3VGJA

Crystal of plasmodium falciparum tyrosyl-trna synthetase (pftyrrs)in complex with adenylate analog
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
353
structure length
353
Chain Sequence
EESKIEDVDKILNDILSISSECIQPDELRVKLLLKRKLICYDGFEPSGRMHIAQGLLKSIIVNKLTSNGCTFIFWIADWFAHLNNKMSGDLKKIKKVGSYFIEVWKSCGMNMENVQFLWASEEINKKPNEYWSLVLDISRSFNINRMKRCLKIMGRSEGEENYCSQILYPCMQCADIFFLNVDICQLGIDQRKVNMLAREYCDIKKIKKKPVILSHGMLPGLLEGQEKMSKSDENSAIFMDDSESDVNRKIKKAYCPPNVIENNPIYAYAKSIIFPSYNEFNLVRKEKNGGDKTYYTLQELEHDYVNGFIHPLDLKDNVAMYINKLLQPVRDHFQNNIEAKNLLNEIKKYKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Malaria parasite tyrosyl-tRNA synthetase secretion triggers pro-inflammatory responses.
pubmed doi rcsb
molecule keywords Tyrosyl-tRNA synthetase, putative
molecule tags Ligase
source organism Plasmodium falciparum
total genus 135
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2011-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3vgjA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3vgjA01
3RHSA 1WXFA 4TS1A 2QUIA 2ZUFA 1EXDA 3MLBA 1QRSA 1V47A 4ZCQA 3K32A 4DJAA 3HGMA 3FNRA 3PNBA 1N77A 4G5FA 1LI5A 1KH2A 1Q19A 1QNFA 4KR6A 1R6TA 1YIDA 5FO0A 1EFVA 2QJOA 1N2JA 1Q77A 2DPLA 1F7VA 4AS1A 1WXIA 1MRZA 1O94D 2ZUEA 3HV0A 3E27A 5DK4A 1HYBA 2CV1A 3ZUGA 1O95D 1WJGA 4MVYA 1U7XA 3FI0A 1EFPA 1K4MA 2X3FA 1ILEA 3P52A 4KPUB 1N2GA 2D5BA 2IELA 4K0RA 3BL5A 4MVWA 1I2DA 3HMQA 3CLSD 4NATA 1NUUA 2XRZA 5LLTA 1M1ZA 2WQ7A 3IVGA 1JHDA 1YUNA 3CVVA 4MW2A 3G6KA 4EG7A 1PFVA 2PFSA 2DXIA 4HPWA 1J09A 1QRUA 1H1TA 1J21A 3HZRA 1H3NA 1EUQA 1I6MA 2CV0A 3RK1A 3KT6A 4QBTA 3H97A 3ND5A 1XJQA 3RFFA 3GMIA 4CDMA 2X1LA 3CVWA 1ZUNA 1IHOA 1EFVB 1N75A 2OV4A 3DV2A 4UZEA 5H16A 1EUYA 4EG4A 4MUEA 4YP6A 1GTSA 1N2HA 2BTEA 1JEEA 3ZJVA 2Z09A 1MAWA 1NI5A 1XNHA 3QTTA 4EG5A 1EFPB 1H3FA 4KR9A 2IP1A 1OWNA 1KP3A 1NYLA 3F3MA 5J58A 1TFUA 4ZCPA 3FETA 1B6TA 2Z08A 1KR2A 1WXGA 1G8FA 1WXHA 4MUIA 1P7PA 3AG6A 2VXOA 2HMAA 4DE5A 3M5WA 1N2IA 1UFVA 3DO8A 3H99A 3ZXSA 1FYDA 1WY5A 2J07A 4NAHA 1PFWA 3DLAA 4ZT6A 4YP5A 3UY4A 1O97C 2AG6A 4PBRA 2PZ8A 1VBMA 1OBCA 4G5YA 1EJ2A 1NUPA 4OUDA 1TQ8A 4KR7A 5IHXA 3NV7A 3COZA 3IMGA 1OD6A 4EGAA 2PZBA 4MWCA 4MWBA 3H9BA 1J1UA 3KT0A 4MWEA 3CLSC 2CSXA 3IOEA 2BYTA 4MW7A 1R6UA 3N2YA 4E1AA 4EG3A 1ULHA 3P0HA 4CT0A 1WOYA 4MW4A 2YWBA 4RPIA 2A88A 3AFHA 4JXXA 3QTBA 4XFDA 2PZAA 1SURA 1JZSA 3A04A 1O96A 5HG0A 3LOQA 3PNYA 1J70A 4X0EA 3FG9A 3CLTD 3AKZA 1N2EA 4YP7A 1IH8A 1U3DA 1YULA 5J59A 3SEQA 4ND7A 3TQIA 1NURA 3MXTA 1KKUA 1QU3A 4R2MA 2O8VA 3ILVA 4XSVA 4PY2A 4NX2A 3TNJA 3MLAA 4MQ6A 4ZT5A 3SDBA 1GN8A 3MMXA 3CLUD 4OUDB 1VLHA 3SZGA 3X1MA 4ZCRA 1D2RA 3IODA 2Z3VA 2DR2A 1NUSA 2GM3A 4YBRA 1KQPA 1JGTA 2E89A 2EL7A 4U63A 4MAFA 4J75A 2CT8A 1QJCA 3SYTA 2D54A 5TGTA 1KQNA 2NZ2A 2YXNA 1JECA 5TS2A 1NUTA 3IMCA 1JIJA 3UC5A 1O0CA 5DASA 3VRHA 4JXZA 2CYAA 1O96B 2A4MA 3P0JA 1NSYA 4GU5A 2X1MA 4MVXA 4K03A 3ZJUA 4NZPA 5TEWA 4DDHA 3PXUA 1Q11A 1CT9A 1MB9A 3IMEA 3UK2A 4FZJA 4G6ZA 4RUKA 4EG1A 4EFKA 1O0BA 4A91A 1YIAA 3N9IA 3CVYA 3GLVA 4MW9A 1IQ0A 4I6GA 2X0KA 1G59A 1M8KA 4JZYA 3FY4A 1J1ZA 3UOWA 3QE4A 3FH0A 3ZIUA 2CYCA 5K0TA 2PXHA 5TEVA 3CLRD 1A8HA 1QQTA 1WKBA 1PFUA 1VBKA 4MUNA 3Q10A 4ARCA 1U3CA 3X1KA 4HJXA 1NP7A 4I6EA 5JBNA 1ZJWA 3PNVA 1JIIA 2QUJA 3LCJA 4EF6A 3X1JA 2A7XA 4R0NA 1T6ZA 1TYAE 1GTRA 4P2BA 2AZXA 4MWDA 1JMVA 2XRYA 3ND6A 3UMVA 4QREA 1Y42X 3CR8A 3Q4GA 4JFAA 2WSIA 1KP2A 1H3EA 3CLUC 2A84A 1U7DA 2NSYA 1T9GS 3TS1A 2WQ6A 2RE8A 1N2OA 1WZ2A 1O94C 1IFXA 2DERA 3AG5A 4ND6A 5DEOA 2A1TR 5KHAA 1KAMA 1G8GA 1N3LA 1QU2A 1O95C 3L92A 1N78A 2CFOA 3C8ZA 4GRIA 1IQRA 1MBZA 1T9GR 3KFLA 1NZJA 3VGJA 1TYBE 3H9CA 3IOBA 5HUJA 2J5BA 3RJZA 1IQUA 4L2IA 4DLPA 3DPIA 4NDAA 4JYZA 1EE1A 4MVCA 1T6YA 4ZT4A 3ND7A 2QUHA 3ELBA 3I05A 3CA8A 4MUHA 1M8JA 4J76A 1JZQA 3A4IA 3COYA 4PBSA 2JAXA 2QUKA 1GLNA 1GAXA 1DNPA 1G8HA 4ZT2A 1YI8A 3FHJA 1N2BA 4MW1A 1K4KA 3D6UA 3PRHA 1KQOA 3CLRC 3GUZA 4CDNA 1N1DA 2E18A 2DUMA 3N8HA 3OTWA 2A86A 3IVCA 2CUZA 5H7XA 4Q16A 2A1UA 3CVUA 2E0IA 1IVSA 1VL2A 3IDFA 1K92A 1MJHA 3ZJTA 3VU8A 4WNYA 3SP1A 3L93A 4DNXA 3CVXA 1BS2A 4EG8A 4L2IB 4YMIA 3HL4A 5IJXA 3FOCA 4MUGA 2CV2A 4OJMX 1X8XA 2DEUA 1ZH0A 4PBTA 3LE8A 3IUEA 1WQ4A 2CYBA 2HGZA 1LI7A 4ZT3A 1KH1A 1M8FA 3H05A 2DLCX 2PIDA 3S3TA 1O97D 4MUJA 1OWOA 2H2AA 5HUHA 2J4DA 2E21A 1S4MA 1R6XA 1WQ3A 2QJFA 2I1LA 3FWKA 3U1VA 2RD2A 2QJTA 3SZ3A 1RQGA 1TYDE 5DB4A 1MOPA 3TQOA 4HJRA 2J08A 4HK4A 2J09A 2QTNA 1XNJA 4KKVA 2A1UB 1I6KA 1I6LA 3KT8A 3SEZA 1K97A 5EKDA 4ZT7A 2ZP1A 1PG0A 1J20A 5F23A 2R5WA 5KWVA 3CLTC 3IUBA 1COZA 1GPMA 4WSOA 1O5TA 3INNA 3COWA 2JANA 1MB2A 3AIIA 4ZCTA 1KORA 1O6BA 2A1TS 5FNZA 2EJCA 3P0IA 1TEZA 4R2LA 4AQ7A 1TYCA 1T6XA 5LFAA 3FIUA 2C5SA 2VTBA 4ARIA 2YY5A 3TZEA 2HZ7A 1KH3A 4CQNA 3IH5A 3IOCA 2G36A 3K9WA 3NBKA 5J5AA 2TS1A 1OWPA 5BNZA 1F7UA 2IJGX 3RBAA 4MULA 2YWCA 1JILA 1FFYA 5KCMA 2O5RA 1U0BB 4S1OA 3ZXIA 5FO1A 3RK0A 5K0SA 4U7JA 4MUKA 1V8FA 3JXEA 1M83A 2WB2A 2B7LA 3A05A 1Q15A 4ZCSA 4UZFA 1OWMA 2QTMA 4Q93A 3FDXA 4XFJA 3OP1A 5LM3A 4MW5A 3COVA 4F3RA 1YUMA 4NAUA 3NBAA 2GOYA 1WXEA 1F4LA 3G5AA 3ZGZA 1IRXA 4DDMA 1X6VA 1JEDA 3MUEA 2AKEA 1QRTA 3Q12A 4I6JA 4MLPA 3D6VA 4EG6A 4MW6A 1VBNA 1LW7A 2GKSA 2V0CA 2D13A 3A2KA 1GZUA 3IVXA 2OQ2A 2DETA 2H29A 1F9AA 2VTBB 1MAUA 1PFYA 2PG3A 2V0GA 3G59A 1MC1A 1ZH6A 1QTQA 4F4HA 1OBHA 2JA2A 3KT3A 4DDKA 4QRDA 4H3SA 4KPUA 5AHWA 1OWLA 3N05A 1JIKA 1NUQA 3HFJA 4U8HA 4MW0A 1XNGA 3TZLA 1M8GA 3ISJA 4MUFA 1KAQA 1PG2A 4BWVA 3AL0C 2QTRA 1M8PA
chains in the Genus database with same CATH superfamily
2C2XA 1BE0A 1XSEA 3WWDA 4XVRA 2GBLA 4P22A 2GJAA 3ASVA 1VIYA 1SK9A 2RG1A 3QHQA 4IS3A 2QP9X 1T0IA 4QGFA 3DWIA 1T36A 4G65A 5ETJA 1C29B 2PD3A 1VPVA 4JNCA 4ARUA 3GN1A 4CKEB 1QRSA 2ZU6A 3BDIA 3JX9A 1HNNA 3HVRA 4OHMA 1G8PA 5CDFE 2HR1A 4WPGA 1DG9A 1Y33E 3UAOA 1M1YE 3GZ4A 1C3OA 2P91A 5DHTA 1J8QA 4G5XA 1TJ3A 3KQOA 4QASA 2W8BB 2O8EA 2OCKA 1UXHA 5C3MA 2Q9BA 3SPXA 4NOJA 3GJTA 3OBBA 1M33A 2GCEA 4II2A 3JAWB 5BWNA 2I7CA 3P4YA 3Q3CA 5GMOA 4Q3DA 3E27A 1LI4A 4U7TB 5EINA 3KQUA 4OY3A 1DWUA 2C7QA 4Q00A 2LIPA 4ESOA 5DNYB 3AB8A 2W83A 1NR7A 1ECCA 3BSWA 2A9QA 3MJVA 4Z4HA 3W78A 2AFVA 2IU3A 2WB4A 3PVCA 4DUGA 1GAQA 4OQPA 3VAYA 4KKXB 4HVAA 5TLSA 3AETB 2CLSA 3NHLA 4LK3A 3ZHXA 4Q9KA 4JA0A 4YMSA 3VSAA 3LI2A 3KJGA 1GZDA 1EFLA 4QXMA 3VOBA 5JNRA 5AUNB 3AUAA 2CJFA 1SBNE 3ZDFA 3CW8X 3GRCA 3WWZA 2VPWA 4JLVA 3D8HA 5DNDA 5BN4A 1Z2DA 1N7HA 2A0KA 2YOGA 1ISHA 4PZ9A 1W4AA 3A3OA 3EH1A 1KERA 1YRHA 5AVRA 4JKYA 1BXGA 4A8TA 3OZSA 1IJKA 1UR5A 3DLBA 4BS9A 3RSHA 1UXOA 3OHPA 3BZBA 5FQOA 5IHPA 3HGTA 4JNKA 1M1YB 4FNMA 4UTVA 2SKDA 5ARDA 2FN7A 1ZAKA 4FCVA 2MYPA 4MUXA 3VX3A 3NGXA 3DHVA 4PYRA 3DEAA 4UMVA 4XWGA 4C07A 5K20A 3EHEA 1EZZA 2ILVA 2HCRA 1PI3A 2HA3A 4MKXA 4MMYB 2BFEB 4QJ4A 1I2MA 4S0XA 4XB1A 3ZQ4A 2BBSA 3GUUA 1WNTA 4NAVA 2DUNA 1JAIA 5EIBD 5EMMA 3ZWXA 2EBUA 4ZJUA 4YP6A 1GTSA 2CXUA 1GARA 2XDYA 4BO6A 1JEEA 1X1QA 1TCUA 2LUOA 4JD5A 2WA2A 1JIUA 1KZYC 5T57A 2NU8B 1IY0A 4KR9A 5A3JA 5EESA 4KG7A 1UPAA 4RK7A 3QVUA 2P5UA 3WRXC 1U8ZA 1Z5UA 5TXGA 2P9QA 2FR1A 1QOQB 3CEAA 4YRPA 2JFHA 3WL6A 4B80A 2MSWA 3BJIC 3VR3D 4C7OB 3I4LA 4HDRA 2OYRA 3E48A 1DKPA 1M72A 1MR3F 4ABTA 3SC2B 1Z2AA 1CDOA 1E7WA 2ATVA 1OXKB 3MAGA 4I1IA 1ESNA 1JI3A 2VZEA 1KQ3A 4NBWA 3BN3A 3L8CA 4BBZA 4E08A 5ALGA 1S4QA 3IA7A 4C0XA 3MRTA 2EHJA 1Y80A 2HPZA 2V54A 4HF7A 3DLAA 1M6VB 2C2OA 2CF6A 2OTCA 3TRFA 2CL5A 3O93A 4A27A 1ZY2A 3OQBA 1E7MA 3N2GA 1XE3A 1IY9A 3ANNA 2BHNA 1AURA 1B73A 1C41A 1YK1A 2G72A 4OQDA 3S8MA 3GFSA 1SD5A 3O83A 2WP8J 3ZU4A 1QH1B 2NO9A 5IHXA 3HCPA 3MGCA 5ALHA 5JZ9A 1RAFA 3IP6A 4X00A 4FUQA 2QW1A 4WI1A 4AJJA 3GGDA 1MHTA 3GRVA 2XUJA 5IKMA 4X63A 4MWEA 4IVPA 2J30A 3NC0C 4IDHA 3QU4A 1N77A 5A03A 3DR3A 1L0BA 5CITA 5BN1A 5CNJA 4UBKA 2KBFA 3GNTA 3SDSA 1NVGA 3Q8MA 2QN1A 3A1NA 4Z53A 4RSHA 5AJTA 4PANA 2OK8A 3HXMA 2L19A 1QH8B 2VCYA 1F6BA 1Z5PA 1I2ZA 1QG2A 2ZT5A 4HEQA 1UFOA 3UMBA 2RAUA 4ZYWA 1H65A 4NJEB 4JXXA 4QBGB 3OJEA 4LRYA 2QMOA 3VH3A 2JLBA 1NW8A 1H9CA 3SSNA 2IYAA 1ATIA 1Z7YA 4ZREA 4EW6A 2A9KA 1ZH8A 4YAIA 2IQ5A 2V8OA 1ADGA 4D1YA 1EAMA 4D5EA 4TWBA 3ZXYA 2AA3A 2VDLB 3U5ZB 3DUFB 3L01A 3H1FA 1GQ2A 2QE7D 4FFRA 1M5RA 4F56A 1VIDA 2D5LA 3FIJA 3NOXA 1SXJC 1C3LA 2UZ3A 3TPZA 4DTIA 2CFSA 5HMMA 1HSOA 3V5NA 3W6UA 1G20E 3DCJA 4OUDB 2C5GA 4YC7A 5JQGA 2XBMA 5A0TA 2WAXA 4TRNA 3P97A 4UEOA 1PGPA 3ADCA 1W5AA 4HRXA 1DWOA 4TL6A 2IH4A 4NEQA 4G56A 5FWYA 1YZVA 4R3WA 3LJKA 1K6JA 4J75A 3DZKA 3E9ZA 3U3JA 3K4PA 3WLOA 1BWRA 1F5SA 3WP0A 1IN7A 3BAFA 2QZ9A 2DUUA 3B1ZA 3N3AC 3LIIA 3M4YA 1OI3A 4ZMRA 1ZHFA 1ODFA 4KLRA 3FWYA 5DHAA 1KO5A 4HFRA 2I4OA 4EKDA 4Y67A 2G5TA 3DD5A 3NVMB 5ERYA 3V3KA 3CF4G 1SBHA 4ZRMA 3UPDA 3GT4A 1GPJA 4V3BA 5KMGB 4KAFA 3RIMA 2A7QA 4EPRA 5JY1A 2ZIAA 4BFCA 3OEED 4HXEB 4EMBA 2GCPA 2O1XA 5U4XA 1N2SA 2QK4A 1W88A 1Q3KA 2VHVA 3HWSA 4M53A 1ZISA 3TSZA 2FW8A 4EA8A 3WC4A 3K9GA 5JZSA 1QC5A 5C1PA 1RFLA 2WAMA 2R7NA 4LA4A 4CEJB 2ODAA 4P4SB 5TVKA 3DBIA 4I6GA 4K6CA 1HDZA 4OMDA 5LU8A 3AVYA 3USCS 5BSTA 4KFSA 4WFIA 4DXDA 4HBZA 2MYTA 1NDUA 5DBEX 4G0VA 3RRJA 4RX1A 1YL7A 1OTHA 4E7PA 521PA 3B6ZA 3PVSA 4TUYA 3RHZA 2NXJA 1ZVJA 4AB1A 3M6UA 3ZIUA 5K0TA 5FL7D 4BKPA 2WTMA 1ML4A 1ZXBA 2DQ4A 4TL7A 2OO5C 1EFRD 1EMDA 1RQNA 1SXHA 1U2TA 1X39A 2KS6A 2P2GA 3H1PA 3Q5EA 4FS3A 2X2FA 1Y7LA 2WVAA 3EAGA 3NHSA 5C3UA 4DSZA 4ZI2A 4UTNA 2XGJA 5IH7A 1ZX1A 4KLCA 2Q1WA 4E03A 1K86A 2DX7A 5A4MS 4IQGA 1ZJWA 1V8OA 2W11A 4XI9A 4ALMA 1L8OA 4YJKA 3LT0A 2PUFA 3N86A 2ECKA 5T3UA 3ZK7A 4QBHA 4A92A 3VO1A 4JR1A 2Y76A 4NH0A 4LNUB 4MWDA 4NJMA 5ARBA 2P4UA 4FOPA 1NVEA 1XA3A 2H16A 4Y2SA 2HPAA 5EP4A 3AV3A 3C3CA 2RBKA 1K6EA 1SQ0A 2Q5JA 4KQ9A 5JUWA 5KOYA 2QBYB 1XIVA 4ZVKA 3EW9A 4FQ8A 2PKQP 4E5DA 2ICAA 3T0GA 4MZDA 3W2FA 1OZ0A 4BPBA 4N82A 2G76A 1SOVA 2CHGA 3ROZA 2F8MA 2HXYA 1REQA 1ADJA 3IBTA 3T5CA 2DERA 5DEOA 2XPCA 1XR3A 2DBRA 1IOVA 3TKLA 3DAYA 4K5QA 2YXPX 3JYLA 4DA7A 1F8YA 5IANA 5DOVA 4EGCB 3NVKI 4YT5A 2A3RA 4KP7A 3VNAA 4R5HA 5CA0A 3E23A 2UYCA 2WE7A 4EAAA 4LF5B 5FA5A 4AP6A 1P2SA 4EGFA 5DV9A 1E2UA 1BWPA 2QMZA 4JSTA 4U3JA 2W6CX 3FPKA 4P0PB 2YJNA 4YAWA 3WLMA 3QENA 5LZ2A 1D3AA 1P6XA 3IEXA 5IM4A 3GRYA 1TYBE 4IO1A 2JGEA 1SUPA 2VEOA 3P2JA 1FX0B 1FFXB 4YQEA 2JEYA 4RFVA 2IU6A 4WV3A 1CP3A 2KQUA 2JFFA 2AVNA 4TT8A 1L5WA 1WULS 1F0PA 1XYVA 4ZT4A 3BGOS 4YV1A 2PZMA 2ZPAA 2B8EA 4ZVVA 5BY2A 3WGIA 3ELBA 1KYIA 4PRYA 4S35A 3E9EA 3MSCA 4BDSA 2J6HA 1E59A 1XRQA 4LY0A 4G0NA 5CURA 4E11A 2ZJOA 3GIDA 4RK4A 4QD3A 5C7OO 4B81A 3KSUA 4LRSB 4XRRA 4P3OA 4DZTA 1E7SA 2W2MA 1ZNZA 1PK9A 4W8OA 3GP8A 3LUHA 2J5KA 2VWHA 1DNPA 1YZ3A 1YQXA 3FJYA 4LY6A 4TV9A 1TJNA 3QLUA 4EEZA 5JWOA 3D3WA 1MZPA 4UKDA 5T8KA 1SBTA 3S40A 2BL4A 3TIGA 3W2EA 4H6VA 1AHHA 2VP6A 4L85A 3ELDA 4NV1A 1YBHA 4J7UA 4B6GA 3CGWA 2B4QA 2HXGA 3IAM6 4I0WB 4L8LA 1NVUQ 4X61A 3KNZA 5AYVA 4CUJA 5A2QA 3ED1A 4LCEA 3EY9A 4LPSA 2M2IA 4YXFA 2RI6A 1VLMA 4EUNA 3LW7A 1Z0IA 2GBGA 4KQMA 1C7QA 3C6QA 3I6MA 4ANFA 3WISA 1H93A 1PEYA 2BJVA 2E0IA 2VDNB 3RWOA 5A6VA 5F1YA 4P4GA 2GASA 1KK2A 1IXKA 2EP8A 4LZJA 1TKRA 1D6JA 4MA5A 3T9AA 4TTTS 1WAMA 4F3NA 2BC9A 4YAKA 1IG0A 3L8MA 2IOQA 3GYGA 3NONA 3BIOA 3GEEA 5KB3A 4BX9A 1HNWB 5EVJA 4BJ5A 5LLSA 4GQAA 3G5UA 3OE7A 4RJ2A 3GG2A 4DAEA 1S7CA 5EIOA 3PUXA 2J3JA 4RENA 4WNIA 4XR4A 2J7PD 3BWCA 5A0FA 5DYYA 4WUVA 1WQ4A 2PO5A 1TC1A 1Z2OX 3CNBA 3H8WA 2VP9A 3I37X 3L7DA 3GCGA 5EE0A 4EYKA 4AIRA 1K98A 3SQLA 2RI0A 3NHRA 3OLXA 1XPRA 2UUAB 2R1VA 5B36A 4KXFB 2EU8A 1MW8X 3SN6A 3A7EA 4CF5A 5EVCA 3KOYA 2XX3A 5JJKA 4C04A 5FKJA 5AJYA 1O97D 1OWOA 1TKAA 3AH8A 1WMBA 4WOCA 1GCOA 2W2LA 3G1UA 4XIYA 3NS7A 1Z8FA 1PR3A 4BASA 3H5RA 9LDBA 1U3WA 1P1CA 4XFKA 4EUSA 1CUVA 4E14A 5FH9A 3PEWA 5D2CA 3Q7EA 5HZKA 3WQBA 1SHLA 5DB4A 3H7IA 2KM1A 4ER5A 3TRKA 1TEVA 1K8YB 2ID4A 1DBWA 1G63A 1T43A 3BTOA 5GVSA 1XNJA 2Y1EA 4QM6A 3LVRE 2AN4A 4JI3B 1I6LA 2C97A 4EKEA 2XR1A 1DGQA 2OV3A 1PS0A 3ILSA 4FC7A 1RM5A 3WK8A 1OKKA 3ELWA 2R6HA 1XCPA 2A2ZA 4PC2A 5THKA 1YB1A 1E2LA 1SKUA 4DLRA 5DIZA 1WHTB 4Y98A 1TK9A 1Y4DE 1FFGA 3QW4B 4YI3A 4Z6KA 2IH5A 4ITUA 3TAXA 3QKUA 4B35A 5LDHA 4NMHA 2FPMA 2A0FA 2Q4DA 3FTPA 1FS5A 1OW3B 4H1HA 4UHDA 3FCAA 3NBMA 4AL4A 4NCBA 1PW5A 5CH5A 4FLEA 4QEDA 5JAIA 3QMVA 5AW4A 3H3JA 2XI4A 1LPNA 1RAIA 2HRZA 3FHOA 2CVQA 2VP2A 3QVJA 2NVBA 4IDAA 3RSSA 3H5LA 5K4HA 1EP9A 1G0NA 2R11A 1H2YA 4UEKA 4CMIA 2GAFA 4EI2A 1H5QA 2WDPA 4CT5A 1JU4A 1LC0A 2XZOA 2YCLA 3CLKA 2IFTA 2WZDA 3T6KA 3ZE0B 1A71A 4YMUA 5FNVA 4BV2A 1Y1QA 3RIHA 2NT3A 1K8RA 4ZN6A 4CM8A 5K8UA 5F2KA 1Z0KA 1QP4A 3R6LA 3LUAA 1Y0BA 5H68A 2I62A 4RLSA 2QT9A 3A3NA 2B2NA 1Q1ZA 2B7LA 4GOOD 4U7WA 3DXFA 3DBHA 5ALSA 4LX8A 5FCDA 3JQRA 1V5EA 2AHOA 2YXDA 4W7IA 1Z73A 1VDMA 2H4XA 3PDIA 1VKZA 1E2PA 3B9RA 3ILYA 1Y8RA 2Q6OA 4OTZA 4LBZA 5TQJA 2AG8A 4BVKA 3O3NB 4FSHA 4OHZA 4B3FX 1PQPA 3KUKA 4MH0R 5J2TB 1G3RA 3WKEA 2LWIA 1Z5NA 4H4EA 1E5XA 1SGWA 2CVFA 2I33A 4V2UA 3Q12A 5GADl 1QRTA 2OZPA 4Q4JB 1CY2A 3RARA 5K8IA 3UXEA 4MPJA 4K6OA 1Z12A 4L76A 3A1SA 3VNRA 1UKEA 3QJGA 4R69A 3PQ2A 5KAPA 4M9UA 4RHTA 5BYBA 4D9KA 5BOSB 3V32A 3CRW1 2XQKA 3KPJA 3KWLA 1J24A 1T29A 5IEJA 5ALKA 5IDQA 3RUIA 1BHO1 3I2FA 1IM2A 3AEQB 3LPNA 2J3LA 1U2RA 4XXHA 5HE9A 1F12A 4FSXA 3G1WA 3WJ2A 1Y6JA 5IAAA 5DLDA 4R9SA 1DG1G 1ZW6A 3U81A 3VMMA 4DLVA 5BMVF 4CG0A 4QRDA 2GN2A 1KVRA 3I6IA 2R8ZA 3WIVA 5BNWA 3TBKA 1WLSA 4WRRA 4MW0A 3ENNA 2XCSB 4QQFA 2OM2A 1OA0A 2QN7A 3L8EA 4TV8F 4UC0A 3RSQA 1UBTS 3MGBA 4AECA 3RVPA 1NXVA 3SQWA 2PLNA 3IUSA 4UU7A 3UJAA 3WSVA 3LVFO 3PP8A 1KDOA 3BWVA 1AKTA 3RC9A 1XLVA 4FD2A 3OIWA 1II8B 2O5CA 1D1TA 3D4IA 3M70A 1N5IA 3K09A 1EB8A 4D9FA 2PWPA 4R2XA 5JZMA 5FOTA 2W2NA 4DJ5X 2ZPUA 3TGPA 2VT2A 5JISA 4D26A 1E79D 2BEWB 3FZNA 8OHMA 2ZUCA 3JV7A 2P2LA 2X2OA 5C1DA 1NMXA 3L49A 2F55A 4KEAA 2VDJA 3LBIA 4Q01A 1ZH4A 4KACA 2PT6A 1T1EA 2XSZA 3O94A 3ZY6A 2LNDA 3DVQX 3M1LA 4G0ZA 4QYSA 3WYBA 3PDWA 1T9CA 1ZIDA 2W4IA 2Z2IA 4C3OB 2VNSA 2W98A 3MJ4A 4X54A 3OTHA 1BIFA 3D0KA 4AY6A 1GGMA 4HH4A 3OU6A 1E58A 4KDRA 5ED0A 3AXTA 2C95A 4Y18A 2ANBA 3ABOB 3OIUA 4PYMA 1Q57A 3WBBA 1M66A 1ILEA 2LR0A 2BUAA 4D3XA 2F90A 5HOEA 1C9JA 3VR5A 3HMQA 2XCTB 2FEOA 1NUUA 2R7KA 3BGSA 2QY9A 3G2HA 1UBGA 3H75A 3IBSA 4GVPA 3SDZA 1HLFA 1TJ4A 2QRHA 1DKUA 1Q0RA 4O3MA 2VA8A 4XJTA 2X0FA 1G7RA 4AMZA 3HBFA 4TX1A 1YUNA 4G86A 1AKEA 1C1XB 4QAQA 3VI3B 1QGZA 1MG5A 1B7GO 2CVOA 5AVOA 2O2HA 3SIWA 3X1XA 3K70C 4HPWA 4BNYA 3L1UA 1Q0LA 2C96A 2H57A 1H1TA 4EFLA 4O2RA 4Y2PA 1W36D 4D6YA 3BFJA 3FVWA 2W6IA 4NZYA 5FI0B 1CHNA 1LK7A 2YW2A 2ZIXB 2ZU0C 3AP3A 3CJRA 3PE4A 4D9NA 3MS4A 1GA1A 2GLTA 1P72A 3A37A 4IJQA 3AJ9A 1EWYA 2P2ZA 1XVLA 4KUEA 1D7AA 4IGIA 4RHYA 4P98A 5FBHA 4E15A 3GPLA 1Y4AE 5L40A 1HFWA 1A2BA 1CB7A 3LU1A 5CPBA 4P8RA 4ETWA 3DOUA 3O8QA 1FMJA 4MUEA 4Y6RA 2Q3EA 1D0IA 1PV2A 1W4BA 4KO2S 2Q1YA 4DRZA 2PYZA 2ZCVA 2ZUBA 5KYXB 1EWKA 4H3KB 4TSKA 2VFAA 3HFSA 4QBKA 4OI1A 3LRXA 1M7BA 1KP3A 1WB9A 5J58A 1KYQA 1ZA1A 3OU2A 5KHLB 4PQFA 3M5PA 5FAKA 1GT6A 1C7RA 5J4LA 4LVOA 2AJBA 4PEVA 3R76A 1XZ8A 3ZWQA 4CHTA 1GSOA 1I51A 4IIGA 1Z56C 4MDYA 5FWXB 3ESCA 1UK6A 4FS8A 2IS4A 1XZIA 3FSGD 2VJMB 2WHEA 1RLOA 3FYTA 2GTIA 1V7ZA 3S2GA 4HH3C 5JPCA 1VYHA 1FYDA 3FGZA 4HLCA 5JNVA 4L22A 1V3VA 5JV5A 2VSFA 2QG9A 3UA3A 4CKEA 2BMAA 4WXYB 3UQZA 4NAHA 5MGBA 2QQGA 2A5LA 4I4CA 4BRSA 4EQZA 4W1QA 1HDYA 4IFTA 2BHRA 5BNTA 1NX9A 5C1BA 1VM6A 1DBIA 1VL1A 3N2EA 5KREA 1LPAB 5GINE 1AH2A 2AHRA 1OX6A 3PEFA 5U9CA 2QM3A 1TQ8A 1I8TA 1YR6A 4KMSA 1OXTA 4GXTA 1GM5A 1Y1LA 2BEUA 3I5UA 1KK0A 1RBYA 2V7QD 3LGXA 3J80A 1EM8A 3O95A 1TTTA 3F5DA 3L4BA 2MTBA 5DP1A 5ESXA 1LX6A 1PLKA 1UM9A 2QA5A 1KR5A 2MSLA 3SQMA 1OGYA 4C0LA 1W2WB 3THRA 3NB0A 4AJ1A 4M9XA 1C9DB 1NYQA 3A1CA 1DPFA 1N7GA 4GP9A 4E1AA 5GV8A 3NCTA 4Q3NA 3EF3A 4I1VA 1DLIA 2XECA 3HB4X 4XGKA 4FOOA 3TFQA 3AESA 2YS7A 2D06A 4Y2QA 4RORA 4KGZA 1RHUA 2P75A 1KRHA 1RLTA 2FPKA 2G1UA 2ODTX 3I5MA 4UZSA 4MVJA 3TZQA 3RBVA 2WSYB 1FUKA 3W4IA 1KO4A 4ZYUA 4ZQHA 5KBYA 2EJWA 2PLAA 2JRLA 3FN4A 3L9WA 3UFBA 1YB5A 1BDIA 4J0FA 3I61A 5GIOE 1F8GA 4EJ6A 5TF0A 1PQ4A 4B6SA 3D7MA 1RLMA 3HKDB 3MPUA 4B9EA 4NDNE 2ZB8A 1S2LA 2L18A 5REQA 1PK7A 3NUQA 1I4DD 5CCEA 1T1SA 3Q5GA 4FN5A 4B7AA 1FRQA 3IUNA 2IV7A 3A9CA 1LSJA 3IQGX 3KTFA 4KX3A 3F9RA 5AT1A 4A0GA 4XKJA 5CDFA 1L2TA 3PFHA 4PY2A 3IKLA 4NX2A 1Z47A 2IOYA 1M1YA 1X7WA 4WY8A 3NNSA 1G5FA 1YOBA 4WOPA 1X77A 3MJHA 4J3FA 3U7QA 3W05A 4AJHA 1LDYA 1I7LA 1KEPA 4UMDA 1W94A 4DBZA 3STVA 1NPYA 4OHKA 4S1VA 2C3MA 3FRHA 1WV1A 4HGRA 2GNAA 1SG0A 4BU0A 5IPFA 1EGHA 2WV7A 2XWJI 2OG2A 4IO0A 2QX9A 1SVWA 2BFMA 4REQB 1NJ8A 2AFIE 2ZZKA 4AU1A 2OCXA 4GRAA 1XTRA 2UUPA 2NU9A 1QYCA 2BTQB 3E8SA 1KQNA 3PD7A 1NKSA 3DJFA 4W6QA 3HS3A 3ZNNA 4X97A 1E60A 2Z2KA 5J5CA 1LH0A 2V6FA 5L6LB 1QFYA 1GT91 1FJHA 4P3PA 4UJ5A 4GZ3A 5DWDA 3D4NA 3TQQA 4A6DA 3TMAA 1CQXA 2YMLA 1H85A 3MBIA 4C7OA 2IPLA 5L6MB 2IYRA 4NICA 1QCDA 5LBUA 3SC2A 4DYHA 1NSYA 2A5FA 1IDN1 2X1MA 3KOWA 4M8IA 1P44A 3TOSA 3VYWA 3SIRA 1I7SB 3IAFA 1EAYA 4BO4A 1ENOA 1GD1O 1ND6A 2ZJ7A 3C0KA 4E5MA 5A05A 4IPTA 4MTCA 1QYXA 1VMDA 2WQZA 4DSUA 4FOSA 1VBFA 4UJ3A 3N7UA 1D07A 5IW8A 1DC8A 1Y5MA 2ZRMA 1YVPA 2WYWA 5EXTA 3U5TA 2Y27A 4LXTA 5HBRA 4HDCA 2L69A 3L8FA 4IRMA 4EKIA 5CDHA 2I0FA 1QH1A 3INTA 4ML3A 5JSZA 2FCAA 3W5VA 3EA4A 3RS8A 3MF4A 3DMGA 4M0PA 5AP9A 3SQXA 2WYHA 2WD8A 3H2BA 4XPIA 1E8DA 2I2FA 1QF9A 2CYCA 4IRXA 1XJCA 4OQFA 3M3HA 4RKEA 2L42A 4CKXA 3OHMA 4CZ2A 3CHYA 4DR2B 3HKBB 4UREA 4BECA 4LGYA 3TMYA 5C51B 1HOXA 4HJXA 1J0XO 2WF8A 3H5OA 1XZPA 1P4RA 1P1FA 1RVV1 3M1IA 3Q1KA 4QYMA 3C85A 4DUPA 1SOMA 4F46A 1R9NA 4NJEA 1ZW1A 1EIZA 4NI5A 2CLKB 5K03A 1EH5A 4ZZ1A 3T9CA 1L8AA 3LFUA 4P93A 4MHTA 4ZDWA 1F38A 3BQ9A 3U48A 1N1EA 1YXMA 2TSYB 3QELB 4WNAB 1HKHA 1HNZB 3HDTA 4YIKA 3ZE2B 4DQDA 4L7VA 2C4TA 2I2CA 5F52A 2IEBA 1DFHA 4RFSA 3RHTA 4A1OA 4OUKX 4XZ3A 1MORA 1PT5A 1VL0A 1BCSB 4DA4A 1NQOA 3UJCA 1S1MA 3Q8XB 1BG6A 1C0LA 1OXVA 2DJIA 1C14A 2C3PA 3MHPA 3B1XA 1WZ2A 3ENVA 3GO4A 5I9BA 1N9GB 1TM3E 1UFKA 2VHCA 1KO1A 2DPXA 2HHAA 5KHAA 1G8GA 4U2EA 5P21A 3N7TA 4GBED 1IN8A 1EGVB 2P6PA 1FBTA 3BBPA 2G8LA 4H1VA 2AZMA 3NBZC 3UWDA 2CMGA 3DMDA 1F9EA 3ZV6A 4BXOB 1E2GA 2Q07A 4JLMA 4LJSA 4FFDA 3WGVA 4CM7A 1SB9A 3T99A 3I9JA 4KLZA 4YLYA 4GMGA 2O14A 1I4LD 1T2AA 3PC2A 3QUQA 4YGYA 5GOTA 1TW3A 2E49A 2AXPA 3EPRA 4BHTA 5LB2A 3JAKB 3RYTC 1DAGA 2BI4A 3M7IA 4EDFA 3OCWA 3T5AA 3JR7A 2HI0A 2WYVA 2ZYGA 1U0JA 3E58A 3ENQA 1Q7CA 4MS3B 1G3MA 1PR9A 2H7YA 3AEUB 1JZQA 3QLTA 2OFOA 1QM5A 5HIMA 1LPPA 4D46A 1XP5A 2GEFA 4Y2TA 3WBKA 4NG5A 5EE3A 5KMGA 2BBTA 1GLNA 2YXEA 3A9RA 4ZT2A 1W36B 3FHJA 1Z36A 4PRKA 2ZSDA 3E22B 3ORYA 4GUAA 4WOKA 1UEJA 3RKSA 2X5OA 4C3ZA 4Z49A 4TZ0A 1S3IA 1XZJA 1N1DA 1EGQA 4ETNA 2FY8A 2VP3A 4XUGB 1O8CA 1UQRA 2JJ1D 5JO0A 1EX9A 2QMHA 3DJYA 1G20A 1G38A 1VLJA 4OXYA 2W2LD 4EIWA 3D7NA 3AF4A 1R74A 1HETA 2V45A 2WUEA 4EPTA 4UQOA 1Y3BE 3WRYC 1QP8A 1MRNA 1CFZA 3QLJA 5F5XA 5JDIC 1IJEA 4INJA 4JP2A 1G4HA 3G0CA 2FSPA 2N0SA 3JQ9C 3H5IA 3GLSA 1H66A 1R4AA 3DWGA 3V8QA 2VTVA 3FSJX 3DKKA 1V8PA 2VF2A 3QITA 4FK8A 4X6XA 5I9SA 4EG8A 1FFDA 1GL7A 4ZOLA 1OLXB 2GCIA 3NASA 2FUCA 3HBLA 4Q1BA 3ZH2A 4MP3A 3KZCA 3NWOA 3TK1A 3KJEA 4AN4A 3IUEA 5DGXA 3SF8A 4LNUA 4U2KA 2WOOA 2WTUA 4NBRA 1WX1A 2EBHX 1APBA 1KH1A 4MGHA 5IH3A 1DKMA 2D2EA 4HGZA 5DHUA 4RQUA 3ZEAA 3IBCA 1PSZA 3DEIA 2I4NA 1IPEA 4L8WB 1GNSA 3HY6A 1H2HA 1W4ZA 5EI5A 3V8VA 4BLOA 5BV2P 1ZNQO 1RKVA 1JEJA 3DAOA 4QGAA 2NZYA 4UE3S 4MUJA 4XOUA 2X3YA 3F90A 3TNYA 3FWZA 1P9LA 3H9UA 4PXAA 5I4IA 1E9AA 4KGXA 2W43A 4K9MA 2QJFA 2HJVA 3G88A 1M2OA 3CF2A 3HBAA 2VT6A 2QQFA 5AKYA 5BPHA 6YASA 4K9PA 3E53A 3U6BA 3GLGE 2Y1DA 5LQNA 4A36A 3D31A 2ZBFA 3DOEA 1Z34A 4S1TA 3DKRA 5CU7A 2CW5A 2BUCA 4M0EA 3KR0A 2OCPA 4RV9A 4BNTA 5I9TA 4KKVA 2JCYA 2AL7A 1D2CA 1HQCA 4N0QA 4YAFA 3ROXA 3TQFA 2ZZNA 2I78A 1KAOA 3JQFC 4BFXA 2DU8A 4NMWA 4WMLA 4B3TB 3QBTA 1KWGA 3SX2A 1FX0A 2Y0EA 4QJIA 2ZP1A 2BKLA 3PUKA 2VAWA 2XY4A 3EWNA 1T4DA 1MJFA 2H0RA 4GNKA 4KO4S 5CJ2A 4J0JA 3OEYA 2M1ZA 3OZ7A 5BQXA 1JYFA 4Y7CA 3EZNA 3LECA 4CFSA 1WB5A 2P6UA 1O5TA 2RMKA 2XHEA 4IQ0A 4DMHA 1GV0A 3JALB 4DXAA 2AYYA 4EI7A 1TCVA 2Y1KA 4P6VF 3HK2A 4EW3A 4LTDA 2EJCA 3VYVA 1R0XA 2J0EA 3BRQA 1J9GA 1JFTA 1TYCA 2IUUA 2RGEA 3CG0A 3VU9B 4Q9AA 3EG9A 3FIUA 2C9MA 5LZ9A 5JCZA 2VDWB 4IBOA 2JLXA 4RF2A 1RCTE 4PWZA 2PGXA 4TMXA 4ZICA 1QFMA 1NULA 3ADBA 1VYVA 3GG9A 1GGVA 4BLPA 3EIWA 1YBMA 1DO0A 1Y98A 4KX5A 2P3SA 2IK8A 1LBTA 1QO7A 3HBJA 6AT1A 5CUQA 2IJGX 2GZ1A 3VR6D 3EIUA 5HDQA 1BJTA 2A35A 2AG5A 3H2GA 3K1AB 1CQZA 1CS0B 2HA7A 3RFCA 4AD8A 3HSYA 3T3OA 3KSMA 2FXVA 1O6ZA 3C1AA 3HBMA 4NBUA 3KAJA 3H11B 1MO6A 3HPRA 4GM0A 2DTEA 1AGRA 2WAOA 2XDAA 3U39A 4WLNA 1JEYA 1DMSA 2BGIA 1ZVKA 3FDXA 5LM3A 1TVCA 1TKBA 3HJCA 1PNRA 4NAUA 1G9SA 1RWVA 4CV3A 1I13A 1HEUA 1M34E 4TMFA 5SYMA 2V7VA 5KTSA 4RKQA 3ZE6A 6CHYA 2XXAB 2ODQA 3I4CA 4CF6A 4L15A 1DQSA 3C3MA 4WBNA 1YFZA 5D01A 1VCHA 3RUPA 3B1KA 4MCJA 1UDWA 8MHTA 4YWJA 5I5EA 1IOZA 4D4HA 1N25A 4O4IF 2IU0A 1DIHA 1A69A 1EA7A 1WDWB 4FONA 3TD6A 3VPAA 4P31A 3K31A 1K0UA 4C7VA 1GZ5A 2DRIA 4G1BA 4YRDA 2JIRA 3UMCA 1E8NA 4H0FA 2LZ0A 3WS7A 4E88A 3S81A 4JLKA 2X0NA 3BL6A 5JLAA 3Q0TA 1BU8A 4NQRA 2XD9A 1F9AA 1RQRA 3CYFA 2C8LA 3K0FB 7MDHA 1JWAB 2PG3A 4J07A 5JCJD 1IXSB 4MZXA 5L7YA 4F12A 1ZN8A 1UBSB 1OBHA 4X66B 4D4GA 3VZRA 4L4UA 1UP7A 5EHGA 3ZHVA 4AF8A 3DFMA 3Q6NA 5FV4A 3HFJA 1QCCA 5JAZA 4BNKA 2OYSA 5J4HA 2WWWA 4D0NA 2VT7A 3EDRA 3H0CA 4MKGA 4W5QA 1KO8A 2PRYA 4MK4A 2OB2A 4MRRA 1AVTA 4NPHA 3SSMA 3LC7O 3BE4A 2G09A 3B1FA 4TS1A 3Q85A 1M34B 3L5KA 2E82A 3NCHA 5BN5B 8AT1A 2XCUA 1YK0A 2VC2B 1R4ZA 1K63A 2R48A 3LRPA 3BERA 4FC6A 1Z8HA 4L0DA 3U4QA 3MGKA 4B3MB 1SQFA 1W581 4UAVA 3WK7A 5JC1A 1ICIA 3D2CA 1S96A 2FK8A 3GJXC 3K0CC 5J1SB 4TWRA 5TGZA 4QTUB 2AOUB 1NVVQ 2J9FB 4OB6A 1T9ZA 2RKOA 1MX9A 1P2VA 5M04A 3GL9A 3LLVA 1SCUA 1OPXA 1FLAA 1N2JA 2PL5A 4EY4A 4JI8B 1P81A 3C16C 4DABA 1BX1A 3EVTA 2GXQA 4ZARA 1GQSA 4BBAA 3HU3A 1FMFA 2PKYX 1GZSA 5HCUA 4DIOA 1P2DA 1VE7A 3RROA 4B2IA 2QW0X 2VWQA 4DW8A 5K3OA 5K3EA 3RS5A 3FPBA 1J0EA 2J3MA 2ZR7A 1U7XA 2ZBRA 1K4MA 1R5BA 4PONA 3G0HA 2PO7A 4A8HA 4XVUA 4PVDA 3QFTA 5LXTA 2AYXA 3RE1A 4ZD6A 5C9ZA 2Y1LA 5AK3A 3SIXA 1F3OA 3EXHB 4B8YA 2GD6A 2ASEA 3LNCA 4PXSA 4PYKA 1E3SA 2ETXA 1V37A 5FUMA 3PGJA 4X41A 3VO8A 2PMCA 4ZQFA 2PXCA 4P84A 4ENWA 1R0CA 1KMHA 2G80A 2GPBA 2IPXA 1RDFA 2VYND 4EG7A 4TKUB 1P5FA 3KR9A 3LT1A 3VNSA 1PAUA 4X8MA 5BR7A 2FXIA 2J41A 4II7A 5FIUA 1RHKA 3JQBA 3TDMA 4JY7A 4W5JA 1J21A 3ZKAA 4XARA 1PJZA 2VQEB 1WO8A 4X45A 2ZTSA 4QBTA 1G2IA 4L3WA 2NQ8A 4HH0A 3VR4A 1XJQA 2HWXA 5AK0A 4DCPA 4EUFA 2H2GA 1FS6A 1OZHA 5KNCA 2ZJ3A 2UUBB 5EZ5A 5L3QB 5LJLA 4XWYA 4BRUA 1GA4A 3CLVA 3EWAA 4FZRA 1ZIYA 1G64A 1BRTA 1X70A 3DOCA 4EG4A 4NABA 1E1MA 1CY0A 2AWOA 4JGBA 4JP3A 5IMSA 4RDHA 1ZM9A 5DT2A 4AKHA 1Z0SA 1GU1A 3MJEA 3PDHA 4FX2A 4UOZA 2HFJA 2LRHA 3IQZA 4PHFA 2GF2A 3BIJA 2ONKA 1I32A 1AGYA 4RMJA 2D7CA 3H9GA 1ZRMA 5ER9A 5IJ0B 4MMXB 2ALJA 4FLMA 4R9VA 1ZK1A 1A2KC 1JN0A 2OOSA 3IUJA 4LAFA 3EGOA 3CZPA 3IAUA 5CXUA 2PGDA 3E84A 5DNUA 4RXTA 1TFUA 4Q19A 2CKDA 4DLAA 2PSEA 1CUUA 1B8PA 3B51X 4CR7A 3AI2A 5TT1A 3UMVA 4D43A 2ZR9A 1P7PA 3RUDA 3TJRA 3DDUA 4CV2A 1Y1KE 4M46A 1TLTA 4BX3A 2WJYA 4BVBA 4XIIA 2WJ6A 4CXMA 3GH1A 2NUTB 2BFOA 2ZKLA 4Q4HB 1II8A 4EPYA 4M9QA 1S6YA 4S3MA 2C3YA 1WY5A 3ELUA 1KI7A 1FSZA 3IAS6 4PV7A 3V9PA 1W4LA 4D45A 2JLUA 3D0RA 3TNLA 1KJJA 1TAGA 1CIJA 1H23A 3BKWA 2B99A 3CB2A 2ZVJA 1T4CB 2JHPA 4G26A 4WACA 3C3KA 5AK5A 5JMWA 1QG4A 3FAKA 3HRHA 4F21A 2V65A 2WOJA 1X7YB 4HSGA 3PJRA 3LZDA 1PR0A 1NPDA 4B82A 5LYJB 3DWEX 3PXAA 3TB6A 1K7CA 2RGDA 3IAAA 4MWCA 2PHZA 3PHJA 3K71B 4AUEA 2PUCA 4AP9A 1XMOB 5JVDA 2AOTB 2OWEA 3D6AA 4NIMA 1NW6A 2R4UA 4KZPA 4M1QA 4UBMA 1FNMA 1KOFA 2XH8A 4A2WA 1YUBA 2JGKA 3ULKA 4Z1MA 2ZJBA 5HKOA 2CLLB 5K0NA 4KBFA 2ZSAA 2H5EA 2WJHA 3SC4A 3QU2A 4OPMA 4UMFA 3DZGA 3EXG2 3BT7A 1O54A 2J3QA 2IS1A 3RIXA 2F6RA 2OQVA 3I2YX 1MFZA 3IR7A 1WSWA 1I4OA 5IT4A 1UPTA 3ZVKA 3GLIA 3Q3VA 1AGPA 1TTQB 4HXFB 5D3MB 3WDKA 2B9EA 2OC4A 2ZI6A 3FNIA 3IT2A 3PF9A 1NPTO 1PVVA 3DTVB 1AE1A 5EZYA 2GS9A 3ZZ0A 5PNTA 4G1VA 3O7MA 1TT7A 5GV7A 1E96A 3LCRA 3NH6A 3MBKA 3H5AA 1YULA 4J7XA 4DIKA 1L7AA 3DTNA 2AMJA 3ZNPA 4DB2A 3R9IA 3NKLA 4HNAB 4TWJA 1WE2A 3CX4A 5EIBC 3UMJA 1IOWA 4BNHA 4HRAA 4JLDA 2FR0A 5U4QA 3AWDA 5DLYA 2BDTA 4YH1A 1XHFA 3IDOA 4B4UA 2FSVA 2I76A 2HDWA 3EQZA 4UTZA 5AKIA 1LJUA 3G0IA 5EJ9A 5T5QA 2C88A 4YJ3F 2JLAA 5IAKA 3WSTA 4B4WA 2JLRA 4U63A 2F48A 1E2JA 4DCUA 3ND9A 1IBKB 3T9BA 5DNAA 1NRIA 2HY7A 5EEGA 2PNFA 1Y3HA 1B41A 3ZBPA 1FXWF 4E13A 5H3CA 4CIVA 3CQ9A 2ZSKA 4QUEA 3LX8A 3S1AB 2FZCA 4WY2A 3KYBA 4OXRA 3DV0B 4E1BA 4CEHB 1Y6GA 2HFKA 3TUIC 3LC2O 2C8VA 5GIPE 2ZE6A 5FWXA 3GIWA 2A67A 1JJ7A 2BR5A 1P6UA 3P0EA 2A4MA 2RH4A 5BSFA 3ZJUA 3KZ1E 4D9EA 2NMVA 1N3IA 3IUYA 4WJZA 3K4HA 3WNCA 1JR2A 3AUTA 2GK6A 4UUOA 3GNSA 4Q3EA 1BA2A 4Z0TA 3FYCA 3C98A 1NI4B 4KQ1A 4OYYA 1Y4SA 3TQCA 5KUTA 3K6SB 1HR0B 4GW3A 1CJUC 1KHTA 1UANA 1W8IA 4MTLA 2P4SA 1GRVA 4J4HA 1E5DA 1MO5A 3O8CA 5F35A 4JZYA 1EXWA 3GJ8A 3UN1A 3TBHA 2K87A 1RLJA 4N8DA 5KPDA 3R7WA 4F1KA 1J2RA 1VGVA 1XN1A 1CDZA 2ZIEA 4YPFA 1FYFA 5B3LA 2YN4A 2ZDGA 2PT5A 1YR8A 3W4JA 1OR8A 4POAA 4U1RA 5DULA 4KK3A 3SJBA 4E51A 1OHHA 5LZ4A 1NN1A 1NA5A 2ZJZA 3H17A 3HXTA 1MHPA 1EQUA 2OUIA 1ZMXA 2CMDA 2ETVA 1KEUA 1K1EA 1TLFA 5I7AA 4A3SA 4LJ4A 2Q3MA 2ZW9A 4TQUS 1S7GA 3GNQA 1EUZA 3O1JC 1OGIA 1I1QB 1G6HA 4JL5A 3RVNA 1GTRA 4JOBA 4GKAA 2IDKA 4JWKA 3ZPXA 1U0SY 3CRNA 4LMRA 2HK9A 1D0SA 3DVAA 3SKYA 5C0OE 3HKDA 3PHLA 3EGDB 4WZBA 1I3CA 1GNQA 1XTTA 2P67A 2W6OA 3AF3A 3HB9A 3SSOA 1TUBB 1C1HA 3KXLA 4E21A 4E2ZA 1AKQA 3A36A 3ZDCA 2F43B 2GFQA 3ELYA 4FZ3A 4LOAA 5JNWA 4WUTA 1P7ZA 3MOSA 1TQ6A 1PJ3A 4AIIA 5CAEB 4XWAA 1TMOA 3MPOA 3OCJA 1THGA 3JR3A 2WSMA 4G4JA 3RVJA 1AXEA 4JJGA 3SMQA 4EBFA 1G8AA 5KI6A 5CG2A 5JZVA 3O4IA 1Z38A 1PZEA 1QZXA 2Z1NA 3NG1A 4RHEA 3VDNB 3EEFA 1G60A 1Z88A 1E61A 1N3YA 3ESAA 2IYOA 4X1YA 4URVR 2JFOA 3M6VA 3T3HA 5JJ5A 1MKYA 3AR3A 4PZEA 1IQUA 4L0CA 3UJ7A 4AJKA 2FZ5A 1MMFB 2COKA 3FCOA 2JFYA 2VHZA 2QUBA 2NG1A 4JLPA 5IARA 4B7XA 4YMTA 2NWQA 4AZTA 1D5WA 2TRSB 1FLVA 3NTUA 4EBBA 2E2WA 3AHCA 3NGMA 3QW2A 4O1IA 3I05A 3GVHA 3PJEA 4IILA 5CLLA 4EGQA 3AINA 4QLBA 3JYQA 1N0VC 2CBGA 7ABPA 4Z99A 4TKVB 2GN9A 1Z0JA 4WK6A 1B0AA 4E70A 5IUJC 2YMMA 4JI1B 3THYB 5K1ZA 2JI4A 1RYFA 4MQEA 1KGDA 2QUKA 1GQFA 1VA5A 2DQSA 1B15A 4N5HX 4P4LA 5I6DA 3EZ7A 5IKEA 5EWLB 2JAPA 3K15A 2XMPA 3PITA 4WK4B 5F2OA 4LXIA 3N28A 5FUBA 5GJWC 5KNBA 1L5GB 4FCWA 4I9UA 4P7JA 3ILXA 4WN9B 2J32A 5ILGA 3OSZA 1LBIA 4D4MA 3JASB 2ECOA 2XTAA 5AM5A 2L2QA 5FR2A 1MDBA 3RBXA 4LZZA 3X0DA 4OQLA 1NFRA 4Z4QA 1NLYA 3DE3X 2VJCA 3LGSA 3IB6A 5AM0A 3ZDAA 3IVCA 4KHPB 1MB0A 4LECA 3COPA 1CY7A 3QTLA 4K9OA 2IEAA 5DGIA 2HJ9A 2G82A 4HSEA 3W1EA 4BNGA 3NBQA 3OHSX 2ZZMA 3SM9A 5DM70 1KZ7B 2IP4A 1CE8B 4OATA 2AR9A 3M83A 2AH5A 1K5DA 2XCRB 1WSAA 3OZXA 4UAUA 1LEHA 2AFIA 3B1WA 3IIKA 3L93A 1KYYA 5DTIA 5IN5A 3T1NA 3WYAA 2HRBA 3SZLA 2PL9A 4US2R 4D9CA 3R40A 1VB5A 1YKGA 2JASA 3HE3A 3AEYA 2YVUA 1J0AA 1ZD4A 4OJMX 1F17A 1UXGA 2VOJA 4AYXA 1MU0A 5TV2A 3GUHA 2DPGA 1PZMA 3D2AA 1F2TB 4XB6B 1BDHA 4GDFA 4Z4GA 1FRNA 2G70A 1N5MA 2W6ZA 5AOBA 4DC0A 5KNDH 1B8NA 1RD4A 3DMFA 1YBVA 3KZKA 2W6QA 3FR7A 4H18A 1BFDA 5EJEA 2C7RA 1WTCA 2A5GA 4ABYA 1UMBB 2DLCX 5AW3A 1PNVA 2RFLA 3D7LA 4MWTA 1BCSA 2O7NA 5FUVA 3D6MA 2J4DA 1S4MA 2JD1A 3CZCA 4CCYB 1DTWA 4RIIA 1BKYA 1N9GA 3NHMA 1LU9A 2V7EA 1JXMA 4FZVA 4UTOA 5EL0A 3SZ3A 2YZGA 2W2XA 4IV5A 4M9ZA 1BWQA 4QUHA 5E0OA 1M6HA 5H8WA 1BS1A 1T8YA 1B4DA 2ZRIA 3P19A 3RVQA 4EUHA 3GRPA 3THXA 4EB3A 1ORRA 3C1TA 1FYXA 3OD5A 4RHXA 2I2DA 4XEUA 2LCQA 4F7WA 4C6TB 3RFUA 1Z9BA 2OL4A 1K2WA 1JKJB 2I6TA 2Z3ZA 2Q46A 1UOEA 3L5OA 4GSLA 1E2IA 1XXHE 2PA3A 3AW8A 4L3OA 2QD2A 4JJEA 1YJ5A 5EKDA 3F6PA 3K30A 3LFTA 4TN1A 4WXPA 5CJPA 2QL6A 1D0VA 1R8JA 1ZH2A 3GJ0A 3D8BA 4NBKA 1QH0A 5F23A 2YN2A 4G0OA 4MPDA 2ONZA 5JYDA 1Q50A 2VWGA 4QLAA 2MU1A 1KNXA 1KE1A 4B3RB 1DTEA 3P2OA 2HLPA 4UUPA 3KQVA 3P4XA 4ZCTA 1O6BA 1XYYA 2BI8A 4Q9JA 4B3JA 3J7TA 1U02A 3CT6A 3W5DA 1O9HA 4IVQA 4QATA 1RWPA 4MV4A 3ZQJA 1NZDA 5HNKA 2DWPA 4ZVPA 5AVUA 1QDEA 4HG2A 3T7AA 4A82A 4AX8A 4GE0A 1RQ2A 2WFAA 3C7AA 3E15A 3I0ZA 3UYLA 2ZIUB 1ZC4A 5K5EA 2OBBA 5C52B 2YXBA 4LWZA 1F7UA 3R0VA 1TPZA 3Q7PA 5EZSA 1GRNA 2GEDA 2J85A 5B64A 1ISMA 1O3YA 3I62A 1Q5PA 4U7JA 2X22A 1C4WA 1W7AA 4FDMA 2QYHA 2AW3A 1V4NA 3DC7A 3AERB 1XVAA 1Y5LA 3FNHA 3MWDB 6REQB 1FQWA 3AEXA 1O9BA 2QLJA 1A76A 1PWHA 1DWQA 4K7JA 5CG1A 1XXHB 1SB8A 1YUMA 4OMUA 1U90A 2JGNA 2FPPA 3OBIA 3CVXA 2OCLA 9ATCA 3TDKA 1XD2B 3M9XA 5AXAA 5I7EA 2Q4OA 1JR3D 2XUPA 2V5UA 3C70A 1NYRA 5ALQA 3D6NB 3EGCA 4EG6A 1LW7A 3GY0A 2NACA 1Z75A 1L1RA 2X2PA 5AVWA 5J4KA 3TLEA 3NHPA 4O6VA 1N33B 4GWKA 4K1LA 2O8BB 3Q3JB 2KJQA 2P11A 1XEXA 2OV1A 1IQPA 1DCFA 1E3QA 3JVUA 4K6KA 5I4CA 1UL1X 3DV9A 3PLAE 1XEFA 2XDQA 2YV3A 4R8RA 2DHQA 1XRMA 3K0BA 4DPMA 4GZ6A 2Z4RA 3AIKA 3AP2A 3DHWC 4UU1A 4JC5A 4RVSA 4EB6A 3WYGA 1ILWA 4WZ6A 5ADVA 1QHGA 5BQ3A 4KWHA 1S2OA 3BB4A 1W5SA 3VOAA 1IMOA 3I09A 4YIHA 1NF9A 2C94A 1EVQA 1QPGA 3CZ5A 1SD2A 3NDIA 4YCNA 3NH9A 5JH7A 2Q3JA 3C3PA 2UYQA 1PG2A 1CV2A 1OROA 3MMSA 1RM4A 3O8OA 5DLQC 2E5LB 5GP1A 1VMIA 1Z07A 3DT8A 3FLEA 1TU0A 1XQWA 2AW5A 4FFSA 4MUMA 4UVHA 3RADC 4DXHA 1FSGA 1PR6A 4NU5A 5BW6B 3IR5A 1P19A 3RYHA 4O2BF 1FUYB 2GZHA 3K6KA 4LHYA 3ZJ5A 4FUTA 1QLJA 3AKCA 3L82B 1V47A 1Q84A 1RWXA 4R2JA 3E2MA 4J0GA 4R31A 1CYEA 4DJAA 3CH6A 3HNPA 2GETA 4ISBA 2Z1DA 5DT9A 2NXEA 2Z8ZA 3BL8A 4IXDA 5T41A 4RA6A 5FADA 5JNUA 3UPUA 1Q19A 1SQ5A 1OTYA 2VL7A 4ENQA 5FT9A 4KR6A 1CF9A 4CLOB 4EW2A 5CDUA 5GONF 1E2HA 2Z98A 1KY3A 1PD0A 3MJRA 3VU9A 1DRJA 1S2MA 4JSRA 2I22A 3BOSA 3L4SO 3PQCA 2V7GA 2Z4TA 1E3DA 1JG6A 4DRXB 4S2EA 5A3QA 5LNK6 2QOEA 1DPGA 2H9AA 2J6CA 4QBFA 3OLCX 5K99A 5L3SB 1Z0ZA 4FFMA 2DT5A 2O7RA 1IBMB 1O95D 1WTAA 2K6GA 3DSRA 1UC4B 3K1AA 3L1JA 1CS0A 3GLGA 3P52A 2C78A 2W2KA 4MJ3A 3C2QA 3FHLA 1PCXA 4XD7D 1T4BA 4NLLA 1ZZEA 2JEOA 2VF5X 4TYWA 3BCRA 2GBLC 5J63A 3WMXA 1OXSC 1YFKA 2WK1A 3C6BA 3KALA 4OG2A 2RHGB 3HR8A 5LLTA 4WLFA 3UT5B 3U16A 1RAEA 3ADDA 3H9EO 1KRWA 4I3FA 3WXBA 4HBGA 1W2HA 4ZI7B 1MX1A 5LKAA 1SZCA 3FZQA 2DXIA 3JRXA 1KJ9A 1WDTA 3PFKA 3PRJA 4QO7A 4LWQA 2NVUA 5HE8A 2PPLA 2ZUDA 1BH2A 1R0KA 3J81A 1YJAA 4PHCA 4ZC1A 1QIMA 4LZNA 1USWA 4ZOAA 3DAFA 4JJ6A 5TQVA 3H97A 2MJLA 4QA9A 1W2GA 2X6QA 3RFFA 3REGA 3DR5A 3AUXA 4N9WA 3VC3A 1DCKA 2MT9A 1T9KA 5DRTA 1W52X 2GHQA 3ZK8A 4KMRA 1IHOA 1NMSA 4J4TA 4IF4A 3C6MA 3HYSA 2C4NA 5DBHX 1CRWG 1D4OA 3TLXA 5IKXA 3K0FA 2CVZA 2NZXA 4F2GA 3MLEA 4KPYA 1HEIA 2I3ZA 2Q45A 2QRKA 3SX0A 2JLYA 1CQWA 1VHWA 2C99A 2DE0X 2FH5B 2C2GA 1VMAA 1PEAA 3EQ6A 3EVAA 4MS4B 5EHQA 1E3WB 5SY4A 3ZJVA 2BKVA 1L4UA 1M76A 2CK3D 1KEWA 2C1XA 1BDJA 2GAOA 5G0VA 3RODA 3UHPA 1ONOA 4AMBA 4HQLA 4B3IA 5I3ZA 2B92A 4LYJA 5TPZA 5LD2B 1SU4A 2QRNA 3JAMA 4LF6B 4ZEMA 3NNDA 4F04A 5IVDA 1O7JA 3O4GA 4MV0A 1HUQA 1NQTA 4I50F 4MUIA 3D9QX 4LRUA 4B6OA 2N42A 5KC9A 2Z2ZA 4AXXA 3B48A 1E0SA 1U7TA 1ZMTA 5KSWB 2OQRA 4J8PA 3DPSA 4KU4A 1M34A 1BQEA 5BN5A 1EZ1A 3URKA 5C7LO 1PX2A 4AFNA 2BGLA 3ABQB 4CM4B 3JD1A 3IIIA 1TCBA 5JAHA 1O1YA 1G8MA 3VUFA 1PDOA 1JMYA 1Y6RA 3PQDA 3WOHA 1MX5A 4M8SA 2XGOA 4A16A 5IULC 3WHKA 2I6FA 4XEHA 1KDPA 3X44A 2ZWMA 4GI3A 3WL5A 2H7XA 2BW0A 2ZFUA 4G1FA 4N8SA 3FDJA 3T1OA 3HSSA 2PJRA 3NV7A 2AEJA 4O1HA 1QHYA 1DQNA 2PZBA 4BFSA 3KU4A 5D3ZA 4BCDA 4WGFA 1WU8A 2QMQA 5HTOA 4FDVA 2FRXA 3FYUA 4BO3A 5BUSA 4ZXPA 5BSHA 2VCHA 1E4EB 4GPEA 1I7QB 1S9HA 4JK3A 1YZGA 3O1LA 3I2KA 4MV6A 1GEGA 1PIWA 2JIZA 2JIQA 4C6RA 1P2TA 2B78A 4D4LA 5JXIA 1GHTA 1D6MA 4HDMB 4RZHA 3WGOA 1YCDA 4FFWA 5FUWA 3BB1A 3A14A 2XQVA 3MN1A 1CNFA 1JTEA 3QXHA 4OQQA 4ZYVA 5IF3A 2BIFA 2WU3A 3QF7A 5LZ5A 4Q12A 3UV7A 3ZVRA 1WCIB 5ILOA 5E6UA 1NQXA 4PX5A 3LY9A 4KC0A 4RYDA 4NU6A 4RF3A 5JSQA 3Q3EA 4HAUA 1K5HA 4W6ZA 1YA4A 5DOZA 4TKUA 2PUAA 4Z7QB 4PS1A 4EEXA 1X80B 3OIVA 4IXWA 3VNQA 2A9PA 1IZYA 4RELA 1NURA 4IX1A 4CLXA 1T5OA 3O26A 3AONB 3ZHRA 2UXCB 1QFZA 2O8VA 2OZEA 3I58A 1E69A 3QLEA 4JYCA 4I55F 3ZV4A 3U44B 2O54A 5HZHA 1C3JA 3THWA 3B78A 4HGNA 5E6SB 3ERCA 4B8ZA 4RHFA 3BVPA 5B2FA 5I9IA 5H0IA 2PGIA 5L3QA 1D2NA 2PV0A 2EP5A 4BTVA 3T94A 5ALZA 2GAJA 3JQAB 1Q1BA 3MERA 3ACBA 5L9AA 4UOEA 2BGGA 4IIJF 1KS2A 2APJA 4L5IA 4TZTA 3UK7A 3WLIA 1QANA 1P0FA 2YH2A 4LQDA 1CCWA 4WY5A 5CTAA 3QEKA 1FL9A 2JF0A 4GMFA 1FP4B 2FU5C 4AZ3A 2HBZA 2E4AA 3EIXA 3EGXB 2XGMA 5HKLA 4YDQA 1DINA 3NRBA 1KVSA 4TT3D 3RRYA 5I48A 1QGYA 1SCQA 2QR5A 4CM3A 4BNUA 4UULA 2J5XA 4HQRA 4AYTA 1BS9A 1Z25A 2PDAA 2W2PA 3C1OA 1LTKA 3R6DA 2P1ZA 2XZPA 5E6RA 4ARVA 2ZQYA 3PFIA 4MICA 3AGPA 1SQSA 2HM7A 2WF7A 3ZY5A 1V2HE 4MR8A 2VQ3A 3B36A 3HO6A 5EUCA 5AVSA 1ZGJA 4OFZA 4KTTE 3PXUA 5THXA 4FZJA 3OQNA 2NO4A 4OFXA 4CYMA 4MYRA 1A27A 1MIHA 1I3KA 3GFQA 4D3SA 3R77A 2YZ7A 3KC2A 3JQCA 4P3NA 4R6XA 1T4CA 4YECA 1I6WA 4JGGA 1XEWX 2X0KA 3CR7A 1P7VA 3QNWA 1T34A 2WV9A 1VL5A 4L73A 4NEGA 3CIFA 4AZVA 4OSEA 1RRKA 1SZPA 3QF4A 3GW8A 4G85A 4L28A 3U9SA 1YHYA 3FY4A 3RS2A 1NBIA 5ALOA 4FI3C 4TMTA 3IKTA 2M6LA 1QV7A 2YOHA 2OQIA 4N0PA 1C7ZA 2WG1A 3PTAA 2AOTA 1MXHA 2DWCA 1Z6XA 2RHTA 4WAUA 3TF5A 3ZZNA 3I04A 1I2AA 4HWSA 1T5DX 2IUTA 1VLQA 1OAOA 2YWGA 3JQGB 3U19A 1WHSA 3DBLB 4IG9A 4ARCA 1IEWA 1R88A 2D1YA 3BFKA 4HB4A 5ADHA 1TAHA 3N6VA 4MWZA 3TLJA 3W3AH 1RYMA 3F7TA 3PNVA 4TTRA 5ELLA 3SVZA 2G9NA 3LBNA 3X1JA 1UPUA 3R8FA 3D6TB 2C5AA 2H1CA 3A1FA 2I8AA 3DOHA 5JSYA 4GOND 4U6QA 2BDEA 1PJ8A 1QYDA 4P2BA 2XRYA 3CZMA 1RW4A 3FZEA 3GJRA 3PENA 4GR5A 1PQUA 3C4QA 4PC7A 4QREA 2NYUA 1CSEE 4AG3A 3DTVA 3C6KA 3K9HA 3OLQA 2DWUA 1E4OA 1PBNA 3D8NA 3EGIA 4ZK6A 3CVVA 1A1VA 2WPDD 1XMPA 2LV8A 2NSYA 3TS1A 2UVQA 1VHTA 3B2EA 2AJCA 4L95C 2RE8A 3SS8A 4TKMA 4BB5A 2AQIA 1T24A 2EEZA 3VC2A 5H59A 5EQFA 3FFBA 4FR5A 3WL7A 5C5IA 5CBKA 1KQFA 4W8HA 3RYCB 3PE6A 4FCTA 2R8XA 2NP6A 3DF7A 3EGEA 3AWIA 1WCYA 3HSKA 1YGYA 4M83A 3G2QA 3ETCA 1VGQA 2X0JA 1L7DA 3CUUA 2WJIA 3E5RA 1B6GA 2VHXA 3OETA 4JL6A 1LPSA 4IQ4A 4HNQA 1ETHA 4RD3A 1YJ8A 5BV1A 2J33A 4G1EB 4RS3A 1DAHA 3R3ZA 4F97A 5JC8A 2A9FA 3BSYA 5JTTA 2I4TA 1FFSA 5C8YB 4MDFA 1C8VB 3U13A 3NX4A 3AX6A 1JHVA 2P2DA 3EODA 3EOAI 3N0RA 4DMLA 4CEHA 2XKBA 5E1BA 1SCDA 3UJNA 3HXQA 4PR0A 4EZBA 2XHZA 4NR0A 4WDQA 4Z51A 4KE6A 5LA6F 3TTYA 4BJ6A 2QL5A 2WE8A 4UUAA 4U7GA 1CR6A 1P2FA 2M6KA 3HCOA 2HUPA 1BAPA 1U8TA 2FHPA 2R8OA 4U2GA 3QP9A 5KVQA 1T4MA 1S01A 5JNTA 3HVUA 4O4HF 4O33A 4JHXA 1V8BA 4W7SA 4UU0A 2VLIA 1CUZA 4XJXA 4JI5B 1FTSA 1L4FA 2JPDA 1BQ4A 2JIOA 3WLSA 4ER6A 5BR8B 2FG7C 3RGWS 3UF0A 1U1CA 1RPJA 2JFNA 3TKAA 4X71A 3WZLA 1C4XA 1OLSA 2E18A 3MWGA 4CN9A 621PA 4MR7A 5DWQA 4LV5B 2WFLA 1RZRA 1WS6A 4B73A 3ZWNA 2FP4B 2GJ4A 2RHJA 2RK6A 4UCWA 5IZCA 4ONEA 1F4PA 3UATA 4W9NA 3CONA 5K0LA 4MUAA 1BVRA 3M1AA 4DLLA 3N1UA 5KQGA 1Z4IA 1R50A 2ZBPA 3CC8A 1QSGA 3D4LA 1VJCA 2B1IA 2J4FA 1CR4A 3EVBA 1GTMA 4HDNB 4OAQA 4UW9A 4ZAWA 3ZJTA 1ZOOA 2JBHA 4GM1A 3SP1A 4R7TA 3ZKWB 5E3IA 1CUHA 1ZK0A 1U7OA 4NRDA 4NCXA 4B6RA 5B58C 4FDAA 1N6KA 5JAPA 4LDQA 1QRRA 1LQTA 2FETA 3UGJA 2ECFA 1Q0ZA 5DSXA 3IDAA 4CF3A 2C5BA 4M88A 3O1IC 3R7AA 3ZCRA 2BTOA 3K35A 4ZAXA 2XT9A 3ZY2A 3I73A 1EP3B 3QLUC 4C20A 1TZMA 5DXFA 4NU0A 2UU9B 3RW9A 1BMDA 1P77A 1FFWA 4GO1A 4J16A 5T8KC 2XZTA 4BE7B 1TUBA 3C24A 3K5HA 4OL0A 1X1DA 5A1TA 3H87A 2AD5A 1JLLA 4JYBA 3VDMA 2A92A 3SD7A 1E0AA 4GC9A 1BX3A 3SS7X 1MTOA 2GK7A 2NYAA 3B89A 3ODPA 4F91B 3N0TA 2QX8A 4Y2YA 3BWBA 4CETA 1P9WA 2QRGA 3LOUA 3KZMA 5LMNB 1DOZA 3PPYA 3E61A 5DTMA 4N03A 2QL9A 1Z08A 5E38A 5FBKA 3TZCA 4OLAA 1QX4A 1ZZGA 4DVJA 5IUKC 2XMDA 1PR5A 4N5LA 4M22A 3T9DA 1GKIA 2ZI4A 3MTJA 4JMPA 4CODB 1EU1A 3OESA 4LSGA 2GZMA 4TLDA 5CFOA 5A9SB 5JU6A 1E94E 3U56A 2GSWA 2GXAA 1X87A 3A2LA 2VPIA 2ZYWX 3MS7A 2DSNA 4CM9A 1UZAA 3ZY3A 1ZG3A 5ENZA 4C01A 2P4EA 2F67A 1F2UB 4EPXA 5BQPA 2YZNA 5HQ3B 1T5BA 3AVVA 4LJYA 2VHYA 3LZCA 3PD0A 4QX6A 5DTEA 3OF5A 2HJHA 4P81A 2OWDA 3L9XA 4D4KA 3PGA1 4YFVA 1M1NB 1XZHA 5EAIA 4EVQA 1Y3FE 4FYYA 3RRZA 1VTKA 3LTNC 3OLYA 3T5MA 1MX3A 4YXWA 1I0ZA 2G6BA 1TZ2A 1ARZA 2UVPB 3EZ9A 2J8ZA 3OA0A 5F77A 4J0CA 4M54A 4RWZA 4YT2A 2HZ7A 3TO5A 4LNAA 3NBKA 3GAZA 1K2VN 4RPGA 3AFGA 5DWVA 3HTXA 1C1DA 2DWQA 4JQOA 1P45A 4QUAA 4CG1A 3VPFA 2OHHA 1QWSA 3AR6A 2RH9B 1M2GA 4B6PA 1QHHB 3IAEA 2QROA 1D2EA 4HQ6A 4BNWA 5SY9A 3UAWA 1JDUA 4ESHA 2WHQA 3DLCA 4MA4A 1PL0A 1CE8A 3M5CA 3F96A 1R5JA 1QCZA 2PBFA 4GLLA 3OP1A 3GARA 2PX5A 5HR5A 4X20A 1LWNA 4EECA 2MIIA 3NJ4A 4PSVA 1QQ7A 3FZGA 1KJYA 3NR2A 1FOEB 3ZIAA 4CU5A 3ZD7A 2AV6A 2XNDD 1E3JA 1RHJA 4OXNA 2ES4A 2WW8A 1RI5A 1XMJA 1KVTA 3SHFA 1NHGA 1QZZA 1YB2A 3M9WA 3RTGA 1KI9A 5B1IA 3SJCA 1GGJA 3R3WA 3GMDA 1H94A 3TLKA 1T8UA 2BAGA 4KJXA 3N74A 4IP0A 2B4KA 1ISRA 1KAGA 1NTOA 1P5HA 2W8ZA 4XLTA 3SXJA 1ZLYA 2YOFA 3QX3A 2DY0A 1B0UA 2VSYA 4BFWA 3B6JA 2VQ6A 4HN2A 4NOKA 2G3YA 2W6JA 4B83A 2VTBB 5C7YA 1V5IA 1KTIA 1Y9AA 1QGAA 1RC8A 1U3VA 4AI6A 4PPFA 4AO6A 2O05A 3ZN2A 5TE9A 2D1FA 4H3SA 1QB7A 4PNZA 3UK6A 4DIBA 5CB8A 2FZVA 3GJZA 3W2GA 4POOA 2LKDA 3VKFA 3GXBA 3PGVA 3FWNA 4OHFA 4QUKA 1KMNA 1S2NA 3M6AA 2QTRA 3AI7A 1VL6A 4V0LA 1R16A 1YB6A 2WD7B 3SJ7A 3UC9A 4GOJA 3NAGA 3WYDA 1G1AA 1GKLA 2HWUA 5BQ5A 3R23A 1KKMA 1N2CA 2V55B 3X1WA 4DQVA 1GRCA 3KETA 1USVA 3EZLA 5ELXA 1QV6A 2XV1A 3BXGA 2WJ4A 1NNI1 3MG9A 4RXUA 2ZAYA 4B34A 5BR1A 3GJ7A 4XIFA 4ZGGA 1KSGA 3IBYA 1ZHHA 1CUBA 3KKMA 5TY0A 1N8NA 4BC1A 4UUQA 4K6MA 2OPBA 4MEAA 3BHIA 1CB0A 3JU3A 1DKOA 1NVAA 2AOWA 3S1LA 4MV8A 4FFPA 3QWBA 3LA6A 3W06A 4F8YA 1O94D 1S8FA 2TMDA 1Y82A 4MVJG 2DGDA 1W96A 4RK1A 3JWJA 1I2CA 3QVMA 1HYBA 2C58A 1CUSA 3WTBA 4LQLA 1K68A 1L7NA 4FHGA 4JZKA 1C7IA 1EB9A 5EP1A 5M2QA 4GWGA 3RWMB 4KXXA 2HPVA 4KPUB 5F64A 1QE0A 2Q4EA 3OQIB 1L6RA 4G1MB 2OAGA 1XYGA 2P62A 3KD2A 3BL5A 4GXRA 2V6IA 2OZLB 3MWDA 2GHIA 4TTAA 4TZKA 4FPXA 4ZPJA 2DLDA 4P32A 3W8NA 3P2YA 3O74A 5H3LA 2FKNA 3PG5A 1HE3A 4LJ8A 2IIBA 3JVDA 3KOOA 4R8SA 3K09C 4DOMA 3AI3A 1UT8A 2AQHA 3O21A 1MAHA 4PO8A 4Q1CA 2Q7XA 2ADOA 1CQJB 1UZUA 2O50A 5D3QA 3CCCA 3GR6A 2ZVDA 4EITA 3WVNA 3WHIA 2FVXA 2FWPA 4J1SA 3S55A 3TCNA 3EHDA 4P38A 2A6PA 1NUHA 2B9VA 3NIWA 1U6IA 2JGAA 1ZD8A 1LJ8A 4Y2HA 2IUSA 3HDQA 4BMNA 4WXRA 4OLBA 2EQ5A 4S2UA 221PA 1HM5A 4QYIB 4RS4A 2I67A 2PMDA 4Z86A 1MAVA 3TSWA 1X38A 3L0SA 3OPQA 4M87A 5DTJA 5CPFA 3LL4A 4IJ6A 3HP4A 3ZQ6A 2C7VA 1DX9A 3EZ2A 1B76A 5TF4A 1R5NA 3GZNB 2Z09A 1CJVC 3CNOA 4C21A 4FI3F 4HQOA 1ODCA 2QM7A 1R8QA 1JA0A 1S2IA 2FWNA 1T3ZA 4ZO4A 2F8TA 3E9YA 1Z2NX 3G7UA 1RXWA 1W0JA 2FUG6 4YBZA 1TAQA 1MCZA 1UKCA 4KSYA 2F1HA 5D7NA 4HC4A 2OVFA 4DMCA 1R6VA 4JSYA 2VXOA 4RD6A 2VK4A 4JC0A 3HKCA 3QVVA 2HEIA 4OI2A 2PY6A 1CPYA 1JFLA 2OXEA 2Q21A 2Q3FA 3F8SA 3ZWYA 1FMLA 1Z6GA 4KN8A 3DZBA 4LVUA 3AOGA 4D02A 3IIMA 3UHJA 1EJBA 4IGKA 3UT0A 4RAQA 4CBVA 1B6SA 4E5UA 2B0JA 4RCVA 1UJCA 5JS1A 3GFVA 4BGDA 3DQQA 4MGEA 4DLXA 3W90A 3WK9A 2PZ8A 4X93A 5I7VA 1EA5A 1YZYA 3GFOA 3P2IA 5AI9A 4CLOA 2Q0QA 5JFGA 1ISGA 2QT0A 4I5FA 2ENUA 2OD9A 3KB2A 3OM1A 4NMLA 3TSYA 3QQ5A 1CHDA 5ISMA 3H9BA 1DBQA 3A3KA 3BHNA 2M32A 4BNLA 4TRMA 2CXNA 1MO4A 3CZQA 2J9GA 3ONVA 3PUVA 1SHZA 4O4LA 3KYCA 3B52X 1DQZA 1NJ5A 3RHFA 1R4NA 2E9SA 4OXXA 4M8LA 4QFCA 4U4AA 2CJPA 2YY6A 1NQAO 2V5AA 4KIFA 1WXWA 5TVGA 3KTOA 3IP9A 1HMPA 4GR9A 4A8JA 1J97A 1IVNA 3L8ZA 2GM9A 4BMCA 1XVTA 2BP7A 3QTBA 4Q9DA 1JG1A 4CN8A 3LQFA 1P9NA 3JPYA 3U6KA 4BKUA 2AIRA 4CV0A 2Y71A 4F60A 3UT5A 2VHWA 4BCCA 4X0EA 3RKUA 1ESMA 2AX4A 3WGUA 1KRXA 1E1QA 4IEFB 3IHTA 1CWUA 1Z06A 2JATA 2BUBA 3QFRA 1LY1A 3SF0A 2FOIA 2YYZA 1QU3A 1IZ9A 4RK6A 3A3PA 1ZVVA 5E7MA 2VJQA 1Y3CE 1Z7GA 2XE4A 3M34A 3FTNA 3SOPA 4R1MA 4EX6A 3QUAA 1BXKA 2PD6A 4MQ6A 4ZVUA 3TXAA 3ZV7A 1TKCA 2YJZA 4IJUA 4CTKA 1B6RA 5A0VA 3C5EA 3K8ZA 3AUJB 3L4BC 4PLYA 1EZ4A 2CNOA 3EK2A 2GWRA 3IKJA 1V9SA 2W4QA 1D2RA 2QLBA 3ENKA 4ZC8A 4A1FA 1VPTA 1J99A 5E95A 3UB3A 4ZK2A 2RDMA 3SICE 3I2JA 5IC4A 3I5XA 1Y34E 4DNQA 2ZTUA 5IM4F 4MP6A 1PGQA 4N8EA 1RRFA 4XWWA 4GDMA 1HRKA 1GOTA 2YHUA 1ORIA 2FW7A 2X76A 1EVJA 2NW6A 1HZJA 4M6WB 1J2UA 1QORA 4IVNA 3ECSA 2Q0SA 1EFCA 3ETDA 4KCGA 4EYQA 3GBPA 5CGQB 4UE2A 4ZODA 3ZCVA 2UZ1B 4D0SA 3D8SA 5MN4A 1CZLA 2X5JO 1W0KA 3P0JA 1SU7A 1TE2A 4NCHA 4PCLA 1CYDA 3VZDA 5A4DA 2Q49A 3QFFA 9MHTA 1P1IA 3HZHA 1PDWA 2ADFA 1VP3A 3FKSD 3OD1A 3QBDA 4ITRC 4L16A 4QTXA 5DSZA 3SBOA 4CM4A 4H35A 4EG1A 1GZHB 3FTQA 3R7LA 4ILKA 3WFZA 1RR6A 2RHMA 4TV9F 1Z8NA 1XCOA 2F1IA 2JAOA 3MCWA 1I4WA 3ZV3A 4MW9A 1IQ0A 3BJRA 4FHDA 4KO8A 3OFKA 3QBEA 4OQNA 5LCXA 3C41J 1N0HA 4JUIA 3WHPA 4QU5A 1AK2A 1N6PA 2HMTA 4Z3OA 1TT5A 2I1QA 1V4BA 3EF1A 3DYIA 3NHKA 4U7HA 1GFIA 3DKPA 4DR3B 1Y9EA 3GLKA 3IHWA 3WBJA 3W5UA 3V34A 4LJRA 2BCGY 1JKIA 3STTA 3RG2A 2G1KA 2P5SA 5J47A 2IDJA 2DR3A 1MT3A 3L0IB 2QDKA 3AI1A 1EJ6A 3STXA 3EIOA 4PZ0A 4CLRB 3LP6A 4JI2B 1BW9B 4J7CA 4G4IA 1WLYA 5B7QA 2QI9F 2I54A 1H2WA 2ZB2A 4I3GA 2REQB 2VDOB 2VRWA 4IFBA 1BHQ1 2Z1MA 1JDPA 2PKQO 5TJ9A 3S28A 3SWWA 3BC1A 1GADO 3ITDA 4U9IS 4TXLA 5CVDA 4YRGA 2XOKA 3VISA 3W5JA 1ZINA 3K0KA 4M0KA 4ATNA 1U7DA 2NADA 4QICA 2EG9A 2YW9A 3K1TA 4WKCA 2EFEB 3USES 1NSFA 4FU0A 3KJHA 4QYXA 4R2KA 5GZ1A 5I47A 1EBBA 2CLEB 2PH7A 2C59A 1G3IA 5FLXA 3KR1A 3Q9NA 5EWMA 2BONA 3L92A 2XAUA 2CFOA 3MFQA 3GQVA 4NYMR 3PGMA 3I2HA 1GR1A 1AKWA 5KSPA 3JQAA 5WRFA 1UBNA 1V1MB 1TPYA 3BJEA 1XCJA 3IALA 3P7MA 1MC5A 3AFNA 5DYTA 3MJSA 1SVOA 1EVLA 5K8TA 3N7AA 3LHKA 3RYFA 1UK7A 3PJDA 4L2IA 4I81A 4DLPA 3OOHA 1T8PA 4A6PA 5HOQA 1YC5A 5LKRA 5E7JA 1PJLA 9ABPA 1EE1A 2MINA 1YOVA 3JVEA 1LF5A 3U4IA 2AKYA 2GA9A 2OG1A 3EIHA 3ROQA 4JI4B 4RZ2A 4FJ2A 4M98A 2OM6A 1L9XA 2Z3WA 3B7WA 3EMKA 3REQB 4YDRA 2FX3A 1Z26A 2CHVA 2C3OA 4LGMA 3W5BA 1UXJA 1U3FA 5FOXA 3A4IA 3I2GA 5P8WA 3BH7A 4HAOA 3JQ7B 1W34A 2R8BA 5DYGA 2HH9A 3EW7A 5LDDC 2JI9A 2XQJA 4RVNA 3KZXA 4F5YA 1XTIA 3QVLA 3UMMA 4PFSA 3S7ZA 4AKTA 1B43A 2Q5EA 1O89A 4F84A 2ORED 3AYXB 2BFBB 3EVGA 3GUZA 2ZJ1A 4IX9A 2HK6A 2N9UA 5HCIA 1DCTA 2PCLA 2XYQA 2GYUA 2I8CA 1DC6A 1X13A 1TQ4A 1YRWA 3IOMA 4R1UA 4JUAA 4H1WA 1ZBQA