIA 1CR0A 4EP1A 3GPIA 2ZZKA 3LQRA 3JYPA 1WNFA 1IN8A 2D59A 4IKEA 5EE9A 4WL0A 5AJWA 3S7TA 3D8RA 3SBEA 3FGNA 3OLCX 4GOJA 5D3MA 3SYNA 2NLOA 3I2GA 1DQNA 2VP5A 3NVDA 5L7WA 2X58A 3KSDO 5E6SB 1JIJA 2XE6A 2QAGA 5FOUA 3ZKWA 4GZ6A 4QDKA 1VKZA 2WWGA 4TXMA 3QUBA 3TJMA 3E3AA 1UUFA 5AM0A 3LYAA 2ZIFA 3AV3A 4D9BA 1E2KA 1DUSA 3VBCA 5JEEA 5JQGB 1B00A 4RMNA 2X9NA 1MRNA 3QLVA 4XVHA 2KBFA 3Q40A 3ZS9A 3R9WA 1K7SN 1VQ1A 4U2KA 1LK5A 3QVSA 4L8FA 2GARA 3PL5A 3IP8A 4JKIA 3DDSA 1NRIA 5KBYA 4KVAA 1TTPB 5BMVF 4EKGA 1B4DA 3OETA 2HJSA 4KSYA 2WG0A 4HZGA 2JLUA 5ALQA 3FUCA 3EXEA 3A11A 2VWHA 2VDVE 4K9OA 1YVPA 1U9IA 1LPBB 4OL9A 4ZCRA 4L9SA 1JHRA 1DAOA 1KJWA 3AI7A 1Z36A 4GSKA 4KO4S 4AY3A 1QX3A 2C5GA 1ONOA 2P9EA 3JD0A 3N86A 2KX7A 3E9EA 2BZSA 3HGTA 3AF3A 2O8BB 5T7BA 3MQFA 3ISJA 1JQ3A 4DRYA 5JCJD 1WPRA 1IN4A 1DRJA 1FLNA 2ZJOA 3OJ0A 4ZEOA 1FFXB 2WTBA 3CF2A 3HG7A 5KYYB 5A1TA 2RH9B 4E2YA 1E2UA 1NVTA 1OBHA 2NO5A 1J06A 3EOAI 5FUYA 3RT9A 5E95A 2FUEA 3CNOA 3KPYA 1TDJA 4DPMA 1VKNA 4MW5A 1CC1S 4DDVA 4FZVA 3CRQA 3RVSA 4YJ3B 3S2ZA 1YBAA 1HFKA 4KXVA 2LW7A 2B8WA 3B5IA 3WL3A 2XMBA 4EYEA 3EUFA 4E11A 1GSHA 5AK6A 3UT0A 1OX6A 4QODA 1XPJA 1HT1E 2P2DA 3LUDA 3VR6A 3ZY5A 2AZTA 2X9LA 2B1GA 3RVQA 3B1ZA 1FMCA 3FSRA 2CXPA 4B7UA 1E7YA 2PSFA 4MV8A 1PS0A 3C1UA 1T2NA 2LIPA 2P2SA 2VCHA 4RM2A 4CI9A 3IAHA 1E69A 3IVRA 3PQ2A 2J6BA 4M8LA 3QXCA 1QE3A 1SO8A 2FW0A 2Q5OA 1LD3A 3DE0X 2VJBA 1C9MA 1D1PA 4HNUA 4FD2A 3K0CC 4GFDA 2QUHA 1QIEA 1LRKA 3HHPA 1U7XA 1SBNE 3NKVA 1P62B 1B41A 4MKHA 1EVEA 1WSAA 4Z9AA 5A5EA 2J6HA 3EW9A 1JR6A 4NONA 2MR6A 3U19A 1OZFA 1ISMA 2AFRA 2AOTA 2CLSA 2Y2UA 4NABA 3S2EA 3W1VA 1GD1O 4PG5A 1ZI6A 4TVSA 5LUAA 1L1RA 1JS1X 4G0MA 4MVJF 3PD0A 2CHQA 3WBFA 4D25A 4AJ2A 1YI0A 1RQLA 3E5NA 4MPPA 5LQMA 5IXJA 3BXOA 4JXKA 4KPGA 5L3QB 1KH1A 1M75A 1YKSA 4MWDA 2XI4A 5JE8A 2IWHA 1C3EA 4A5SA 4RD3A 2P2LA 1RRGA 1YAJA 1P5HA 4M4SA 4GKJB 1HX7A 1C9KA 3ZHQA 2BGIA 1NV9A 4YDQA 3VKFA 1N5DA 1PZXA 4NZYA 1J9GA 3RYCA 3UPDA 1ZOLA 2AJBA 2GETA 3E2PA 5IC6A 2LDBA 1QRDA 3KV3O 1JNYA 1KXZA 1RBQA 1TD1A 4E03A 2Q5EA 4EJ6A 2YFYA 3EUEA 3UHPA 1NTRA 3MS2A 5KNCA 3JATB 3RVBA 1Q15A 4AG6A 4DNPA 2PGLA 4M0LA 3IH5A 1U11A 4CIYA 1FP4A 1P5FA 2Z8YA 2V5VA 2HXYA 2BY4A 3BPSA 5CYFA 2RCYA 3SDBA 3A9TA 4ZIRA 1T5LA 2OK7A 4BGIA 2A0XA 1P4JA 2R85A 1UKYA 1VE6A 1V1RA 2D5AA 3O3NB 4DQUA 2P30A 2BJWA 5BN5B 3NTVA 3E9NA 2GYWA 3K2BA 3PXAA 4YNBA 2QUAA 2W8BA 4P3NA 4UTZA 1QB8A 2TYSB 3AI1A 3OQNA 1L0BA 2AFHB 1I4OA 1PE0A 2F9FA 4GUDA 5BR7A 4FYIA 1GGJA 5KVCA 1JPJA 2PD4A 1U28A 4DY6A 1JHQA 3KOMA 4RVHA 1LW7A 2GEBA 4I0WB 3Q10A 1ZN8A 3QKIA 5HDQA 1OYVA 1EQAA 4ZZIA 1G59A 1T1GA 1PRYA 1NATA 1Y8RA 2X0NA 3DR3A 3NX4A 1X1CA 2C2OA 2QRPA 3BZBA 2KM1A 4KV9A 3FJOA 4TL6A 4X91A 2CLCX 5FD8A 2PUBA 2Q2NA 1FYXA 1NNEA 2HSWA 3QYFA 2AOWA 5CFRA 4KN9S 4FM9A 2WPDD 2C42A 1KYVA 2A4KA 4V0NA 2MSEB 2Z1NA 3T95A 4RVGA 4BNLA 5CFZA 1ESMA 1GG2A 3DM5A 3ENZA 3G5UA 3REQA 5AOVA 1NJGA 2H4YA 2NU9B 5HVNA 1YRWA 1I51A 3RANA 3QTLA 5AD1A 1TAGA 3EXHC 3KIPA 4N5IX 3VHRA 4EWLA 1J2RA 2CGEA 3OMWA 2FR8C 5J2TF 1NVWQ 1ZGHA 4NU0A 1G8PA 1RJ9A 2HGSA 3IDQA 1PR1A 1SG6A 1PQ4A 4HDMA 4LKRA 4A1FA 4ZXPA 1BOFA 1BCSB 1YR7A 2PSEA 1B6SA 5HS4A 4AURA 2QLNA 4PLPA 4DCPA 5AHXA 5B3LA 1ZIXA 2AW3A 3O8RA 1FYVA 3E48A 4DGSA 2H0AA 1PNRA 5C18A 4ASUD 1E0SA 1UBHS 2AI2A 2C97A 3JARA 3Q2IA 2JFQA 5D3QA 3SJBA 4K6FA 2AKAB 2R1TB 4GDFA 2PKYX 3H04A 3QU2A 4IM7A 2LCIA 4A91A 4ZCIA 721PA 1MG0A 3U5ZB 3IERA 1VPDA 4K46A 2E4ZA 1WWKA 4N0MA 5JS1A 1L4BA 1NF3A 1PD0A 3QX9A 3VGJA 2F90A 2HPVA 4JJ7A 4YK7A 5HOEA 4ZKDA 3T9CA 1APBA 2X3YA 2Z58A 3I0ZA 4TWJA 1L1FA 4E2ZA 2PUCA 4KU4A 5J40A 3RASA 4AN4A 4OXNA 2OKGA 4HWSA 1YZUA 4O08A 3LF1A 2V58A 2BFFA 4MJLA 1JSLA 1T24A 2BM9A 3DGFC 1T3TA 4OI0A 4WFQA 5D5PA 4RU1A 2UVDA 3M3DA 4K7JA 1FF9A 2GPJA 3A3PA 4DLTA 3JRNA 2QJOA 4LISA 3PR1A 3QE0A 3D3EA 2HU2A 2JD1A 3QTBA 3TSCA 4HL6A 4MAMA 5CDSA 1DTSA 4QYIA 2OORA 2YWDA 4HFRA 1O77A 1PEDA 1WDMA 2MMGA 4Q02A 3BFVA 5CJJA 3ZTTA 3WGGA 3OX4A 4F93B 1YFZA 4GKAA 4XVCA 3L84A 3SZOA 3ZCVA 4MI6A 1UINA 1XEAA 2HZ7A 4OQZA 1E1YA 3LPLA 4AG3A 1ZVKA 2GXQA 3L7AA 1AMNA 1Z74A 3UM9A 5BY2A 1EFKA 1F1BA 2WVJA 3QEMB 4YGXB 5K7SA 1PGPA 3DLHA 5DXFA 3OKPA 1RT9A 4IJQA 3STVA 4K9QA 3UXEA 1SKUA 3VYWA 1Z88A 3W3AD 2ECFA 4GSYA 4XLZA 3N2KA 3EPHA 2QYTA 1TIKA 1JJ7A 1WW2A 3JYLA 5D87A 2XT9A 4F4DA 1J07A 2R11A 4MYHA 5IAKA 1GZ6A 4LJAA 4BGVA 2C9OA 4EY5A 4PC1A 5JC1A 4DY4A 4EB0A 2ZI7A 1XUOA 1DVRA 1U2SA 1Y5RA 5DN6A 3R5FA 4AZTA 4Q7QA 5AIBA 1VMIA 2VSNA 4FFNA 1FNDA 4DW8A 3CCCA 1MT3A 1P73A 4R1SA 3B6ZA 4M60A 2C3OA 5ENZA 4LG1A 4WXMA 3R3WA 4A82A 4KDEA 3WB0A 4B40A 1R64A 1RWNA 3PFCA 4ECAA 4ND6A 1ICIA 4CBVA 1XTQA 3ML1A 4QBFA 2GD1O 4Y6PA 1QYRA 2R9VA 4FXPA 3I62A 2C8KA 2JIOA 3WICA 3DBHB 4DDTA 3UMJA 4NOJA 2QTLA 4DCMA 5IZCC 5D85A 3VNRA 3KCQA 2ONYA 3MQ2A 3Q3VA 3R74A 3NALA 1TAHA 3ZGVA 4BUZA 5DOZA 1IJEA 4IL5A 2CHUA 5HOQA 1ZK0A 1XCMA 3ACCA 1Y3FE 1TQ8A 5JALA 3X1KA 5LPNA 4BCCA 2OXCA 5JYBA 5K8JB 1SB8A 4V2IA 7MHTA 1J8QA 2BFNA 2GX6A 3O38A 1EZ1A 5K3FA 2R7KA 4KQ1A 5JWRA 2RG7A 1G8MA 4GZMA 4OP2A 2WFMA 3C7CB 1PKEA 2FZ5A 2Z3ZA 3LCJA 3PXUA 4ZQCB 1LPNA 3MNFA 5BNFA 2HA2A 3VPBA 3GMDA 4R6XA 1D2HA 2LE0A 3AR9A 2HA3A 4X0EA 4D3XA 4Z4GA 1JEJA 1EXNA 4OQNA 5GAJA 1GCUA 2VF7A 4AJLA 4EO4A 2WABA 3KFLA 1OJLA 3E81A 1U7HA 1XAIA 2Y6VA 2VBCA 4WFKA 4C14A 1P4RA 2W6OA 2X5JO 2PL1A 3G9ZA 5IK2A 3NM4A 3S3TA 2J33A 3L7OA 5JNRA 1GCIA 3DE1X 2QIOA 5KOJA 2GXAA 2X9VA 4ILEA 4O4LB 1YA4A 3AL3A 4MEAA 2YR0A 3F5DA 3ZY6A 4X44A 5D86A 1QAOA 2QLJA 4N9WA 4BO2A 1BVUA 2XBMA 2H9AA 3MWJA 3D3KA 3STXA 1T1EA 1OA1A 2VHQA 1ODFA 9MHTA 3VR4A 5JW6A 1RZ3A 4EPWA 1UPFA 2JEZA 3V4PB 3DZFA 1Z3IX 3RVMA 2RB4A 3DTYA 4WERA 4HFNA 1CS0A 1S2OA 5DBHX 4E0BA 4KQ2A 3GLGE 1BSVA 3B5EA 3UY4A 1UFKA 1GTJ1 1VECA 4N1AA 5IAEA 4CIVA 3GT3A 1FMFA 1K8QA 1T36A 3HDVA 4RGYA 2H18A 2N47A 4DUPA 1DUVG 1I2MA 3I9V6 3GJZA 3HLYA 2PFKA 1O58A 4RQTA 1JKMA 4BNMA 5I01A 2RH4A 3FM9A 3VDMA 3ZWAA 2QTTA 3R24A 5H80A 1ELOA 1JVSA 3CKMA 3RYFB 5CH5A 4C0KA 3ONVA 3IPCA 1BA2A 1QV7A 4YRQA 4DMMA 5ESRA 4AXBA 4CV2A 2BTEA 3T1OA 1JSZA 3Q9LA 1U7WA 4I9HA 4BPBA 1R8JA 4HO1X 4WZBE 4EF4A 2BEWB 2IYLD 1A9XA 3DDOA 4OEHA 1TD9A 4RENA 2VAPA 1TXGA 3UK2A 1GAJA 4MINA 5B5SA 4N7RA 4BYMA 4F3KA 2Q3JA 3OIWA 1CR4A 1SBTA 3LUBA 3AXTA 1EFHA 2AI3A 2FP3A 4Z9XA 4P38A 1FFGA 5KWIA 1EM8A 2X77A 4ZC8A 3V7YA 2O8DB 4C3ZA 1LY1A 3D2AA 3FAKA 3QW4B 3FPLA 1NI5A 1M2OB 3QBVA 1EVJA 3O4GA 3B9RA 1XTIA 4ZI7A 2W2LA 1U2ZA 1RAIA 2VH1A 2P4HX 2ZOSA 2QLBA 4R51A 5C7LO 3U7FB 3L8ZA 3D81A 3N1UA 3OP4A 1MRZA 4PWYA 5CW2A 1TQDA 1RWXA 3OJCA 2ECPA 3EYWA 4AUEA 3NTXA 3LZDA 3EIXA 1T0HB 2EQ5A 3GW8A 1WZNA 3F74A 3I42A 2VJAA 4DQLA 2WQZA 2IV3A 3A6JA 1L5ZA 1K3TA 1RXIA 1CHDA 3VZBA 4M0EA 3M6UA 1R6DA 4PYKA 1KVUA 5DB4A 4ZKEA 1D2GA 3MWEB 3WMFA 3IP6A 3K0HA 1I1HA 1E1DA 1H65A 1SXHA 1VJGA 2WFLA 4JITA 1YMUA 4GYJA 4JLJA 4QXQA 1YB7A 2XV1A 4ADSG 4KRFA 1IEXA 5I7UA 4Y0VA 3LCCA 3HV0A 1ID8A 4FJ1A 2PZMA 1CEQA 2LGJA 3F1LA 2YOHA 3LBIA 4EVQA 2BTQB 2C2HA 3BMNB 1C8LA 4U5XA 2GAJA 1YS2X 1A3CA 4HP8A 4I5IA 4XSGA 1OB5A 3ICQB 2QV7A 1DIOB 2QM0A 5KC8A 1E1QD 1GLNA 2R3SA 4NH0A 3FDZA 3D8UA 3I2IA 4KBFA 1GKIA 4PCLA 1ZMXA 1BFKA 3I4FA 2J5RA 4MV0A 4OU4A 4IRXA 3VNBA 5KTYA 4QXPA 5IT4A 2ETVA 2W37A 2JFOA 3PVCA 4YROA 4OMUA 5CG1A 1W0JA 2YINC 5AVQA 1C8KA 4PC2A 1W1IA 3JR7A 4BNIA 3F5FA 1J33A 5AXCA 1WF3A 6PFKA 4EY4A 2Z08A 3KQNA 3D3QA 3WYBA 4H7JA 4FOTA 3U3ZA 4I08A 1MQ8B 2OV6A 4KFUA 3FR8A 3FCXA 1K7CA 1QTNA 4JXZA 2QRJA 3B1XA 5BV0A 3QI2A 4MUAA 4EM6A 2PMEA 2ASVA 2IU4A 3HO6A 1UF9A 5JHGB 3DYIA 5DN9A 5KYXA 4C4SA 4G37A 1UDRA 1N8SA 2NZ8A 3A14A 2CL0X 1DTWA 3OWOA 4BCBA 4QUIA 2D8AA 1VBFA 4RHEA 1TEXA 1O6FA 3BMQA 2YZGA 3V3KA 4ZHSA 5C5DA 1RAGA 1P5RA 4J0EA 3A9CA 3RVJA 1OZ0A 4HWOA 5JAPA 1BD3A 4LVOA 1NN0A 2EEPA 3WGMA 4E5VA 1GILA 1Z0IA 1KK1A 4E31A 1DAPA 5J4KA 5IJXA 1R9GA 3SNKA 1N34B 3TKLA 4EFNA 3PRKE 3JYOA 1W36B 3ESCA 4I9UA 4AKEA 4RHTA 1KBOA 4A16A 4X62B 1IM2A 4FHGA 4EHLA 4KHZA 1O97C 4RAQA 5LYYA 3SYTA 3VKWA 4DQXA 4RV9A 2QW0X 1Y7PA 3RIHA 3M5CA 4L07A 4UCFA 4OG2A 4S1WA 2Y2VA 3AT1A 4JL8A 5KTKA 3N0XA 5EXXA 1RLJA 5ITSA 4LCBA 4XTRA 4C4RA 4BKRA 2JFVA 1E59A 1QSGA 1NBWB 2QD5A 3IVCA 2KE5A 4BFTA 2P91A 3OKAA 1YU9A 1ZX1A 3GEGA 1Y8CA 5DTMA 5B1EA 4J0JA 4BIMA 2IYOA 5JFOA 2ZPUA 2HC9A 1X74A 2B4YA 1VJTA 1QDEA 1SN7A 2EQBA 3L04A 2C2GA 1Z4JA 3NDBB 1BFDA 3SSOA 3O74A 1RI1A 2Q07A 3HS3A 2WF8A 3P52A 4Y9RA 2BBOA 2IL1A 5LZ8A 1S9DA 3K9NA 1HT3A 5IYZB 1D9XA 4KWHA 3UGKA 4B45A 3NDPA 4F06A 2OHGA 5DASA 1JXMA 3MT0A 1K97A 1EWTA 2HRQA 3ES9A 1DARA 3P9YA 3HB1A 4XDZA 3ZDZB 1V16B 1I9CA 2VZ9A 2H3EA 1XZGA 2F3SA 1QIKA 2YJ6A 4MQEA 4HB3A 3LYLA 2JVIA 4H6VA 4QJIA 5U4QA 1WA5A 1G9SA 3R2JA 3ETCA 4O4IB 3NTLA 5HCUA 3U3MA 1ZNYA 3JU3A 3ZYZA 5C8ZA 4L4UA 4MQMA 4PAOA 2J3HA 3I6QA 4CF4A 3E9ZA 1RCTE 3O5AA 2ALJA 3QPUA 8AT1A 1R6AA 1J24A 4GPTA 2RBGA 3CJTA 3U7QA 2CFSA 4LAFA 1FS5A 4BQIA 5HJ5A 1P1RA 3I34X 3N9IA 2HJRA 4K6KA 5ICEA 1J21A 3MHPA 5JD6A 2HRZA 1ZD5A 3BD8A 5IXSA 3ABSB 1MVOA 4DJAA 3M5WA 3LP5A 4B2IA 3ZHYA 1D5CA 1EVQA 1ZM4A 1FYFA 5BWMA 1DE0A 3PXCX 2CNLA 1R0KA 3I2JA 2YVLA 1P2SA 3MM4A 1N36B 1M2HA 2W22A 5C3MA 3JAWA 1BHJA 2C9DA 1RPNA 3WP1B 1UXHA 4C08A 3EW7A 3H0EA 5JSZB 2AN1A 3ODGA 3BSSA 3V97A 2PBZA 5HBRA 2Y4OA 1GTG1 2Q6TA 2I54A 1A82A 4FCWA 2WMOB 5G4KA 1DIGA 1SXPA 3GG9A 5DLEA 5AHRA 4YRCA 2C00A 3LBNA 1WNTA 2B36A 5TXGA 3DXFA 3U60B 3MWYW 2XYHA 4V0QA 3K8ZA 4NMWA 2XUGA 2OCGA 1UCFA 3I9OA 3JD1A 3CNEA 3OICA 5AM5A 4V39A 5JSUA 4BLTA 1LS6A 3PNOA 1R7RA 4XWTA 3ZGYA 2FDCA 1ECFA 1OD6A 1LPSA 3W7VA 3DXXA 4REOA 1JKJA 4LSZA 3VR6D 1WMDA 1GPLA 3CGGA 1Y6GA 1IWPB 2JAQA 1YCFA 1FNCA 1MFZA 5AOCA 2K2QB 4ALJA 1MV8A 4I5FA 4OL0A 2O9JA 4A8TA 1NQXA 1QE5A 1X7YB 1X8LA 5LSAA 3UJ3X 1M2WA 3T5PA 4MR7B 4V1CB 5GVRA 1MVLA 2FSFA 1DRWA 5JMPA 2Q6IA 5JO0A 2IEZA 4AK9A 2PMFA 3CF4A 3KYJB 2R84A 5C8YF 3UA4A 1NQUA 1YIOA 3M9LA 3A1CA 2V6MA 4L6IA 1ZI8A 1RE0A 3IJ5A 3N28A 2WM8A 2JBAA 2YX1A 1RDFA 4UMVA 3RC1A 3SEQA 3TQFA 3UJAA 3VM6A 4RZUA 3WZ2A 4ARZA 3EX7C 4TL7A 4V24A 2C9BA 2XMGA 2Z5FA 3ICOA 4TKUA 1PLJA 1U3CA 4EMUA 4IIVA 1SRQA 1NPDA 1QF7A 3LL7A 3BFKA 5AVWA 3HUTA 1I3NA 5F5LA 5EC8A 4IIXA 3U4QA 3FZYA 4Q7JB 1D6JA 2QOEA 2VNHA 4FSXA 2JNWA 2BLLA 5P8WA 1DJNA 2Z1DA 1EVYA 1V3TA 3M3PA 1KKMA 4DM4A 3RF6A 1ULBA 3ESQA 4M1SA 2QGZA 2OLEA 1CUFA 4AMUA 4QGSA 3F6EX 1XROA 3DF7A 3SG0A 1CIPA 3ECAA 3KOWA 3ZQKA 4ND8B 1X7DA 1AURA 4K5QA 5F21A 4ZOAA 3RS3A 3LA8A 4R8SA 4O2BA 4TSFD 5FPYA 4I36A 1L8AA 4DDWA 1ESEA 3I6ZA 1DWUA 3HZHA 1ZVVA 5EIEA 3AKCA 1W9MA 4IIDA 4QICA 1DJPA 2QE7A 2QLLA 4IINA 5COAA 3DT9A 1JN0A 5M34A 2ATVA 1WDLA 3H6GA 3GLSA 3KQTA 3O4VA 5C46F 2XYQA 5HIAA 4G8DA 1V43A 3FBWA 5C35A 2YFQA 3D0KA 4BWGA 3SZUA 3IVXA 1PBNA 3AILA 3VR2A 1OLSB 1H42A 2BF4A 4JDUA 2JKZA 3SFZA 4I1PA 2BH2A 2I7CA 2V6GA 4MMZB 2W00A 5KWSA 2R6CA 1E7MA 3ZH9B 1CYDA 4B17A 4DJEC 2WIFA 4NEHB 3L7DA 4L9RA 1TJ4A 1JU4A 3QVWA 4OQLA 2UUPA 2DZDA 2JA2A 3GJ6A 1ECPA 2VNSA 4HTAA 4JI6B 1C1XA 4DKJA 3AWIA 1FQJA 1VMEA 3BIJA 2P9GA 2Q8NA 3EEYA 4PZZA 4UBOA 3E8XA 5E7MA 4CR6A 3ERCA 3TZHA 1X42A 4KQIA 1AHIA 2O2EA 4JN6B 3HR7A 4R3UC 1LPAB 1ZJ6A 3T0IA 1NP7A 4B74A 2HCBA 4HEHA 4YCCA 5CA0B 4WZAB 5CT9A 3QWAA 4U7FA 2H9IA 3IMGA 3NKLA 4C2BA 2J7PA 1QK3A 3G13A 4MLZA 4HS4A 1Z2NX 5DHAA 3GGDA 4CG0A 1M1ZA 2AKYA 5LP6F 1MHTA 3CVUA 1A7KA 4X54A 2GN1A 1XQ9A 1CQIA 3UXYA 1IZ7A 5IU6A 4NBKA 2HSZA 2IITA 1V8PA 1VP3A 2I33A 2NZYA 3OE4A 4P82A 4RGQA 1MABA 2DFDA 5L4SA 1E3LA 5LR6A 5D3MB 4U1RA 1QZ3A 4HDKB 1WZEA 3I9LA 3L49A 1C8VB 4MDEA 4MAAA 5HNKA 3DV0A 1Y5LA 2EYQA 1IBSA 2QAGB 1QK5A 3JQEA 3ZKWB 1ADYA 1HKHA 1P75A 2V45A 3ZWMA 3V8PA 1XOIA 4BRSA 4F5WA 2V3VA 2VF8A 3CE6A 1I80A 5GVSA 2XCUA 3VR1A 4O0LA 3OZBA 1LRJA 3CW9A 1KPGA 1FDSA 3ED1A 4BVGA 1TYBE 3CSDA 4HVAA 5HF8A 5U1PA 4EJ0A 2NVWA 2ZJ6A 3QU7A 4MW0A 2CE2X 3R40A 4FZRA 4XIFA 2H2DA 2ZBVA 4F96A 1WKBA 1N7IA 4UUMA 3K09A 5KMGB 4UM8B 2W6CX 1ZISA 2HBQA 3EXEB 1OR8A 2VDMB 1UBGA 4JYPA 4B6FA 4FYKA 4AJHA 1NVXQ 3MJ4A 2HSDA 4MUMA 1HM5A 2WIJA 4Z9FA 4NCKA 2GRAA 4WZAE 3HXTA 4LDZA 1NJ2A 4KIUA 2CCKA 2RGNA 3Q7QA 1N3IA 4FMCB 2O3JA 3ESDA 4KVZA 4YP6A 4XCQA 3IE2A 2VP3A 3KKEA 5KNBA 2DTEA 3QEBZ 2E5LB 2J0EA 1FDOA 2RJNA 3TECE 2BCGY 1XHEA 3E61A 4KZPA 4BV8A 3WBBA 3K0KA 1H1DA 3JWIA 2GO1A 2I66A 3NO4A 2ARKA 1ZJ5A 1ZESA 1RVV1 5B58T 4BLUA 3E23A 1NJFA 3DMTC 4PX5A 3ZJTA 1DIAA 1O6BA 4WBNF 1AX9A 2JAXA 2HMVA 3QVJA 1L5HA 3ZGZA 3UJ6A 1R9JA 1A8UA 1MAHA 3MB5A 1G3UA 2YBDA 3PCRB 2H5EA 4AMGA 4CNBA 5HE8A 4V0LA 4C2AA 2A9QA 2N42A 1XK6A 3NHSA 4WDQA 3K4PA 5KO2A 3IOMA 1DIHA 3IIKA 1P2DA 1Z62A 3HGQA 4PSUA 4QAQA 4UEKA 2ZAMA 4OHZA 1NBME 4YR9A 1TVCA 3FYUA 1KSGA 2D8MA 1EDBA 3LP8A 2PLAA 2FN7A 2H9YA 3B60A 3QYAA 4PZUA 3WMEA 3DPSA 1BWSA 4IZIA 2OHVA 3KJIA 5BQFA 1Z16A 4MCIA 4EG6A 3FOFC 1K66A 3EIOA 4RLQA 1N33B 3AR5A 2FOIA 5EZYF 1ZD1A 4NLLA 1YL6A 1ATIA 1OASA 2FPKA 4NEGA 1R27A 4NMMA 3UZUA 3GI1A 2JD0A 3LPNA 3OZTA 4C01A 2A30A 4FBMA 4CNQA 3BH7A 2JGNA 1MMFB 2AOTB 1Y4ZA 3KUCA 5JAOA 1EH5A 4H3KB 4TVBA 3HU5A 1D1TA 2DGDA 3R5JA 1W4AA 4GPD1 2BFEA 1YB1A 1M2VA 1E2HA 4ICIA 4F2DA 2Y1FA 5CDUA 1U04A 4ARIA 5BUZA 3T3OA 4N3NA 4EY6A 1Z68A 4H35A 1NLZA 3R8CA 1PWZA 3RW9A 5AH0A 4F12A 3DL7A 3UB4A 1EQ2A 5H0IA 4H0FA 1DHTA 5DYTA 4BMCA 1RWWA 1FVOA 3FOEC 2JK1A 1DQSA 4LHVA 4OAPA 1M6HA 3KQOA 4B81A 5L40A 1EAMA 4BMZA 3FNHA 4RBNA 4M0CA 2I0FA 3TLCA 4KCGA 1Z12A 2HADA 1IY9A 1NZJA 4LSGA 1OH6A 3OD1A 1QS0B 4DV0B 2BR4A 3AVUA 5KNDH 4ROSA 3EXFA 1ONSA 2WZQA 1ODSA 4RPIA 2Q6VA 1FP4B 3Q9NA 5GGXA 1DV2A 1JECA 4E6EA 4E7OA 2Q2OA 2ZSKA 2X6TA 4WUVA 2C2KA 4DNOA 3KJNA 2RKWA 1IAVA 2A5YB 2V5AA 4G63A 3N59A 4LHXA 1SC3A 1V1RB 3VDXA 1YL5A 5CVVA 5C8VA 4HQLA 4GXNA 1NV8A 1ENOA 2JZNA 2W8BB 1T5TA 3K5HA 4GMDA 1Y6FA 3W5DA 4FZ3A 1WVGA 2RG1A 4RY0A 2JFGA 2HK6A 2IT1A 3D6VA 4NMLA 4GLJA 1I01A 1JX6A 2A33A 4QVGA 2RHLA 1BA3A 5MGBA 2ODQA 5HDBB 4XD2A 4GOLD 1K6IA 4F2GA 1JPVA 1MDBA 2C54A 4C05A 1IY2A 1Y8RB 2ZIAA 2QT0A 4J3JA 3NH6A 2WBLC 1YDGA 2HQ1A 2VT6A 2QI9F 4FD3A 1P17A 3RARA 4ZGGA 4UEQA 4OI2A 1T8UA 3BJMA 5LCXA 3UQZA 5IANA 2YV3A 1SUWA 2VNAA 4S35A 4Q1FA 2MCFA 3TOZA 2JI4A 1PGNA 4K6MA 2BPOA 2M6LA 2ECQA 4LX0A 1T3HA 1XRNA 4X60A 5FIUA 5LP6C 5GM1A 1LXCA 1H2FA 3HCEA 5DCUA 4B7ZA 1E77A 5KHLB 2PUJA 4H18A 4PE5B 3CXRA 3D8SA 4O6VA 4DRXA 1I6KA 2CFRA 4J4TA 4WEOA 4OB8A 3TEJA 3WNDA 4YRAA 5JZVA 3H83A 4HBZA 4BMVA 4MWBA 3RKSA 3X3HA 4D45A 3W7BA 1RJ9B 3OVMA 2BISA 1FDRA 2FETA 3GLRA 4RWZA 5KSPA 3ZQUA 4EW1A 1Q7EA 4HDMB 3UG6A 4E4RA 3OZXA 3SY8A 1NVBA 3SIWA 3I32A 3NGLA 4MLPA 4WJKB 1AV6A 2R87A 3NJ8A 4DMHA 1X77A 4QREA 1YSCA 3B89A 3P5BA 3I73A 1B1CA 4O4JA 4TV9A 3VJKA 4LF9B 2IEIA 4DC0A 1YCGA 5TF0A 4BWFB 5H70A 4L3WA 2XYGA 3JARB 1C0KA 2DFPA 4Q3NA 3H3FA 3KV1A 2NT4A 3CX3A 3GRYA 4LGMA 4XVQA 1H4VB 3P26A 3N0RA 4FN4A 4KRXA 2B2NA 3TYXA 2X1MA 4TRRA 1YIDA 3QVTA 1E79A 2O6HA 2QHXA 1R4AA 3HCOA 2QTCA 5CB4A 1H5QA 2GXSA 3AY7A 3RAJA 2YRXA 3GBSA 3K1ZA 4MAFA 3PA6A 3HJNA 1P2BA 1PAUA 5DFAA 2BFFB 5F5XA 5K0FA 1Y5MA 3ND7A 1IN1A 2B37A 2BKVA 2EHDA 2LKDA 4GDMA 3X0DA 4KDFA 1U0EA 5DYGA 1AGPA 1VE7A 2WI8A 3BRWA 2PGIA 5HF5A 3RJMA 5KI6A 3H16A 4JX9A 3HSKA 4TSRA 4MICA 1G8HA 3CIFA 4D8YA 1YZNA 3AJRA 4LMBA 3MCUA 4QYIB 5DIFA 2AFVA 1IY0A 4EG3A 1ZFNA 1DIRA 1C4KA 3WDSA 4QARA 2ZS8A 3O8BA 3I05A 1MJGA 1CS4C 5DI3A 1NP6A 1Q0PA 1NHGA 1KEVA 4JJEA 4CTNA 4U7PB 4KTTE 4XRRA 3T1YB 4XEHA 4F8JA 4N49A 5EAIA 1SG9A 3QBJA 1JNXX 1MB0A 2C98A 1G8YA 2OGTA 3HO8A 3SHOA 3IQEA 1A72A 3W5VA 4EHKA 3V55A 4HTFA 2A1IA 1RS0A 4ZO8A 1YGPA 2O8VA 3G0HA 1KZ1A 3RWOA 4BASA 4NOLA 1J4AA 2WHQA 3TLBA 4B2LA 3NT2A 4EGCB 1HZJA 3BIXA 1W49A 1G21E 1QGAA 1BD4A 2QZJA 3N2KB 1OQAA 4E2FA 1TVKA 1C41A 1VJ0A 2DKOA 3H1TA 2FEWB 2XDYA 3H9BA 3OUZA 4LWOA 3FTCA 1DQPA 5A3SA 3T7SA 3FOZA 1H5NA 1VHWA 2BP7A 3E9QA 3PC2A 3SX0A 3V46A 1KHHA 2QRHA 4P98A 1NVEA 4LFBB 1YJBA 3D2CA 3OZVA 1YI1A 3FHCB 4MR9A 1N8NA 1I6LA 2FFBA 2OBXA 4PHTA 4GKBA 4ABYA 4Z9YA 4CL3A 4CQNA 3EHEA 1YUBA 3C16C 5EJIA 3C3AA 4YQEA 1P7VA 2C88A 3EIUA 4DYVA 1UMDA 1Y3BE 1Y6RA 2D1RA 2NO0A 3AX6A 3CLHA 3U4AA 1U7TA 2R1ZA 3AFGA 5FL3A 2W83A 1TQ2A 5CVDA 1YMQA 3PHCA 2PLNA 4UAUA 1CDOA 2RHMA 1U8UA 4JOBA 5DRYA 4BNGA 4GYYA 1Z35A 3KC2A 4D81A 1OE0A 1PQUA 3ANMA 3DE2X 3HYRA 4L50A 2CEAA 5FV7A 4IUDS 1ES9A 3ZG6A 1Y9EA 5KQRA 5ENVA 4DG8A 2IPLA 4HQKA 2GZHA 3DA8A 3K1AB 4B3CA 3OCYA 4H0NA 5A4JA 5K0EA 1YC2A 2CXSA 1MQ9A 2BW0A 3CUKA 2GEUA 3COZA 4M53A 4IQ4A 3VI4B 2PX8A 3LUCA 2CZQA 4D41A 4KN5A 4NV3A 1FFWA 5JYDA 2XZDA 4ISCA 2ODNA 5K3FB 3R3UA 3V9AA 5JARA 3JVUA 2CYAA 1L5HB 3I3SR 3RRFA 3E0QA 1WW3A 3C3MA 2CEKA 4OGKA 3A6GA 3KT6A 1G20A 4TYQA 5B55A 4LJ7A 4H31A 2VBGA 5K0JA 4OQXA 2G5TA 3ELDA 4LYGA 5K6TA 4RA9A 4Z4EA 4GL2A 1RLMA 4GUAA 3SPXA 4FYJA 4ZIRB 2CBGA 2C84A 1E94E 2HZBA 4IFEA 2AG6A 3DZBA 5AKJA 2EDAA 3HJCA 4B6SA 5A3QA 2HLDD 5IEJA 5GJCA 3IA2A 4BQSA 1ZIYA 2IELA 1FRFS 2POQX 3K7EA 3KJZA 3M83A 3L0SA 2R8ZA 1UQRA 4R1UA 1SCJA 5B1SA 3BCUA 3KCNA 5CHYA 2QI9C 3JASA 4MS3A 4ECEA 3RRNA 4BLQA 1Z5OA 4AMZA 2IYRA 5G3ZA 3IOBA 4ZQGA 4CF6A 4ARVA 1UBUS 5F9MA 2YOGA 3DBRA 3IP1A 3V6MA 1QZTA 3DOUA 3H0CA 4BLOA 1CS0B 4FNAA 1O87A 2DG2A 1F8GA 4OQ4A 1KSJA 4YQYA 3KAPA 5CFNA 4D8TA 3GFFA 1PNVA 1DAFA 2I03A 3DZ8A 4JGBA 2J0VA 3BREA 3SNHA 3VR5D 4LECA 5HZHA 2YC2C 4AUMA 3C5WP 2NO1A 2FEMA 1LA2A 4HPJB 1P7ZA 5K1ZA 3T4UA 4CQMD 1T36B 2Q2WA 4ER5A 2JIMA 4N3AA 1PKXA 1DBPA 1V2GA 4KXYA 1AM4D 2E3JA 5KJEA 3S0JA 3ZHBA 3FD8A 2JHAA 1T9HA 3I9V1 1IN6A 1YU6A 4MRVA 2YW9A 5FO1A 4LIPD 5JUWA 2FHPA 5C51B 3HY4A 1RXWA 4CDMA 2NQ2C 1C9JA 2HV9A 3W5BA 2PUEA 1GYQA 3LTNC 2PT5A 3RYHA 3TRIA 3UT5B 1QJCA 3K9HA 3WRXA 2HNBA 3A58B 4LQ4A 4D3ZA 1FDVA 2O1WA 1Q2XA 4JJKA 5K2MA 1YF3A 1KYQA 1A9XB 1U90A 3H19A 4JR0A 3ZDXB 1NUUA 1CB7A 2C2XA 4RLFA 3SZ3A 2IA5A 5EKDA 1PJ4A 1Q11A 3DNPA 3C6YA 1RVDA 1NVFA 1PR6A 5REQB 1Z39A 4YUWA 5FJJA 5EJ8A 4L76A 4XX0A 5BR8B 1V3VA 4DCSA 4BWVA 3ZJ5A 1E2LA 4M36A 1USGA 1YJCA 1EM8B 1T6ZA 3UMCA 2Q21A 4N5LA 5B3JA 5BQ5A 4US2R 4KR3A 4COKA 5H9WA 2VJYA 3VKGA 1S96A 5D5HA 3WGIA 3TRFA 1ZMBA 1JMYA 4ZI7B 4YGYA 2NSHA 2X4DA 1V9LA 1GL6A 1QIIA 1V8OA 2DH5A 2IW3A 2ZBRA 3DLAA 1JHDA 4I50A 1KZYC 4RAOA 3SKYA 4KXWA 4ZCMA 2IC5A 5CCEA 1ZSNA 3U62A 4ZICA 2D7DA 1AQYA 1M8FA 3IRVA 5DGDA 1C1YA 4IIHA 1FP6A 4FJ0A 5CNMA 3IUNA 1U3GA 2XNDD 4HAYA 3ROZA 1JG2A 2R8EA 2DPHA 3DDUA 2IXEA 3NIFB 3B5JA 3UC5A 3O4JA 4MW2A 5DNEA 4MS4B 3ZU3A 3ETEA 3L77A 3QLVC 3GDGA 2WFLB 5C53B 3W5IA 2QVZX 2ZZMA 3K1YA 3LWNA 2YUIA 3AUAA 4CUKA 3GGOA 1CUYA 3B1JA 4F60A 2E85A 1D0IA 1TU0A 1FTNA 1B8VA 1P6UA 1NBHA 3LX8A 1Y3DE 3RU7A 4E3WA 3BSFA 3NTOA 5LM3A 2QR3A 4H3VA 2H1FA 3RRXA 2HA7A 3KSUA 4LPSA 5AW5A 1QUFA 2QJFA 4RJJA 1J8FA 1ZIPA 5E9JA 5F76A 3DOIA 5B4VA 3U37A 4DC1A 1DAKA 1U9IC 2CJYA 3PDIA 4HK4A 1QCCA 2D4AA 3JWHA 3FDZB 5EPUA 4RHFA 1TF2A 2WVGA 2EL7A 4G5SA 3P5SA 1INLA 1Q95A 3OFSA 4XCXA 5JBNA 3BRCA 4ZHQA 1SC6A 1XI2A 2Z09A 1GYRA 3H7IA 5GZ3A 1XVAA 2XXBA 1T1JA 4BE9A 2GBGA 1RRPA 4K9KA 1VE5A 4XX1A 5KTSA 4TT3D 3BXXA 4KOAA 1UP6A 1O5TA 1GG5A 1GV1A 1WB4A 2VDJA 2YXEA 3I09A 1XO1A 2BGJA 3OTGA 5CX1A 2E4YA 4HUJA 3HC7A 1JHXA 1D3AA 2ZU6A 3PUZA 5A2QA 2WU3A 4QX6A 1TMOA 1SCNE 1BS1A 3MA0A 4YCNA 4O2AF 1Q0HA 3RVDA 1YONA 1RD4A 4Z0NA 1QHIA 1DU4A 2I2CA 5KYXB 3OAAD 4E46A 4WNCA 2R68A 3C4VA 3GUZA 3SYMA 1Q1BA 1XDZA 4F3RA 8ATCA 4YRBA 1DTWB 1K4MA 1PWYE 2P67A 2WT4A 2WQ6A 4MYUA 1N7GA 3DDNA 3BMQB 3CMMA 1KO7A 2UZIR 4OXRA 1BXGA 1W19A 1B6GA 2X5NA 4RD0A 4LXUA 2AXQA 3G23A 3J81A 1I3CA 2CLIB 2K6GA 1FTWA 3BWXA 2HLNA 2FJ0A 2J30A 3LDHA 4L0DA 3AHIA 4ZYYA 3GGCA 5B7GA 3LXMA 2XZOA 1ZOSA 3C8MA 1QMGA 2W6JA 3JV7A 4GKVA 3WMWA 3A3OA 3N2NA 4ZAFA 5PNTA 3VR2D 1AUQA 3FPEA 1HQDA 1TF7A 2E0IA 3H3XA 1U5AA 1VYHA 2QVXX 1F0KA 2YV2A 1ACJA 3THYA 4UVIA 4KEAA 1F5SA 1E9CA 3RC3A 4L7QA 3LDUA 4U02A 5EFOA 2AZXA 2WNIA 2ZIXB 1Q0RA 4Q24A 4EO9A 3DM9B 1XIVA 2AWNA 4JHLA 2LD4A 4IBOA 1FMLA 4OB7A 5EKXA 1XMOB 4EYQA 1A9SA 2AF4C 5J63A 5I4BA 3CCBA 1NVVQ 4EJ2A 4M0MA 2OO5C 3RVNA 5F98A 3Q0EA 3DFZA 4UDNA 4J0FA 2R48A 1LC3A 4PHHA 4DR3B 2J7PD 3DQZA 1WPXA 3L6EA 3IMCA 4KGDA 1Z2DA 1I6MA 1UIMA 2V0CA 4FHCA 4Z4HA 2OBMA 1L7DA 1GGFA 1SKYE 2QRUA 2AEFA 3QYJA 4ACAA 4UBNA 4L3OA 4G0VA 3LTEA 2JGFA 2EKZA 4LQCA 1JSCA 2IHUA 1KH2A 3IEXA 1Z0KA 4LPKA 1T2UA 1TLLA 4UD2A 2HUNA 2D4HA 2ZBFA 4G6ZA 4CQMB 2OY0A 1XQ6A 3RFCA 4MQEB 1P6XA 3D1VA 2XNSA 3AW9A 3OOYA 4RHCA 3WWZA 4EYGA 3I6BA 2Z04A 4G26A 1PEAA 4MV5A 2QX8A 5AKKA 2ZULA 1Y1QA 4XQGA 5ARCA 3MEQA 3I01A 2X5OA 4G1FA 1KP2A 5IBCA 1ACMA 2IUEA 3V48A 1G4AE 2BHSA 2NAPA 3E9MA 3JQ9C 5E9WA 4EF5A 5KDDA 3FNFA 3U7QB 2V6BA 3IALA 3OTHA 4HB2A 4QUHA 3C3BA 2C5AA 1VIYA 2UZ3A 4B31A 2WC1A 4YV0A 2B4KA 3AESA 4RLHA 4X7RA 1O3YA 2CYBA 2RK6A 2IOFK 4IIGA 4PO1A 4ITRC 4I3GA 3I6YA 3T7CA 2P9HA 2WMDA 2PO7A 4J2TA 3RADC 2WHPB 3RSSA 3H6HA 4HVCA 2HQRA 1EVLA 2CL5A 2RH8A 2EBHX 3JAWB 4K3UA 3UV6A 2AG0A 1HDCA 5JTTA 2W90A 3IPAA 5KAPA 3KSBC 1DRKA 3ZVKA 3EC7A 3FI0A 1OXXK 4YMSA 3EPJA 7YASA 2PUFA 1NONA 4FWBA 3GY0A 1KEEA 4BL5A 2EX1A 3DD5A 3QV1A 3UJHA 4I7EA 1I2DA 3UGTA 4ROTA 2ERCA 4IH9A 3DEIA 4YWJA 2VI5A 5JH7A 4NSNA 3O4HA 1F8UA 1P31A 1TUBA 2Z43A 1CDEA 4FNGA 2O1XA 4BKQA 2GAOA 3Q4GA 1QP8A 2VJDA 3GROA 1XNGA 4NC9A 1FQKA 4R1QA 3ZCUA 2JK0A 3GU3A 1D03A 1MW8X 1X7HA 3LQYA 1A8QA 4GS5A 1Z0SA 3KWJA 3NEAA 5EG5A 5ETJA 3ZEAA 4S0XA 2VSQA 3CNHA 3H11B 3JAKA 2OUIA 2Y1EA 1P2VA 3OC6A 3ZGOA 5CXQA 5IF9A 3MWFA 2VK1A 3OOJA 4JH0A 1CZNA 1CERA 2YRFA 3CX8A 3LC2O 3U40A 1PFUA 3VV2A 4M76B 4R0VA 4XPZA 4QO7A 3WV4A 1NN1A 2WICA 3QYPA 3GRAA 2APJA 2VF2A 3O7WA 2GQ0A 1PNTA 3N5KA 4GPBA 1O54A 3OX2A 1N2OA 4PYLA 4BKPA 4J49A 4X71A 5AK3A 2JBAB 2X8LA 4V0RA 3UAOA 4ARZB 4EKNB 2A1UA 2WK1A 3H9UA 3LV8A 1SQ5A 3G88A 4W99A 4XYGA 4IQFA 1RKQA 4KDRA 3FGOA 3CNLA 3CH5A 4TKUB 4B3SB 3M82A 4QYSA 3DBVO 1N5MA 3L93A 3WNQA 2WE8A 1PL7A 1M8JA 1R0XA 5FF9A 2OSBA 4IQ8A 1CRWG 1KSFX 1R2QA 4XLLA 1XELA 5AI9A 5A4DA 4Q03A 3AHCA 4DUYB 3U4QB 2JLRA 2HR1A 1OUMA 1QQ7A 1H4QA 1U6KA 3NXKA 2ST1A 4CCWA 3LP6A 1D9ZA 5FLYA 3NOXA 4RELA 1KYTA 3ND6A 2YIDA 1FFAA 3EGCA 2ZJ2A 3LT0A 3IJEB 3BXFA 1NY5A 3MTEA 3FFBA 1W87A 2PD6A 4QDUA 4W7IA 4MSUA 2FSUA 1FP2A 3D3WA 1PV2A 4BNWA 5CAEA 3DLBA 1ULAA 2H1RA 1N5RA 3H1GA 1XZEA 2J6CA 4PC3A 4RMIA 3WXBA 2UXBB 4FDAA 1I30A 1UPTA 4O2BB 1PUXA 5H4HA 4EHNA 3A4VA 3L0CA 3TQHA 5AUNB 1E5LA 1W34A 1JFTA 4HMPA 2J5BA 1ZIDA 3BIFA 3IV7A 4JBWA 3IVGA 4BKMA 4ZMRA 3UMSA 4XGRA 4O4HA 1EUZA 5ICFA 3VNUA 2QQEA 2OFOA 4BMNA 1HDGO 1JI3A 4ZQEA 3BG5A 2WUEA 3T9BA 3DKKA 4H4EA 2XUOA 3HYLA 1AQUA 4JS0A 4XWYA 1P77A 2YJGA 1AKMA 1CV2A 2HCRA 2RKOA 4P7BA 3TG2A 3GEBA 3MZ0A 4NBNA 2XNJA 4KYVA 3NHMA 1HLDA 3N8IA 1X87A 2R25B 4EG8A 5FPKA 1Q83A 2ZUBA 1U0JA 5DK4A 1S89A 1C1XB 2ZB7A 3AU8A 3HGMA 4UUBA 2OD7A 3GF4A 4AULA 1UWKA 3UK6A 5K0GA 3LNCA 3LCUA 2F43A 3N7TA 1GPWB 4XOIA 4KBYA 1NXOA 2Z9DA 2QF7A 1VSVA 3QOXA 3PHIA 2H16A 3VYRB 2XUQA 4C43A 4K9SA 3HB4X 4AZWA 3TBKA 5F5NA 3NTUA 3EH2A 5EWMA 4KXUA 4TVOA 3AC0A 1J0DA 2OESA 1S8FA 1RMTA 4C04A 5I7WA 2OA0A 2ZUWA 3BQMB 2R96A 2F9LA 3NS7A 5A3VA 4H4CA 3U9SA 3ZHUA 2DBQA 2DRIA 4E1AA 1PK8A 2H1VA 2JJMA 4DQDA 2Y0CA 1SUSA 4DLWA 4LWZA 2PX5A 3TLKA 4ZAXA 1YJQA 3JD2A 5LA6F 3IL2A 1XYVA 3KYIB 1X39A 2UYOA 4KYTA 5AR1A 3D31A 4UBJA 1MABB 3V8QA 3TXAA 3KXKA 4PHGA 3M6IA 3BWYA 4QAJA 1OI7A 1XC7A 1S4MA 1YRBA 3AKEA 1N8KA 5TJ9A 3DV0B 1DXOA 1W7AA 2VPYA 4BXOA 1N5LA 2G9ZA 2BRUA 121PA 2Q6KA 3FSEA 4NE7A 1IWOA 2E9SA 1ZU4A 3P0EA 3RFUA 2ATCA 2F3RA 3OJOA 2OCPA 3WGYA 3HM2A 3AHHA 4CGYA 5HKKA 4RZHA 2EFJA 1W5BA 3RB8A 1MJFA 4QL3A 3DDWA 1JGTA 4YIKA 3T7JA 5FWYA 5JLJA 1NKTA 5CGQB 3STTA 1GPJA 1VL8A 5ELLA 3T54A 4M9CA 5KQSA 1WHSA 5AVVA 2UXDB 1HE2A 1UXGA 2VP4A 4DABA 5J1SB 1QWOA 1ZC4A 4JROA 1R5OA 1YVEI 4QOJA 4RE6A 5B2ZA 1UWCA 4IMRA 4F9TA 1SR8A 2DCUA 4K8RB 4DJJA 3OFND 4F85A 2W2MA 4WKBA 3IUYA 1WPQA 4R8MA 1SK9A 2GF2A 5ENDA 3N0VA 4ZOQI 1KAHA 1ZW6A 2HMSA 5DBIA 5KPDA 2HO4A 5CNIA 1H3EA 5BOSA 1SZCA 1LB1B 3HUFA 1GLGA 1S1CA 3UWDA 2AVNA 4X1OA 4AROA 1GSOA 2I7XA 2JFZA 2R6AA 3TD6A 4UE3S 2Z4RA 3MOGA 2O7SA 4UU8A 3T15A 5DM70 1QO7A 4DMUB 5DW3A 4F97A 1HKUA 3L6BA 1MORA 4C7MA 2J9ZB 1NLMA 2D6FA 4IO1A 2PHZA 4KNWA 2D0OB 3BCHA 3CZMA 4LYYA 1SG0A 4B3FX 4DZRA 4JLAA 3URMA 1XNJA 4F56A 5H81A 8LDHA 1XCBA 3LSTA 4FNMA 1PFVA 2MYPA 1JJVA 3PPWA 4RPKA 2CJPA 3KSZO 2PSDA 2ZYRA 1O95D 1NMZA 1GN9A 2JF0A 2GPSA 3F4KA 3U7IA 2J3EA 2HI0A 1VDMA 2GAFA 2QVBA 2BZGA 3M4NA 2AFIA 3GFPA 4C4AA 2BN4A 1C7ZA 3ENKA 1OREA 3M5PA 1W6UA 2OCKA 3FYUB 4RF3A 2QZ4A 2E37A 1J22A 1KHTA 1RHUA 4MQBA 3JXEA 3T1QA 2BEUA 2RBKA 4XGKA 5BSTA 4YLYA 1AKYA 4OUDA 2A35A 4QC2A 4XIJA 1C2YA 3GEEA 1GFIA 1UBKS 2VRNA 4WOPA 5IJAA 5HF6A 2D7CA 4D42A 4IVPA 2VJQA 4KREA 1K4YA 2NUPA 5AKYA 5IN5A 4F3CA 5K0TA 3FFWA 2GWRA 3ED5A 4ESHA 1KZ7B 2YW2A 1HFEL 3IYLW 2PQ2A 3KJXA 5AXAA 3AO0B 2GMWA 3W8FA 3IESA 3FOBA 4DWWA 3V1LA 1FUEA 1ZCBA 3M5DA 1QR6A 3VOTA 2YYSA 4JVMA 2BFEB 1M2JA 1M2VB 2XUAA 2Y0DA 4GMHA 4NYMR 5B6PA 1FRQA 2FEKA 5IT9A 3SI7A 3KAKA 3OO0A 1JDBB 2CJWA 4N01A 1ADFA 2BE9A 1GSAA 2AN4A 3Q7PA 1KTVA 2M32A 2ZRLA 4F7WA 1TZKA 5FB3A 1T5HX 1U80A 2G08A 1K5PA 4IIEA 3T0GA 2FWIA 1LVHA 3HSSA 1NJ6A 4H7EA 4WWHA 4EH1A 3PTAA 4G5XA 4NZ9A 4D4MA 1QHEA 2HHCA 2PX4A 4YI3A 1H2ZA 4AZSA 3KB1A 4HADA 4CTJA 1BC5A 4ERXA 3PITA 4E4YA 5I5GA 3SZMA 3PE6A 4DWJA 4ARCA 1M6EX 2Y1LA 1BHQ1 2PAFA 4F6CA 2E7ZA 1VL1A 3HNPA 4P36A 3EXFB 4D4JA 1OC2A 5DM60 4IDPA 3R9IA 3MBKA 4K88A 2GPTA 5FI3A 4PBTA 1N3LA 4OHMA 1XA4A 3E8MA 4UUAA 2ERYA 3AR3A 1C80A 4EHJA 1L8OA 1GPAA 3U6BA 2O0MA 1K68A 1WE2A 1ORIA 1OLOA 4L78A 1ONNA 4D9GA 3UMYA 4JOCA 1UJCA 5TQ2A 3GLKA 3RT1A 2C9CA 2PJUA 4IX1A 2QVGA 1DXYA 1ML3A 1I1QB 1ZNQO 1TM5E 2D1TA 2VL7A 2PH3A 3DG9A 4F3NA 2PVCA 1KE1A 3EXAA 3UJDA 3E53A 1HI9A 2RC6A 3G0GA 3EZ7A 4WNYA 9ABPA 3TNLA 5EIHA 3H9CA 2HW8A 1GUAA 1I5OA 3EIWA 3LPMA 2CXUA 4QM7A 3SCZA 1XTRA 1OT3A 2I55A 5C1PA 2D0PB 2DTDA 4HNAA 3K1TA 4V0SA 1ZH8A 1KXJA 4A0HA 4RY8A 4UASA 1ZMRA 2JAHA 2MINB 2HJ9A 3K96A 3OOSA 5DSTA 1E32A 1GKYA 3O6VA 4IYRA 3R4CA 3DFMA 4JUAA 1FLVA 1L7NA 1GL9B 4GE3A 4UHFA 3ANSA 2ZUEA 2RHGB 3H4IA 4GHWA 1YOVA 3EY4A 1FSFA 2FMXA 4XKJA 3LX4A 3JSXA 1IOZA 1YASA 1NU6A 3U26A 2IBTA 4GL4A 2X9GA 1FW6A 1G7TA 3NGMA 4HH1A 3OUTA 4KSBA 7REQA 3QEKA 4WXYB 4DT1A 3C4JA 1E3WA 3AF0A 4IFTA 2HUPA 3WA7A 3DO5A 3MMPA 2QTNA 2OFWA 2WYHA 4O4JB 4TV9B 1GN8A 4J1TC 5HRAA 5KKNB 4FWIB 4RVCA 3ZCSA 3PGMA 1KBZA 2CCJA 3RUPA 3V80A 1T4CA 4TZTA 1T3ZA 2Z4TA 1NE7A 1Z18A 3E9YA 3KVNA 1SVIA 4FW8A 2BFCA 2CBZA 4UEOA 1L5KA 4NZMA 3MHTA 4HDRB 3CLUD 4CFYA 3ZIAD 1E1RA 4QE3A 2WWIA 1VLZA 1G17A 4LZWA 5DHFA 2MSNA 2X76A 3RD5A 5CEJA 2GUWA 4FDMA 1M83A 3TQTA 2V03A 3CQ9A 4F71A 3BB4A 4M89A 1RHQA 2FKAA 5AW0A 5CB4B 3VTKA 3I0MA 3RWMB 4Z4IA 3GMIA 2V6FA 4DV1B 3TMAA 1KZ9A 2CFIA 3RIGA 3RV4A 1GGMA 3UKDA 4H6WA 4W9NC 5CT5A 2QWXA 3UWPA 3GNQA 5EP3A 3LGAA 5EJ6A 1T4DA 3KSAC 4X7BA 1TT5A 3DMYA 2ILTA 2FZLA 5A0FA 1USUA 3DZIA 2H85A 2XUIA 1DC7A 1Y7TA 2N9UA 5IFKA 4IZ6A 1UZAA 4MW6A 3QITA 3TBFA 2V7QD 5K8LA 1JI0A 1OXTA 3AKZA 2WSMA 1G3IA 3Q5DA 2AC4A 2VHEA 3DNMA 2NSYA 4N7MA 1I0IA 4FFBA 2B7LA 1HSZA 4YJ2B 5BW6B 5DI3B 3ORSA 3A1FA 5E4FA 4EENA 1I3KA 3LX6A 3OE1A 4XQ0A 4YV2A 1VG1A 2O19A 4Z4CA 2IYEA 3T3NA 3TOXA 3N58A 5I5EA 2CF6A 5AJUA 1C8BA 1Y4SA 2JAWA 4HTFB 1HK7A 2NIPA 5JAMA 3WQSB 2FPIA 1Z5PA 3TIGA 3RVLA 3VO2A 2XADA 3OP1A 3NT4A 1P2UA 3VYVA 5JNTA 1DX6A 4RPLA 1BCRA 4WKGA 4X90A 5EXPA 3NUZA 2PUVA 2I7DA 4BDTA 5KOYA 2VQEB 1TVKB 2HPHA 3QE9Y 1YV9A 4R68A 3RABA 4YP1A 4I9FA 3SWWA 2BP7B 3NHJA 5HILA 2C82A 2VNKA 3VTFA 3IOYA 2ADFA 3FVRA 4C4PA 1F6BA 2JATA 1CIJA 1JMVA 2PRJA 4K6HA 2IDMA 4N18A 4QG7A 2HJWA 2VRBA 1T2CA 1NDUA 2GD0A 3G7SA 3J7TA 3P2MA 3Q88A 4JJGA 4V38A 5FAXA 1XZPA 3UCXA 2IYZA 2FWMX 2YHAA 3EDOA 3NDIA 4PXYA 1V5EA 2WJIA 2C8VA 2LNDA 1UMDB 2EVWX 4MJXA 4S12A 1HDXA 3UMVA 2VOEA 3RFTA 4D7AA 1OI3A 4IMIB 2A1TS 4RZQA 1QF9A 4TXHA 3FUXA 4KDCA 2WM2A 3L1VA 2REQB 2ZBUA 3E6AA 5ALUA 4WN9A 4ZOLF 3FJYA 3UYKA 5JZBA 3SDSA 4LBWA 1BWPA 3CM0A 5FRDA 1JRLA 1PVVA 1JKFA 1OPRA 1ZHHA 1ZM9A 3ASZA 4BNYA 4PSAA 2F17A 4K2AA 3ZVMA 3OECA 1KMCA 1EP1B 4M6WA 5A02A 2ODTX 4IY1A 4L9WA 4EUKA 2AQIA 3TGPA 3G2MA 3VNSA 3AEXA 5JTUA 3COSA 3IMFA 4DIOA 5ALLA 5G02A 4OSEA 4C0HA 3MBOA 1SIUA 4O8ZA 4U6NA 4PQFA 4WXEA 3WLTA 4BYGA 4NBLA 5I6DA 5IBPA 4MGZR 4DBLE 4A0FA 4D8VA 2Q5CA 1JHVA 1Z5GA 3F90A 5DBEX 4UTRA 5C1OA 4DA9A 1FOEB 4NK5A 4I8IA 4MEJA 3NPMA 1G20B 2BHTA 1JXQA 4RYLA 2AOXA 2O14A 5IJ0A 2CD7A 3IILA 4ZTUB 2AK3A 1GKKA 2R86A 4X1KA 1PZFA 4ZAZA 2DHEA 4BX0A 4M2LA 4OBXA 5KQPA 2CHEA 4WNAA 4CIXA 1RZRA 1KRXA 5JCZA 2R0QC 1W25A 3TTWA 2C2WA 4OHKA 3PX2A 4BC0A 3GIWA 1SIWA 1DG1G 3O95A 4GI3A 2PV0A 1QYDA 3B1VA 1RM3A 3JASB 2FQXA 2Y1KA 4MS3B 5FJIA 4G4JA 4FWTA 1MOPA 2ZI6A 2X8JA 3OFJA 2FR0A 3LDGA 1LVUA 1ZOPA 3DCJA 3ZWXA 1A7AA 4NZPA 3DBRB 4BJ6A 5EJ7A 1FP1D 4LRTB 4PONA 2J8ZA 2YV5A 4ZFNA 3F5QA 5JCPA 3VDQA 1P33A 2P69A 3ILSA 4KN6A 3S40A 4MRNA 3I5MA 5AJXA 1AT1A 2IY7A 2G9RA 1BDIA 4B3TB 4QEKA 3O4RA 1RTTA 3BN3A 3PNKA 3Q6IA 4U8GA 5GV7A 4B3RB 2FG6C 2PL5A 4PHCA 5JPCA 5JXJA 1P9NA 3KKLA 4OHOA 4YCLA 4M7OA 1G20E 4Q1BA 1NFQA 1EZZA 1P3DA 3IB6A 4ZYUA 3Q6MA 3K5WA 5TQVA 1M6VA 2NPOA 2W2NA 1HLFA 1NT2A 2JW5A 4TQUS 3G59A 1JFFA 4DSUA 4UBLA 3LYHA 1UM8A 1V5GA 1N0VC 1XWIA 2QY6A 4OI4A 2F2TA 3RYHB 5BV7A 5JY1A 4CUJA 2VNIA 1GG9A 1SURA 4N54A 2VQ6A 2IYWA 1HEUA 1K0UA 4QXOA 5KSOA 1DO2A 1Z4QA 2F1HA 4KMSA 4CQJA 4QLBA 5LYJB 1A9PA 1XFAA 5GV8A 3WQHA 5L9AA 1NG9A 3DHNA 3K9LA 4XX0B 1ECGA 2BVNA 3LQ1A 1FMTA 3OZFA 3LIPA 3A9SA 5JBIA 3A4NA 1QGDA 1GFSA 1TE2A 2YHSA 3L0IB 3QXGA 3I92A 2PAAA 3BRQA 1VIMA 3AH8A 4NFLA 4GZ3A 5IM5A 4BEBA 2JRLA 2P41A 4JASB 1SPXA 2I87A 1XVTA 3RS9A 3EIHA 3C5CA 1QIMA 1SJ9A 4HDNA 3PIDA 4ZOEA 1SHTX 4AM8A 2PZLA 2C8LA 4GKKB 4LFCB 1V48A 1TJNA 3RI3A 2FB9A 2P4SA 2GHQA 3T4PA 1P1CA 3IIIA 1E98A 3CT4A 4I50B 3GRZA 2JHPA 5A5DA 3T9EA 3D7RA 2Q1WA 5DHQA 2PL9A 1KQNA 4G5FA 1A2KC 1TC1A 2EDCA 4HLUA 4QBGB 5TS3A 3GJ0A 2DUMA 5AJYA 3IMEA 4QYTA 3E2IA 1EE9A 2RK4A 1NF9A 2CNOA 4S2EA 5AT1A 5CM9C 3R7WA 2QN6A 3S1AB 4ETIA 4EW6A 2NYAA 3S55A 4H1TA 3OF3A 1KP3A 1V8BA 5I4CA 1D0VA 2QP3A 3KZMA 4MVJI 4QUEA 3TQCA 1EP3B 1RW4A 3HNOA 4M83A 2CCGA 3RSZA 3TW8A 3QX8A 2WP8J 1PVOA 1FFEA 5EP1A 2QMZA 3P7MA 3SMVA 2AMLA 2EKBA 5EXTA 3K9FC 2P3OA 3DBIA 3EFHA 1RXVA 3VO9A 3ZV7A 3DFUA 2PLRA 3P9RA 4LDPA 3T4EA 4IDOA 1YE3A 3K73O 5TVKA 3K09C 4L28A 3TJZA 5B12A 3Q41A 2ZS9A 1GEGA 1HZZA 4Q7EA 5AI0A 1XP8A 2HPAA 1RYYA 3PDIB 2WDZA 1O96A 3EQ7A 3KUDA 4S1OA 1AHNA 1X3SA 2Q6LA 4OBEA 1JA9A 3TZBA 3ZXSA 5AKGA 1UFOA 2Q50A 3DUWA 3M34A 3WGVA 1II0A 2M1ZA 4EMBA 4ZHQB 1N6NA 5BXYA 4Q3OA 2JJ8A 3G1UA 2JH8A 5JYEA 5LZ2A 2DKNA 4IDGA 5LQSA 3EVDA 1PNQA 4CLEA 1Z0UA 3LUHA 3EJWA 2VP9A 3C1TA 4BO0A 5LLDA 4JI0B 1J8VA 3GXOA 3ASVA 2G3YA 3CLRD 2JDIA 4RW0A 3NORA 5DBGA 1KOFA 1CJVC 1VHQA 2MYNA 4J75A 1D4AA 4FYHA 5BWOA 1G5TA 1E6EA 2AB0A 5FWXA 2NACA 3EVNA 3I04A 1TM3E 2CDRA 3G8YA 1PEKE 4DIBA 4M37A 1FNMA 3K8QA 2C7BA 4LZZA 2KYRA 1U5BA