3VHLB

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
b'MQTIKCVVVGDGAVGKNCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 8
publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vhlB00
2XOKA 4M1WA 2ZEJA 1XCMA 4DUGD 1Z5ZA 4OQLA 1P9RA 5IDVA 4BZQA 2WSSD 5KSOA 1E4VA 1R8SA 1LY1A 1Q3TA 2BCGY 3SDZA 3CB4A 1X1SA 1DO0A 2XOKD 3NDPA 3A4LA 3PUVA 2QP9X 1XXHE 4Q47A 3KZ1E 1K5DA 3V00A 4US2R 8OHMA 4V0MA 3NVAA 1LVGA 2RGGA 1MO6A 5JSZB 3ZD7A 4Q4JB 4PC6A 1ZM9A 5K8LA 3A1SA 3REFA 3AGPA 1U0LA 3BH0A 1ZUNB 2CL7X 2QZ4A 2WAXA 1II9A 3THYB 5LD2B 3BORA 5JJLA 2C8VA 1FX0B 4Q1FA 4ERNA 4DVGA 3MJRA 3EA0A 2PJRA 1AQUA 1OIWA 3AF4A 4B34A 3A8TA 3OAAD 4ESHA 5GVSA 2ODNA 2DFNA 4OI0A 4TYYA 2IEZA 4D4JA 3A1TA 4Q9JA 1NN1A 2G6BA 4NU0A 2CEAA 2OBLA 4O2RA 4ASUA 3UWOA 4PHGA 1XDBA 4CW7A 3ASZA 2W00A 3ZZ0A 3B1ZA 4JVLA 3RDPA 4C3ZA 4LJ8A 1H8EA 3PEWA 3FOZA 1QHGA 4RCZA 3CF2A 3KKPA 4EAQA 4C0QC 4PPGA 1FQJA 1TQ6A 2FSFA 1N6KA 1AZSC 2YNMA 4ZKEA 2WJHA 3U3MA 1G7SA 1H8ED 3NBYC 4LJ6A 4QNMA 4LJAA 4G5QA 3DEFA 1NVVQ 4WBSA 2HT1A 2O8FB 4BLRA 5FUYA 1G9XA 4KCGA 1YVDA 4HLDA 4JJKA 2YKGA 1CJVC 4BRUA 4EFLA 3BRWD 3Q5DA 2IXGA 4KXFB 5JRZA 2CE7A 1PZNA 2H17A 3C15C 1KZ7B 5EZ6B 4CEHA 1OXTA 1CJUC 3ZIAD 3SI7A 4DCTA 1OF1A 3EPHA 1OH5A 2QRNA 4FWTA 1NMZA 1HE1C 1VG9B 3KKMA 3QPVA 3ZDQA 1KMHB 1WE2A 3LWNA 2VPPA 4BFTA 2GTPA 1BIFA 1G8PA 3TIFA 3UMSA 5HCNA 3T1OA 4BFYA 4ZDKA 1BMFA 2WSMA 2CCKA 2BM1A 3FFBA 1D2NA 4JLKA 5IRCD 3C5HA 1R4AA 1GITA 4EUNA 3QKSB 2RGAA 4K81B 3T5DA 3IPXA 4OBEA 2O0HA 1KAGA 1D6JA 2HXYA 2BOVA 5H70A 5JWRA 5JFGA 4DB4A 4BGDA 2JJ2A 1KO1A 3ETLA 4TZ6A 3L2OB 1X3SA 2AFIE 3AKCA 2WKRA 2WZQA 4IHQA 2NGRA 4RJLA 5DE3A 4MKFA 2WMOB 1E0JA 3ASYA 1W46A 3AP2A 1KSJA 1HE8B 1E2LA 4W9MC 1DAHA 2EW1A 4EKDA 4DLUA 1F60A 4QJ5A 2B7BA 2N1BA 1VCIA 3EZ7A 2G1JA 4AYWA 3NTUA 1UBFA 2J9RA 2W0SA 2Z5FA 1E3MA 4AWXA 4DKXA 4CGZA 2BBSA 4QOSA 3T5GA 1CRQA 2QE7D 3UWKA 1OKKA 4QRHA 1N5IA 2D7CA 1N2CE 3SQXA 4G3XA 1HEIA 4LBVA 2YVUA 5FBWB 4V0KA 4Q4AB 1ZBDA 4B75A 5KHOC 1E79D 2BM0A 3THWB 1U8ZA 1MT0A 4TLBA 1RVDA 4TYQA 3DHWC 2J0SA 1QHNA 3IIKA 2O8DA 3K9HA 4W7SA 2ZUCA 3AF3A 4XVUA 2QAGA 3L82B 4V0ME 4MRVA 1JBKA 4JSTA 1C1YA 1XPRA 1UBCA 4B2LA 3FHOA 4B74A 1UKVY 3MAAC 3LX8A 2ZROA 4LPKA 1YQTA 4ZV4A 2ZE6A 2W2XA 3JZMA 4HZUA 3I62A 2GETA 3GQBA 1P4SA 1XP8A 5JI2E 4M0LA 3ZVNA 1BS1A 1G5TA 1QHXA 4TLCA 4C9BA 4DDTA 1OFTA 3MJHA 2FU5C 4GT1A 2IYUA 3U5ZB 1AGPA 1S1MA 3I73A 2V4ZA 3M0EA 4KFRA 3VNUA 1YZQA 1G3UA 3GLGA 3DKPA 1XD2A 3I72A 4XH9B 4DLXA 1I4TD 1JEDA 2FE4A 1OSNA 2OFOA 2FOLA 4DEYA 5KSYA 3VFDA 3BK7A 1RKBA 2P6UA 1AJEA 1DO2A 4O3MA 5IHPA 3EZ9A 1NKTA 2C9CA 1MO3A 1W36B 5L8VA 4N0DA 1XZQA 2ANCA 2Q21A 3AUXA 4TMTA 2BEJA 4YMWA 4P4SA 5FTKA 3PXGA 1SXJD 2IWHA 621PA 4LHVA 5E95A 2PBRA 2VRWA 1G4UR 1W4RA 3WHLA 2QNRA 4LDJA 4M53A 1SULA 4MRNA 1CEEA 1NBME 4JT4A 3K0AB 4LC0A 1X8LA 1UFQA 3H84A 3E70C 5SZKB 2VP5A 1H8HD 3GJ8A 1OXUA 4ESVA 5BWMA 4IXMA 4L9WA 1FZQA 2J5XA 4NL4H 3QNUA 4PZLA 4TZ0A 1CIPA 1KI9A 4KITB 3HU1A 1UEJA 1KI8A 2OFXA 4KAXA 3SYNA 1GSIA 3A4MA 1CR1A 2RGBA 2OXCA 3QXHA 1SQ5A 2VF8A 1LF5A 3BS4A 3RS7A 1K8RA 1RJ9A 2LKCA 3ADBA 3MUFA 4MGKR 4EJSB 4MYCA 4PO8A 2C03A 4HB2A 1ZUIA 4PQFA 3CPHA 5G3ZA 2REBA 2J7PA 5JZVA 2P0EA 4TLDA 3A1WA 1UBEA 1GUAA 3SYKA 2BJVA 2LCFA 2YWFA 2CLDX 2FPMA 3K0SA 3C4JA 4UNRA 1VIYA 5DISB 5AUPB 3RRZA 2MMCA 3CUEF 4KYUA 5BQ5A 3GFPA 4DT1A 1LV7A 1OIXA 2R6CA 3F0TA 4PAQA 4TQUS 4V02A 1S9DA 3RC8A 4I81A 4LSGA 2YZ2A 5J4LA 3E5HA 1QRAA 1PLJA 1UBGA 2GZAA 5FUWA 3W8RA 5BYKA 5KO2A 2QY9A 3MSXA 4D2IA 1N6NA 4FINA 4JKIA 2EYUA 1PVOA 4V03A 3UKDA 5DHFA 4GL2A 3SJBA 1FW6A 1GKUB 3D8BA 1VG0B 4JVMA 5EE5B 5KNBA 4NCIA 1BH2A 4OK5A 1YZNA 1KY2A 2HV8A 3LX5A 3ZYCA 4PSAA 4PTLA 2PX3A 1MRNA 1X8JA 1B0UA 3I1FA 2CK3D 5JWHA 2Q9BA 1VHTA 4L16A 3WNDA 4NP6A 1N5LA 1IXZA 1Z0AA 2FN4A 4Q21A 1TU3A 3LXXA 4F4JA 2V7QA 4DB2A 2GZHA 1SKYB 1C4OA 4M2LA 1T3LA 2XTZA 2OCBA 4C0AC 2CBZA 2G3YA 2NO0A 2DB3A 2XX3A 4RZ2A 4AD8A 5L3QA 3HR8A 1OFHA 4ZIRA 2XITA 2HLDA 2PCJA 1N6LA 4PQRA 1NL3A 4XVRA 4GBMA 1EG7A 1T0JB 1XJ0A 2C9OA 3AB3A 4GI7A 5DI3B 4ZCIA 1PV4A 3RNLA 1JJVA 2A5DA 4IOKA 3PIRA 2C78A 5HCIA 1TX4B 2W2VA 4PHFA 2WWYA 2XB2A 1YE8A 2IS4A 4HZIA 4HATA 4DCNA 2A5FA 3PR1A 4B2IA 2X8AA 1YZGA 3I32A 3KJEA 4HAUA 3V4RA 1W0JA 1OE0A 3GLFB 2XJ4A 1G6HA 1P7CA 1X6VA 3ZS9A 4LPSA 3KDSE 5TB5A 1R5BA 3CRW1 1JAIA 2A30A 1U99A 2AN9A 2BMJA 1W0JD 4QJ4A 1EFCA 1MKYA 1N6IA 2ZRJA 3B6EA 1CTQA 4TL7A 3BFKA 2OBMA 1Z0DA 4GOKA 1E2EA 2ZANA 3C7KA 4XWAA 1T8TA 3KB1A 2OCPA 3LAWA 1EXMA 1PJRA 4LC1A 5HZKA 3QVUA 4OI1A 2DWQA 3FHTA 4HUQA 4XD7A 3R8CA 4F7WA 1FMJA 1GNQA 4ZDIA 4BFWA 2IYLD 3VTKA 2Z4SA 3N70A 4QBFA 2G0TA 1XTJA 4PHTA 4OKSA 2ZVPX 2QGZA 2JAQA 3ADKA 5L3SA 2IYSA 4D80A 4JT2A 1XNJA 2AXPA 3K0FB 1F5NA 2YYZA 3U60B 2V8OA 1NSFA 3TAHA 4NYMR 2B21A 1E9EA 3T06B 2VHJA 5TY0A 5JCZA 3IO3A 4ABYA 1Z2CA 2BC9A 2IT1A 1TQ2A 3MD0A 2WWWA 4LI0A 1MOZA 4M4SA 1W0KA 2GEVA 2ZUDA 5G41A 2F1IA 3AKEA 5FOVA 1KKLA 1S8FA 4D0GA 1LS6A 3DOFA 3NBZC 3GPLA 3VU9B 1E9AA 2PLFA 2C99A 5D3QA 1OXXK 3R9WA 2GK7A 2H1LA 4KLNA 2O8EA 1IM2A 3B8HA 4C30A 4BEBA 1JB1A 2FFHA 3QE0A 1ESNA 2HF8A 3IIMA 4QC2A 4CVNA 3RS5A 1SVLA 2D4HA 2VTKA 2ZRNA 3JVVA 1ZCBA 3TAUA 4Q1DA 4CRWB 1DADA 3TUIC 5CIWA 2EFGA 4U5XA 2C95A 2IHBA 4HB3A 2ONKA 3NEJA 1MR3F 4GNKA 2NO6A 4KHZA 1F2TB 2PMDA 2ZR9A 3HPQA 5H1YA 2IC5A 3BFXA 5KDLA 4ACAA 4MRRA 3L0IB 4BFVA 2JLZA 3U7GA 1M7GA 3IUYA 1NN3A 2J0QA 5B57C 4LY6A 5EQTA 3IEUA 1G3QA 2WKQA 4D4MA 4YXWD 1E32A 2J87A 3DL0A 1ZM4A 3QG1A 2GEDA 3QI2A 1IY0A 4IFBA 5FTMA 1XCGB 4UJ3A 2O5VA 1FL9A 2OXRA 4FW9A 1XD8A 3B9PA 1GRQA 3C16C 4OHWA 5DNYB 2QGNA 4XOIA 3QPUA 2G0NA 2OEPA 2GAOA 1XWIA 2PT5A 5CB8A 1GNRA 5AUOB 2KBEA 2LKDA 4GPTA 1FFHA 2J45A 1KJYA 1OB2A 1E9SA 3FGNA 5J4VA 5SZHB 1QHSA 1GL7A 3EZFA 3CH4B 2IYRA 1XRJA 3B85A 4NTZA 1XZPA 3W8NA 5CDFA 2J0UB 3UMFA 1TF5A 1OW3B 2YOFA 3QSYA 1FP6A 2QG6A 3THOA 3O8RA 2J0VA 2OG2A 1RPZA 3CNNA 1ZINA 1E69A 3GJ7A 2W6IA 4Q9LA 3AVYA 3SN6A 1OIVA 3OE7A 1HYQA 4B2PA 2QTVB 4CEHB 1GNPA 1HT1E 3U4QA 2CL0X 5EP4A 5TDHA 821PA 2GCPA 4JL5A 5HR5A 2C5LA 3OE7D 4NMMA 3WY9A 3KJGA 2IF0A 2XEXA 2FEOA 4Q9HA 4M1YA 4TMXA 4OI2A 3SS8A 1GKYA 1IAQA 1T5IA 4CEJA 3P27A 4JYCA 1G5PA 1OH7A 2W83A 1RIFA 4TN1A 3GLHE 1YKSA 2VBCA 3IHWA 4JBXA 1COWD 2QBYB 1KY3A 2DFLA 3Q85A 1WMSA 3DOEA 2ZRHA 2P2LA 4ARZB 1E1QD 2X1VA 2ATXA 4Q9KA 4NYIR 5CM9C 2R2AA 4G5OA 2B6HA 3WNCA 421PA 1AIPA 4Q4HA 4RZUA 1P6XA 3ZGXA 4F91B 1GZSA 2QEQA 1KK2A 2ZS7A 2ASEA 1KAOA 5JRJA 2IWRA 2A9KA 4PPNA 1R8QA 2FV8A 1F2UB 1Q22A 4Q7KA 3PQCA 1ODFA 4PZZA 4QM7A 3OHMA 5E7IA 3UMRA 3LQRA 2NPIA 3QKUA 3AVPA 4S2EA 2YHSA 4MGIR 2JDID 4OK6A 5TVKA 1E2HA 2ERYA 2GAAA 2GJ8A 2OO7A 3BOSA 4DCUA 3KQNA 2FMXA 3T61A 3GCGA 4CIDA 2WJVA 3GP8A 1EGAA 2NZJA 3LNCA 1EFRD 1J7KA 4D6PA 2G1KA 3WP0A 1P9NA 4LCBA 3TNFA 3LXRA 5B64A 4TYNA 2PZEA 1AN0A 5DYGA 5EJEA 3K9LA 4D4KA 3EZ2A 1KJZA 4LK2A 4DLWA 3ZVLA 2XJ9A 2CXXA 4Q01A 2OV2A 3PEVA 1XEXA 4A8JC 2UKDA 4KI0A 4MQBA 3CRVA 3RS3A 3X1XA 1A1VA 1IN6A 1GILA 2CL6X 2IYWA 2NTYC 2K5UA 1P61B 4Q66C 4BZPA 4Q03A 1SVWA 2O8BB 4IDNA 1G20E 1IXSB 5EUQB 2F1JA 2HYIC 4HAWA 1E9BA 1TF7A 4NCJA 5DIFA 2GVDC 3BD9A 4PO9A 2GWHA 1WQ1R 1VECA 2QT1A 3EPLA 3K70C 1KIMA 2X77A 1XMSA 4QKQA 3ADDA 2DHRA 2JATA 4HYYA 3Q7QA 3ZQ6A 3FMOB 2D74A 2CVFA 3A4NA 4R2IA 3KUDA 3GLGB 4TTPA 1Q3HA 2FWRA 2VP0A 1YHNA 4B3FX 1NMYA 3SNHA 3AVVA 3SU8A 2OCAA 1OB5A 1HQYE 4KSBA 4JIMA 4WOPA 5KUTA 3NKVA 5JLJA 1NLZA 3CIOA 3QXCA 2GK6A 1WB9A 2NZ8A 1KYIA 5CDFE 5TXGA 1SHKA 3FMIA 2FF7A 3CNLA 4NONA 5FI1B 4P32A 1KZGB 2UZ3A 3G0HA 4BFUA 4OYHA 2F1RA 1G291 1SXJB 2G88A 1IN7A 1ZM3A 4Q7JB 3L0SA 3RWOA 5M04A 2B92A 2UZIR 1XCPA 2KB0A 3CONA 2FSHA 1E6CA 1ZCAA 4P4SB 2YWGA 3QXSA 5JBQA 2WWFA 4JKYA 1M7HA 2ZI4A 4JSYA 4L8GA 4MH0R 4PSVA 4DDVA 2PX0A 4POAA 1II0A 5E7MA 2F43A 5AUQA 1KMQA 4EPRA 1OFUX 1NVVR 3VKHA 1ZD1A 1KSHA 2A78A 4LYHA 3CM0A 3WNBA 2DWPA 2QAJA 1OH6A 2GXAA 4F4IA 4Q1BA 2GBLC 5KYKA 1ONBA 2JLQA 5JI3E 3X1DA 1YZTA 2GEUA 1XJCA 4DHEA 4DEXA 4ZI3A 4B3DA 2QRZA 4QFMA 3BBPA 1QBKC 3GLIE 4Z54A 1D9XA 2BV3A 3Q8XB 5J4YA 1V5WA 2QQ0A 2QENA 5F2EA 1Q44A 1W44A 1CR4A 1RJ9B 3TVDA 1Z2AA 1ELOA 4RZ3A 5DHAA 3OFNA 5EP2A 1DTSA 3QJYA 1IY1A 4RKEA 4EQ6A 1Z08A 1KO7A 2XGJA 2PL3A 4NDZA 2HEIA 3UK6A 1FMLA 1NVXQ 3MRSA 1XFAA 2IXFA 3M4YA 4LJYA 4IVPA 5CM8B 1XPUA 2O0KA 3D6TB 4C4PA 3KQKA 4OQFA 2ZQ5A 4Q19A 1G4AE 1OFIA 2BKEA 2BBWA 3OIUA 1I4LD 1T8UA 4JVNA 4KU4A 2FSIA 5LD2C 1ZYUA 2ONJA 4ASUD 2ECKA 2IEYA 4CEIB 2F9LA 2GJSA 4DZZA 2WIBA 1Z6XA 4TT3A 3FMFA 4NCKA 3VR3A 1XEWX 1GKIA 1QG2A 5DN6A 1N6OA 3IBYA 2A5GA 1JECA 3C5CA 4PHHA 5BN3A 4CDGA 1M6NA 1WBDA 5B2ZA 4EFMA 1W5TA 2B7CA 1N5KA 2CJWB 2VIIA 3FDIA 3KUCA 4KVGA 1RE0A 4XSHA 1ZW6A 3CR7A 4NPHA 2GA8A 4ZO4A 1I4DD 4E03A 4GOXA 3THXA 1NBMA 4MUAA 3GJ0A 4AKGA 1DE0A 3EIHA 4UXHA 5G40A 3KKOA 4YMTA 2ZRIA 4M22A 2EWVA 4FMDB 2REXB 1NBMD 2XTNA 4I1SA 4MKGA 1BKDR 6Q21A 4MUBA 1LB1B 4G0NA 4YMVA 2FG5A 1ETUA 3GEEA 4WXPA 2E9SA 2HDNB 4LJ9A 2XZPA 5GJWC 1S0UA 4F4CA 4QBGB 2BMEA 4QGGA 2ZSDA 5E4FA 3OEEA 1BYUA 4K8OA 4P33A 3IEVA 4LJ7A 1BMFD 2R62A 3KQHA 1JNYA 5LB2A 721PA 4AKHA 1JR3E 4KJZA 1E2FA 5FOWA 1T3SA 4YC7A 3OEED 5BN4A 2R9VA 1S1CA 3QBVA 3A37A 1S2MA 1AZTA 4YDSA 4G01B 5G53C 3DMNA 1SVIA 3TQCA 2ZYTX 3LDAA 1AS3A 4DSUA 1VIAA 2JJ2D 3HJNA 1RRGA 4B6EA 2QSZA 4A0HA 4UXJA 2KBFA 1Q21A 5H68A 1Z6GA 1AM4D 2ZJZA 4W5HA 1CRPA 1A5TA 2O8CA 1G3RA 1D2EA 1XD9A 4IDHA 4UJ5A 1XBTA 2QL6A 1TADA 3AV0B 4RY2A 3DPUA 3MMPA 3BXZA 4OJQA 3OEHA 1DG3A 2GZDA 2ORWA 4WA7A 2J3EA 1W2HA 3BH7A 4TWZA 2OHFA 2QM8A 3KJIA 3J81k 2ZSAA 3KKNA 1Z63A 2IS6A 1NVUQ 1OKKD 1J99A 1QHYA 5JS7A 4DLYA 3KB2A 5AJZA 2A5JA 1UEIA 1J90A 2RGCA 3WXMA 4JVSB 1R0ZA 1ZNWA 4FD2A 3BGWA 4Z8XA 4A8JA 1G7CA 1Q1QA 1QVAA 1VCNA 2ZJBA 3W90A 2VP2A 4BLQA 4B43A 5JHHB 4H9GA 4MRPA 5P21A 4ZKDA 2HJGA 1G5RA 3LBHA 4OQXA 1KI6A 2Q6TA 2GVZC 4LHYA 5KTYA 2XXAA 4B6FA 1VCOA 1GIAA 4JLAA 1I2MA 4C0JA 1W47A 4U02A 3BB4A 4NHOA 1W5SA 2EFHB 3CPEA 5CLQA 3I3SR 1W1WA 3Q3JB 4IFEA 1E2NA 5HKKA 1XTKA 2IW3A 2AKAB 1RRFA 2I3BA 2ZIAA 3Q72A 5JECA 3K70D 3QEOA 2JLYA 2R6AA 1XTQA 4PC2A 1L4UA 5DO9A 2O8EB 1UJ2A 2GJKA 5FL7A 5HKKD 3LVRE 1DARA 1GTVA 1T5LA 2BHRA 1VMAA 1VDZA 2FA9A 4FMCB 3SZRA 2VP9A 4BRWA 2GXSA 5L3VA 3CRRA 4GRAA 1R6BX 2X2FA 4CT4B 3O8CA 5LDDC 4ON9A 2FJUA 1G64A 3TK1A 3DVLA 2ZRDA 1MABB 1ZM2A 3B1WA 2Q3HA 1KK0A 1ZAKA 2KI5A 3PUZA 1D8TA 2OILA 1Y3AA 2AD5A 2P65A 3LA6A 5HE8A 2IYVA 1ZJ6A 4D25A 2Z0MA 3X1WA 2CCGA 1W36C 2GBLA 4J0QA 3X1YA 4PANA 1WXQA 4KO8A 3NEYA 1IOZA 4DDUA 2ZSBA 3EASA 4JBWA 2DPXA 3CWZA 4II7A 4TLEA 3ZVRA 1R0WA 1M1YE 4N0EA 4Z8YA 2IYZA 1TQDA 4LWZA 3K53A 1YJ5A 2IA5A 2Z6VA 2ZRMA 3TW8B 2QPOA 3WYAA 2CLCX 1AKYA 1XJQA 2ZSEA 4D82A 4E22A 4XIGS 3BB3A 1J2JA 1P73A 4E5UA 3R7WB 4PQYA 2Z83A 5B30A 2OAP1 4B3BA 3QENA 1YR6A 1J8MF 3KKQA 3QF4B 4DDWA 4MYUA 3T15A 4RZXA 3MCAA 4URUR 5JSZA 1G7TA 1NJGA 2ZU0C 4RVCA 2J59A 1OYWA 1F48A 1EX7A 2BDTA 1WA5A 4OQMA 1P3JA 4UQOA 2IUUA 3ZH9B 2J7PD 3U4QB 1CF4A 2OAQ1 1QHHA 2AK3A 2ZJOA 2FFAA 4XWOA 4YLGA 5HTKA 3RVBA 4M1OA 3W6NA 2JLUA 3THYA 4DLVA 2FPLA 4NCHA 4NH0A 1FX0A 3U3JA 2ZRLA 3RSOA 1Z29A 2IUSA 4TMWA 3U61B 3EIQA 1XXHB 2R65A 3EPKA 3NH6A 4DIEA 5FI0B 5E7JA 3K09C 2P3SA 4JS0A 4MGYR 4KFSA 2C2HA 1JPNA 2HJVA 4B33A 5F9FA 1T6NA 4EPXA 2A7QA 1ANKA 5GADl 1VKJA 3U7FB 1DAKA 4PXAA 4GZLA 5DH9A 3HU3A 5JWOA 3B60A 4IW3B 2RCNA 1BYIA 2OZEA 4QHYA 4OK3A 2V9PA 4TYPA 4YMSA 3B5JA 2RGEA 1U98A 4DLRA 2GDJA 3FE2A 2BIFA 2HF9A 4UNNA 2JIZA 2NO9A 1CKEA 3TGPA 2GESA 1IJEA 4OHVA 3U44B 2KJQA 2QMHA 3ONWA 4MYHA 5G3YA 3T34A 3AF0A 2FFQA 4LHZA 5J4HA 1S96A 2X2EA 4Q4LA 4OQNA 2V7QD 2D2EA 2ZE8A 2F55A 2ZS9A 5DGXA 1VG8A 4HDCA 4XVQA 1XEFA 3K8YA 4BQSA 1OXVA 3TMKA 3ZVMA 4IEEA 5C4MA 1P9WA 1KKMA 3S1AA 3TW4A 2WWGA 1KMHA 2HLDD 1AS0A 2PZGA 2A2ZA 2QPAA 2MMGA 1WRBA 2JJ8A 4HDOB 4A6PA 1VYTA 1G1MA 2G77B 3IQWA 1IN8A 5KPDA 1YR8A 4Q7LA 1DBSA 4BFXA 2BWJA 3P32A 1JJ7A 2OM2A 5ANRB 1RFLA 3D31A 3UIEA 1JXOA 1QHIA 5JEDA 3PVSA 4R2HA 2QTHA 2A5YB 4UXIA 4B35A 5JJKA 4GMDA 1KOFA 2AL7A 3GJ3A 3D3QA 1G3MA 1ZC4A 4W5WA 1WP9A 4BLTA 5J47A 1L8QA 3OIVA 1T91A 4P3YA 5EXPA 1KHTA 1R7RA 4KLZA 3EC2A 4GP7A 2F6RA 2YWHA 3QKRB 4DBLC 3GLHA 3QF7A 2Q9CA 1EFTA 2FGJA 4OHXA 1RC8A 1TUEA 1MO4A 3QVVA 4GOJA 2VQSA 4ZDWA 4C0SA 2RH5A 4XD7D 5KPJA 3AKYA 3DZ8A 5C18A 2IF2A 2OUKA 3SQWA 2OFWA 2H16A 2B8WA 4OI4A 2J1LA 4Z51A 1Z0JA 2JEOA 3CNOA 3FVQA 2WICA 1P5ZB 5AJXA 2ZAMA 2Q0HA 1Z0KA 1NP6A 2RGNC 4RD0A 3MLEA 5DYIA 4E09A 2XZOA 1RYHA 4Q4AA 4RD3A 2O52A 4PC1A 1HA3A 2MSCB 1GRRA 3JVUA 3KTAB 2CHGA 4JZKA 4WZBE 3H0KA 3NH9A 4Q1CA 1ZNZA 3FMPB 3L0PA 2YOGA 1MH1A 4PPQA 121PA 2IX3A 2P5TB 2WAYA 3KX2A 1CP2A 1A82A 2CCJA 2WOOA 3TJZA 1GP2A 2C77A 5HPYB 4R98A 1W0KD 3WYGA 3WMEA 2PEYA 1U8YA 1UKEA 3I5YA 3QUSA 2ZAOA 4D81A 3N2IA 3NIBA 1G8FA 1HURA 5GJBA 4QG7A 3H2YA 1XU4A 3CR8A 1IONA 2BCJQ 2WJIA 3CW2A 2AK2A 4LYFA 1KDRA 5EXXA 3AVTA 1GL6A 2ODBA 3CX7A 1Y63A 2FGKA 3ECCA 3MWYW 5A0FA 3QG5A 2VHUA 3LBIA 4LGMA 5AJVB 2ZITA 4A2PA 1J70A 3BAFA 1E9RA 3LD9A 4EPVA 5TV2A 4PZYA 4M1TA 3E1SA 3SJZA 2OESA 1Z0IA 2PCLA 2WMNB 5FPKA 3CPJB 4DCSA 1Q1ZA 3FKSA 2V1XA 4IOLA 3K1JA 1HT2E 1E2JA 2EU8A 2IYXA 3DO6A 2JJ1A 4WZAE 4B71A 1E99A 3DKVA 1P2TA 1Z28A 1XMVA 1E4YA 3FKSD 3IIJA 4JLBA 2AWOA 4TQ9A 1FOEB 1WBBA 1G19A 2EFCB 2JJ1D 4P4UA 1OPXA 1ZP6A 3I4LA 5DSZA 1E2IA 2VLIA 2H5EA 2IXEA 4DLSA 1WF3A 3M1IA 4HB0A 1LF0A 4A0GA 2FX3A 2P6RA 4I1UA 5IK2A 4HLCA 1X8KA 2GJ9A 2ZRCA 3O8DA 4BFSA 5KOYA 1HTWA 4TTQA 5CB6A 1N25A 2C9YA 5EE9A 3H4MA 1GVNB 3N5CA 4JMPA 3ZQJA 4MGZR 5FBRB 2C04A 2WPDA 2R6DA 3LFUA 3TLXA 4LBWA 2GCOA 2OBNA 1NJFA 3WRYC 4B32A 1EWQA 3THXB 4LBYA 3IHLA 1Z47A 2W6ID 3B2EA 1SKQA 4Q5IA 3NBFA 1TEXA 2ZI7A 4BLPA 3LQQA 3EX7C 2H92A 3B7GA 4AKIA 2CNWA 2V55B 2DR3A 5DI9A 2BMDA 1M34E 4GZMA 1CU1A 4IEIA 3CZQA 4WW0A 1G7RA 4LYJA 1E9DA 3PITA 2ZRGA 2CNWD 2DFTA 3KFXA 2PLRA 1SVMA 3K09A 3TSOA 1UF9A 3ZZUA 3GLIA 3TUZC 2ZRFA 1MO5A 221PA 1DAFA 1U0JA 2VL7A 3WBJA 2VHCA 4G5SA 2WJGA 1CBUA 2IUTA 2ZI5A 2W6JA 1SVOA 1ZIOA 3DM5A 5FUVA 3B1VA 3RYTC 4O0MA 5EE1A 3TR0A 2WIAA 1FUKA 3CRQA 3ND8A 1ZRHA 2W6JD 4IRUB 3U7EB 4IJMA 4LBZA 1YZLA 3CLVA 4M1SA 5FPTA 1GL9B 5TARA 1PLKA 4V0LA 3X1ZA 2L0XA 1ZNXA 3CO5A 2H7VA 3O8BA 1IBRA 1T3HA 2F3TA 1A7JA 1E94E 1E2GA 3P4XA 3EC1A 4YQFA 5FL3A 4U7DA 4BPBA 1AGRA 3GFTA 4C0KA 2ZTSA 1KNXA 2WV9A 3GFOA 3RABA 1VPLA 2P5SA 2A3RA 2Z43A 2ZSFA 1AA9A 3RRNA 3SJAA 4CZ2A 3RS2A 2ZE7A 2F3RA 2Q9AA 3VR6A 3PEUA 1CR0A 2KSQA 2JLXA 4TSFA 2O8DB 3SR0A 2ZPTX 2IK8A 1SGWA 2QAGB 3EZ6A 1W49A 5DI3A 2OE2A 5FR2A 3AUYA 4DLZA 1E2MA 3PEYA 2H8KA 2Z4RA 1R2QA 2BEKA 3EIEA 4A1FA 1R5NA 2D3WA 1U0HC 3ZS8A 1KI4A 2IHYA 4HZUB 2QMOA 1E9CA 4PPFA 2HT6A 1YZKA 2CHVA 3IGFA 1VHLA 4W5JA 3SHWA 2ZJ8A 3BFVA 4NCNA 4XWKA 3FPAA 3KXLA 3KXKA 3ZD6A 4G5GA 3VHLB 1GG2A 3IILA 3GLFA 1KK3A 1II8A 2FZ4A 1FTNA 3NC0C 3AQ4A 1VYVA 2SHKA 1DVRA 2GILA 3K70B 4AKEA 1JR3A 1BOFA 2XSZA 5D3MA 5C4GB 1Z06A 4A2WA 4DXAA 1YR7A 1XD2B 1U8AA 4RD6A 1GWNA 1Q1EA 1JR3D 3I8SA 4FMDF 4A36A 1HQCA 3RRYA 4AY2A 1UKYA 2RGNA 2QUZA 2ZRBA 3IQXA 3B1XA 1R0XA 2B8TA 4TLAA 2ZR7A 2ZUBA 1E2KA 2QQEA 2ZI9A 2V54A 3KJHA 4HLQB 1Z0FA 2GF0A 2NO1A 1OT3A 3VR4A 5FOTA 1L2TA 1Q1BA 2HCJB 1KTVA 4PO1A 1KI7A 3CH5A 4B48A 4OHZA 3L8YA 1R10A 2NMVA 1TEVA 2QMEA 4Y0AA 2ZS8A 1E1RA 3FYHA 2RGXA 2QSYA 1XEWY 4BWYA 2V1UA 2RAPA 2PH1A 3UPUA 3BERA 1ZUHA 1OXSC 1YRAA 1U9IC 1ZIPA 1E1RD 1FP7A 1SXJC 4Q48A 4QJ3A 1OYYA 3FTQA 2WKPA 4IDQA 4A9AA 1E0SA 1W4CA 4LYAA 1NIJA 4QL3A 1S3SA 3I61A 1MRSA 2EWWA 1XTSA 3VU9A 4BUJA 4B44A 1PLLA 3M6AA 4JLVA 2RKOA 1VTKA 2OLJA 3A36A 3MWJA 4H1UA 3VR2A 2QI9C 1Q12A 5FBQB 2W2TA 3PJRA 3VR1A 2PZFA 4Q00A 1ESMA 2XB4A 4RCYA 1OH8A 3P1JA 3ZJYA 4AK9A 5DLQC 2IYQA 2MSEB 2GJAA 2NQ2C 3RLFA 1IN5A 1EFUA 1VYUA 2HXSA 4H1VA 2HCBA 4B47A 5B58C 1M8PA 5FPHA 3KXIA 4TL6A 5FPSA 1TTTA 3OFND 5HE9A 5L3RA 4ZDJA 4K46A 2FPKA 2ANBA 1CJKC 1F2TA 1GFIA 2E1RA 3W6PA 2TMKA 3HU2A 1RZ3A 1ZU5A 2C96A 4Q1EA 4QBHA 4US0R 3SOPA 2DWOA 1QHHB 2ORIA 3PG5A 3C41J 3P20A 4IDPA 4DT1B 1FTSA 2ZJ2A 3OAAA 1G18A 4E07A 5KSZA 4AURA 2JLWA 4LOAA 2R44A 3SC3A 1QF9A 2GKSA 4AI6A 1EX6A 2HUPA 3AVQA 2P6NA 2ZETA 4DIDA 4RFVA 3MG9A 4NYJQ 2EFDB 2XTMA 3UG6A 5AUNB 1SKYE 5GJVC 1T4GA 3LW8A 4GP6A 1UM8A 4I1VA 4TT3D 1E2PA 4FCVA 4KYIB 4UNQA 1K6MA 2WJJA 3CZPA 3F8TA 3HDTA 3NHAA 5CYOA 3VHXA 5DN6D 3FFAA 2R6FA 5FR1A 2HYDA 1DPFA 2PJZA 2R8RA 5EE0A 1KSGA 2FDCA 4L4UA 4FMCF 1AQYA 3W5JA 2J0UA 3MFYA 4NZYA 1AKEA 4HAXA 5K8IA 4IOJA 4URYR 4JJZA 1N0WA 4R7ZA 3EWSA 3ZIAA 5JMTA 2QU8A 1U81A 2N42A 2FNAA 1XPOA 3VR5A 1AS2A 2EFEB 5BW8A 3OZXA 3VKGA 3DMDA 4EPWA 4X8LA 3TRFA 3LO5A 2WM9B 5L3QB 5K8UA 3GLFE 4ZIRB 3RS0A 2WWXA 4M9ZA 2AFHE 2D2FA 3EXAA 1S3GA 1KSFX 3D7MA 4RKFA 2YINC 3S1AB 4YDHB 2GNOA 3GD7A 1U90A 1XF9A 2JA1A 5UKDA 2F1HA 5BXQC 4ILEA 1EWRA 4L5BA 4A4DA 2QORA 4OHYA 5EXSA 3U2QA 3SFZA 1JQJC 2ODEA 2VSXA 4DWJA 3BJIC 4QGFA 1X1RA 1Z6AA 2AKYA 3BWDD 1NLYA 1SVKA 1XMIA 2QBYA 1US8A 2I4IA 1LNZA 3B9QA 3LBNA 3RHFA 2Q3FA 2OLKA 4ARZA 1OLOA 3ADCA 4KV9A 1S4QA 1R0YA 3CF6R 3GEIA 3HPRA 5TMPA 3AVXA 1ZD8A 1A4RA 3I5XA 2YOHA 4M1MA 1ZMXA 3FWYA 5HZHA 5JEEA 4C2TA 1KK1A 1SVSA 4LZZA 4RSGA 1N5JA 1SHZA 3P26A 1UKZA 1NF3A 1M7BA 3HP1A 4N1AA 2JLVA 3K0CC 4BE7B 1KI2A 1F2UA 2ATVA 3LV8A 4WXRA 4MDEA 2Y8EA 3I92A 4D26A 4HUQB 3ZZTA 3GLHB 3OEHD 3K0EA 3TE6A 3AH8A 3QIAA 2QE7A 2IL1A 2D7DA 4DJTA 4B3CA 1CJMA 3SHFA 4A0FA 2QM7A 5CK4A 4XJXA 2DYKA 5EUMA 1TAGA 2BMFA 1NN0A 3QXXA 3U6KA 2RHMA 1E79A 4HDQB 4EPTA 4RFSA 5L3SB 4QBIA 2CDNA 3QOFA 2CE2X 1N0VC 4V0NA 3CRMA 4B3GA 4AYXA 4BASA 2WWHA 1NKSA 1QVRA 3TH5A 1ZM7A 4M9QA 4B73A 2NO7A 4C7OA 1C9KA 2OT3B 4Q1AA 1TNDA 3EARA 3SFVA 1P72A 3HWSA 1DOAA 1DAIA 2AXNA 3L0OA 2PEZA 4TQAA 5AJWA 3ICEA 4GSYA 2O8BA 3AVOA 4QNRA 2AD1A 3Q7PA 3L8ZA 3R8FA 1O87A 4DSNA 3CWQA 3A6PC 1W2GA 2JLRA 1FNNA 1CR2A 3MWLA 3P4YA 3LRPA 2IYTA 1JEEA 1X86B 1KDOA 4URWR 3DZDA 2F9MA 4C0BA 1VG1A 3BE4A 4LJ4A 3RAPR 3UG7A 2VH5R 2VSFA 1E2QA 1R5OA 5FL7D 4ITRC 5GJCA 4LHXA 4DSOA 3EW9A 5JCPA 4DLTA 1KDPA 1F6BA 2ZE5A 4I1OA 3SYLA 3WRXC 5H8WA 2AX4A 4BFZA 1KDTA 3B82A 5K8TA 4G1UC 3U3OA 2IS1A 2V6JA 1BO6A 1UDXA 1CXZA 1NY5A 3VMFA 4HAVA 4PC7A 2VA8A 2PMKA 3PV0A 5C46F 1JALA 3PCRB 1G8YA 3RWMB 3A1VA 1U9IA 1SXJA 2IBMA 5EXTA 3QKTA 2ZXUA 1Z6TA 2ZRKA 3EAQA 3G82C 3T12A 1W7AA 1IHUA 4JLPA 1KI1A 4WIAA 5BN5A 1KO8A 4ACBA 1TUIA 3F5FA 2JLSA 1E0AA 1VCMA 2AR7A 4KVAA 4TMVA 5CIQA 5KU1A 1H8HA 4CYMA 5CJPA 4LV8B 2VEDA 4AIIA 3W5IA 1UPTA 4IOMA 5A5GA 2VHQA 1H65A 1NMXA 4C0HA 5JJIA 2RMKA 2WVJA 3U6BA 1NI3A 2GCOB 4Q4JA 1W48A 3VX3A 1KGDA 1RRCA 5AR1A 5SZJA 4WAUA 4LUCA 3CX6A 1L7VC 2AWNA 1N0UA 2ZYWX 4DRZA 3LLMA 2ZVQX 1JPJA 3NHBA 3OF5A 4X8HA 1RRPA 4EJSC 1Q0UA 3HYTA 4R9UC 3NWJA 2XAUA 3T1QA 4HUTA 4X8OA 4NKRA 4QHTA 1Q20A 1U2RA 4L9SA 1NVWQ 1NG1A 4CEJB 3L43A 1KNQA 1JI0A 2CMKA 1DG1G 2QP3A 1CS4C 3R9XA 3K9GA 4US1R 3GLIB 3PUYA 1ZNYA 5F9HA 4M8NE 4F38A 3G5UA 1P60A 3BC1A 1LS1A 5J5CA 3PUXA 4R71A 1HUQA 1DAEA 1Z07A 4X8MA 4MYTA 4CEIA 3SBEA 1ZVQA 1KO5A 4Q4HB 1B23P 4JLNA 1LTQA 4IXNA 2J46A 5KNDA 3LY5A 3RSLA 4Y0VA 4BZXA 5AJYA 4A15A 3TR5A 3AKDA 3E2IA 3W9YA 5FTJA 3LH5A 4A82A 2O8FA 2ZRAA 3IBGA 4HSEA 4P31A 5IT5A 4HAZA 4MKIA 4M9XA 2WHXA 1K5GA 2CJWA 1WDTA 1QG4A 2CK3A 3PUWA 1DAGA 4MDFA 3AEZA 3DM9B 1EK0A 1N3BA 1IXRC 1N6RA 3NC1C 4OJKA 1WCV1 4A0RA 4B76A 2JIZD 4RD2A 4BEJA 3FKQA 3C8UA 5JS8A 1U94A 5EE3A 3OESA 4KBGA 2G9NA 2QT0A 5EP1A 4O2LA 1XB2A 4G5RA 5KDDA 2ZRPA 3IO5A 4ZCMA 3ND9A 1P62B 4F92B 4PR0A 4C2UA 1TMKA 3CF0A 3V9PA 3X2SA 2AHOA 1CLUA 1GOTA 5FFMA 4HB4A 4DC9A 2GXQA 3JZAA 3EWAA 3KL4A 4BECA 4URXR 1XEXB 4NE2A 3QKSA 4AC9A 1TPZA 2I1QA 4EPYA 2CVHA 4GMXA 4ZI2A 4FN5A 2XNDA 3WBKA 3GLGE 4DSTA 3CX8A 4NBSA 2BVNA 4U00A 1G6OA 1LW7A 2YV5A 1GRNA 1G41A 3QXJA 2XNDD 1RYFA 4KODA 1NNEA 5EZ5A 2PT7A 1TQ4A 2FH5B 3N2EA 1T0HB 3NXSA 5FTNA 1V43A 1XMJA 3K0CA 4TL9A 3VQTA 3ICQB 4YMUA 3LLUA 5LBIA 1II8B 1DELA 3GJ6A 1SXJE 4BLOA 1Z83A 4Q18A 5CYPA 3WP1B 1G8GA 3B1YA 3VNVA 5FOUA 5D3MB 2ZYUX 1N6PA 1YU9A 4UKDA 4EFNA 2JGNA 3HYRA 2WTUA 5J4KA 3TSZA 1PUJA 4DCVA 1ZC3A 1G21E 4XTCS 4LX0A 1PUIA 3WYFA 4JLDA 2EQBA 1E96A 3K9NA 5FBVB 1YR9A 3THWA 3OIYA 2VO1A 1LFDB 2YJTD 5FOSA 2QA5A 4URVR 4M1KA 3A58B 1GAJA 3IPYA 4UNPA 5FBLB 1QZXA 3FHCB 3GJXC 2QN6A 4JBYA 2ZM5A 1KO4A 1NY6A 4HLUC 3WMGA 2V3CC 3B13B 1NG9A 2ZREA 2F43B 3AVUA 4M9SA 2GHIA 5KNCA 4ZCLA 4C0LA 1CJTC 4A6XA 4LHWA 5C2JB 1J8YF 1CULC 1OJLA 1P2UA 2H57A 2ORVA 3IKJA 3U3KA 1IN4A 2WWIA 3GEHA 1AK2A 4XSGA 2XZLA 1D2MA 1M74A 2BBTA 1JQLB 5KDOA 3QEJA 2EVWX 4JL8A 5FTLA 1FUUA 1FQKA 1DS6A 1O3YA 2JCSA 1XX6A 2J7KA 4HEJA 3TBKA 1G17A 1OHHA 1Z3IX 4D0NA 4QM6A 2V6IA 3GJ4A 3NBXX 3VX4A 3QBTA 2FZLA 4MRSA 1OHHD 3LW7A 1YZUA 4EQ6B 2QTFA 1GDDA 1F3OA 3H1TA 4FXPA 2W0MA 2NPFA 2JASA 4RD1A 2CLSA 2O0JA 1D5CA 5A4JA 4IVQA 3PENA 4UNSA 1MABA 4YXWA 3TQFA 4LJ5A 2FFBA 1GM5A 1NIPA 1E98A 1N6HA 2OCYC 2I1VB 4FI3C 5JHGB 5CITA 2IS2A 5E3HA 3U3RA 3EA5A 1W36D 1SZPA 4PC3A 5FOXA 3AP3A 2Q3MA 4GFDA 2OSBA 4QGHA 1TF2A 3K0AA 2ODWA 3RS4A 1L4YA 1UAAA 2ZYVX 3HR7A 4D0LB 5LPNA 4IVRA 3KQLA 4PAMA 3TUJC 5IK2D 4L15A 2XNSA 4NYMQ 4MA4A 3VAAA 2LWIA 5GVRA 2MSDB 2RB4A 2ZR0A 3AGQA 2WBLC 4LV6A 5ELXA 3RC3A 3AF1A 4PX9A 4BLSA 1A2KC 3ZLJA 4GDFA 1NSTA 2WPDD 4EDHA 1P2SA 3SE0A 1HH4A 5LB4A 3T1TA 4EJSA 3R7WA 5CJ2A 2F7SA 1XTRA 3TSWA 5AWFC 1EFHA 4A92A 1QDEA 3RANA 3H86A 3QF4A 4Q9IA 3BB1A 4KSCA 2X19A 4ZPXA 2QROA 4P0TA 2FSGA 4MITA 1D9ZA 4N3NA 2DCUA 3B78A 2WJYA 3TVTA 2ERXA 4KBFA 3UANA 1TU4A 3W3ZB 4TYWA 4MKHA 1RW4A 2KWIA 1IY2A 1ZU4A 3OIWA 4Z1MA 4Q02A 3DDCA 2VYFA 3IDQA 1XXHA 2R6GA 2J41A 4EIWA 1COWA 3GMTA 4RD4A 2VF7A 4LRWA 5F3WB 4Z1MD 1E1QA 2BJWA 3QPWA 4TMKA 2GRJA 1E0KA 1UADA 4FCTA 1EESA 1UDWA 1US8B 1S9HA 4LV5B 3W34A 4AG5A 2O8CB 4HAYA 4JL6A 4M21A 521PA 3MWKA 1KJWA 1OV4A 2JDIA 2REOA 3WHKA 2QP4A 1JXMA 2VSOA 4WZ6A 3SEAA 2G83A 3U7HB 1FPMA 1MV5A 4TTRA 3I8XA 4D4LA 3U44A 4V0OA 1EFRA 3RRMA 4CF7A 1IJFA 1Z8FA 5F98A 5BYJA 5FH9A 2P67A 3A1UA 2C98A 4Q7MB 4A8JB 4A2QA 2W58A 1FNMA 1I2DA 4O25A 1T9HA 2H18A 4F93B 5IF9A 4TSFD 2VP6A 5AK0A 3GJ5A 3PFIA 3QY0A 4RFSB 3UXMA 2DBYA 4YONB 4CT5A 3LVQE 2GXUA 1P75A 2E87A 4IKEA 4KFUA 3W6OA 4KFTA 1KI6B 4QXAA 5CK5A 1DEKA 2RGDA 3EG5A 2XXAB 1KI3A 1E9FA 3SJCA 2ZI6A 1JAHA 3EPJA 1YRBA 2FEMA 2IYYA 1IQPA 2VHTA 2YWEA 4FCWA 2QAGC 3T1VA 1E2DA 4C7OB 5J40A 4PAOA 3W3AA 3NDBB 2QPTA 3MGCA 3R20A 2ZU6A 1ZD9A 4IDOA 3T35A 1W4BA 2ZJAA 3CBQA 3KFVA 3C14C 3AP1A 2EYQA 3NG1A 2YC2C 4JLJA 4NYIQ 1G16A 4PFSA 5EP3A 3Q5EA 3REGA 4HI0E 1NRJB 2XSZD 4QHSA 3R9IA 3F3YA 5CLLA 3UATA 1HV8A 3QKRA 3Q9LA 4JLOA 4URZR 4TL8A 2NOAA 4B3XA 3AVWA 4TMZA 3TKLA 2QMUA 2ZJ5A 3VKWA 1W4AA 2NG1A 4FWIB 4JLMA 2DFKB 1G8HA 2ZI3A 3WMFA 2VP4A 1DAMA 1M2OB 2UVQA 5KSPA 5FUXA 3KQUA 1XTIA 4P4TA 3V4FA 2CHQA 4HLUA 3SBDA 1HY3A 2N46A 2D62A 4S35A 3K0FA 3BIFA 1A2BA 4QGAA 1P2VA 4FIDA 4NYJR 2GCNA 4JYBA 3KTAA 3AF2A 4FMBB 4WVFA 4XTRA 5FPYA 4I99A 1NN5A 2BKUA 4AG6A 3BH6A 2BBOA 5C1BA 2WOJA 1Q57A 3FB4A 1Z22A 2NIPA 3O47A 1JR6A 4I4LA 2D06A 1Z6YA 1NLFA 1TL7C 3QQ5A 2KE5A 2ZJYA 4OL0A 2RHDA 2WSSA 4PSKA 4DUGA 3AM1A 2DY1A 5SZIA 2GF9A 2YC4C 1G3IA 3CKLA 4AYTA
chains in the Genus database with same CATH superfamily
4IUDS 1PF7E 3B6JA 3NWPA 4HNRA 3BHNA 3JZFA 3PBKA 4KWCA 4OXYA 5IDVA 3TFOA 4ZYYA 1V8PA 4LXIA 3MERA 1Q3TA 4PX3A 3UYLA 4CMGA 2YN4A 3K94A 3O5AA 4J76A 4YJGB 3TTUA 1WNTA 4ETWA 5ADWA 5FAKA 1X15A 2QP9X 3C3CA 5ILQA 4WJKB 4V0MA 2Q6KA 4FEGA 5B55A 1GAQA 1YBHA 1YQGA 4RV4A 5A3JA 1H9BA 4AS3A 1QIGA 4KXWA 4Q4JB 2YIJA 4RVSA 4AJHA 4JOSA 3GJRA 2WJZB 2G5CA 1WF6A 3RRXA 2YV4A 1F0PA 3FOEC 4G0WA 2JD0A 1GGHA 1NBIA 3GLRA 3JQDA 1PU2A 3LT4A 2L82A 3OOYA 4D42A 1RKXA 1EFAA 3COWA 3T7SA 1EUDB 3ZE9A 4AU1A 3OE1A 1KAEA 5ITSA 1Q6YA 3ZCXA 1E5LA 2HRCA 3PI7A 2IYAA 3GB9A 4LSWA 1BHJA 3ZI0A 2Q3EA 1JSLA 3AF4A 5H4HA 3RFUA 1ESDA 3A8TA 3EE6A 3K1AB 1NXVA 5GVSA 2DFNA 4AP5A 2AQHA 5PNTA 8ADHA 3IMKA 5JAHA 3CCFA 1UDAA 4G6ZA 3A1TA 2G6BA 2OBLA 4O2RA 4WNIA 4PHGA 2FPWA 3FVTA 3ASZA 3LJKA 4CI9A 1QU3A 4C3ZA 3PEWA 1QB8A 1S2IA 3HLKA 3G0GA 1IJBA 1FS6A 3Q1KA 4OA8A 3ZE8A 4RCZA 4C05A 2AGVA 1XAHA 3CF2A 1HBJA 3KKPA 2CV0A 2W2KA 5TC4A 3Q87B 4CF6A 2FSFA 3I52A 3OQOA 1G7SA 4G26A 2I3DA 1FA9A 3HCRA 4HWTA 1Y7HA 2YRWA 5LQMA 1E61A 3ZY5A 2HU2A 3DE7X 5JYEA 1FJXA 4UVHA 1A5AB 2BDEA 4BC1A 4BX8A 4P84A 1IMJA 1G9XA 3NVMB 1DGQA 3OPQA 4HLDA 3ENZA 3R0JA 3A6KA 4RY0A 5T4EA 3CGWA 8GPBA 1ECBA 3E58A 5DGDA 2QIPA 2OYRA 2CE7A 5JRZA 4ZVRA 1VJCA 1KZ7B 1NFRA 4TRRA 5EZ6B 3I64A 1ONOA 4AAYA 2WA2A 3GA5A 3EGVA 4D5EA 4DCTA 3ZV7A 4LE1A 3OM8A 4G1BA 1YJQA 4BVKA 1CUIA 2BI8A 2QRNA 4WOBA 1HE1C 5BW6B 4YRKA 1POXA 2I76A 4J07A 4QUHA 3QU7A 4DHWA 2GBPA 2YYSA 3QPVA 4JHXA 1WE2A 2PLWA 4L6AA 3ZDQA 3LKBA 9GPBA 2J9YB 1WDWB 2XMPA 3IKTA 3LIIA 5JJBA 5BMVB 3H3JA 4YLYA 3SLKA 1XROA 1GPLA 2PGNA 3CLSD 3KJQA 3FFBA 4O4IA 5CVCA 3H1AA 3G0CA 1YJ8A 1SA0B 3JQQA 1RSZA 2DQSA 3C5HA 3CWCA 1GITA 4EUNA 2E6UX 3PQ8A 2MSWA 3KU4A 4EVSA 3QKSB 3HKBA 4K81B 1D2HA 2J08A 1D0SA 1MDFA 1C0KA 3AR7A 2HQSA 3D0KA 4HNSA 1BE1A 3QLUA 4QXQA 4BKOA 2WFLB 4EG1A 1IEWA 1O6FA 2HXYA 3L49A 2AI3A 2BOVA 2R1TA 4S1VA 5CFPA 5JFGA 2CVZA 4DB4A 3HSSA 1Y80A 1GA1A 2WJPA 3DVAA 3ETLA 3OTIA 3ZV5A 5C1BA 7REQA 5BWOA 4RJLA 4DV0B 4ZI7F 4MKFA 2FUEA 2WMOB 1GPKA 2PLNA 1B6GA 3AP2A 3DDUA 1SG0A 4JC8A 5AVKA 5AW8A 3NJRA 2EWMA 4AS1A 4IGIA 5IJ0A 4C6TA 4XQCA 2XT0A 4C0XA 3MQ4A 3HDVA 5IAAA 4EKDA 1F60A 2B1IA 3OCVA 1IEQA 1NPTO 3OD5A 2N1BA 3EZ7A 4EJ6A 3L0ZA 4OHCA 4AYWA 1UOQA 3L4BC 3OI7A 1A9PA 2J9RA 4PVCA 3TOVA 4DKXA 4HMPA 2VK4A 1E6KA 2VOEA 1GSOA 4QOSA 4JJ4A 3ZKAA 1MORA 3EUAA 4MRMA 1N5IA 2D7CA 1T5SA 2HJHA 5DM2A 3HB0A 2G71A 5DWVA 1UM9A 4X84A 3OJCA 1XP5A 2Q3CA 5SYNA 1YZ3A 2PAAA 3K5WA 4FYVA 3ZGNA 4L5AA 2I55A 5K4GA 4QFDA 4Y9DA 1UC8A 3DHWC 4H7IA 4DLLA 2J0SA 1BWSA 3PTZA 3ESQA 2O8DA 2RB5A 3C3YA 2ZUCA 5JH7F 1W85A 1H22A 4E4TA 2UYHA 4JYZA 4ICIA 3L82B 2K7ZA 3GFVA 4JBGA 4AN0A 1GUYA 2GBIA 2O2GA 3AHDA 3FHOA 2UUPA 3FPSA 2WF6A 3V34A 1V3QE 1CZHA 4IXTA 4ER6A 3I62A 3RHSA 2HNKA 1WEKA 1OZ0A 1TEHA 2FZKA 3VPFA 3GXOA 5WRFA 2CZQA 1U7HA 3ANMA 3FCYA 4IHJA 4N49A 4TLCA 5BSMA 1OFTA 5D01A 3O7WA 3KR0A 3HHPA 2WM2A 3HCPA 4W8HA 4O4HB 2DSNA 2V4ZA 3IALA 4QICA 2IYFA 3DW1X 4FBMA 2BSXA 2W8BA 1QAQA 1TZKA 2VUHB 3C97A 3KQYA 3I72A 4XH9B 4C4ZA 3FFWA 4NY1A 4QFBA 5T67A 1HKUA 2FRDC 3GRUA 3GGJA 1U3DA 4U4AA 4YMLA 5KSYA 1SZDA 3HCOA 4J03A 1UMDA 4LXGA 1RBZA 1YZYA 2VVTA 1DO2A 3VVLA 1FRVA 1WQ4A 3NHYA 3OPYB 2JKYA 4QPZA 4O3MA 3H75A 1XKQA 1GA6A 4NZNA 3L6CA 4E5YA 1VRWA 2WNSA 5CT9A 1Z6PA 3C24A 2Q6VA 1GT6A 3DTTA 1O9HA 4R81A 4J4HA 2Q21A 4RK1A 2GTHA 2G28A 4ESEA 5BSWA 4YMWA 5KIAA 4UDYX 4E15A 4HWPA 4DXDA 1SXJD 1FYFA 4Y2XA 2IWHA 4L72A 2IEGA 1OWNA 1T8YA 2I5PO 2NO5A 4KG7A 4MWBA 4QUKA 2JARA 1IUNA 4DCPA 4E31A 5DASA 1SULA 4JT4A 3PWZA 2CFCA 5KWJA 2O23A 4UCFA 2C3MA 4LMBA 4N0QA 2WP0A 2V9CA 5J1SB 4IIEA 1CF2O 2VJNA 1MAUA 4ZT2A 1FFBA 1BVYF 4MW6A 2HIAA 3UUWA 3GJ8A 2OV1A 1P17A 1PGPA 2B4YA 5BWMA 4CIYA 3CZ9A 4JN6B 1TJ5A 1AUXA 4IIVA 2J5XA 4FGSA 3QNUA 1HDZA 1GPNA 4QLBA 5L51A 4RTOA 1XG5A 3T8YA 3KQOA 4IDBA 1NI5A 1UEJA 4E2WA 1EK1A 2OFXA 3AL3A 3JWEA 1OWMA 3O8QB 5D85A 3TI9A 1VJDA 1F0KA 1YCHA 1X7YA 3U3RA 3QXHA 2VF8A 1BG6A 3V1NA 3WLJA 2UU9B 1K8RA 3ADBA 5AK5A 3G9XA 1C7QA 3I2GA 4HQOA 4MGKR 4XFKA 2X4IA 4EJSB 1AN9A 1O97C 3BXEA 2YMMA 3DDOA 4UCXA 1ZUIA 2J3KA 3IQHX 3QVGB 4R1MA 5DM4A 2ZYGA 3CPHA 3O4HA 5EWJB 4RJTA 1QRSA 2VJYA 4GBED 2WT8A 4HNAB 4KNYA 4JY7A 5DULA 5GPBA 3S2GA 2P0EA 4ID9A 5TIIA 3WLFA 2ZIXB 4BMDA 3OFKA 3MRVA 2X8BA 3RK0A 1A9QA 2BJVA 2YWRA 1CZRA 1UZUA 5M7EA 5LDHA 3PRHA 3K0SA 1JFLA 1T9GR 1UC9A 3IX7A 4GM0A 4JI7B 4YP6A 1EMDA 1V48A 4J29A 3T5MA 4QDUA 3CUEF 2BGTA 5EIBD 5AD1A 4KN5A 4BNTA 4DQXA 4UC0A 3OX2A 1GNLA 1LV7A 2GBGA 4C1BA 4E70A 1JPUA 3JR3A 3OLZA 1TW3A 4I81A 3N59A 5J4LA 1RWWA 5H02A 1JFFB 3E5HA 4LZLA 2V98A 3W8RA 5BYKA 3C48A 3T1HB 1A77A 3FPBA 3SGLA 3ZW8A 1Y8QB 1QGED 3D6MA 4WK4B 4GL2A 3BUSA 2UZ1A 1FW6A 3O84A 4CU5A 1V2GA 1JZTA 2CD7A 3OBBA 4HTFA 4JVMA 4ND8B 4PTZA 1QOQB 1BH2A 3GVXA 5EJ7A 5CU7A 2HV8A 3ZYCA 2QTTA 2GPAA 1NXQA 3PEEA 4IJVA 1PGNA 1E6WA 3NNDA 3SY8A 3WGUA 3STVA 1OJ7A 3DBHB 4L76A 1UXKA 2QN3A 3WIBA 3DHYA 3WNDA 5ABPA 4Z4FA 1QYIA 2FN4A 1JG6A 2V7QA 3LTNC 4DB2A 3W5AA 2GZHA 4K3VA 3ZWDA 3LUAA 4DMHA 4TTAA 4M2LA 5D5QA 1T3LA 3HO1A 3K1YA 2EJCA 4UE2A 5KYYB 4G41A 2J5KA 3HVUA 2A9OA 4MP8A 4AJ4A 3PGJA 4RZ2A 4AD8A 4CU2A 3FSEA 1ZAYA 2HL6A 4LTMA 4LAFA 2PCJA 1M2EA 3NTLA 4ZIRA 5JANA 2C9OA 2W2PA 4C22A 3EAFA 4PONA 4ZCPA 4IOKA 5ALPA 1VC2A 4D4GA 4EGAA 4HGZA 4PHFA 4Q3AA 2YWCA 4BNVA 3VKVA 2IS4A 3FMVA 1XL1A 4P2BA 4XWYA 2ZUVA 1TI7A 3M7IA 2VDVE 2WU4A 4B2IA 2O9JA 1YZGA 3KJEA 4LFAB 3DFKA 5JNVA 1AHPA 2H1RA 3ILVA 3SC4A 4CCYA 3A6EA 1DOZA 4MHOA 1WU8A 3OZSA 4YMIA 1G6HA 4UDOA 1SC9A 3QX3A 1IUKA 3O03A 5TB5A 4N40A 1BXRA 3WFIA 1JAIA 3DEZA 2A30A 2AN9A 3L4BA 4LRXA 3UV7A 1EFCA 4AY6A 1RYYA 4YJKA 5JR3A 2GZMA 3OQHA 4I4TB 4FHCA 4GOKA 1E2EA 2WNHA 3H5WA 3C7KA 3H2BA 2WTMA 2Q3DA 2ECPA 3S5JA 3KB1A 3LAWA 3TJRA 3FLEA 2OCLA 1PT7A 2D0PB 1CY1A 5AM0A 4LC1A 1NTOA 3U7JA 3UUEA 4D1YA 5HZKA 4OI1A 2ESRA 5JS6A 4HUQA 4BNWA 3FHTA 2Y0DA 3KKLA 4YFVA 3MXOA 4DUPA 1PUXA 1FMJA 3S0JA 2FAXA 1ZI6A 3EQ6A 3OZEA 3GEGA 4RF5A 2R8ZA 5EMMA 5CB4B 1L1QA 3N70A 5DRYA 4YRQA 5CGQB 3TQQA 3PJGA 4ZN6A 2WHEA 4ENUA 2NAPA 3IDOA 1ZL0A 1I3LA 1KYWA 3JVIA 3F96A 5I3CA 2QGZA 5F33A 4F2HA 4QPJC 4MHTA 2GM5A 2JBHA 1THZA 1LRJA 2NYVA 4O29A 4BAZA 3KSAC 4UM7A 3S7TA 1S01A 3C6ZA 1EQUA 1NSFA 1K5PA 3S8MA 3B3JA 2VHJA 5TY0A 4AMUA 2A4KA 5JCZA 1F38A 1W96A 1Z2CA 5EIBC 3DC7A 1M83A 1PTKA 2N3ZA 2WWWA 4KO2S 5ALTA 4AZWA 4LI0A 1M2JA 3JQBC 2QU7A 1K2VN 3Q8LA 4UE3S 3LDHA 1BQ3A 1MF7A 5ER9A 2I3ZA 3HZHA 4LE2A 3WQHA 5G41A 1E8MA 3DP7A 3BMQA 2N47A 2H59A 3ETNA 4JT8A 1B3BA 1PEDA 4PYOA 1S8FA 5FOVA 3R5KA 3ZWOA 3EXEB 4HWSA 3T9EA 4D0GA 4R5HA 5AOCA 3A6ZA 3UHOA 1I32A 1V3UA 3WQRA 3HA2A 3VU9B 4YYZA 4ZWNA 5AVTA 4DUYB 1NR7A 4MQ4A 4BN5A 1K89A 2HU7A 3Q4GA 5KCZA 1J09A 2FPOA 3LG2A 3TL6A 3STTA 3TM4A 4F6RB 2YXDA 4BEBA 2FRDA 2KS6A 3DCYA 3JD1A 4QC2A 3J7AC 1XDZA 3PDIA 3INTA 5C8ZA 4RC9A 2D4HA 2IE8A 2VTKA 2YJ4A 3TQTA 5G02A 5CFQA 3E35A 1CUFA 2XIJA 3AFMA 4PGHA 3TUIC 2FP4A 3PGKA 4KI7A 3GMDA 3T3NA 2IDKA 1HDGO 3T7JA 2DFPA 4LNUB 4MIKA 3UK2A 4A8PA 4MJ3A 4X66B 2I6TA 2PMDA 3FG9A 3G1UA 3HPQA 4ZCSA 1CWUA 4INOA 4X24A 3BMCA 1USVA 4MRRA 4ACAA 3D8UA 2D1RA 4FLEA 1M7GA 4E2XA 4L9RA 4R41A 3CUSA 1HQKA 1H69A 3NAMA 4LY6A 2H2AA 3CINA 4D4MA 1E32A 1REQB 2FPGB 3LSTA 3MTBA 3U80A 1TRKA 3SKXA 1FDTA 5HNKA 5C51B 1Y42X 1L7RA 3FFXA 4AIRA 1CY4A 2RHHA 4MO2A 4FW9A 5C5CA 3ZHZA 1RAGA 3CO0S 3C16C 3OY2A 5HIKA 3VNRA 3BXOA 4BFCA 4XOIA 4R9SA 3QPUA 4NJOA 4XM2A 2OEPA 3U1BA 2PKQO 1TIPA 2WJ3A 3HRIA 4QOHA 5IDYA 3VNAA 1XWIA 4JGIA 4DQKA 9ATCA 2PA3A 1L5GB 4DY4A 1HYBA 3GPBA 2KBEA 1CP3A 1VIMA 4HEA6 3OD1A 4GPTA 1FFHA 1RLTA 1VE7A 1SVUA 1ZEMA 2J45A 3FNFA 4GQBA 1C9YA 2ZW9A 1PNRA 3FGNA 1PJQA 2YNMC 3L8GA 1GL7A 3EZFA 1N0IA 4KJXA 1XRJA 1K66A 3PYXA 3GOHA 1DFIA 1Q17A 3WFZA 2GKGA 5CDFA 4RLFA 4BC0A 1N3YA 1VRCA 1TF5A 2YRXA 1OW3B 2YOFA 1K06A 3CNQS 1QCDA 3NKFA 1FYDA 4XUGB 3S2IA 1G5IA 1G2IA 3CNNA 1VKOA 3DHEA 1H0RA 1VKNA 2VFAA 2W6IA 5EPEA 1A9RA 4I3GA 4Q9LA 2D2VA 4Q9AA 3PKIA 3SN6A 3OE7A 2A0XA 2LD4A 1O97D 3DBRA 4PR3A 1XC7A 2PR2A 4YACA 4CEHB 1J9GA 1HT1E 1WUIS 4L5YA 2R97A 1U7TA 1P39A 1X19A 3QYJA 2C5LA 1VKRA 3OE7D 3C8HA 3NS7A 2E0IA 4BNYA 3WY9A 1VLQA 3BCUA 3DH0A 3JWGA 1QGOA 1JP7A 1W88B 2IF0A 1UANA 2FEOA 3EFOB 3D6NB 3KJGA 3SWWA 4KRGA 5SY4A 5TF0A 2IY9A 2CXTA 2ZSUA 1GKYA 1IAQA 1T5IA 2MT9A 2CW5A 4HGNA 4IGFA 1Y1RA 4RIEA 4UUNA 4JYCA 4ZOLB 4GWGA 4DAEA 1Z5VA 1MFPA 2VBCA 3ES9A 4Z49A 4K0RA 3T7DA 4KPUA 4PX5A 3Q85A 3DL7A 4RY9A 1HNXB 3M3PA 1K97A 4B87A 2VSYA 3TX6A 1L8XA 4PLHA 3OG9A 2CJYA 1N2SA 2PUBA 421PA 1PV2A 3I8OA 1AIPA 1XO1A 4RZUA 1P6XA 4FGUA 1PWEA 1DJOA 4M54A 5C1PA 5CX1B 2BTQA 2H63A 4I1YA 3I2JA 4F91B 1BVRA 2CNBA 5DBFA 1ORRA 5JRJA 1XA4A 3L6OO 3EF1A 2AMJA 4WNCA 3X2EA 2PBZA 4R83A 4LMPA 1R8QA 1Q22A 4BBPA 3PQCA 1ODFA 3F49S 4XB2A 1FQWA 4ZREA 4YCMA 3AHFA 3L7MA 3UMRA 3H16A 3QKUA 4S2EA 3ILSA 4F9FA 2YHBA 4DCUA 2DLNA 2GJ8A 3A10A 4WLVA 2WPNA 4C2AA 4QVGA 4F5WA 1EVZA 3GCGA 4GI3A 1NF9A 2WJVA 2DETA 1HDRA 1O54A 3CA8A 4IG4A 3WP0A 3RSFA 2XW6A 4OQEA 3UH1A 5FLXA 4OFXA 1GJRA 4ER3A 2UVPB 5FLEX 1CEQA 1NYTA 3LXRA 1CQIB 2Q3LA 2PZEA 4YJFB 5FFNA 1JSCA 1PW7A 3DE4X 5DYGA 5B64A 4MW0A 5HUQA 1HX7A 1T3TA 1NW9B 5AKGA 5H59A 4DLWA 4OX9Y 4QELA 1GO2A 4JSRA 5C8DA 5I4IA 3HSKA 1FRQA 5CLJA 1FJHA 3KUUA 3FUWA 3RS3A 1SG6A 3KZMA 3PQDA 1SMKA 1GCIA 1GILA 3ILHA 3ZHUA 1SOWA 3LC7O 3NW9A 2K5UA 1P61B 4BZPA 4Q03A 1SVWA 4QUIA 3BA1A 1PL8A 3AL2A 4IDNA 3W3AD 2ONYA 2I2BA 3PNQA 2MWMA 2IZ7A 5K3BA 4YQZA 1BA3A 4PSUA 4MV4A 5DIFA 1H42A 1KORA 2GVDC 2X8WA 3VA7A 4J9UE 3H9CA 1H0SA 1XZEA 3O21A 4RE5A 4RVHA 2VH2A 2PUEA 2QY6A 4DQUA 1KIMA 3FAZA 1XMSA 4OP1A 3VPXA 5T6BA 2IIVA 4BNDA 2DHRA 2XYPA 1EFVB 2QLBA 3DCIA 2JFHA 1V7ZA 3FWKA 3H13A 4L28A 4D9HA 4QZVA 3GFFA 3ZQ6A 2Q7DA 1GPAA 4EUKA 2CVFA 1GHTA 3KUDA 4TTPA 1JKJA 1Q3HA 1H2FA 1GR0A 2FWRA 2C94A 3FI0A 5AM5A 1CE8B 3R7FA 3OMLA 4B3FX 1NMYA 1SHTX 4E88A 3PHJA 3BCSA 5ES4B 4TLMB 3YASA 3LT5A 1HQYE 5GONB 1R1DA 4WOPA 5BMVF 3AHEA 4GEGA 3MMNA 3CIOA 2VXOA 3VO2A 2GK6A 1XF1A 1G66A 4H0NA 1FNDA 4M1ZA 3W5SA 2DCMA 3K6JA 1SHKA 2Z56A 3E3LA 3CNLA 5EJGA 1FRZA 4WNAA 1LBEA 1Y1PA 4BFUA 2F1RA 1G291 2BFAA 1EAYA 1IN7A 3STHA 1NVFA 3RWOA 1A7UA 3JQBA 4GOOD 1OTYA 2HA7A 13PKA 2KB0A 2FSHA 3C7AA 5JNUA 1ZCAA 3VZSA 3O2JA 3DV9A 4WGGA 3V7UA 1I7LA 1IZZA 2WWFA 4JKYA 2ZI4A 4JSYA 2LIPA 2DBRA 1QDLB 3QUTA 4QLOA 4UAJA 2PX0A 3QPAA 4DSAA 4HPXB 2WTBA 4F1KA 2W43A 5JATA 1QTQA 2NU8B 4F3KA 1NVVR 3G7SA 4ITVA 4OQZA 1R6XA 1KSHA 2DQYA 2A78A 3ZTTA 4P5EA 3CM0A 1OH6A 4K0KB 3L8FA 4M9CA 4YAKA 2QYTA 3G2KA 1YCDA 2GBLC 3ZCVA 3ZCTA 3K6RA 4HBGA 5KYKA 4KFCA 5JI3E 4I55B 1M8FA 1YZTA 2GYVA 3ASUA 2GEUA 2XLCA 3TRIA 4DNFA 3COVA 1WUJS 4FDUA 3GO4A 4H1HA 3K4PA 4LOKA 3GY0A 3BBPA 5FD8A 3G2QA 2NUPB 1C3EA 4L7VA 4Z54A 3Q8XB 1I13A 1WWKA 2NZVG 4V2IA 3LLVA 5AW9A 3N6XA 1ULTA 1V5WA 2QQ0A 2FP3A 2DUMA 2QENA 2FCRA 3I53A 3IQZA 3PXBA 4Q3BA 2D1YA 3H2IA 1FFEA 1P5HA 2YVKA 4XPIA 1CFJA 2O14A 5IAKA 4MLCA 1DTSA 2QUAA 1AKNA 1IY1A 5LP6B 4EQ6A 1H0HA 4FOTA 1E63A 6REQA 2A0KA 4EZIA 2W5UA 1E6MA 3KCNA 1AT1A 2XWSA 1XTUA 4NDZA 4BX9A 2ODQA 1YO6A 3GRFA 3E27A 3MRSA 4D9EA 2IXFA 4Z9FA 3OZBA 1XPUA 1EEHA 3QUCA 3D6TB 1G4AE 1WHTB 3ESZA 5EJ9A 2BKEA 2V0NA 3VV2A 2FSSA 1B0ZA 2VRNA 2WUFA 4NBVA 2FSIA 3EY9A 2PM8A 1NYRA 4WCVA 1KL7A 4FX5A 1H1DA 3SHQA 2XMZA 2ONJA 3DR5A 3DXFA 1RPAA 5AI6A 1YVUA 1EFLA 2X76A 1ZSVA 4B6SA 4KPYA 3ZGLA 5C7OO 1YE5A 2B4TO 1Z6XA 1IB6A 4EW2A 1W2WB 3TZ6A 3VR3A 4EDFA 1XEWX 3VU3A 3N74A 2TRSB 4I4CA 3INRA 4TKUA 4YRGA 2YNMD 4IS2A 4PHHA 4KIJA 1L9XA 1P77A 4ZT6A 3RE1A 4BJ5A 4CDGA 1VB5A 3M4XA 2C82A 1E60A 3UM9A 2Z2KA 2B7CA 1N5KA 2F3SA 2I2FA 2ZR8A 4KVGA 3VR3D 4KUEA 2FEPA 4AKGA 4NPHA 2EZ4A 1I4DD 4RTLA 4F1WA 5J58A 1VE6A 3O8LA 4RXUA 5HKLA 2X0NA 3BWXA 1C7JA 1P1BA 1SXHA 1RI4A 2NNLD 2PO5A 3EPRA 3GJ0A 3OWXA 4IBOA 3KSMA 1Z4OA 5AW5A 1TQ8A 1DRUA 3LKDA 3MGGA 2R2GA 5AKEA 4CQLB 1KQGA 4M22A 2OB1A 2HMWA 2XTNA 5B2FA 6Q21A 1Y5IA 3QM1A 1RHJA 4ZK6A 1YT5A 2VJDA 4GEKA 2JI4A 4EI2A 1PKXA 1XU9A 5D7BA 1ETUA 2D59A 5H3CA 2HDNB 4LJ9A 2XZPA 5GJWC 1S0UA 2CVOA 4QBGB 3HJTA 5A3VA 4NABA 1RADA 1TUBB 1GR1A 3AR5A 4MVJM 4XX0B 5T3UA 4K8OA 4P33A 5LZ2A 3FUUA 1BMFD 1VIDA 2R62A 4EP1A 2EBHX 4RHEA 1JR3E 1NUTA 2HADA 4BVGA 5BN4A 3BGOS 2BT4A 5AVYA 3DGEC 4R5MA 2ACEA 1SFRA 3QBVA 3TTTA 4F8YA 3RUHA 3MK31 1AZTA 1QFSA 2W4IA 4YDSA 4EY5A 1JTFA 1YACA 4BGIA 1SXQA 2YCBA 3I58A 2QLMA 1DEXA 3LDAA 1MRZA 3KK0A 1VBMA 5L4NA 3N58A 4DMGA 1NQXA 1UC5B 1QF6A 2ZYHA 1GY8A 1PWYE 4UAVA 5FIUA 1OFGA 2ZJZA 3HS3A 4EMBA 2VDOB 3KJXA 2Y76A 1A5TA 4JNKA 3ZDRA 3TOZA 2RK6A 3VBCA 5IAJA 1W0CA 3D7KA 1G3RA 2B1RA 4MYDA 1D2EA 1D2RA 4UTOA 4DIOA 1XWFA 3RRBA 1JJBA 1OGIA 4JFRA 2QL6A 5JOQA 2HSZA 1DUVG 2DPMA 4F5YA 3U4AA 1GAWA 3GT3A 2G80A 1YAJA 3B5IA 4FZRA 3R3XA 4WA7A 4LDZA 1Y8RB 4BRZA 3BH7A 3VH2A 4LRTB 2OHFA 2QM8A 3A1NA 3GEDA 2VDKB 4JDPA 2O1EA 1RI1A 4JI5B 3P19A 4S24A 5F73A 4CL3A 2LDBA 2YXLA 3OIDA 2HJ9A 3NORA 5C1DA 3A3OA 4JP1A 2VDQB 1T2VA 5LL6P 2DXIA 2A5JA 4B4KA 2CLHB 3W78A 1Z9BA 2J6IA 1JDBB 3CEAA 1XZGA 1JW9B 1R0ZA 1ZNWA 5CA0B 3KB8A 2I4LA 4FGLA 3D59A 3ZWKA 2HDWA 1VCNA 1GUBA 3ZWQA 2ZUSA 4B43A 4C03A 1RAHA 1WDLA 2HJGA 5EJMA 4WX2B 4B6QA 4FIZA 5IBQA 4DR4B 4X94A 2Q6TA 4JJ8A 1BXZA 4LHYA 1IK4A 2H9YA 1OFUA 4YVFA 1O94C 1Y9JA 3NRBA 1J5XA 1W47A 3C3XA 3E1KA 3DOIA 3WKDA 2EFHB 5A9SB 3DDWA 1JQEA 1Y34E 3CPEA 4ODIA 1U5CA 4TMYA 3W9SA 1UOPA 2X0RA 4ZAYA 5DW0A 3W5HA 4B46A 3AUSA 1T36B 4IFEA 1CX9B 4YDRA 1JLLA 4GRIA 4G5YA 2IW3A 4AQDA 1SU4A 4M8LA 3HSYA 4YBRA 2ZPUA 1HFKA 2ZIAA 5FXMA 3WLOA 1SZCA 4JXZA 5DF1A 1OLUB 2Y92A 3RKUA 1WSAA 4PC2A 1L4UA 1QO0A 2R6R1 3OURA 3VSAA 1UJ2A 2GJKA 3ENNA 5GIOE 5K3OA 4AI6A 1KKUA 1T5LA 3N05A 3ZHSA 1TD9A 5LJLA 1VMAA 2GHTA 4IRMA 1QTRA 1H2AS 1DX6A 4GRAA 1E1CA 3N3BC 1QO0D 4D9MA 5AKYA 3R3JA 1RMYA 4C06A 3O4FA 3L7CA 3BDVA 4BJ3A 1BFDA 4BJ1A 3N2KB 5M34A 5AKXA 4GMGA 3ZGVA 1MABB 1DINA 1XRQA 5A0TA 3TKYA 1IATA 3OTWA 3Q7SA 2Q3HA 1OBCA 2D13A 3KDAA 4JKOA 4XB6B 5IMBA 4ITUA 2JFGA 3L1VA 2H4WA 2IZ0A 3O4IA 2BFBB 1A2QA 3I04M 1DUSA 1VE5A 2D5BA 4MVJE 2HU5A 1PK9A 1IB0A 4OLAA 5HE8A 5EKXA 3T5TA 5FOQA 1N2OA 4H3KB 4GOMD 4D25A 2Z0MA 4UQLA 1SD1A 3KE9A 4BX3A 3X1WA 1TM2A 4Y2JA 3TLYA 1PSDA 3AI3A 1C14A 2G04A 2GBLA 5EJIA 3UVEA 3BF8A 4UHFA 4V0QA 3O7MA 1K88A 3O92A 1FBTA 2Q4EA 1HNZB 1GCOA 1EEXB 4PBSA 1IU9A 2IU6A 1S2OA 3OOEA 4Y9RA 1R4MA 3AEUB 3SF8B 1QAMA 2F1OA 1GKKA 1Y1TA 2I65A 2QPOA 5DM60 2R85A 1AKYA 1XJQA 3IV7A 3TLZA 4E22A 2E3JA 4XIGS 1SCAA 3IPLA 4CL0A 4Q82A 4LVOA 2QZSA 4QEZA 4E5UA 1BGXT 3WQBA 6ADHA 4J0EA 4PQYA 4F86A 5AOVA 4LHEA 5H82A 2ECQA 3EB9A 4ZVNA 1N57A 2PUGA 2JLCA 1IZ9A 3QF4B 4DDWA 3PT5A 4DMCA 4RZXA 3DEYX 5A3QA 4URUR 2D00A 5BR7A 1G7TA 4JLUA 2C4HA 4KXYA 3AO0B 2J59A 4BVJA 3PR2B 2BDTA 1WMDA 1UXJA 2J7PD 1NTRA 4PS0A 2OAQ1 4PAWA 4XJTA 1RJWA 4O3FA 4YLGA 3A25A 5LQNA 4HGYA 4QXOA 1HE5A 1LFAA 2FDXA 4M1OA 4A8TA 2B5WA 3L6DA 5ERGB 4X90A 3KQVA 4NH0A 1WHSB 4XR9A 1H9AA 1DT3A 2ZRLA 3BZBA 5CVJA 1SCKA 5DU2A 4TMWA 3LK7A 3KOUA 1UK9A 1PJCA 4H60A 2VDNB 4E7PA 2XWBF 3FNBA 3PX3A 1TAHA 4BV3A 4HQ0A 2VDJA 1CC1S 4X54A 4CKCA 4XX1A 5EUBA 3SEZA 3BCRA 1XQ1A 4XRGA 3U5TA 3R4VA 4WQMA 3NBQA 5F9FA 1RI5A 3SC2A 4CJXA 3BE8A 4CMIA 5K0JA 1JS1X 1JSZA 3TFQA 3MJTA 1ANKA 2VPXA 3U0VA 1VKJA 4F2PA 4PICA 4X91A 5CTJA 5JSKA 4X64B 5BP7A 5F21A 2EAUA 3HU3A 5F1OA 1JHMA 2OZEA 1JU4A 4QHYA 4OK3A 2V9PA 2ZCJA 4Z9YA 2VI5A 3B5JA 3V7WA 3WNQA 4D99A 5KNDH 5F2NA 3S29A 3ACDA 3SXPA 4OHKA 2BIFA 4CF5A 1XRPA 1U9JA 1C8VB 2JIZA 3AHJA 4OOEA 5K0LA 2GESA 1IJEA 3VUFA 1XZIA 5B4VA 3U44B 3IBCA 1QCYA 3Q2OA 1NNI1 2FFQA 3GFGA 1OWOA 4LHZA 4EOGA 4D9KA 3OKAA 4OQNA 3B70A 1FIUA 4C1NA 5TQ0B 2QVXX 4FQ8A 4IHAA 3TL3A 4FUQA 3ZVMA 2VTEA 4LDRA 2OECA 1P9WA 3RWBA 1OA0A 3Q9SA 1KMHA 4BPRA 3DB1A 3G23A 2X9LA 1WRBA 2JJ8A 2O48X 2L69A 4HDOB 1FP4B 4K05A 4UBMA 4BATA 2G77B 4COKA 2X4GA 2RHRA 4EG7A 1TGYA 3W2GA 4A03A 1AMNA 1SXIA 1GQFA 1VGQA 3JPWA 2VTBB 5DM0A 4RHYA 4ES6A 2OM2A 1RFLA 1CQZA 3IAHA 5CVVA 1O9GA 5JEDA 1J5EB 1YTUA 2GNPA 4GKAA 5K0SA 4R2HA 4CM9D 5JJKA 1ZWLA 2BGLA 4AMZA 2BH2A 4GMDA 2I2AA 2VNKA 1KOFA 3DWFA 5B4UA 2UYYA 4YUZA 3GJ3A 5BORA 1WP9A 3DZCA 5BN5B 2G67A 3UB2A 1YBAA 2Z30A 4DJFC 1IDOA 3ASVA 3KQSA 3L18A 3G5TA 1KHTA 3KM0A 2AUNA 3UQZA 2OO3A 2WZBA 4OJTA 3WKAA 2QMQA 3QKRB 3ZQUA 4GXRA 1UBRS 2Q8QA 2WTNA 4HNTA 1QP8A 2H11A 2Q9CA 4UZFA 1B76A 2FGJA 3G0DA 3ILXA 4TTIA 5D6NA 1IPFA 1RC8A 1JR4A 4TSRA 4MIEA 4UFNA 2O2XA 1WZNA 4ZDWA 4HAIA 1V95A 3AIOA 2BY4A 3GRKA 3WDLA 2RH5A 4XD7D 5KPJA 1DJPA 4WKGA 4CKEA 3FTEA 2OD7A 2OFWA 2A1UB 3GNTA 4OUDA 3D6HA 4Z51A 1DQRA 4JC0A 1Z0JA 2RJ3A 6NULA 3IAM1 1P5ZB 1WXXA 2ZAMA 1NJ1A 2X5KO 3AR9A 4FPXA 2Q0HA 2IKQA 5IUKC 2RGNC 4RD0A 3MLEA 1XELA 1MD9A 3LDFA 4HHEA 4YP9A 5ULLA 4E09A 4E5DA 4ZJYA 4Q4AA 2GSDA 1PS0A 1WTCA 2YQ4A 4OSPA 3A3NA 4LY0A 3S44A 1ML3A 3AETB 1CUBA 1IOLA 4A8HA 5TRTA 3H8SA 1O94A 4F96A 1Z18A 4CUZA 1ISMA 4YWHA 3Q8MA 2ZATA 5AHOA 1XVIA 2ID7A 4LIPD 5CLFA 10MHA 3KX2A 4G9BA 1EDZA 1X0XA 2WOOA 4YRFA 5HPYB 2VBIA 4CXMA 3GRPA 1KE1A 3ER9A 1W0KD 2WVHA 1U8EA 1YQWA 2RI6A 3IYLW 4FHDA 1ODCA 4LJLA 1IBCA 8AT1A 2DWUA 3KHTA 3FNRA 3C6BA 4HLNA 5DHTA 3T9DA 4JAVC 2IITA 3N2IA 4AZVA 3PX7A 2OC4A 2IDJA 3NIBA 5AM1A 4ZRNA 4DG9A 5JMPA 2VBGA 1G98A 1NVEA 4RKYA 3CLHA 2A9FA 1AD2A 1YIOA 4G4IA 4CLRB 5LKRA 4O33A 3CW2A 2XGGA 4CIVA 4GF5A 1BXGA 1J8VA 2HO5A 1JQBA 1RWMA 4FR0A 3W2HA 1E8DA 1OAOC 3CX7A 3MB8A 1V8FA 1ZIDA 1P4AA 2ZBGA 3QYPA 5C81A 2H2GA 5ENZA 2V7EA 1XI2A 2DE0X 2GPJA 5A0FA 3LBIA 4LGMA 4A2PA 4BCBA 5COAA 1J70A 3LD9A 1BCRB 4P86A 3CUKA 3DBLA 3SJZA 2G1UA 2OESA 1HEUA 1QK3A 2WMNB 6PFKA 3CPJB 3OPVA 4DN6A 3IAEA 1IUOA 1M1NB 3FKSA 2V1XA 3JCZA 1V0JA 3LFTA 4FFOA 3TF5A 2R8PA 2JJ1A 1YDEA 2XXBA 4B71A 3NNNA 1MTOA 1RMTA 4QWWA 1PS8A 3H19A 3FKSD 4JLBA 5EJ4A 4LQDA 3G9TA 4R9NA 2XUQA 2JJ1D 4IZOA 1OPXA 4P4UA 1TJYA 4R54A 3TINA 3Q7RA 4TV9F 2H52A 2VLIA 1VLHA 4RA6B 4BO4A 5K99A 1QYCA 1V16B 3LGAA 1LF0A 4HFRA 3MWGA 2FX3A 3AERB 4HX5A 3SLRA 2KLBA 4ARAA 2VDUE 2FSUA 2ZRCA 3KEMA 3PQ3A 2AJBA 1TXGA 1E1DA 4KK4A 3BAZA 4MEAA 4TTQA 3RIXA 4ZI7A 5BUQA 1Q6ZA 4YRTA 3HEMA 2IV3A 1RQNA 1GVNB 4JMPA 3DMHA 1RAFA 3ZY4A 2PD6A 2EZ8A 3TLXA 2R6DA 4PIMA 2PD4A 1Y7IA 1KIAA 3CF4A 3EIFA 1YIDA 2GCOA 4QOEA 4XIJA 3P2OA 3UT0A