3VH3B

Crystal structure of atg7ctd-atg8 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein/protein transport
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vh3B00
2WX1A 3VTUA 4IW0A 2MWSB 4PS8A 2G45B 4AUQC 3ZNGC 4F8CB 2JWZA 3RUIB 4K7SA 1TZ1A 3H7PA 2DAJA 4AP4C 2FIDA 2FUHB 2K25A 3UQBA 2I1JA 2AL6A 1IP9A 2KJRA 1EF5A 3A33B 1TTNA 1UBQA 1E90A 3PVLA 4LJPB 3WANA 2N9PC 2ZCBA 4FHJA 3VXWA 4W9CA 2L00B 4EUTA 3L54A 2MCNB 1TGZB 3L16A 3RULA 2MBEA 3WAPA 4WAAA 3M63B 3PSEB 3KYDD 1GC6A 2RPQA 2RSUA 2FCSA 3KUDB 1VD2A 3KYCD 2FCQA 2D3GA 3VUXA 2K6QA 1J0GA 2NBWB 4KDIC 3ENEA 1YX5B 3TIXA 2O6VB 1YJ1A 4MGYE 4GU2A 2IY1B 2B3AA 4JIOU 2KC2A 2LZ6A 3UGBB 2GBKA 4CO7A 1EO6A 3UIOB 2ZZPB 2GBNA 2M1MA 4ICUA 2RD0A 4AJYB 4ANXA 5LXIB 2GMIC 1OEYJ 1Q0WB 5CTRC 4WWOA 2AYOB 2BYFA 5DCNA 4DHJD 4J6IA 2KTFA 1WY8A 4P7IA 5AZFA 1H4RA 2R2OA 3QHTA 2W9NA 3QK0A 2ZPYA 1XD3B 3PHWB 4GDKA 4NQLB 1ZW7A 2R2QA 4BKSD 3X23A 3AULA 1WE7A 3WAOA 2CR5A 2MBHA 3JW0X 3N30A 3KUZA 3QARA 4FADA 3A9JB 2C9WB 4ZDVA 4NJ6A 2XBBC 1ISNA 4W9LA 2D2QA 4MEMA 4IWOA 3QAQA 4ZRKA 1UELA 1WXSA 3DOWA 1V81A 2C7MB 4WWPA 1Z2MA 3AI5A 3ONSA 2JT4B 4DXAB 2KQ7A 5FR6A 3X0WA 3DBLI 3HHMA 2KANA 4DHJB 1NDDA 2K39A 2NR2A 3VH4B 4MELA 4BKSA 2KFKB 3CSFA 1WH3A 2M8SA 4ANVA 2C7NB 3H7SA 3MHSD 1HE8A 4M0WB 2BWES 3GZNI 4HJKA 3QJZA 3N32A 4GIVA 4WWNA 4FA6A 3TJPA 3APCA 2CHZA 3ZRCA 2GBJA 2MP2B 2KD0A 2M4NA 3AU5A 3C0RB 4MSQB 4ANWA 1EUVB 1XQQA 4M8MA 4GSWA 2EMTA 4LDTB 4A3OA 3VHTC 3RZFA 3K9PB 4FBJB 1WJUA 4E3CA 1P1AA 1WJ6A 1WR1A 2BYVE 2MSED 3ZKJC 2REXA 4W9KA 2QHOA 4MM3A 1WMHB 2EKEC 2NS5A 3MTNB 3RYTA 1KOTA 1AARA 5BO4B 1R4MI 4DHZB 5D6JB 1WJNA 2AL3A 5JH5C 4X57B 4BBNF 2G3QB 4A20A 2O2VA 4W9GA 4MDKE 3CMMB 1SGHA 3R3MA 4HXDA 2XEWA 4W9HA 1I42A 3WALA 4IWPA 4BBNC 5J17A 2K8BA 3V6EB 2BKRB 2D07B 4MSMB 3W1YA 3HM6X 3R7QA 3Q3FA 3M62B 3V61A 3VUWA 1WR6E 3OJ3A 3WA0A 5LXHA 1G6JA 4PYZA 4B9KA 2LJ5A 4W9FA 5D7GA 3UINB 3PHXB 4NPNA 1WX7A 4RMAA 4CHKA 2CS4A 4EOYA 2AWTA 2PE6B 2KN5A 1V49A 3CSTA 2KNBA 3SHQA 3N3KB 2JZ3B 2KDBA 3S2AA 4MGIE 3QA8A 3ZVVA 4NQKE 4HK2A 4DHZE 3T8MA 3NOBA 3T9LA 1K8RB 4DK5A 4II3B 3IG3A 3M3JA 1X1MA 2Y5BB 1Q1OA 4GOCA 3DBHI 3JVZX 1ZKHA 3KW5B 1WGHA 4FLHA 4WJNA 3VTWA 3AU4A 1KM7A 3M95A 1WX8A 3L10B 2L8JA 2KDEB 3H9DA 5CHFA 3O65B 5KHQA 3PLUA 1GUAB 3I3TB 4JLCA 4LCDE 4TV3A 3KUCB 3NY5A 4FJVB 3A9KA 2Z59B 3L0WB 4MGZE 2O6VD 1GC7A 4HDOA 4GB9A 3AXCA 2GBRA 1E8ZA 2WWZA 3U30A 1WE6A 4ZYNA 2DZKA 2KJ6A 2LVPA 2BKFA 2DYMA 4W9DA 4IUMB 2VRRB 3RD2A 3VFKA 2JZZA 2O2VB 4TKNA 4DWFA 2A4ZA 1UBIA 1C1YB 2KMAA 3DCGA 4E74A 4KIKA 2DZMA 5IA7A 2HTHA 4BFRA 3VTVA 3TMPB 4IG7B 3EC8A 4XX5A 3V60A 4XC2A 1E8WA 2FAZA 2MW5A 1WI0A 1WXAA 3DBSA 2JPHA 1CMXB 2WDTB 1WIAA 2JUOA 5D2MB 3ZO5B 2M17A 4NAWB 2KDFB 1YQBA 5JZEB 5E6OA 2KHWB 4HPLB 2BWFA 1WXMA 2MBBB 4G0NB 2KJHB 2KOXA 3HK0A 4KDLB 3W1SC 1KLVA 1WMHA 4FJZA 1OGWA 1WRDB 1WXVA 2PE9A 4LDTD 1FXTB 2IO1B 3HM3A 1WYWB 2N7EA 4LJOB 4CYEA 2NPTB 4KSKC 5AZHA 1NI2A 1M94A 2KFKA 2JY6A 3VUYA 3L08A 4KZCA 5GMVA 3ZNZB 3VVWB 5CHWA 2NVUI 3PLVA 1VCBA 2N1VA 4DBGA 3A4RA 3EECA 4WJQA 4RM8A 1WFYA 2M0XA 2K8HA 1S3SG 2LWPA 2L7RA 1XT9B 4IM0A 4BKGA 3ZW3A 2MP2A 2PJHA 5L83A 1V86A 3BY4B 4M8NA 4WJPA 3ZDTA 2C5LC 2JF5A 2MLBA 2AEHA 3A1QA 3EHVA 4GDKB 3DPDA 4EZKA 2DX5B 2L05A 5L95C 3JYUA 5AEKB 2DZIA 2N9EB 1UH6A 3ML8A 3UF8A 1Y8RC 2ZCCA 2KQSA 2MBOA 5DPTA 1SE9A 2ZJDA 3ZTDA 3OLMD 2UWQA 1A5RA 4GDLB 1NBFC 2DENB 3TBLD 1F9JA 4MH0E 1YX6B 2HJ8A 3ZIMA 3PRZA 2FCMA 2K8CA 3IHPC 5J18A 1WM3A 1Z5SB 3NZUA 3WAMA 5D94A 3PPAA 1E8XA 3MJWA 2LGYA 3B0AA 2HD5B 4ZRIA 1U4AA 3B08A 1RFAA 1RRBA 2JXXA 4HVBA 4JQWC 1P9DU 2KK8A 4I6PA 1T0YA 1V6EA 1EF1A 1WGGA 2WYQA 4G50A 4URKA 3GOEA 2NBUA 4IC7B 1L2NA 1WGYA 2L3ZA 4FN2A 4NAWA 1OQYA 4GXBA 2ZVOA 1TBEA 5JHAA 4NJ7A 2LGDA 5LLIA 4YL8A 2D10A 1LM8B 3KH0A 2MBQA 4I6LB 2DHZA 2XK5B 4FULA 3V6CB 1E8YA 1YIWA 5DPRA 2NCNA 3L13A 1OEYA 3ZNID 4TQ0A 3SDLC 4KVGB 1GNUA 3DVGX 3H6NA 3VDZA 3QWZB 2LD9A 3SU8X 4KV2A 2C7HA 2LRUA 2RGFA 3SD5A 4BOZB 1UD7A 1E7VA 3A4SC 2GOWA 1R4NI 2LGXA 3CF6E 3DVGY 2Z0EB 2JRHA 2N1WA 4OVVA 3QIJA 1C3TA 3A9KB 4RM9A 3ZRFA 1GG3A 3NZSA 4K7UA 3A1QB 4WJOA 2ZPNA 1J8CA 4NNJB 5KHOA 1WX9A 3DBRI 3JSVA 1V80A 3L17A 3ZNHB 2I1KA 2KVRA 4W9EA 2CU1A 2EMSA 2FNJB 2ZNVB 4EEWA 4EFOA 4BKTA 2LUEA 3PGEA 2BYEA 4GMVA 1E5WA 2LVOA 3R7RA 5E6NA 4PS7A 2NBVB 2HE7A 3U8ZA 1WGRA 2BGFA 1JRUA 1UGMA 4MJSA 2IBIB 2LXAA 4MJSB 3ALBA 2DAFA 1UZXB 3R66C 4ANUA 3ECIA 3RZWC 1PQSA 2MA9B 3APFA 2DYOA 1V9JA 4WQOB 4GN1A 2KWCA 2LASA 2CHXA 4KZ0A 2KX0A 4FHKA 3K9OB 2JRIB 3V62A 1I35A 1D3ZA 2FIFA 4AJWA 2PPHA 2ZNVC 2ZEQA 5TR5A 2KDIA 1WZ3A 1MG8A 5G2NA 4HWIB 3H1UA 3NS8A 2IO2B 4HDQA 2LRWA 2CHWA 4ICVA 4B6WA 2N7DA 5AZGA 4GGQA 2XK5A 2JVCA 2J0MA 3NHEB 2CKHB 4W9IA 3APDA 3IFWB 2BPSA 1S1QB 3PZDA 5CHVC 2KXJA 3DVNV 2K6DB 3RT3B 2ZVNA 4K7WA 1P3QU 2YLMA 3W1SA 2BF8B 2IYDB 3WIMA 2V4LA 3P2BA 2KLGA 2OJRA 2V1YA 2DZJA 2G4DB 2MQJA 1GJZA 5E6PA 4A3PA 3OJ4B 1E7UA 4AWJA 1KJTA 4FJYA 3B1LX 1QZEA 2DYBA 4G3XB 3OAWA 4IWQA 4KSLC 2GBMA 2KX3A 3ZLZA 3DDCB 2FCNA 4HCNB 3LJ3A 3ZUNA 1P98A 1IPGA 1P0RA 4N9F4 1J19A 2KLCA 2MRPA 4F7ZA 2RR9A 4B95A 2N9XA 3JSVB 4XZ4A 2KTRB 4E71A 4MGKE 2KTRA 2MX2A 3ML9A 5DPWA 3D32A 2D11A 3UIPB 4EZLA 2K1FA 2KFJA 3BINA 4I6NB 3TCAA 1V5OA 1V2YA 4W9JA 2NPTA 4TUUA 3VAWA 5C1ZA 1WF9A 4PYUA 1WJ4A 4F1SA 3VQIA 2J0KA 3H7PB 1YD8U 1V5TA 1L7YA 4NY0A 1WM2A 2LI5A 1Q5WB 5J2RA 4G11A 4PS3A 3IBEA 3PRMB 4ASWC 1LXDA 2KWVB 3HIZA 4HPMB 2J7QB 4AOFA 2IO3B 2G4SA 3PREA 1ZGUB 2IO0B 4OVUA 2L0TA 2PEAA 2YVCA 5G55A 3U7DA 1WZ0A 3A9JA 4EZJA 1H8CA 1WGDA 2KO3A 2KWUB 2A5UA 1RLFA 3KVFB 4BVUC 3QX1A 2ASQA 3DVNU 2J0JA 1LQBA 4ZRJA 3EFUA 3RCZA 5DPSA 2KMCA 2IY0B 4K81A 2O6VA 1LFDA 3IVFA 2KZRA 3PV1A 2V3SA 3QQ8B 4GDLA 4HLEA 3UQAA 5IAAC 5C23A 4EKUA 1IYFA 3PT2B 2IZVB 3Q3JA 3QCAA 2WX0A 3DQVA 4HCPB 5EDSA 5JHBA 4KIKB 4BOSC 1OTRB 2UYZB 3PTFC 5HKHA 2L0FA 3ZTCA 3LDZE 4JL9A 1RAXA 5CX3A 3PRPB 2LXCA 4IM2A 1BT0A 4DDID 4DDGD 3QC8B 2C60A 2Z0DB 2OOBB 2KKCA 3ZDMC 2L76A 4K1RB 3VH3B 4JGHB 3PS6A 2N4FA 4II2B 4IM3A 3TL5A 4TQ1A 2KC1A 1SIFA 2LVQA
chains in the Genus database with same CATH superfamily
2WS3B 1TS3A 4IW0A 4PS8A 2G45B 1FNWA 2PIAA 4F8CB 2JWZA 1I4PA 4A9AA 4K7SA 3PO0A 2BB5A 2BQQA 1L6VA 2K25A 2IGGA 1IP9A 4M0WA 3Q3MC 1M4VA 2OJWA 5D3IB 3L54A 2MCNB 1FCLA 1TGZB 5IO9A 2PKOA 4WAAA 5EE0A 2NMQA 1GC6A 2RSUA 2FCSA 1EWCA 3U2SC 2FCQA 3MJ5A 2D3GA 4BZAA 1L0YB 2NBWB 2L83A 1XCQL 3NJTA 1JCKB 3U4EG 2M1MA 2RD0A 1Q0WB 1HTQA 4WWOA 1WY8A 4P7IA 5AZFA 1H4RA 3C19A 2KMMA 3PHWB 4GDKA 3AEEB 2G1EA 3N30A 2C9WB 1L0VB 4IWOA 1MHXA 4ZRKA 2AQ2B 3DOWA 4YTPB 4LNOA 3DBLI 3LYYA 2KANA 4BKSA 4MELA 3W5VB 3CSFA 1WH3A 1JWBD 2BS4B 3GZNI 3N32A 4GIVA 4FA6A 4KGSA 2KD0A 4ANWA 3C0RB 1F77A 4LDTB 2EMTA 4A3OA 1SF0A 1P1AA 2BYVE 1C78A 2M19A 3AE9B 5I4DA 1TIFA 2JQRB 2G3QB 4A20A 3ZXVA 4P6VF 4W9GA 2MJDA 5MPOA 4MDKE 2WXQA 1SGHA 4HXDA 3WALA 5D3DA 2D07B 4MSMB 3Q3FA 3WA0A 3OJ3A 1G6JA 2H89B 1F2RI 3PHXB 4NPNA 1UWXA 1PGAA 2E3TA 1YOVB 1BXTA 1SXTA 2KNBA 4N59A 3SHQA 4B0EA 3QA8A 3Q8CA 4HK2A 3IG3A 1X1MA 4GOCA 3DBHI 3E56A 1WGHA 4A6QA 4WJNA 1WX8A 3L10B 2KDEB 5CHFA 3PLUA 4TV3A 5IKCM 2CJNA 3NY5A 2Z59B 3L0WB 1GC7A 2WGSA 5EE3A 1K53A 3ETRA 1E8ZA 1SJHD 4YSXB 4ZYNA 2KJ6A 2LVPA 1K50A 4KX6B 4IUMB 3PZ7A 2VRRB 2V3PA 4TKNA 2O2VB 1UGJA 2KMAA 3EUB2 4ZOHC 3VTVA 4MT5A 2FAZA 4XWWA 2XN9C 4KGRA 2JPHA 2WDTB 2M17A 4NAWB 1YQBA 4G0NB 2KJHB 3HK0A 4OZBA 1V1OA 1WXVA 1FXTB 4K3CA 4YT0B 4LJOB 2LJIA 1NI2A 1M94A 3P4QB 2LMCA 4KZCA 5GMVA 5CHWA 1JMLA 3HUIA 5BYRA 4YTMB 4WJQA 3Q8FA 1D6EC 3GP7A 1YNTE 4JE3B 3H8HA 2MH7A 2JYEA 4YWGG 1V86A 4M8NA 4WJPA 2C5LC 3A1QA 2AEHA 3DPDA 4EZKA 2DX5B 1ZDVA 3NZ3A 3Q69A 2L32A 2DBYA 3ML8A 4RGMA 3UF8A 1Y8RC 2OEDA 4HRSA 1FM0D 1A5RA 1L5PA 5BMGA 3SFEB 3TBLD 2N7JA 3ZIMA 3PRZA 2K8CA 1N6ZA 3AE6B 3U7ZA 2PVGC 3B08A 2JXXA 4AQ7A 2KK8A 4I6PA 1EF1A 1WGGA 4GXBA 3LXFA 4NJ7A 1VZ7A 2QCZA 4FULA 3L13A 1OEYA 2BVCA 3ZNID 3SDLC 4KVGB 4RF0A 1BUIC 1ET6A 2LD9A 2C7HA 1DOXA 1C77A 4HPPA 3BK2A 3DVGY 2JRHA 2N1WA 1C3TA 3A1QB 4WJOA 1KLGD 4C4VA 3DBRI 3GE3C 4W9EA 2CU1A 3B2GA 1I4RA 4USAA 2NBVB 3U8ZA 4C56C 1CK1A 1R7SA 2VH1A 1E7PB 1ENFA 3APFA 2KWCA 2CHXA 2D3BA 2WLBA 3BVGA 4FHKA 2JRIB 1D3ZA 5TR5A 1MG8A 1NVID 4RFBA 1I4QA 2SEBD 3NHEB 1D4BA 2CKHB 3FKYA 4M00A 5CHVC 1QLBB 1RYJA 2IYDB 3BVMA 4YTNB 1QF6A 1LO5D 2DZJA 2G4DB 2MQJA 2AQ1B 4A3PA 2WXFA 1SEBD 4FJYA 2V0GA 1QZEA 2IJ0A 3HVZA 2CJOA 1EWYC 2GBMA 4HCNB 5FK9C 3LJ3A 2RDGA 3ZUNA 1P0RA 3BVZA 2KLCA 4F7ZA 4B95A 3JSVB 4MGKE 5BMHA 2KTRA 3ML9A 2RDHA 2K1FA 2JXTA 4I6NB 4ACFA 2NPTA 4TUUA 1QOGA 4PYUA 1WJ4A 3TUOA 1C4CA 3H7PB 2J4XA 1V5TA 1T0RC 4NY0A 1K51A 1WM2A 4ZRQA 1WYGA 4PS3A 3IBEA 3PRMB 1LXDA 3T3OA 4WH4A 4P1BC 1F52A 1I42A 3PREA 2INNE 1ZGUB 2IO0B 3U7DA 3A9JA 2KWUB 4HEA1 1RLFA 3KVFB 2WQYB 1LQBA 3NVWA 4ZRJA 2MJEA 3I9V1 5DPSA 4K81A 2O6VA 1ZP0B 1LFDA 1SB3C 3PV1A 3QQ8B 4GDLA 4EKUA 1IYFA 2IZVB 3Q3JA 3DQVA 4HCPB 5EDSA 1GAQB 4KIKB 5HKHA 3PTFC 1TJEA 2L0FA 4NZLB 2RMMA 4JL9A 3PRPB 2NTSA 4DDGD 3QC8B 1IGDA 2OOBB 2Y5CA 1ZXIA 2VZKD 3VH3B 2WXJA 2UU7A 3E9SA 1RWSA 5IP4D 3AV8A 3TL5A 1UNSA 2MEKA 2KC1A 2INDC 1SIFA 1SIJA 2LVQA 4LNIA 5IOIA 2MWSB 2WDQB 3DHIC 1SSNA 3RUIB 1T0QC 1D5MC 1JROA 2FIDA 3UQBA 2I1JA 3A33B 3N9YC 4LJPB 2N9PC 3VXWA 3KWLA 4W9CA 4O1NA 1TS5A 3L16A 3RULA 3M63B 3I63C 3PSEB 5AUKA 3N1XC 3KUDB 3KYCD 3VUXA 4KDIC 2BYTA 1YJ1A 2IY1B 2B3AA 2ICIA 1VZ6A 2LZ6A 3IXSA 2GBKA 4LNKA 4ANXA 2GMIC 1TY2A 1OEYJ 2AYOB 4DHJD 1QOAA 3NG0A 4HKQA 2ZPYA 1NI3A 2CU3A 3WAOA 3AMZA 1PUTA 3P42A 2MBHA 3KUZA 5HG2A 1VR9A 2TSSA 3Q6BA 4MEMA 3QAQA 1UELA 3AE8B 1Z2MA 4DXAB 2HDEA 1XCTL 2KQ7A 5FR6A 2NR2A 2I38A 2KFKB 2M8SA 3H7SA 1HE8A 2BWES 4WWNA 3GS2A 3TJPA 2JU6X 3B9JA 2GBJA 3KWVA 2M4NA 3AU5A 1EUVB 1V8CA 1XQQA 5G5GA 2BTEA 3MC0B 3VHTC 4E3CA 1WJ6A 2PTLA 3OG5A 4W9KA 1R4MI 4DHZB 1WJNA 2Y5PA 3CMMB 4TSSA 1FXIA 2XEWA 4W9HA 1E9MA 2N9LA 2K8BA 3V6EB 1TS2A 3HM6X 3RN9C 3M62B 5EE1A 1WR6E 3AEDB 4B9KA 2LJ5A 5D7GA 1AYFA 4YSZB 5HFYA 3UINB 4D2KA 4CHKA 3BK1A 2CS4A 1CZPA 4EOYA 1L6UA 4XDCA 2K5PA 3S2AA 4L1BA 3DHGC 3M3JA 1GB4A 4RF1A 1ZKHA 4REZA 1T6BX 3VTWA 1PFDA 2L8JA 4LTUA 5KHQA 3O65B 4LCDE 3I3TB 3ZXRA 1LGRA 3A9KA 1SE3A 2W54A 1EM7A 1XEEA 1XF5L 2WWZA 1WE6A 4RNAA 1JQ4A 2R61A 1UWMA 3V3XA 3VFKA 4ZRPA 4DWFA 2IPKD 3AH7A 3UI3A 2DZMA 1HQRD 4IG7B 2VZKB 2EELA 3EC8A 1FO4A 1E8WA 3R2TA 4KGTA 1TY0A 3DBSA 1N60A 3AE3B 1WIAA 3ZO5B 2GRIA 2KDFB 2WXKA 3BYYB 1DOIA 5E6OA 2KHWB 2MBBB 3W1SC 5LNK1 1KLVA 4LDTD 2IO1B 2FBWB 2BW2A 1EU4A 3HM3A 2N7EA 4KSKC 2PLPA 3ZNZB 5E6JA 1PGBA 4RM8A 2K8HA 1MHHE 4BKGA 2Y3AA 5L83A 2JF5A 2MLBA 4GLSC 2FUG1 5AEKB 4L23A 1XLQA 2MBOA 2ZJDA 2D5GA 5BMIA 2K22A 3O13A 3AM9A 1F9JA 1YX6B 2HJ8A 4RH6A 2FCMA 3AEGB 1WM3A 4US8A 3PPAA 3B0AA 4ZRIA 1U4AA 1RFAA 1RRBA 2H88B 4HVBA 1P9DU 2EKIA 1V6EA 2WYQA 3L4PA 3GOEA 1XLNA 2IGHA 1OQYA 4MACA 2LGDA 4YL8A 4WWMA 1LM8B 3KH0A 1ZOYB 2MBQA 2XK5B 3SEBA 1YIWA 1F2RC 4IDIA 4TQ0A 1GNUA 3DBHB 1BMLC 3ZJVA 3QWZB 4BOZB 1E7VA 2NTTA 4OVVA 3QIJA 3VRAB 4XWTA 4WURA 2LFIA 4NNJB 1FXAA 3JSVA 1V80A 4EEWA 1YN3A 4BKTA 2LVOA 3R7RA 4WIPA 1WGRA 2BBCA 4MJSA 2LXAA 3DBLB 4MJSB 1QOFA 2DAFA 1UZXB 3R66C 4ANUA 3ECIA 1N62A 2DYOA 4GN1A 3TEYA 2QSDA 3K9OB 3V62A 2M56B 2BS2B 2PPHA 2ZNVC 2ZEQA 4HKZE 2WXOA 1WZ3A 3H1UA 3NS8A 1L0XB 4ICVA 5AZGA 3P63A 2J0MA 3FILA 3IFWB 3PZDA 1ZDXA 3DVNV 2K6DB 3RT3B 2ZVNA 4K7WA 3WIMA 2BF8B 2OJRA 2V1YA 4AWJA 3OJ4B 1E7UA 2L1AA 1T0SC 1FFUA 4YXDB 3RNGC 2WXNA 3DHHC 3DDCB 3ZLZA 2JZPA 3PZ8A 1FPYA 2HJ1A 4N9F4 4E71A 2KTRB 5H8YE 2MX2A 5DPWA 3J9CA 2AQ3B 1GPXA 1HXYD 1KLUD 1D5ZC 3VAWA 1WF9A 2J0KA 5BYSA 1Q5WB 4G11A 4KKIA 3HIZA 1WWTA 4AOFA 2G4SA 1WSPA 2L0TA 4RGTA 1YJJA 1V1PA 3TEWA 4EZJA 2A5UA 4BVUC 3QX1A 2ASQA 3DVNU 2J0JA 3EFUA 3RCZA 1WRIA 2KMCA 2WNMA 3ABVB 4M01A 5IAAC 2V9HA 3PT2B 1TKYA 3I5JC 1GB1A 4BOSC 1OTRB 2UYZB 1CQVA 4IOIE 2LHDA 3TEXA 5CX3A 1BT0A 2C60A 1ZXHA 2Z0DB 2N9KA 4K1RB 4JGHB 4HJGE 2LUMA 4II2B 5H92C 4TQ1A 5EE9A 4AUQC 3ZNGC 1JWSD 4OZCA 3H7PA 3HRDD 4AP4C 1C4PA 2AL6A 2KJRA 1EF5A 3MFGA 3PVLA 3WANA 1TT5B 1CJEA 2WP9B 4RGNA 3WAPA 1C4AA 1VD2A 3MHZA 4C7ZA 1J0GA 1E0ZA 1ZPSA 3ENEA 1I4HA 3MP9A 4GU2A 1K52A 4JIOU 2J52A 3UGBB 3NS1A 3UIOB 2ZZPB 2GI9A 2GBNA 1PDXA 1WXQA 2W55A 2QJLA 5CTRC 2BYFA 1D5XC 2R2OA 1MG4A 1E6EB 3QHTA 2W9NA 4NQLB 1XD3B 1XLOA 1ZW7A 1R4NB 1WE7A 2CR5A 4FADA 3A9JB 1ISNA 2J42A 4W9LA 1KFYB 1V81A 2C7MB 3W5UB 2JYTA 3ZYYX 4H2AA 3VH4B 1JALA 1P7FA 2ONQA 4ANVA 3RFZB 2C7NB 2WXRA 4ZHPA 3MHSD 4HJKA 1VLBA 3QJZA 1HA5A 3LB8C 4A8XC 3APCA 3ZRCA 2MP2B 4MSQB 4WAFA 4M8MA 4FBJB 1V1PB 4A90A 2KDMA 2NS5A 2G9HD 3RYTA 4JWUC 2MHJA 5D6JB 1NYQA 2AL3A 5JH5C 3NVVA 4BBNF 2D3AA 3MC8A 4Q2JA 2W3RA 3R3MA 3HVDA 2KAJA 4IWPA 3AEBB 2BKRB 3VUWA 4HROA 4PYZA 4XGAB 4RMAA 3DBRB 4K3BA 3IT4B 2PE6B 2L52A 1V49A 2JZ3B 1AN8A 4MGIE 4NQKE 3T8MA 3B2FA 4II3B 3EFCA 1Q1OA 1KH0A 3AE1B 3JVZX 4FLHA 4ZYSA 3M95A 3TEZA 4LNFA 1KTKA 1C9FA 3KUCB 1V97A 2D3CA 2O6VD 1OQQA 4GB9A 3AXCA 1Q10A 3IAS1 3RD2A 2JZZA 2A4ZA 3Q8BA 4E74A 4KIKA 5IA7A 2K0PA 4BFRA 3V60A 2QMTA 3KLSX 4MH8A 1WXAA 2B76B 1FRDA 3ZJUA 1SBBB 2Z8LA 4HPLB 4FJZA 1OGWA 3OWEB 4CYEA 3VUYA 3L08A 4ITKA 1VCBA 4DBGA 3T3NA 1NENB 2WXIA 1WFYA 2M0XA 1S3SG 1MJDA 1XT9B 1E10A 1J7BA 3ZW3A 4NJCA 2MP2A 2QIEB 2X8XX 2L05A 1QILA 1EU3A 2IDYA 2HTME 2DZIA 2DNFA 4ZHOA 1N5XA 2ZCCA 5DPTA 1SE9A 2PW9A 3OLMD 1NBFC 3BIID 4MH0E 3CWIA 3IHPC 5J18A 4N6EB 5G5HA 4ARCA 3CIRB 3AN1A 2HD5B 1I7HA 3P4SB 5IN7A 4IC7B 2RPVA 4FN2A 4NAWA 2ON8A 1TBEA 5JHAA 4MM3B 3U52E 5LLIA 2D10A 3V6CB 1E8YA 2NCNA 4LLGM 1VJKA 1I4GA 1QKZA 3DVGX 3H6NA 2KT7A 3Q2AC 3SD5A 2RGFA 4BAXA 3A4SC 3AEFB 2QEJC 2GOWA 1R4NI 2LGXA 3RMKC 2Z0EB 1GG3A 3NZSA 2ZPNA 2WDVB 1WX9A 1XLPA 3ZNHB 2I1KA 4XYCA 4TMAB 1E5WA 1NYRA 2HE7A 2GB1A 1ROEA 1JRUA 1UGMA 2BGFA 3RNEC 2DLBA 4RGOS 2KYWA 2MA9B 2INCC 4WQOB 1OQRA 2BB6A 4OZAA 2KX0A 1FCCC 2QILA 2XNAC 2LGIA 4HWIB 3AECB 2N7DA 4GGQA 2WU5B 3N1ZC 2KXJA 1QT9A 3W1SA 2YLMA 3RNFC 3SR6A 3AE4B 2PVOD 3P2BA 2V4LA 3NVZA 2KQ4X 4PK1A 3B1LX 2M0AA 1VZ8A 4G3XB 4KSLC 1JWMD 1ZUD2 1DOYA 1TKEA 3GE8C 2N9XA 4XZ4A 1F1HA 4LK0M 3D32A 3UIPB 3URYA 2RDBC 3Q3NC 3TCAA 1C76A 1V2YA 5HI1A 5C1ZA 1FNVA 1AW7A 2KVZA 1YD8U 1L7YA 1ACCA 2LI5A 5J2RA 5AUIA 3AE7B 2X38A 4JPSA 2IO3B 4OVUA 2INPE 5G55A 1WZ0A 4ARIA 1IUEA 1WGDA 4YSYB 1QOBA 1UF0A 1N61A 1YN5A 1SE2A 1MVKA 2IY0B 2WXGA 2V3SA 4HLEA 1B1ZA 3UQAA 4US9A 1N63A 1B9RA 1HTOA 1MPEA 3LDZE 4XE0A 2YEPF 1RAXA 2LGSA 2LXCA 1GOZA 1TKGA 2KKCA 3ZDMC 2N4FA 4IM3A 2WX1A 3Q8AA 3VTUA 3W9CB 3ZJTA 2KWDA 1TZ1A 4J3OD 2DAJA 2QC8A 2FUHB 1TTNA 1UBQA 3DWMA 1E90A 2ZCBA 4FHJA 2L00B 4B0MA 4EUTA 1MI0A 2WXPA 1KF6B 2MBEA 3Q8EA 3KYDD 1YQ3B 2RPQA 5JXVA 4PT5A 3AE2B 5FR3A 2K6QA 2MJ3A 1YX5B 2YEPB 2O6VB 3TIXA 4MGYE 3FILB 2BT6A 1FFVA 4R3DA 2KC2A 3EA6A 4CO7A 1EO6A 5LXIB 4ICUA 4AJYB 2LHEA 4P1CC 2VH2A 5DCNA 2E6XA 4J6IA 2KTFA 3MC9A 1A70A 1P7EA 3QK0A 2R2QA 4BKSD 3X23A 4C80A 3AULA 1JWAD 2IGDA 3JW0X 3QARA 4ZDVA 2LEKA 4NJ6A 2XBBC 1FRRA 2D2QA 5TSSA 3FAHA 3VRBB 2I2YA 3AE5B 4N58A 1WXSA 4WWPA 1ZE3D 3AI5A 3ONSA 1OFFA 2JT4B 3X0WA 3HHMA 4DHJB 1NDDA 2K39A 1SJED 4NAMA 3BYTB 4M0WB 3ZGZA 2CHZA 3RNCC 1HEZE 2KACA 4GSWA 1FNUA 3RZFA 3K9PB 1WJUA 1WR1A 2MSED 3ZKJC 2REXA 2QHOA 4MM3A 1WMHB 2EKEC 3MTNB 1KOTA 1AARA 5BO4B 3IAM1 4X57B 4RCOA 2O2VA 1R4MB 1QQRA 1IBXB 3I57A 3R8BA 1JWUD 4BBNC 5J17A 3W1YA 1I4XA 1L4ZB 3R7QA 3V61A 3NUHB 5LXHA 4W9FA 3C8YA 1WX7A 3VR8B 1NEKB 2AWTA 3SFDB 2KN5A 3CSTA 3P4RB 3N3KB 1F0ZA 2KDBA 3ZVVA 4DHZE 3NOBA 2FE8A 3T9LA 1K8RB 3KQ4A 4DK5A 4WQMA 2Y5BB 1ET9A 3KW5B 3AU4A 1KM7A 3V05A 1STEA 3H9DA 1GUAB 1T5XD 4FXCA 4JLCA 1XO3A 2K9XA 4FJVB 3NVYA 4MGZE 1PGXA 1KRHA 4HDOA 1SE4A 3BZDB 1UUPA 2OHFA 2GBRA 3Q3OC 1TS4A 3U30A 2DZKA 2BKFA 2DYMA 4W9DA 3TSSA 3ZQ4A 1YMHE 1UBIA 1C1YB 3DCGA 1HZ6A 2HTHA 3FC4A 3TMPB 3R2IA 3AEAB 4XX5A 2W82A 4XC2A 1AWDA 2KN4A 2MW5A 3RPFC 1WI0A 4KKJA 1CMXB 4CQNA 3P4PB 2JUOA 5D2MB 4C4VB 5JZEB 4JX1C 2BWFA 1WXMA 2KOXA 2GLSA 4KDLB 4P16A 1WMHA 1WRDB 2PE9A 2ZW1A 1FMAD 1WYWB 1HZ5A 2NPTB 4DXFA 1TYGB 5AZHA 2KFKA 2WXHA 2JY6A 3VVWB 2NVUI 3PLVA 2N1VA 3A4RA 3EECA 2ZW0A 2W3SA 2LWPA 2L7RA 1XXGA 4IM0A 2PJHA 3BY4B 4LNNA 3ZDTA 2Q5WD 5T8IA 3EHVA 4GDKB 2DWQA 2JX5A 5L95C 3JYUA 2N9EB 5BYQA 1C79A 2K3UA 3GB1A 1UH6A 2KQSA 3ZTDA 2UWQA 4GDLB 2BS3B 2DENB 1T3QA 1Z5SB 3NZUA 1J7CA 3WAMA 5D94A 1E8XA 3MJWA 2LGYA 1JRPA 1RM6C 4JQWC 2ACZB 4OVZA 1T0YA 4G50A 4URKA 2NBUA 2JWUA 1L2NA 1WGYA 2L3ZA 4IKGA 3AB5A 2ZVOA 2J53A 1MFWA 5GXGB 4I6LB 1YN4A 2DHZA 2V3NA 2QDFA 5DPRA 1J7AA 1IBXA 3VDZA 1DGJA 3SU8X 4KV2A 2LRUA 1UD7A 4OHJA 3CF6E 4M02A 1YJIA 3A9KB 4RM9A 3ZRFA 4K7UA 4S0RA 1J8CA 3BWUD 2WXLA 5KHOA 1FEHA 3L17A 2KVRA 1IGCA 1Y56A 2EMSA 2FNJB 2ZNVB 2N0SB 4EFOA 2LUEA 3PGEA 2BYEA 1N5WA 4GMVA 5E6NA 4PS7A 2IBIB 3ALBA 4QAYA 1TZOA 3RZWC 1PQSA 3RI7C 3N20C 3VR9B 1V9JA 2LASA 4KZ0A 3NRZA 1I35A 5C3JB 2WDRB 2FIFA 4AJWA 2V4IB 2KDIA 5G2NA 2IO2B 4HDQA 2LRWA 4OW0A 2CHWA 4B6WA 2XK5A 2JVCA 4W9IA 3APDA 3N1YC 2BPSA 1S1QB 2JSVX 3DWGC 1P3QU 5FKAC 1FIQA 3GZNB 2KLGA 1GJZA 5E6PA 1KJTA 3Q14C 2DYBA 3OAWA 4IWQA 2KX3A 2SAKA 2FCNA 1P98A 1IPGA 1J19A 2MRPA 2RR9A 1WGKA 2D11A 4EZLA 2WXMA 1JW9D 2KFJA 3BINA 1RFKA 3WCQA 1V5OA 4XDDA 4W9JA 1FD6A 4DXGA 3RNBC 4F1SA 4L2YA 3VQIA 4UDUC 1DYQA 4ASWC 1L4DB 1PYWD 4S17A 2KWVB 1VDVA 4HPMB 2J7QB 2PEAA 2YVCA 4EE2A 1H8CA 2KO3A 3P1MA 4AS1A 2WU2B 4JWSC 1YQ4B 5HHDG 4DQOC 3IVFA 2KZRA 3IT6B 5C23A 4A55A 4C7YA 2PMVA 3QCAA 2WX0A 5JHBA 2AX5A 4C00A 1VRAB 3ZTCA 3EGRA 5C2TB 3RNAC 3W2DA 4IM2A 2WHIA 4DDID 2L76A 3PS6A 1ESFA
chains in the Genus database with same CATH topology
2WX1A 3VTUA 4IW0A 2MWSB 4PS8A 2G45B 4AUQC 3ZNGC 4F8CB 2JWZA 3RUIB 4K7SA 1TZ1A 3H7PA 2DAJA 4AP4C 2FIDA 2FUHB 2K25A 3UQBA 2I1JA 2AL6A 1IP9A 2KJRA 1EF5A 3A33B 1TTNA 1UBQA 1E90A 3PVLA 4LJPB 3WANA 2N9PC 2ZCBA 4FHJA 3VXWA 4W9CA 2L00B 4EUTA 3L54A 2MCNB 1TGZB 3L16A 3RULA 2MBEA 3WAPA 4WAAA 3M63B 3PSEB 3KYDD 1GC6A 2RPQA 2RSUA 2FCSA 3KUDB 1VD2A 3KYCD 2FCQA 2D3GA 3VUXA 2K6QA 1J0GA 2NBWB 4KDIC 3ENEA 1YX5B 3TIXA 2O6VB 1YJ1A 4MGYE 4GU2A 2IY1B 2B3AA 4JIOU 2KC2A 2LZ6A 3UGBB 2GBKA 4CO7A 1EO6A 3UIOB 2ZZPB 2GBNA 2M1MA 4ICUA 2RD0A 4AJYB 4ANXA 5LXIB 2GMIC 1OEYJ 1Q0WB 5CTRC 4WWOA 2AYOB 2BYFA 5DCNA 4DHJD 4J6IA 2KTFA 1WY8A 4P7IA 5AZFA 1H4RA 2R2OA 3QHTA 2W9NA 3QK0A 2ZPYA 1XD3B 3PHWB 4GDKA 4NQLB 1ZW7A 2R2QA 4BKSD 3X23A 3AULA 1WE7A 3WAOA 2CR5A 2MBHA 3JW0X 3N30A 3KUZA 3QARA 4FADA 3A9JB 2C9WB 4ZDVA 4NJ6A 2XBBC 1ISNA 4W9LA 2D2QA 4MEMA 4IWOA 3QAQA 4ZRKA 1UELA 1WXSA 3DOWA 1V81A 2C7MB 4WWPA 1Z2MA 3AI5A 3ONSA 2JT4B 4DXAB 2KQ7A 5FR6A 3X0WA 3DBLI 3HHMA 2KANA 4DHJB 1NDDA 2K39A 2NR2A 3VH4B 4MELA 4BKSA 2KFKB 3CSFA 1WH3A 2M8SA 4ANVA 2C7NB 3H7SA 3MHSD 1HE8A 4M0WB 2BWES 3GZNI 4HJKA 3QJZA 3N32A 4GIVA 4WWNA 4FA6A 3TJPA 3APCA 2CHZA 3ZRCA 2GBJA 2MP2B 2KD0A 2M4NA 3AU5A 3C0RB 4MSQB 4ANWA 1EUVB 1XQQA 4M8MA 4GSWA 2EMTA 4LDTB 4A3OA 3VHTC 3RZFA 3K9PB 4FBJB 1WJUA 4E3CA 1P1AA 1WJ6A 1WR1A 2BYVE 2MSED 3ZKJC 2REXA 4W9KA 2QHOA 4MM3A 1WMHB 2EKEC 2NS5A 3MTNB 3RYTA 1KOTA 1AARA 5BO4B 1R4MI 4DHZB 5D6JB 1WJNA 2AL3A 5JH5C 4X57B 4BBNF 2G3QB 4A20A 2O2VA 4W9GA 4MDKE 3CMMB 1SGHA 3R3MA 4HXDA 2XEWA 4W9HA 1I42A 3WALA 4IWPA 4BBNC 5J17A 2K8BA 3V6EB 2BKRB 2D07B 4MSMB 3W1YA 3HM6X 3R7QA 3Q3FA 3M62B 3V61A 3VUWA 1WR6E 3OJ3A 3WA0A 5LXHA 1G6JA 4PYZA 4B9KA 2LJ5A 4W9FA 5D7GA 3UINB 3PHXB 4NPNA 1WX7A 4RMAA 4CHKA 2CS4A 4EOYA 2AWTA 2PE6B 2KN5A 1V49A 3CSTA 2KNBA 3SHQA 3N3KB 2JZ3B 2KDBA 3S2AA 4MGIE 3QA8A 3ZVVA 4NQKE 4HK2A 4DHZE 3T8MA 3NOBA 3T9LA 1K8RB 4DK5A 4II3B 3IG3A 3M3JA 1X1MA 2Y5BB 1Q1OA 4GOCA 3DBHI 3JVZX 1ZKHA 3KW5B 1WGHA 4FLHA 4WJNA 3VTWA 3AU4A 1KM7A 3M95A 1WX8A 3L10B 2L8JA 2KDEB 3H9DA 5CHFA 3O65B 5KHQA 3PLUA 1GUAB 3I3TB 4JLCA 4LCDE 4TV3A 3KUCB 3NY5A 4FJVB 3A9KA 2Z59B 3L0WB 4MGZE 2O6VD 1GC7A 4HDOA 4GB9A 3AXCA 2GBRA 1E8ZA 2WWZA 3U30A 1WE6A 4ZYNA 2DZKA 2KJ6A 2LVPA 2BKFA 2DYMA 4W9DA 4IUMB 2VRRB 3RD2A 3VFKA 2JZZA 2O2VB 4TKNA 4DWFA 2A4ZA 1UBIA 1C1YB 2KMAA 3DCGA 4E74A 4KIKA 2DZMA 5IA7A 2HTHA 4BFRA 3VTVA 3TMPB 4IG7B 3EC8A 4XX5A 3V60A 4XC2A 1E8WA 2FAZA 2MW5A 1WI0A 1WXAA 3DBSA 2JPHA 1CMXB 2WDTB 1WIAA 2JUOA 5D2MB 3ZO5B 2M17A 4NAWB 2KDFB 1YQBA 5JZEB 5E6OA 2KHWB 4HPLB 2BWFA 1WXMA 2MBBB 4G0NB 2KJHB 2KOXA 3HK0A 4KDLB 3W1SC 1KLVA 1WMHA 4FJZA 1OGWA 1WRDB 1WXVA 2PE9A 4LDTD 1FXTB 2IO1B 3HM3A 1WYWB 2N7EA 4LJOB 4CYEA 2NPTB 4KSKC 5AZHA 1NI2A 1M94A 2KFKA 2JY6A 3VUYA 3L08A 4KZCA 5GMVA 3ZNZB 3VVWB 5CHWA 2NVUI 3PLVA 1VCBA 2N1VA 4DBGA 3A4RA 3EECA 4WJQA 4RM8A 1WFYA 2M0XA 2K8HA 1S3SG 2LWPA 2L7RA 1XT9B 4IM0A 4BKGA 3ZW3A 2MP2A 2PJHA 5L83A 1V86A 3BY4B 4M8NA 4WJPA 3ZDTA 2C5LC 2JF5A 2MLBA 2AEHA 3A1QA 3EHVA 4GDKB 3DPDA 4EZKA 2DX5B 2L05A 5L95C 3JYUA 5AEKB 2DZIA 2N9EB 1UH6A 3ML8A 3UF8A 1Y8RC 2ZCCA 2KQSA 2MBOA 5DPTA 1SE9A 2ZJDA 3ZTDA 3OLMD 2UWQA 1A5RA 4GDLB 1NBFC 2DENB 3TBLD 1F9JA 4MH0E 1YX6B 2HJ8A 3ZIMA 3PRZA 2FCMA 2K8CA 3IHPC 5J18A 1WM3A 1Z5SB 3NZUA 3WAMA 5D94A 3PPAA 1E8XA 3MJWA 2LGYA 3B0AA 2HD5B 4ZRIA 1U4AA 3B08A 1RFAA 1RRBA 2JXXA 4HVBA 4JQWC 1P9DU 2KK8A 4I6PA 1T0YA 1V6EA 1EF1A 1WGGA 2WYQA 4G50A 4URKA 3GOEA 2NBUA 4IC7B 1L2NA 1WGYA 2L3ZA 4FN2A 4NAWA 1OQYA 4GXBA 2ZVOA 1TBEA 5JHAA 4NJ7A 2LGDA 5LLIA 4YL8A 2D10A 1LM8B 3KH0A 2MBQA 4I6LB 2DHZA 2XK5B 4FULA 3V6CB 1E8YA 1YIWA 5DPRA 2NCNA 3L13A 1OEYA 3ZNID 4TQ0A 3SDLC 4KVGB 1GNUA 3DVGX 3H6NA 3VDZA 3QWZB 2LD9A 3SU8X 4KV2A 2C7HA 2LRUA 2RGFA 3SD5A 4BOZB 1UD7A 1E7VA 3A4SC 2GOWA 1R4NI 2LGXA 3CF6E 3DVGY 2Z0EB 2JRHA 2N1WA 4OVVA 3QIJA 1C3TA 3A9KB 4RM9A 3ZRFA 1GG3A 3NZSA 4K7UA 3A1QB 4WJOA 2ZPNA 1J8CA 4NNJB 5KHOA 1WX9A 3DBRI 3JSVA 1V80A 3L17A 3ZNHB 2I1KA 2KVRA 4W9EA 2CU1A 2EMSA 2FNJB 2ZNVB 4EEWA 4EFOA 4BKTA 2LUEA 3PGEA 2BYEA 4GMVA 1E5WA 2LVOA 3R7RA 5E6NA 4PS7A 2NBVB 2HE7A 3U8ZA 1WGRA 2BGFA 1JRUA 1UGMA 4MJSA 2IBIB 2LXAA 4MJSB 3ALBA 2DAFA 1UZXB 3R66C 4ANUA 3ECIA 3RZWC 1PQSA 2MA9B 3APFA 2DYOA 1V9JA 4WQOB 4GN1A 2KWCA 2LASA 2CHXA 4KZ0A 2KX0A 4FHKA 3K9OB 2JRIB 3V62A 1I35A 1D3ZA 2FIFA 4AJWA 2PPHA 2ZNVC 2ZEQA 5TR5A 2KDIA 1WZ3A 1MG8A 5G2NA 4HWIB 3H1UA 3NS8A 2IO2B 4HDQA 2LRWA 2CHWA 4ICVA 4B6WA 2N7DA 5AZGA 4GGQA 2XK5A 2JVCA 2J0MA 3NHEB 2CKHB 4W9IA 3APDA 3IFWB 2BPSA 1S1QB 3PZDA 5CHVC 2KXJA 3DVNV 2K6DB 3RT3B 2ZVNA 4K7WA 1P3QU 2YLMA 3W1SA 2BF8B 2IYDB 3WIMA 2V4LA 3P2BA 2KLGA 2OJRA 2V1YA 2DZJA 2G4DB 2MQJA 1GJZA 5E6PA 4A3PA 3OJ4B 1E7UA 4AWJA 1KJTA 4FJYA 3B1LX 1QZEA 2DYBA 4G3XB 3OAWA 4IWQA 4KSLC 2GBMA 2KX3A 3ZLZA 3DDCB 2FCNA 4HCNB 3LJ3A 3ZUNA 1P98A 1IPGA 1P0RA 4N9F4 1J19A 2KLCA 2MRPA 4F7ZA 2RR9A 4B95A 2N9XA 3JSVB 4XZ4A 2KTRB 4E71A 4MGKE 2KTRA 2MX2A 3ML9A 5DPWA 3D32A 2D11A 3UIPB 4EZLA 2K1FA 2KFJA 3BINA 4I6NB 3TCAA 1V5OA 1V2YA 4W9JA 2NPTA 4TUUA 3VAWA 5C1ZA 1WF9A 4PYUA 1WJ4A 4F1SA 3VQIA 2J0KA 3H7PB 1YD8U 1V5TA 1L7YA 4NY0A 1WM2A 2LI5A 1Q5WB 5J2RA 4G11A 4PS3A 3IBEA 3PRMB 4ASWC 1LXDA 2KWVB 3HIZA 4HPMB 2J7QB 4AOFA 2IO3B 2G4SA 3PREA 1ZGUB 2IO0B 4OVUA 2L0TA 2PEAA 2YVCA 5G55A 3U7DA 1WZ0A 3A9JA 4EZJA 1H8CA 1WGDA 2KO3A 2KWUB 2A5UA 1RLFA 3KVFB 4BVUC 3QX1A 2ASQA 3DVNU 2J0JA 1LQBA 4ZRJA 3EFUA 3RCZA 5DPSA 2KMCA 2IY0B 4K81A 2O6VA 1LFDA 3IVFA 2KZRA 3PV1A 2V3SA 3QQ8B 4GDLA 4HLEA 3UQAA 5IAAC 5C23A 4EKUA 1IYFA 3PT2B 2IZVB 3Q3JA 3QCAA 2WX0A 3DQVA 4HCPB 5EDSA 5JHBA 4KIKB 4BOSC 1OTRB 2UYZB 3PTFC 5HKHA 2L0FA 3ZTCA 3LDZE 4JL9A 1RAXA 5CX3A 3PRPB 2LXCA 4IM2A 1BT0A 4DDID 4DDGD 3QC8B 2C60A 2Z0DB 2OOBB 2KKCA 3ZDMC 2L76A 4K1RB 3VH3B 4JGHB 3PS6A 2N4FA 4II2B 4IM3A 3TL5A 4TQ1A 2KC1A 1SIFA 2LVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX1 A;  3VTU A;  4IW0 A;  2MWS B;  4PS8 A;  2G45 B;  4AUQ C;  3ZNG C;  4F8C B;  2JWZ A;  3RUI B;  4K7S A;  1TZ1 A;  3H7P A;  2DAJ A;  4AP4 C;  2FID A;  2FUH B;  2K25 A;  3UQB A;  2I1J A;  2AL6 A;  1IP9 A;  2KJR A;  1EF5 A;  3A33 B;  1TTN A;  1UBQ A;  1E90 A;  3PVL A;  4LJP B;  3WAN A;  2N9P C;  2ZCB A;  4FHJ A;  3VXW A;  4W9C A;  2L00 B;  4EUT A;  3L54 A;  2MCN B;  1TGZ B;  3L16 A;  3RUL A;  2MBE A;  3WAP A;  4WAA A;  3M63 B;  3PSE B;  3KYD D;  1GC6 A;  2RPQ A;  2RSU A;  2FCS A;  3KUD B;  1VD2 A;  3KYC D;  2FCQ A;  2D3G A;  3VUX A;  2K6Q A;  1J0G A;  2NBW B;  4KDI C;  3ENE A;  1YX5 B;  3TIX A;  2O6V B;  1YJ1 A;  4MGY E;  4GU2 A;  2IY1 B;  2B3A A;  4JIO U;  2KC2 A;  2LZ6 A;  3UGB B;  2GBK A;  4CO7 A;  1EO6 A;  3UIO B;  2ZZP B;  2GBN A;  2M1M A;  4ICU A;  2RD0 A;  4AJY B;  4ANX A;  5LXI B;  2GMI C;  1OEY J;  1Q0W B;  5CTR C;  4WWO A;  2AYO B;  2BYF A;  5DCN A;  4DHJ D;  4J6I A;  2KTF A;  1WY8 A;  4P7I A;  5AZF A;  1H4R A;  2R2O A;  3QHT A;  2W9N A;  3QK0 A;  2ZPY A;  1XD3 B;  3PHW B;  4GDK A;  4NQL B;  1ZW7 A;  2R2Q A;  4BKS D;  3X23 A;  3AUL A;  1WE7 A;  3WAO A;  2CR5 A;  2MBH A;  3JW0 X;  3N30 A;  3KUZ A;  3QAR A;  4FAD A;  3A9J B;  2C9W B;  4ZDV A;  4NJ6 A;  2XBB C;  1ISN A;  4W9L A;  2D2Q A;  4MEM A;  4IWO A;  3QAQ A;  4ZRK A;  1UEL A;  1WXS A;  3DOW A;  1V81 A;  2C7M B;  4WWP A;  1Z2M A;  3AI5 A;  3ONS A;  2JT4 B;  4DXA B;  2KQ7 A;  5FR6 A;  3X0W A;  3DBL I;  3HHM A;  2KAN A;  4DHJ B;  1NDD A;  2K39 A;  2NR2 A;  3VH4 B;  4MEL A;  4BKS A;  2KFK B;  3CSF A;  1WH3 A;  2M8S A;  4ANV A;  2C7N B;  3H7S A;  3MHS D;  1HE8 A;  4M0W B;  2BWE S;  3GZN I;  4HJK A;  3QJZ A;  3N32 A;  4GIV A;  4WWN A;  4FA6 A;  3TJP A;  3APC A;  2CHZ A;  3ZRC A;  2GBJ A;  2MP2 B;  2KD0 A;  2M4N A;  3AU5 A;  3C0R B;  4MSQ B;  4ANW A;  1EUV B;  1XQQ A;  4M8M A;  4GSW A;  2EMT A;  4LDT B;  4A3O A;  3VHT C;  3RZF A;  3K9P B;  4FBJ B;  1WJU A;  4E3C A;  1P1A A;  1WJ6 A;  1WR1 A;  2BYV E;  2MSE D;  3ZKJ C;  2REX A;  4W9K A;  2QHO A;  4MM3 A;  1WMH B;  2EKE C;  2NS5 A;  3MTN B;  3RYT A;  1KOT A;  1AAR A;  5BO4 B;  1R4M I;  4DHZ B;  5D6J B;  1WJN A;  2AL3 A;  5JH5 C;  4X57 B;  4BBN F;  2G3Q B;  4A20 A;  2O2V A;  4W9G A;  4MDK E;  3CMM B;  1SGH A;  3R3M A;  4HXD A;  2XEW A;  4W9H A;  1I42 A;  3WAL A;  4IWP A;  4BBN C;  5J17 A;  2K8B A;  3V6E B;  2BKR B;  2D07 B;  4MSM B;  3W1Y A;  3HM6 X;  3R7Q A;  3Q3F A;  3M62 B;  3V61 A;  3VUW A;  1WR6 E;  3OJ3 A;  3WA0 A;  5LXH A;  1G6J A;  4PYZ A;  4B9K A;  2LJ5 A;  4W9F A;  5D7G A;  3UIN B;  3PHX B;  4NPN A;  1WX7 A;  4RMA A;  4CHK A;  2CS4 A;  4EOY A;  2AWT A;  2PE6 B;  2KN5 A;  1V49 A;  3CST A;  2KNB A;  3SHQ A;  3N3K B;  2JZ3 B;  2KDB A;  3S2A A;  4MGI E;  3QA8 A;  3ZVV A;  4NQK E;  4HK2 A;  4DHZ E;  3T8M A;  3NOB A;  3T9L A;  1K8R B;  4DK5 A;  4II3 B;  3IG3 A;  3M3J A;  1X1M A;  2Y5B B;  1Q1O A;  4GOC A;  3DBH I;  3JVZ X;  1ZKH A;  3KW5 B;  1WGH A;  4FLH A;  4WJN A;  3VTW A;  3AU4 A;  1KM7 A;  3M95 A;  1WX8 A;  3L10 B;  2L8J A;  2KDE B;  3H9D A;  5CHF A;  3O65 B;  5KHQ A;  3PLU A;  1GUA B;  3I3T B;  4JLC A;  4LCD E;  4TV3 A;  3KUC B;  3NY5 A;  4FJV B;  3A9K A;  2Z59 B;  3L0W B;  4MGZ E;  2O6V D;  1GC7 A;  4HDO A;  4GB9 A;  3AXC A;  2GBR A;  1E8Z A;  2WWZ A;  3U30 A;  1WE6 A;  4ZYN A;  2DZK A;  2KJ6 A;  2LVP A;  2BKF A;  2DYM A;  4W9D A;  4IUM B;  2VRR B;  3RD2 A;  3VFK A;  2JZZ A;  2O2V B;  4TKN A;  4DWF A;  2A4Z A;  1UBI A;  1C1Y B;  2KMA A;  3DCG A;  4E74 A;  4KIK A;  2DZM A;  5IA7 A;  2HTH A;  4BFR A;  3VTV A;  3TMP B;  4IG7 B;  3EC8 A;  4XX5 A;  3V60 A;  4XC2 A;  1E8W A;  2FAZ A;  2MW5 A;  1WI0 A;  1WXA A;  3DBS A;  2JPH A;  1CMX B;  2WDT B;  1WIA A;  2JUO A;  5D2M B;  3ZO5 B;  2M17 A;  4NAW B;  2KDF B;  1YQB A;  5JZE B;  5E6O A;  2KHW B;  4HPL B;  2BWF A;  1WXM A;  2MBB B;  4G0N B;  2KJH B;  2KOX A;  3HK0 A;  4KDL B;  3W1S C;  1KLV A;  1WMH A;  4FJZ A;  1OGW A;  1WRD B;  1WXV A;  2PE9 A;  4LDT D;  1FXT B;  2IO1 B;  3HM3 A;  1WYW B;  2N7E A;  4LJO B;  4CYE A;  2NPT B;  4KSK C;  5AZH A;  1NI2 A;  1M94 A;  2KFK A;  2JY6 A;  3VUY A;  3L08 A;  4KZC A;  5GMV A;  3ZNZ B;  3VVW B;  5CHW A;  2NVU I;  3PLV A;  1VCB A;  2N1V A;  4DBG A;  3A4R A;  3EEC A;  4WJQ A;  4RM8 A;  1WFY A;  2M0X A;  2K8H A;  1S3S G;  2LWP A;  2L7R A;  1XT9 B;  4IM0 A;  4BKG A;  3ZW3 A;  2MP2 A;  2PJH A;  5L83 A;  1V86 A;  3BY4 B;  4M8N A;  4WJP A;  3ZDT A;  2C5L C;  2JF5 A;  2MLB A;  2AEH A;  3A1Q A;  3EHV A;  4GDK B;  3DPD A;  4EZK A;  2DX5 B;  2L05 A;  5L95 C;  3JYU A;  5AEK B;  2DZI A;  2N9E B;  1UH6 A;  3ML8 A;  3UF8 A;  1Y8R C;  2ZCC A;  2KQS A;  2MBO A;  5DPT A;  1SE9 A;  2ZJD A;  3ZTD A;  3OLM D;  2UWQ A;  1A5R A;  4GDL B;  1NBF C;  2DEN B;  3TBL D;  1F9J A;  4MH0 E;  1YX6 B;  2HJ8 A;  3ZIM A;  3PRZ A;  2FCM A;  2K8C A;  3IHP C;  5J18 A;  1WM3 A;  1Z5S B;  3NZU A;  3WAM A;  5D94 A;  3PPA A;  1E8X A;  3MJW A;  2LGY A;  3B0A A;  2HD5 B;  4ZRI A;  1U4A A;  3B08 A;  1RFA A;  1RRB A;  2JXX A;  4HVB A;  4JQW C;  1P9D U;  2KK8 A;  4I6P A;  1T0Y A;  1V6E A;  1EF1 A;  1WGG A;  2WYQ A;  4G50 A;  4URK A;  3GOE A;  2NBU A;  4IC7 B;  1L2N A;  1WGY A;  2L3Z A;  4FN2 A;  4NAW A;  1OQY A;  4GXB A;  2ZVO A;  1TBE A;  5JHA A;  4NJ7 A;  2LGD A;  5LLI A;  4YL8 A;  2D10 A;  1LM8 B;  3KH0 A;  2MBQ A;  4I6L B;  2DHZ A;  2XK5 B;  4FUL A;  3V6C B;  1E8Y A;  1YIW A;  5DPR A;  2NCN A;  3L13 A;  1OEY A;  3ZNI D;  4TQ0 A;  3SDL C;  4KVG B;  1GNU A;  3DVG X;  3H6N A;  3VDZ A;  3QWZ B;  2LD9 A;  3SU8 X;  4KV2 A;  2C7H A;  2LRU A;  2RGF A;  3SD5 A;  4BOZ B;  1UD7 A;  1E7V A;  3A4S C;  2GOW A;  1R4N I;  2LGX A;  3CF6 E;  3DVG Y;  2Z0E B;  2JRH A;  2N1W A;  4OVV A;  3QIJ A;  1C3T A;  3A9K B;  4RM9 A;  3ZRF A;  1GG3 A;  3NZS A;  4K7U A;  3A1Q B;  4WJO A;  2ZPN A;  1J8C A;  4NNJ B;  5KHO A;  1WX9 A;  3DBR I;  3JSV A;  1V80 A;  3L17 A;  3ZNH B;  2I1K A;  2KVR A;  4W9E A;  2CU1 A;  2EMS A;  2FNJ B;  2ZNV B;  4EEW A;  4EFO A;  4BKT A;  2LUE A;  3PGE A;  2BYE A;  4GMV A;  1E5W A;  2LVO A;  3R7R A;  5E6N A;  4PS7 A;  2NBV B;  2HE7 A;  3U8Z A;  1WGR A;  2BGF A;  1JRU A;  1UGM A;  4MJS A;  2IBI B;  2LXA A;  4MJS B;  3ALB A;  2DAF A;  1UZX B;  3R66 C;  4ANU A;  3ECI A;  3RZW C;  1PQS A;  2MA9 B;  3APF A;  2DYO A;  1V9J A;  4WQO B;  4GN1 A;  2KWC A;  2LAS A;  2CHX A;  4KZ0 A;  2KX0 A;  4FHK A;  3K9O B;  2JRI B;  3V62 A;  1I35 A;  1D3Z A;  2FIF A;  4AJW A;  2PPH A;  2ZNV C;  2ZEQ A;  5TR5 A;  2KDI A;  1WZ3 A;  1MG8 A;  5G2N A;  4HWI B;  3H1U A;  3NS8 A;  2IO2 B;  4HDQ A;  2LRW A;  2CHW A;  4ICV A;  4B6W A;  2N7D A;  5AZG A;  4GGQ A;  2XK5 A;  2JVC A;  2J0M A;  3NHE B;  2CKH B;  4W9I A;  3APD A;  3IFW B;  2BPS A;  1S1Q B;  3PZD A;  5CHV C;  2KXJ A;  3DVN V;  2K6D B;  3RT3 B;  2ZVN A;  4K7W A;  1P3Q U;  2YLM A;  3W1S A;  2BF8 B;  2IYD B;  3WIM A;  2V4L A;  3P2B A;  2KLG A;  2OJR A;  2V1Y A;  2DZJ A;  2G4D B;  2MQJ A;  1GJZ A;  5E6P A;  4A3P A;  3OJ4 B;  1E7U A;  4AWJ A;  1KJT A;  4FJY A;  3B1L X;  1QZE A;  2DYB A;  4G3X B;  3OAW A;  4IWQ A;  4KSL C;  2GBM A;  2KX3 A;  3ZLZ A;  3DDC B;  2FCN A;  4HCN B;  3LJ3 A;  3ZUN A;  1P98 A;  1IPG A;  1P0R A;  4N9F 4;  1J19 A;  2KLC A;  2MRP A;  4F7Z A;  2RR9 A;  4B95 A;  2N9X A;  3JSV B;  4XZ4 A;  2KTR B;  4E71 A;  4MGK E;  2KTR A;  2MX2 A;  3ML9 A;  5DPW A;  3D32 A;  2D11 A;  3UIP B;  4EZL A;  2K1F A;  2KFJ A;  3BIN A;  4I6N B;  3TCA A;  1V5O A;  1V2Y A;  4W9J A;  2NPT A;  4TUU A;  3VAW A;  5C1Z A;  1WF9 A;  4PYU A;  1WJ4 A;  4F1S A;  3VQI A;  2J0K A;  3H7P B;  1YD8 U;  1V5T A;  1L7Y A;  4NY0 A;  1WM2 A;  2LI5 A;  1Q5W B;  5J2R A;  4G11 A;  4PS3 A;  3IBE A;  3PRM B;  4ASW C;  1LXD A;  2KWV B;  3HIZ A;  4HPM B;  2J7Q B;  4AOF A;  2IO3 B;  2G4S A;  3PRE A;  1ZGU B;  2IO0 B;  4OVU A;  2L0T A;  2PEA A;  2YVC A;  5G55 A;  3U7D A;  1WZ0 A;  3A9J A;  4EZJ A;  1H8C A;  1WGD A;  2KO3 A;  2KWU B;  2A5U A;  1RLF A;  3KVF B;  4BVU C;  3QX1 A;  2ASQ A;  3DVN U;  2J0J A;  1LQB A;  4ZRJ A;  3EFU A;  3RCZ A;  5DPS A;  2KMC A;  2IY0 B;  4K81 A;  2O6V A;  1LFD A;  3IVF A;  2KZR A;  3PV1 A;  2V3S A;  3QQ8 B;  4GDL A;  4HLE A;  3UQA A;  5IAA C;  5C23 A;  4EKU A;  1IYF A;  3PT2 B;  2IZV B;  3Q3J A;  3QCA A;  2WX0 A;  3DQV A;  4HCP B;  5EDS A;  5JHB A;  4KIK B;  4BOS C;  1OTR B;  2UYZ B;  3PTF C;  5HKH A;  2L0F A;  3ZTC A;  3LDZ E;  4JL9 A;  1RAX A;  5CX3 A;  3PRP B;  2LXC A;  4IM2 A;  1BT0 A;  4DDI D;  4DDG D;  3QC8 B;  2C60 A;  2Z0D B;  2OOB B;  2KKC A;  3ZDM C;  2L76 A;  4K1R B;  3VH3 B;  4JGH B;  3PS6 A;  2N4F A;  4II2 B;  4IM3 A;  3TL5 A;  4TQ1 A;  2KC1 A;  1SIF A;  2LVQ A; 
#chains in the Genus database with same CATH topology
 2WS3 B;  1TS3 A;  4IW0 A;  4PS8 A;  2G45 B;  1FNW A;  2PIA A;  4F8C B;  2JWZ A;  1I4P A;  4A9A A;  4K7S A;  3PO0 A;  2BB5 A;  2BQQ A;  1L6V A;  2K25 A;  2IGG A;  1IP9 A;  4M0W A;  3Q3M C;  1M4V A;  2OJW A;  5D3I B;  3L54 A;  2MCN B;  1FCL A;  1TGZ B;  5IO9 A;  2PKO A;  4WAA A;  5EE0 A;  2NMQ A;  1GC6 A;  2RSU A;  2FCS A;  1EWC A;  3U2S C;  2FCQ A;  3MJ5 A;  2D3G A;  4BZA A;  1L0Y B;  2NBW B;  2L83 A;  1XCQ L;  3NJT A;  1JCK B;  3U4E G;  2M1M A;  2RD0 A;  1Q0W B;  1HTQ A;  4WWO A;  1WY8 A;  4P7I A;  5AZF A;  1H4R A;  3C19 A;  2KMM A;  3PHW B;  4GDK A;  3AEE B;  2G1E A;  3N30 A;  2C9W B;  1L0V B;  4IWO A;  1MHX A;  4ZRK A;  2AQ2 B;  3DOW A;  4YTP B;  4LNO A;  3DBL I;  3LYY A;  2KAN A;  4BKS A;  4MEL A;  3W5V B;  3CSF A;  1WH3 A;  1JWB D;  2BS4 B;  3GZN I;  3N32 A;  4GIV A;  4FA6 A;  4KGS A;  2KD0 A;  4ANW A;  3C0R B;  1F77 A;  4LDT B;  2EMT A;  4A3O A;  1SF0 A;  1P1A A;  2BYV E;  1C78 A;  2M19 A;  3AE9 B;  5I4D A;  1TIF A;  2JQR B;  2G3Q B;  4A20 A;  3ZXV A;  4P6V F;  4W9G A;  2MJD A;  5MPO A;  4MDK E;  2WXQ A;  1SGH A;  4HXD A;  3WAL A;  5D3D A;  2D07 B;  4MSM B;  3Q3F A;  3WA0 A;  3OJ3 A;  1G6J A;  2H89 B;  1F2R I;  3PHX B;  4NPN A;  1UWX A;  1PGA A;  2E3T A;  1YOV B;  1BXT A;  1SXT A;  2KNB A;  4N59 A;  3SHQ A;  4B0E A;  3QA8 A;  3Q8C A;  4HK2 A;  3IG3 A;  1X1M A;  4GOC A;  3DBH I;  3E56 A;  1WGH A;  4A6Q A;  4WJN A;  1WX8 A;  3L10 B;  2KDE B;  5CHF A;  3PLU A;  4TV3 A;  5IKC M;  2CJN A;  3NY5 A;  2Z59 B;  3L0W B;  1GC7 A;  2WGS A;  5EE3 A;  1K53 A;  3ETR A;  1E8Z A;  1SJH D;  4YSX B;  4ZYN A;  2KJ6 A;  2LVP A;  1K50 A;  4KX6 B;  4IUM B;  3PZ7 A;  2VRR B;  2V3P A;  4TKN A;  2O2V B;  1UGJ A;  2KMA A;  3EUB 2;  4ZOH C;  3VTV A;  4MT5 A;  2FAZ A;  4XWW A;  2XN9 C;  4KGR A;  2JPH A;  2WDT B;  2M17 A;  4NAW B;  1YQB A;  4G0N B;  2KJH B;  3HK0 A;  4OZB A;  1V1O A;  1WXV A;  1FXT B;  4K3C A;  4YT0 B;  4LJO B;  2LJI A;  1NI2 A;  1M94 A;  3P4Q B;  2LMC A;  4KZC A;  5GMV A;  5CHW A;  1JML A;  3HUI A;  5BYR A;  4YTM B;  4WJQ A;  3Q8F A;  1D6E C;  3GP7 A;  1YNT E;  4JE3 B;  3H8H A;  2MH7 A;  2JYE A;  4YWG G;  1V86 A;  4M8N A;  4WJP A;  2C5L C;  3A1Q A;  2AEH A;  3DPD A;  4EZK A;  2DX5 B;  1ZDV A;  3NZ3 A;  3Q69 A;  2L32 A;  2DBY A;  3ML8 A;  4RGM A;  3UF8 A;  1Y8R C;  2OED A;  4HRS A;  1FM0 D;  1A5R A;  1L5P A;  5BMG A;  3SFE B;  3TBL D;  2N7J A;  3ZIM A;  3PRZ A;  2K8C A;  1N6Z A;  3AE6 B;  3U7Z A;  2PVG C;  3B08 A;  2JXX A;  4AQ7 A;  2KK8 A;  4I6P A;  1EF1 A;  1WGG A;  4GXB A;  3LXF A;  4NJ7 A;  1VZ7 A;  2QCZ A;  4FUL A;  3L13 A;  1OEY A;  2BVC A;  3ZNI D;  3SDL C;  4KVG B;  4RF0 A;  1BUI C;  1ET6 A;  2LD9 A;  2C7H A;  1DOX A;  1C77 A;  4HPP A;  3BK2 A;  3DVG Y;  2JRH A;  2N1W A;  1C3T A;  3A1Q B;  4WJO A;  1KLG D;  4C4V A;  3DBR I;  3GE3 C;  4W9E A;  2CU1 A;  3B2G A;  1I4R A;  4USA A;  2NBV B;  3U8Z A;  4C56 C;  1CK1 A;  1R7S A;  2VH1 A;  1E7P B;  1ENF A;  3APF A;  2KWC A;  2CHX A;  2D3B A;  2WLB A;  3BVG A;  4FHK A;  2JRI B;  1D3Z A;  5TR5 A;  1MG8 A;  1NVI D;  4RFB A;  1I4Q A;  2SEB D;  3NHE B;  1D4B A;  2CKH B;  3FKY A;  4M00 A;  5CHV C;  1QLB B;  1RYJ A;  2IYD B;  3BVM A;  4YTN B;  1QF6 A;  1LO5 D;  2DZJ A;  2G4D B;  2MQJ A;  2AQ1 B;  4A3P A;  2WXF A;  1SEB D;  4FJY A;  2V0G A;  1QZE A;  2IJ0 A;  3HVZ A;  2CJO A;  1EWY C;  2GBM A;  4HCN B;  5FK9 C;  3LJ3 A;  2RDG A;  3ZUN A;  1P0R A;  3BVZ A;  2KLC A;  4F7Z A;  4B95 A;  3JSV B;  4MGK E;  5BMH A;  2KTR A;  3ML9 A;  2RDH A;  2K1F A;  2JXT A;  4I6N B;  4ACF A;  2NPT A;  4TUU A;  1QOG A;  4PYU A;  1WJ4 A;  3TUO A;  1C4C A;  3H7P B;  2J4X A;  1V5T A;  1T0R C;  4NY0 A;  1K51 A;  1WM2 A;  4ZRQ A;  1WYG A;  4PS3 A;  3IBE A;  3PRM B;  1LXD A;  3T3O A;  4WH4 A;  4P1B C;  1F52 A;  1I42 A;  3PRE A;  2INN E;  1ZGU B;  2IO0 B;  3U7D A;  3A9J A;  2KWU B;  4HEA 1;  1RLF A;  3KVF B;  2WQY B;  1LQB A;  3NVW A;  4ZRJ A;  2MJE A;  3I9V 1;  5DPS A;  4K81 A;  2O6V A;  1ZP0 B;  1LFD A;  1SB3 C;  3PV1 A;  3QQ8 B;  4GDL A;  4EKU A;  1IYF A;  2IZV B;  3Q3J A;  3DQV A;  4HCP B;  5EDS A;  1GAQ B;  4KIK B;  5HKH A;  3PTF C;  1TJE A;  2L0F A;  4NZL B;  2RMM A;  4JL9 A;  3PRP B;  2NTS A;  4DDG D;  3QC8 B;  1IGD A;  2OOB B;  2Y5C A;  1ZXI A;  2VZK D;  3VH3 B;  2WXJ A;  2UU7 A;  3E9S A;  1RWS A;  5IP4 D;  3AV8 A;  3TL5 A;  1UNS A;  2MEK A;  2KC1 A;  2IND C;  1SIF A;  1SIJ A;  2LVQ A;  4LNI A;  5IOI A;  2MWS B;  2WDQ B;  3DHI C;  1SSN A;  3RUI B;  1T0Q C;  1D5M C;  1JRO A;  2FID A;  3UQB A;  2I1J A;  3A33 B;  3N9Y C;  4LJP B;  2N9P C;  3VXW A;  3KWL A;  4W9C A;  4O1N A;  1TS5 A;  3L16 A;  3RUL A;  3M63 B;  3I63 C;  3PSE B;  5AUK A;  3N1X C;  3KUD B;  3KYC D;  3VUX A;  4KDI C;  2BYT A;  1YJ1 A;  2IY1 B;  2B3A A;  2ICI A;  1VZ6 A;  2LZ6 A;  3IXS A;  2GBK A;  4LNK A;  4ANX A;  2GMI C;  1TY2 A;  1OEY J;  2AYO B;  4DHJ D;  1QOA A;  3NG0 A;  4HKQ A;  2ZPY A;  1NI3 A;  2CU3 A;  3WAO A;  3AMZ A;  1PUT A;  3P42 A;  2MBH A;  3KUZ A;  5HG2 A;  1VR9 A;  2TSS A;  3Q6B A;  4MEM A;  3QAQ A;  1UEL A;  3AE8 B;  1Z2M A;  4DXA B;  2HDE A;  1XCT L;  2KQ7 A;  5FR6 A;  2NR2 A;  2I38 A;  2KFK B;  2M8S A;  3H7S A;  1HE8 A;  2BWE S;  4WWN A;  3GS2 A;  3TJP A;  2JU6 X;  3B9J A;  2GBJ A;  3KWV A;  2M4N A;  3AU5 A;  1EUV B;  1V8C A;  1XQQ A;  5G5G A;  2BTE A;  3MC0 B;  3VHT C;  4E3C A;  1WJ6 A;  2PTL A;  3OG5 A;  4W9K A;  1R4M I;  4DHZ B;  1WJN A;  2Y5P A;  3CMM B;  4TSS A;  1FXI A;  2XEW A;  4W9H A;  1E9M A;  2N9L A;  2K8B A;  3V6E B;  1TS2 A;  3HM6 X;  3RN9 C;  3M62 B;  5EE1 A;  1WR6 E;  3AED B;  4B9K A;  2LJ5 A;  5D7G A;  1AYF A;  4YSZ B;  5HFY A;  3UIN B;  4D2K A;  4CHK A;  3BK1 A;  2CS4 A;  1CZP A;  4EOY A;  1L6U A;  4XDC A;  2K5P A;  3S2A A;  4L1B A;  3DHG C;  3M3J A;  1GB4 A;  4RF1 A;  1ZKH A;  4REZ A;  1T6B X;  3VTW A;  1PFD A;  2L8J A;  4LTU A;  5KHQ A;  3O65 B;  4LCD E;  3I3T B;  3ZXR A;  1LGR A;  3A9K A;  1SE3 A;  2W54 A;  1EM7 A;  1XEE A;  1XF5 L;  2WWZ A;  1WE6 A;  4RNA A;  1JQ4 A;  2R61 A;  1UWM A;  3V3X A;  3VFK A;  4ZRP A;  4DWF A;  2IPK D;  3AH7 A;  3UI3 A;  2DZM A;  1HQR D;  4IG7 B;  2VZK B;  2EEL A;  3EC8 A;  1FO4 A;  1E8W A;  3R2T A;  4KGT A;  1TY0 A;  3DBS A;  1N60 A;  3AE3 B;  1WIA A;  3ZO5 B;  2GRI A;  2KDF B;  2WXK A;  3BYY B;  1DOI A;  5E6O A;  2KHW B;  2MBB B;  3W1S C;  5LNK 1;  1KLV A;  4LDT D;  2IO1 B;  2FBW B;  2BW2 A;  1EU4 A;  3HM3 A;  2N7E A;  4KSK C;  2PLP A;  3ZNZ B;  5E6J A;  1PGB A;  4RM8 A;  2K8H A;  1MHH E;  4BKG A;  2Y3A A;  5L83 A;  2JF5 A;  2MLB A;  4GLS C;  2FUG 1;  5AEK B;  4L23 A;  1XLQ A;  2MBO A;  2ZJD A;  2D5G A;  5BMI A;  2K22 A;  3O13 A;  3AM9 A;  1F9J A;  1YX6 B;  2HJ8 A;  4RH6 A;  2FCM A;  3AEG B;  1WM3 A;  4US8 A;  3PPA A;  3B0A A;  4ZRI A;  1U4A A;  1RFA A;  1RRB A;  2H88 B;  4HVB A;  1P9D U;  2EKI A;  1V6E A;  2WYQ A;  3L4P A;  3GOE A;  1XLN A;  2IGH A;  1OQY A;  4MAC A;  2LGD A;  4YL8 A;  4WWM A;  1LM8 B;  3KH0 A;  1ZOY B;  2MBQ A;  2XK5 B;  3SEB A;  1YIW A;  1F2R C;  4IDI A;  4TQ0 A;  1GNU A;  3DBH B;  1BML C;  3ZJV A;  3QWZ B;  4BOZ B;  1E7V A;  2NTT A;  4OVV A;  3QIJ A;  3VRA B;  4XWT A;  4WUR A;  2LFI A;  4NNJ B;  1FXA A;  3JSV A;  1V80 A;  4EEW A;  1YN3 A;  4BKT A;  2LVO A;  3R7R A;  4WIP A;  1WGR A;  2BBC A;  4MJS A;  2LXA A;  3DBL B;  4MJS B;  1QOF A;  2DAF A;  1UZX B;  3R66 C;  4ANU A;  3ECI A;  1N62 A;  2DYO A;  4GN1 A;  3TEY A;  2QSD A;  3K9O B;  3V62 A;  2M56 B;  2BS2 B;  2PPH A;  2ZNV C;  2ZEQ A;  4HKZ E;  2WXO A;  1WZ3 A;  3H1U A;  3NS8 A;  1L0X B;  4ICV A;  5AZG A;  3P63 A;  2J0M A;  3FIL A;  3IFW B;  3PZD A;  1ZDX A;  3DVN V;  2K6D B;  3RT3 B;  2ZVN A;  4K7W A;  3WIM A;  2BF8 B;  2OJR A;  2V1Y A;  4AWJ A;  3OJ4 B;  1E7U A;  2L1A A;  1T0S C;  1FFU A;  4YXD B;  3RNG C;  2WXN A;  3DHH C;  3DDC B;  3ZLZ A;  2JZP A;  3PZ8 A;  1FPY A;  2HJ1 A;  4N9F 4;  4E71 A;  2KTR B;  5H8Y E;  2MX2 A;  5DPW A;  3J9C A;  2AQ3 B;  1GPX A;  1HXY D;  1KLU D;  1D5Z C;  3VAW A;  1WF9 A;  2J0K A;  5BYS A;  1Q5W B;  4G11 A;  4KKI A;  3HIZ A;  1WWT A;  4AOF A;  2G4S A;  1WSP A;  2L0T A;  4RGT A;  1YJJ A;  1V1P A;  3TEW A;  4EZJ A;  2A5U A;  4BVU C;  3QX1 A;  2ASQ A;  3DVN U;  2J0J A;  3EFU A;  3RCZ A;  1WRI A;  2KMC A;  2WNM A;  3ABV B;  4M01 A;  5IAA C;  2V9H A;  3PT2 B;  1TKY A;  3I5J C;  1GB1 A;  4BOS C;  1OTR B;  2UYZ B;  1CQV A;  4IOI E;  2LHD A;  3TEX A;  5CX3 A;  1BT0 A;  2C60 A;  1ZXH A;  2Z0D B;  2N9K A;  4K1R B;  4JGH B;  4HJG E;  2LUM A;  4II2 B;  5H92 C;  4TQ1 A;  5EE9 A;  4AUQ C;  3ZNG C;  1JWS D;  4OZC A;  3H7P A;  3HRD D;  4AP4 C;  1C4P A;  2AL6 A;  2KJR A;  1EF5 A;  3MFG A;  3PVL A;  3WAN A;  1TT5 B;  1CJE A;  2WP9 B;  4RGN A;  3WAP A;  1C4A A;  1VD2 A;  3MHZ A;  4C7Z A;  1J0G A;  1E0Z A;  1ZPS A;  3ENE A;  1I4H A;  3MP9 A;  4GU2 A;  1K52 A;  4JIO U;  2J52 A;  3UGB B;  3NS1 A;  3UIO B;  2ZZP B;  2GI9 A;  2GBN A;  1PDX A;  1WXQ A;  2W55 A;  2QJL A;  5CTR C;  2BYF A;  1D5X C;  2R2O A;  1MG4 A;  1E6E B;  3QHT A;  2W9N A;  4NQL B;  1XD3 B;  1XLO A;  1ZW7 A;  1R4N B;  1WE7 A;  2CR5 A;  4FAD A;  3A9J B;  1ISN A;  2J42 A;  4W9L A;  1KFY B;  1V81 A;  2C7M B;  3W5U B;  2JYT A;  3ZYY X;  4H2A A;  3VH4 B;  1JAL A;  1P7F A;  2ONQ A;  4ANV A;  3RFZ B;  2C7N B;  2WXR A;  4ZHP A;  3MHS D;  4HJK A;  1VLB A;  3QJZ A;  1HA5 A;  3LB8 C;  4A8X C;  3APC A;  3ZRC A;  2MP2 B;  4MSQ B;  4WAF A;  4M8M A;  4FBJ B;  1V1P B;  4A90 A;  2KDM A;  2NS5 A;  2G9H D;  3RYT A;  4JWU C;  2MHJ A;  5D6J B;  1NYQ A;  2AL3 A;  5JH5 C;  3NVV A;  4BBN F;  2D3A A;  3MC8 A;  4Q2J A;  2W3R A;  3R3M A;  3HVD A;  2KAJ A;  4IWP A;  3AEB B;  2BKR B;  3VUW A;  4HRO A;  4PYZ A;  4XGA B;  4RMA A;  3DBR B;  4K3B A;  3IT4 B;  2PE6 B;  2L52 A;  1V49 A;  2JZ3 B;  1AN8 A;  4MGI E;  4NQK E;  3T8M A;  3B2F A;  4II3 B;  3EFC A;  1Q1O A;  1KH0 A;  3AE1 B;  3JVZ X;  4FLH A;  4ZYS A;  3M95 A;  3TEZ A;  4LNF A;  1KTK A;  1C9F A;  3KUC B;  1V97 A;  2D3C A;  2O6V D;  1OQQ A;  4GB9 A;  3AXC A;  1Q10 A;  3IAS 1;  3RD2 A;  2JZZ A;  2A4Z A;  3Q8B A;  4E74 A;  4KIK A;  5IA7 A;  2K0P A;  4BFR A;  3V60 A;  2QMT A;  3KLS X;  4MH8 A;  1WXA A;  2B76 B;  1FRD A;  3ZJU A;  1SBB B;  2Z8L A;  4HPL B;  4FJZ A;  1OGW A;  3OWE B;  4CYE A;  3VUY A;  3L08 A;  4ITK A;  1VCB A;  4DBG A;  3T3N A;  1NEN B;  2WXI A;  1WFY A;  2M0X A;  1S3S G;  1MJD A;  1XT9 B;  1E10 A;  1J7B A;  3ZW3 A;  4NJC A;  2MP2 A;  2QIE B;  2X8X X;  2L05 A;  1QIL A;  1EU3 A;  2IDY A;  2HTM E;  2DZI A;  2DNF A;  4ZHO A;  1N5X A;  2ZCC A;  5DPT A;  1SE9 A;  2PW9 A;  3OLM D;  1NBF C;  3BII D;  4MH0 E;  3CWI A;  3IHP C;  5J18 A;  4N6E B;  5G5H A;  4ARC A;  3CIR B;  3AN1 A;  2HD5 B;  1I7H A;  3P4S B;  5IN7 A;  4IC7 B;  2RPV A;  4FN2 A;  4NAW A;  2ON8 A;  1TBE A;  5JHA A;  4MM3 B;  3U52 E;  5LLI A;  2D10 A;  3V6C B;  1E8Y A;  2NCN A;  4LLG M;  1VJK A;  1I4G A;  1QKZ A;  3DVG X;  3H6N A;  2KT7 A;  3Q2A C;  3SD5 A;  2RGF A;  4BAX A;  3A4S C;  3AEF B;  2QEJ C;  2GOW A;  1R4N I;  2LGX A;  3RMK C;  2Z0E B;  1GG3 A;  3NZS A;  2ZPN A;  2WDV B;  1WX9 A;  1XLP A;  3ZNH B;  2I1K A;  4XYC A;  4TMA B;  1E5W A;  1NYR A;  2HE7 A;  2GB1 A;  1ROE A;  1JRU A;  1UGM A;  2BGF A;  3RNE C;  2DLB A;  4RGO S;  2KYW A;  2MA9 B;  2INC C;  4WQO B;  1OQR A;  2BB6 A;  4OZA A;  2KX0 A;  1FCC C;  2QIL A;  2XNA C;  2LGI A;  4HWI B;  3AEC B;  2N7D A;  4GGQ A;  2WU5 B;  3N1Z C;  2KXJ A;  1QT9 A;  3W1S A;  2YLM A;  3RNF C;  3SR6 A;  3AE4 B;  2PVO D;  3P2B A;  2V4L A;  3NVZ A;  2KQ4 X;  4PK1 A;  3B1L X;  2M0A A;  1VZ8 A;  4G3X B;  4KSL C;  1JWM D;  1ZUD 2;  1DOY A;  1TKE A;  3GE8 C;  2N9X A;  4XZ4 A;  1F1H A;  4LK0 M;  3D32 A;  3UIP B;  3URY A;  2RDB C;  3Q3N C;  3TCA A;  1C76 A;  1V2Y A;  5HI1 A;  5C1Z A;  1FNV A;  1AW7 A;  2KVZ A;  1YD8 U;  1L7Y A;  1ACC A;  2LI5 A;  5J2R A;  5AUI A;  3AE7 B;  2X38 A;  4JPS A;  2IO3 B;  4OVU A;  2INP E;  5G55 A;  1WZ0 A;  4ARI A;  1IUE A;  1WGD A;  4YSY B;  1QOB A;  1UF0 A;  1N61 A;  1YN5 A;  1SE2 A;  1MVK A;  2IY0 B;  2WXG A;  2V3S A;  4HLE A;  1B1Z A;  3UQA A;  4US9 A;  1N63 A;  1B9R A;  1HTO A;  1MPE A;  3LDZ E;  4XE0 A;  2YEP F;  1RAX A;  2LGS A;  2LXC A;  1GOZ A;  1TKG A;  2KKC A;  3ZDM C;  2N4F A;  4IM3 A;  2WX1 A;  3Q8A A;  3VTU A;  3W9C B;  3ZJT A;  2KWD A;  1TZ1 A;  4J3O D;  2DAJ A;  2QC8 A;  2FUH B;  1TTN A;  1UBQ A;  3DWM A;  1E90 A;  2ZCB A;  4FHJ A;  2L00 B;  4B0M A;  4EUT A;  1MI0 A;  2WXP A;  1KF6 B;  2MBE A;  3Q8E A;  3KYD D;  1YQ3 B;  2RPQ A;  5JXV A;  4PT5 A;  3AE2 B;  5FR3 A;  2K6Q A;  2MJ3 A;  1YX5 B;  2YEP B;  2O6V B;  3TIX A;  4MGY E;  3FIL B;  2BT6 A;  1FFV A;  4R3D A;  2KC2 A;  3EA6 A;  4CO7 A;  1EO6 A;  5LXI B;  4ICU A;  4AJY B;  2LHE A;  4P1C C;  2VH2 A;  5DCN A;  2E6X A;  4J6I A;  2KTF A;  3MC9 A;  1A70 A;  1P7E A;  3QK0 A;  2R2Q A;  4BKS D;  3X23 A;  4C80 A;  3AUL A;  1JWA D;  2IGD A;  3JW0 X;  3QAR A;  4ZDV A;  2LEK A;  4NJ6 A;  2XBB C;  1FRR A;  2D2Q A;  5TSS A;  3FAH A;  3VRB B;  2I2Y A;  3AE5 B;  4N58 A;  1WXS A;  4WWP A;  1ZE3 D;  3AI5 A;  3ONS A;  1OFF A;  2JT4 B;  3X0W A;  3HHM A;  4DHJ B;  1NDD A;  2K39 A;  1SJE D;  4NAM A;  3BYT B;  4M0W B;  3ZGZ A;  2CHZ A;  3RNC C;  1HEZ E;  2KAC A;  4GSW A;  1FNU A;  3RZF A;  3K9P B;  1WJU A;  1WR1 A;  2MSE D;  3ZKJ C;  2REX A;  2QHO A;  4MM3 A;  1WMH B;  2EKE C;  3MTN B;  1KOT A;  1AAR A;  5BO4 B;  3IAM 1;  4X57 B;  4RCO A;  2O2V A;  1R4M B;  1QQR A;  1IBX B;  3I57 A;  3R8B A;  1JWU D;  4BBN C;  5J17 A;  3W1Y A;  1I4X A;  1L4Z B;  3R7Q A;  3V61 A;  3NUH B;  5LXH A;  4W9F A;  3C8Y A;  1WX7 A;  3VR8 B;  1NEK B;  2AWT A;  3SFD B;  2KN5 A;  3CST A;  3P4R B;  3N3K B;  1F0Z A;  2KDB A;  3ZVV A;  4DHZ E;  3NOB A;  2FE8 A;  3T9L A;  1K8R B;  3KQ4 A;  4DK5 A;  4WQM A;  2Y5B B;  1ET9 A;  3KW5 B;  3AU4 A;  1KM7 A;  3V05 A;  1STE A;  3H9D A;  1GUA B;  1T5X D;  4FXC A;  4JLC A;  1XO3 A;  2K9X A;  4FJV B;  3NVY A;  4MGZ E;  1PGX A;  1KRH A;  4HDO A;  1SE4 A;  3BZD B;  1UUP A;  2OHF A;  2GBR A;  3Q3O C;  1TS4 A;  3U30 A;  2DZK A;  2BKF A;  2DYM A;  4W9D A;  3TSS A;  3ZQ4 A;  1YMH E;  1UBI A;  1C1Y B;  3DCG A;  1HZ6 A;  2HTH A;  3FC4 A;  3TMP B;  3R2I A;  3AEA B;  4XX5 A;  2W82 A;  4XC2 A;  1AWD A;  2KN4 A;  2MW5 A;  3RPF C;  1WI0 A;  4KKJ A;  1CMX B;  4CQN A;  3P4P B;  2JUO A;  5D2M B;  4C4V B;  5JZE B;  4JX1 C;  2BWF A;  1WXM A;  2KOX A;  2GLS A;  4KDL B;  4P16 A;  1WMH A;  1WRD B;  2PE9 A;  2ZW1 A;  1FMA D;  1WYW B;  1HZ5 A;  2NPT B;  4DXF A;  1TYG B;  5AZH A;  2KFK A;  2WXH A;  2JY6 A;  3VVW B;  2NVU I;  3PLV A;  2N1V A;  3A4R A;  3EEC A;  2ZW0 A;  2W3S A;  2LWP A;  2L7R A;  1XXG A;  4IM0 A;  2PJH A;  3BY4 B;  4LNN A;  3ZDT A;  2Q5W D;  5T8I A;  3EHV A;  4GDK B;  2DWQ A;  2JX5 A;  5L95 C;  3JYU A;  2N9E B;  5BYQ A;  1C79 A;  2K3U A;  3GB1 A;  1UH6 A;  2KQS A;  3ZTD A;  2UWQ A;  4GDL B;  2BS3 B;  2DEN B;  1T3Q A;  1Z5S B;  3NZU A;  1J7C A;  3WAM A;  5D94 A;  1E8X A;  3MJW A;  2LGY A;  1JRP A;  1RM6 C;  4JQW C;  2ACZ B;  4OVZ A;  1T0Y A;  4G50 A;  4URK A;  2NBU A;  2JWU A;  1L2N A;  1WGY A;  2L3Z A;  4IKG A;  3AB5 A;  2ZVO A;  2J53 A;  1MFW A;  5GXG B;  4I6L B;  1YN4 A;  2DHZ A;  2V3N A;  2QDF A;  5DPR A;  1J7A A;  1IBX A;  3VDZ A;  1DGJ A;  3SU8 X;  4KV2 A;  2LRU A;  1UD7 A;  4OHJ A;  3CF6 E;  4M02 A;  1YJI A;  3A9K B;  4RM9 A;  3ZRF A;  4K7U A;  4S0R A;  1J8C A;  3BWU D;  2WXL A;  5KHO A;  1FEH A;  3L17 A;  2KVR A;  1IGC A;  1Y56 A;  2EMS A;  2FNJ B;  2ZNV B;  2N0S B;  4EFO A;  2LUE A;  3PGE A;  2BYE A;  1N5W A;  4GMV A;  5E6N A;  4PS7 A;  2IBI B;  3ALB A;  4QAY A;  1TZO A;  3RZW C;  1PQS A;  3RI7 C;  3N20 C;  3VR9 B;  1V9J A;  2LAS A;  4KZ0 A;  3NRZ A;  1I35 A;  5C3J B;  2WDR B;  2FIF A;  4AJW A;  2V4I B;  2KDI A;  5G2N A;  2IO2 B;  4HDQ A;  2LRW A;  4OW0 A;  2CHW A;  4B6W A;  2XK5 A;  2JVC A;  4W9I A;  3APD A;  3N1Y C;  2BPS A;  1S1Q B;  2JSV X;  3DWG C;  1P3Q U;  5FKA C;  1FIQ A;  3GZN B;  2KLG A;  1GJZ A;  5E6P A;  1KJT A;  3Q14 C;  2DYB A;  3OAW A;  4IWQ A;  2KX3 A;  2SAK A;  2FCN A;  1P98 A;  1IPG A;  1J19 A;  2MRP A;  2RR9 A;  1WGK A;  2D11 A;  4EZL A;  2WXM A;  1JW9 D;  2KFJ A;  3BIN A;  1RFK A;  3WCQ A;  1V5O A;  4XDD A;  4W9J A;  1FD6 A;  4DXG A;  3RNB C;  4F1S A;  4L2Y A;  3VQI A;  4UDU C;  1DYQ A;  4ASW C;  1L4D B;  1PYW D;  4S17 A;  2KWV B;  1VDV A;  4HPM B;  2J7Q B;  2PEA A;  2YVC A;  4EE2 A;  1H8C A;  2KO3 A;  3P1M A;  4AS1 A;  2WU2 B;  4JWS C;  1YQ4 B;  5HHD G;  4DQO C;  3IVF A;  2KZR A;  3IT6 B;  5C23 A;  4A55 A;  4C7Y A;  2PMV A;  3QCA A;  2WX0 A;  5JHB A;  2AX5 A;  4C00 A;  1VRA B;  3ZTC A;  3EGR A;  5C2T B;  3RNA C;  3W2D A;  4IM2 A;  2WHI A;  4DDI D;  2L76 A;  3PS6 A;  1ESF A; 
#chains in the Genus database with same CATH homology
 2WX1 A;  3VTU A;  4IW0 A;  2MWS B;  4PS8 A;  2G45 B;  4AUQ C;  3ZNG C;  4F8C B;  2JWZ A;  3RUI B;  4K7S A;  1TZ1 A;  3H7P A;  2DAJ A;  4AP4 C;  2FID A;  2FUH B;  2K25 A;  3UQB A;  2I1J A;  2AL6 A;  1IP9 A;  2KJR A;  1EF5 A;  3A33 B;  1TTN A;  1UBQ A;  1E90 A;  3PVL A;  4LJP B;  3WAN A;  2N9P C;  2ZCB A;  4FHJ A;  3VXW A;  4W9C A;  2L00 B;  4EUT A;  3L54 A;  2MCN B;  1TGZ B;  3L16 A;  3RUL A;  2MBE A;  3WAP A;  4WAA A;  3M63 B;  3PSE B;  3KYD D;  1GC6 A;  2RPQ A;  2RSU A;  2FCS A;  3KUD B;  1VD2 A;  3KYC D;  2FCQ A;  2D3G A;  3VUX A;  2K6Q A;  1J0G A;  2NBW B;  4KDI C;  3ENE A;  1YX5 B;  3TIX A;  2O6V B;  1YJ1 A;  4MGY E;  4GU2 A;  2IY1 B;  2B3A A;  4JIO U;  2KC2 A;  2LZ6 A;  3UGB B;  2GBK A;  4CO7 A;  1EO6 A;  3UIO B;  2ZZP B;  2GBN A;  2M1M A;  4ICU A;  2RD0 A;  4AJY B;  4ANX A;  5LXI B;  2GMI C;  1OEY J;  1Q0W B;  5CTR C;  4WWO A;  2AYO B;  2BYF A;  5DCN A;  4DHJ D;  4J6I A;  2KTF A;  1WY8 A;  4P7I A;  5AZF A;  1H4R A;  2R2O A;  3QHT A;  2W9N A;  3QK0 A;  2ZPY A;  1XD3 B;  3PHW B;  4GDK A;  4NQL B;  1ZW7 A;  2R2Q A;  4BKS D;  3X23 A;  3AUL A;  1WE7 A;  3WAO A;  2CR5 A;  2MBH A;  3JW0 X;  3N30 A;  3KUZ A;  3QAR A;  4FAD A;  3A9J B;  2C9W B;  4ZDV A;  4NJ6 A;  2XBB C;  1ISN A;  4W9L A;  2D2Q A;  4MEM A;  4IWO A;  3QAQ A;  4ZRK A;  1UEL A;  1WXS A;  3DOW A;  1V81 A;  2C7M B;  4WWP A;  1Z2M A;  3AI5 A;  3ONS A;  2JT4 B;  4DXA B;  2KQ7 A;  5FR6 A;  3X0W A;  3DBL I;  3HHM A;  2KAN A;  4DHJ B;  1NDD A;  2K39 A;  2NR2 A;  3VH4 B;  4MEL A;  4BKS A;  2KFK B;  3CSF A;  1WH3 A;  2M8S A;  4ANV A;  2C7N B;  3H7S A;  3MHS D;  1HE8 A;  4M0W B;  2BWE S;  3GZN I;  4HJK A;  3QJZ A;  3N32 A;  4GIV A;  4WWN A;  4FA6 A;  3TJP A;  3APC A;  2CHZ A;  3ZRC A;  2GBJ A;  2MP2 B;  2KD0 A;  2M4N A;  3AU5 A;  3C0R B;  4MSQ B;  4ANW A;  1EUV B;  1XQQ A;  4M8M A;  4GSW A;  2EMT A;  4LDT B;  4A3O A;  3VHT C;  3RZF A;  3K9P B;  4FBJ B;  1WJU A;  4E3C A;  1P1A A;  1WJ6 A;  1WR1 A;  2BYV E;  2MSE D;  3ZKJ C;  2REX A;  4W9K A;  2QHO A;  4MM3 A;  1WMH B;  2EKE C;  2NS5 A;  3MTN B;  3RYT A;  1KOT A;  1AAR A;  5BO4 B;  1R4M I;  4DHZ B;  5D6J B;  1WJN A;  2AL3 A;  5JH5 C;  4X57 B;  4BBN F;  2G3Q B;  4A20 A;  2O2V A;  4W9G A;  4MDK E;  3CMM B;  1SGH A;  3R3M A;  4HXD A;  2XEW A;  4W9H A;  1I42 A;  3WAL A;  4IWP A;  4BBN C;  5J17 A;  2K8B A;  3V6E B;  2BKR B;  2D07 B;  4MSM B;  3W1Y A;  3HM6 X;  3R7Q A;  3Q3F A;  3M62 B;  3V61 A;  3VUW A;  1WR6 E;  3OJ3 A;  3WA0 A;  5LXH A;  1G6J A;  4PYZ A;  4B9K A;  2LJ5 A;  4W9F A;  5D7G A;  3UIN B;  3PHX B;  4NPN A;  1WX7 A;  4RMA A;  4CHK A;  2CS4 A;  4EOY A;  2AWT A;  2PE6 B;  2KN5 A;  1V49 A;  3CST A;  2KNB A;  3SHQ A;  3N3K B;  2JZ3 B;  2KDB A;  3S2A A;  4MGI E;  3QA8 A;  3ZVV A;  4NQK E;  4HK2 A;  4DHZ E;  3T8M A;  3NOB A;  3T9L A;  1K8R B;  4DK5 A;  4II3 B;  3IG3 A;  3M3J A;  1X1M A;  2Y5B B;  1Q1O A;  4GOC A;  3DBH I;  3JVZ X;  1ZKH A;  3KW5 B;  1WGH A;  4FLH A;  4WJN A;  3VTW A;  3AU4 A;  1KM7 A;  3M95 A;  1WX8 A;  3L10 B;  2L8J A;  2KDE B;  3H9D A;  5CHF A;  3O65 B;  5KHQ A;  3PLU A;  1GUA B;  3I3T B;  4JLC A;  4LCD E;  4TV3 A;  3KUC B;  3NY5 A;  4FJV B;  3A9K A;  2Z59 B;  3L0W B;  4MGZ E;  2O6V D;  1GC7 A;  4HDO A;  4GB9 A;  3AXC A;  2GBR A;  1E8Z A;  2WWZ A;  3U30 A;  1WE6 A;  4ZYN A;  2DZK A;  2KJ6 A;  2LVP A;  2BKF A;  2DYM A;  4W9D A;  4IUM B;  2VRR B;  3RD2 A;  3VFK A;  2JZZ A;  2O2V B;  4TKN A;  4DWF A;  2A4Z A;  1UBI A;  1C1Y B;  2KMA A;  3DCG A;  4E74 A;  4KIK A;  2DZM A;  5IA7 A;  2HTH A;  4BFR A;  3VTV A;  3TMP B;  4IG7 B;  3EC8 A;  4XX5 A;  3V60 A;  4XC2 A;  1E8W A;  2FAZ A;  2MW5 A;  1WI0 A;  1WXA A;  3DBS A;  2JPH A;  1CMX B;  2WDT B;  1WIA A;  2JUO A;  5D2M B;  3ZO5 B;  2M17 A;  4NAW B;  2KDF B;  1YQB A;  5JZE B;  5E6O A;  2KHW B;  4HPL B;  2BWF A;  1WXM A;  2MBB B;  4G0N B;  2KJH B;  2KOX A;  3HK0 A;  4KDL B;  3W1S C;  1KLV A;  1WMH A;  4FJZ A;  1OGW A;  1WRD B;  1WXV A;  2PE9 A;  4LDT D;  1FXT B;  2IO1 B;  3HM3 A;  1WYW B;  2N7E A;  4LJO B;  4CYE A;  2NPT B;  4KSK C;  5AZH A;  1NI2 A;  1M94 A;  2KFK A;  2JY6 A;  3VUY A;  3L08 A;  4KZC A;  5GMV A;  3ZNZ B;  3VVW B;  5CHW A;  2NVU I;  3PLV A;  1VCB A;  2N1V A;  4DBG A;  3A4R A;  3EEC A;  4WJQ A;  4RM8 A;  1WFY A;  2M0X A;  2K8H A;  1S3S G;  2LWP A;  2L7R A;  1XT9 B;  4IM0 A;  4BKG A;  3ZW3 A;  2MP2 A;  2PJH A;  5L83 A;  1V86 A;  3BY4 B;  4M8N A;  4WJP A;  3ZDT A;  2C5L C;  2JF5 A;  2MLB A;  2AEH A;  3A1Q A;  3EHV A;  4GDK B;  3DPD A;  4EZK A;  2DX5 B;  2L05 A;  5L95 C;  3JYU A;  5AEK B;  2DZI A;  2N9E B;  1UH6 A;  3ML8 A;  3UF8 A;  1Y8R C;  2ZCC A;  2KQS A;  2MBO A;  5DPT A;  1SE9 A;  2ZJD A;  3ZTD A;  3OLM D;  2UWQ A;  1A5R A;  4GDL B;  1NBF C;  2DEN B;  3TBL D;  1F9J A;  4MH0 E;  1YX6 B;  2HJ8 A;  3ZIM A;  3PRZ A;  2FCM A;  2K8C A;  3IHP C;  5J18 A;  1WM3 A;  1Z5S B;  3NZU A;  3WAM A;  5D94 A;  3PPA A;  1E8X A;  3MJW A;  2LGY A;  3B0A A;  2HD5 B;  4ZRI A;  1U4A A;  3B08 A;  1RFA A;  1RRB A;  2JXX A;  4HVB A;  4JQW C;  1P9D U;  2KK8 A;  4I6P A;  1T0Y A;  1V6E A;  1EF1 A;  1WGG A;  2WYQ A;  4G50 A;  4URK A;  3GOE A;  2NBU A;  4IC7 B;  1L2N A;  1WGY A;  2L3Z A;  4FN2 A;  4NAW A;  1OQY A;  4GXB A;  2ZVO A;  1TBE A;  5JHA A;  4NJ7 A;  2LGD A;  5LLI A;  4YL8 A;  2D10 A;  1LM8 B;  3KH0 A;  2MBQ A;  4I6L B;  2DHZ A;  2XK5 B;  4FUL A;  3V6C B;  1E8Y A;  1YIW A;  5DPR A;  2NCN A;  3L13 A;  1OEY A;  3ZNI D;  4TQ0 A;  3SDL C;  4KVG B;  1GNU A;  3DVG X;  3H6N A;  3VDZ A;  3QWZ B;  2LD9 A;  3SU8 X;  4KV2 A;  2C7H A;  2LRU A;  2RGF A;  3SD5 A;  4BOZ B;  1UD7 A;  1E7V A;  3A4S C;  2GOW A;  1R4N I;  2LGX A;  3CF6 E;  3DVG Y;  2Z0E B;  2JRH A;  2N1W A;  4OVV A;  3QIJ A;  1C3T A;  3A9K B;  4RM9 A;  3ZRF A;  1GG3 A;  3NZS A;  4K7U A;  3A1Q B;  4WJO A;  2ZPN A;  1J8C A;  4NNJ B;  5KHO A;  1WX9 A;  3DBR I;  3JSV A;  1V80 A;  3L17 A;  3ZNH B;  2I1K A;  2KVR A;  4W9E A;  2CU1 A;  2EMS A;  2FNJ B;  2ZNV B;  4EEW A;  4EFO A;  4BKT A;  2LUE A;  3PGE A;  2BYE A;  4GMV A;  1E5W A;  2LVO A;  3R7R A;  5E6N A;  4PS7 A;  2NBV B;  2HE7 A;  3U8Z A;  1WGR A;  2BGF A;  1JRU A;  1UGM A;  4MJS A;  2IBI B;  2LXA A;  4MJS B;  3ALB A;  2DAF A;  1UZX B;  3R66 C;  4ANU A;  3ECI A;  3RZW C;  1PQS A;  2MA9 B;  3APF A;  2DYO A;  1V9J A;  4WQO B;  4GN1 A;  2KWC A;  2LAS A;  2CHX A;  4KZ0 A;  2KX0 A;  4FHK A;  3K9O B;  2JRI B;  3V62 A;  1I35 A;  1D3Z A;  2FIF A;  4AJW A;  2PPH A;  2ZNV C;  2ZEQ A;  5TR5 A;  2KDI A;  1WZ3 A;  1MG8 A;  5G2N A;  4HWI B;  3H1U A;  3NS8 A;  2IO2 B;  4HDQ A;  2LRW A;  2CHW A;  4ICV A;  4B6W A;  2N7D A;  5AZG A;  4GGQ A;  2XK5 A;  2JVC A;  2J0M A;  3NHE B;  2CKH B;  4W9I A;  3APD A;  3IFW B;  2BPS A;  1S1Q B;  3PZD A;  5CHV C;  2KXJ A;  3DVN V;  2K6D B;  3RT3 B;  2ZVN A;  4K7W A;  1P3Q U;  2YLM A;  3W1S A;  2BF8 B;  2IYD B;  3WIM A;  2V4L A;  3P2B A;  2KLG A;  2OJR A;  2V1Y A;  2DZJ A;  2G4D B;  2MQJ A;  1GJZ A;  5E6P A;  4A3P A;  3OJ4 B;  1E7U A;  4AWJ A;  1KJT A;  4FJY A;  3B1L X;  1QZE A;  2DYB A;  4G3X B;  3OAW A;  4IWQ A;  4KSL C;  2GBM A;  2KX3 A;  3ZLZ A;  3DDC B;  2FCN A;  4HCN B;  3LJ3 A;  3ZUN A;  1P98 A;  1IPG A;  1P0R A;  4N9F 4;  1J19 A;  2KLC A;  2MRP A;  4F7Z A;  2RR9 A;  4B95 A;  2N9X A;  3JSV B;  4XZ4 A;  2KTR B;  4E71 A;  4MGK E;  2KTR A;  2MX2 A;  3ML9 A;  5DPW A;  3D32 A;  2D11 A;  3UIP B;  4EZL A;  2K1F A;  2KFJ A;  3BIN A;  4I6N B;  3TCA A;  1V5O A;  1V2Y A;  4W9J A;  2NPT A;  4TUU A;  3VAW A;  5C1Z A;  1WF9 A;  4PYU A;  1WJ4 A;  4F1S A;  3VQI A;  2J0K A;  3H7P B;  1YD8 U;  1V5T A;  1L7Y A;  4NY0 A;  1WM2 A;  2LI5 A;  1Q5W B;  5J2R A;  4G11 A;  4PS3 A;  3IBE A;  3PRM B;  4ASW C;  1LXD A;  2KWV B;  3HIZ A;  4HPM B;  2J7Q B;  4AOF A;  2IO3 B;  2G4S A;  3PRE A;  1ZGU B;  2IO0 B;  4OVU A;  2L0T A;  2PEA A;  2YVC A;  5G55 A;  3U7D A;  1WZ0 A;  3A9J A;  4EZJ A;  1H8C A;  1WGD A;  2KO3 A;  2KWU B;  2A5U A;  1RLF A;  3KVF B;  4BVU C;  3QX1 A;  2ASQ A;  3DVN U;  2J0J A;  1LQB A;  4ZRJ A;  3EFU A;  3RCZ A;  5DPS A;  2KMC A;  2IY0 B;  4K81 A;  2O6V A;  1LFD A;  3IVF A;  2KZR A;  3PV1 A;  2V3S A;  3QQ8 B;  4GDL A;  4HLE A;  3UQA A;  5IAA C;  5C23 A;  4EKU A;  1IYF A;  3PT2 B;  2IZV B;  3Q3J A;  3QCA A;  2WX0 A;  3DQV A;  4HCP B;  5EDS A;  5JHB A;  4KIK B;  4BOS C;  1OTR B;  2UYZ B;  3PTF C;  5HKH A;  2L0F A;  3ZTC A;  3LDZ E;  4JL9 A;  1RAX A;  5CX3 A;  3PRP B;  2LXC A;  4IM2 A;  1BT0 A;  4DDI D;  4DDG D;  3QC8 B;  2C60 A;  2Z0D B;  2OOB B;  2KKC A;  3ZDM C;  2L76 A;  4K1R B;  3VH3 B;  4JGH B;  3PS6 A;  2N4F A;  4II2 B;  4IM3 A;  3TL5 A;  4TQ1 A;  2KC1 A;  1SIF A;  2LVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...