3VHLB

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKNCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 8
publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vhlB00
4PTLA 3EPHA 3FMFA 2ZVPX 1IN5A 2Q9CA 3BE4A 4GFDA 5SZHB 1UM8A 4TN1A 4DLYA 1AGRA 3LH5A 4OJQA 2EWVA 4ZI3A 3ZVMA 1VYTA 4DT1B 4AK9A 1Q12A 1N5KA 3B1XA 2XEXA 3GQBA 5DYGA 5E3HA 4C2UA 4NYJQ 1E9RA 2CL6X 1MO4A 1QDEA 3BB3A 3EA5A 1OH7A 2HLDA 5FI1B 3ZDQA 1N0UA 3D8BA 1NJGA 3V4FA 1U8ZA 3OEED 2XZOA 1OFHA 5FFMA 4RJLA 3LQRA 5TV2A 2YWEA 5FUXA 3THYA 2IYZA 1Q44A 3HWSA 5EE1A 4N0EA 4EPTA 3WMEA 1N6LA 1P3JA 2NZ8A 1Q20A 2BMEA 4MYTA 2NO1A 3GLHA 4NDZA 5FBQB 2C95A 3IKJA 4U00A 1G17A 3K70C 1PVOA 3DKPA 1E2FA 3NVAA 2JGNA 2V3CC 1GAJA 2JLQA 4DJTA 3W3AA 3C4JA 2W0SA 4FCTA 2R6AA 4TZ6A 3P26A 1GVNB 2BBOA 2A9KA 4TMXA 2YZ2A 3DPUA 2BVNA 1DAHA 2ZREA 4QBGB 1A4RA 3K0FA 2GCPA 4NU0A 2JLYA 3SS8A 2XNSA 4FINA 5SZKB 4A6PA 3A4NA 1G3IA 1XBTA 1XD9A 4PPNA 4HUQA 4M21A 1NP6A 2AWOA 2G0TA 1LTQA 2V4ZA 1GNRA 2OUKA 3VFDA 1QHIA 4V02A 1Z5ZA 2D62A 1ZBDA 4E09A 2H92A 3QF4B 3I32A 4V03A 2JLVA 2FFQA 2RGNC 2O8BA 3ND9A 1EXMA 4LC1A 3NEJA 5JEDA 3QKRA 3K0AB 1TADA 4TYNA 1OIXA 2QENA 4IKEA 1W2HA 1YZTA 2GKSA 4H1VA 1NVXQ 3IIJA 4JL8A 4FI3C 1OKKD 2F1JA 2GJAA 2AWNA 3K9LA 5HKKD 5EP1A 2VF7A 1XU4A 1EWQA 1KOFA 4LV8B 2I4IA 3KX2A 2AXPA 5DGXA 1S9DA 5H68A 4BECA 2IX3A 2HJVA 1CEEA 3PJRA 1KDOA 3KQLA 1GTVA 1W1WA 3GJ6A 2BEJA 4KYIB 3AUYA 1QG4A 2JLSA 2UZ3A 1DVRA 4DB4A 1NMXA 1N6RA 2CK3D 2H5EA 2VF8A 3NHAA 5DYIA 2QQEA 3UMSA 1TEVA 1HEIA 3ZD6A 3WBJA 4HATA 5DO9A 4AY2A 3B82A 1D9ZA 2ZI4A 1W0JD 1E4YA 3QBTA 4Z54A 1C9KA 2W6JA 1KJZA 3SU8A 5AUPB 3K9GA 2RCNA 1KMHA 2VEDA 1F48A 1KDRA 1NRJB 2ORWA 5G40A 2O8DB 5J47A 1CP2A 1KI6B 2ZRAA 2ZSBA 3U6BA 3Q5EA 5C46F 1M1YE 4DLUA 2ZR9A 5DIFA 1OKKA 2F43B 4MUBA 2ERXA 5HKKA 1N6IA 2R44A 2XXAB 5KNCA 3OAAA 5FTJA 3FPAA 3AGPA 3IEVA 4C7OA 2PCLA 5AWFC 4KJZA 4FMCF 4AURA 3W3ZB 4OK5A 2WPDD 2QT0A 3KKMA 3PR1A 1OXUA 2O0HA 2CK3A 3AKDA 3FHOA 1HE1C 4QJ4A 5F9FA 1ETUA 1TX4B 1WE2A 4Q02A 1Z83A 4IDPA 4Q48A 4ZIRB 4LHWA 2D2FA 1D2EA 4LUCA 5LD2B 3AVUA 2OFXA 3BH7A 1W36B 3B9QA 3OESA 4R7ZA 4BFTA 3GJ3A 5HZKA 4TZ0A 1SXJA 2ANCA 2ZUBA 2HEIA 1O3YA 3MWYW 3KXKA 1E0JA 5G53C 3A4MA 1AKEA 1F60A 3GLGB 1UKZA 1YR9A 4QOSA 4LI0A 4A0GA 4YC7A 2WJIA 4B43A 3GFPA 4AKHA 1IN7A 1R0WA 2QAGA 4NPHA 2RGDA 1EFRA 4IRUB 4P4SB 5AJXA 1KK3A 4XD7D 3RVBA 2L0XA 3EX7C 2BWJA 1RYHA 2V9PA 2R6FA 2F55A 3EZFA 4HYYA 2RAPA 3RC3A 1RVDA 1ZM9A 1YR6A 2A7QA 4FCVA 1KI4A 2EW1A 3U7HB 3B78A 4YXWA 1M7GA 3GJXC 2YJTD 2FNAA 3BFVA 4TLDA 5TARA 2CCJA 2HDNB 1X8LA 1W2GA 3QXJA 1Y3AA 2FOLA 4RFSA 1ZM2A 3F8TA 4A9AA 1SHZA 5L3SA 2XTMA 1XZPA 4QRHA 1TU3A 2QMEA 4K46A 4C0AC 3RS3A 1XD2B 4NYIQ 3BAFA 2MMGA 3RHFA 1Q22A 3HP1A 2FDCA 2P3SA 4CEHB 5IK2D 2ZUDA 4LWZA 3C7KA 1WXQA 4XD7A 3TIFA 1TUEA 1HT1E 1XXHA 4IVRA 1N0WA 1KSGA 1G8PA 3U3OA 5BWMA 1JPNA 4NCIA 1NVVR 1SVLA 1ZINA 3FKSD 4IOLA 3ASYA 1IJFA 4XWOA 3FB4A 4OI0A 2VYFA 3CF6R 4BLSA 2EYQA 3TH5A 2J46A 1Z0KA 1KO4A 5G3ZA 3VAAA 2JLUA 4JKIA 2DFLA 2DYKA 1W7AA 2ZRFA 3T12A 3OIYA 1Z0JA 1SQ5A 2P6NA 3H86A 4C30A 2GRJA 1TQ2A 2ZPTX 3LWNA 4A2PA 2AR7A 3SJBA 5BN3A 3OIVA 2G77B 1LW7A 3DL0A 5IK2A 4Q7KA 2FE4A 4Q4JB 5KDLA 1W48A 3CRVA 4EPXA 5KU1A 2E9SA 2IUTA 3U3MA 3V00A 5ELXA 1E2PA 5EUQB 3L0IB 3PEVA 4OQMA 4BWYA 1JI0A 3LAWA 3LD9A 3MUFA 1VYVA 4Z1MD 2GAOA 4UXJA 2NOAA 3I73A 4TQAA 1N5JA 2GXQA 3K0EA 3KKNA 2IYSA 4KFSA 4OQNA 4JVMA 1NY6A 1MO6A 2Q9BA 2YWGA 3EZ7A 5JRJA 1PV4A 4B3GA 3AVTA 4PSVA 2V1UA 3EASA 5JCPA 3SJZA 2PCJA 2YWFA 3EC1A 2ZE5A 2MSCB 3AF2A 4Q7LA 3L8YA 3P27A 1N6KA 4DSUA 3K0SA 2ZJ2A 3PXGA 3EIEA 3EPKA 121PA 1JR3D 3VX4A 4BLQA 2PMDA 1UADA 1VHTA 1Z6YA 3FFBA 4BFSA 2DY1A 4A0HA 3IQWA 2GHIA 2QTVB 2DFTA 1XTIA 4ZCIA 2ODNA 4Q5IA 4KHZA 3SFZA 1YVDA 4PANA 4V0NA 1KY2A 4R98A 1Z6AA 2CNWD 1IY2A 4IHQA 4KBFA 3RS2A 3NDPA 421PA 2G0NA 4HAZA 3AP3A 3U60B 2RHMA 3CPEA 1FW6A 3MRSA 3ZD7A 3BORA 3GMTA 4ZDIA 5BXQC 1Z22A 1ZJ6A 2XB4A 4QHYA 4TL6A 2RGAA 1NKSA 1Z63A 2VSOA 2JLRA 3N2IA 5JHHB 2RGEA 2B7CA 3B7GA 4MQBA 2O8FB 1FQJA 1P75A 3KTAA 4M9ZA 4DLWA 3CZQA 4DCVA 5JZVA 3WY9A 3IO5A 1JR3A 1GP2A 3I8SA 1V5WA 2BOVA 2PEYA 2WWHA 2Z5FA 3KKOA 3CH5A 3I92A 4JJKA 4M9QA 1G5PA 3KFXA 1UJ2A 4ASUD 3CRQA 2F1RA 2IXGA 4QNMA 1RJ9B 1QVRA 1JEDA 3CZPA 1WBBA 1E9FA 4XWKA 1R5OA 3SI7A 3THWB 2ASEA 2ZE7A 4OQFA 4DLTA 4XVRA 1G16A 5CK4A 4F7WA 2ODWA 1N6NA 1WF3A 1XD8A 3CF2A 1OF1A 2IHYA 1NN5A 2WJYA 5AJWA 3W90A 4OHWA 4A8JB 3LDAA 3QPUA 2BMDA 3QKUA 5FL7A 5D3MA 3GD7A 2HCJB 4IFBA 3FOZA 1NBMD 3D6TB 3FVQA 2YC4C 2OBMA 4XWAA 1A2KC 1MH1A 1CKEA 2V55B 2VP9A 4PAOA 4G5SA 4M0LA 4JT4A 1N0VC 2EFHB 1P9RA 3I61A 3WYFA 3W9YA 1Z3IX 4CT5A 4BEBA 4EFMA 2ZRMA 2FZ4A 4Q00A 1G3QA 2D7CA 3BK7A 4PQFA 4EQ6B 3RANA 4R2HA 5JLJA 2H57A 3UMRA 4ACBA 1T8UA 1QHHA 5KSYA 5IRCD 1T0JB 1RW4A 3S1AB 1ZD8A 3QPVA 4JS0A 3BH0A 3BS4A 3TK1A 4A82A 4I81A 2FH5B 4W5HA 2CLCX 821PA 1XMSA 3BRWD 2XB2A 4OQXA 1X1SA 2V6IA 4OHYA 2MMCA 3GJ8A 1D5CA 4PAMA 1ZD9A 3KUDA 1CR2A 5CM9C 3ZGXA 3L2OB 2OSBA 1KI3A 1CTQA 1MR3F 1NBMA 2CLSA 3NBXX 5GJVC 5JWHA 4GNKA 3UKDA 3O8RA 1OH5A 3BGWA 1E9CA 2F1IA 2VTKA 5EE0A 3RS4A 3AM1A 2JIZA 4E22A 4A1FA 1V43A 3R7WB 3BBPA 4MYUA 1E6CA 3KJIA 3MJRA 1W5TA 1H8HA 1EFTA 3P4YA 3T1OA 1LV7A 4HZUB 2ZJOA 3I4LA 5AJVB 4C0SA 2XZLA 2C77A 2GJKA 3EWAA 4LYFA 3I72A 3AVXA 3FYHA 4DT1A 5FTLA 1R0ZA 5AUNB 1OIVA 4JZKA 4RKEA 2PT7A 1XB2A 3DMDA 3TKLA 4B2PA 4D0GA 1BH2A 1S3SA 2Z6VA 1EESA 1XEXB 5H8WA 2OXRA 4B2IA 1MKYA 2IC5A 2REOA 3NXSA 1II0A 3QENA 4US2R 4DIEA 1DEKA 2BHRA 4DLSA 4DZZA 1E9AA 1KIMA 1F2TB 4QM6A 3C8UA 3B1WA 1WMSA 1IAQA 1KSJA 4HEJA 3WBKA 2J5XA 1MO3A 4LV6A 4I4LA 1HA3A 3TQFA 1C1YA 3RS0A 3UK6A 4G5QA 4GOKA 1RE0A 2YWHA 3EZ9A 5JWRA 2KSQA 3K70B 2QBYB 1GFIA 4RVCA 1NKTA 3P32A 2ZEJA 2WV9A 4HDOB 4UNSA 4NHOA 2GA8A 1JJVA 3GCGA 1PLJA 2CMKA 2OZEA 3FWYA 4LBZA 4MYCA 4ZCLA 3WNCA 4D0LB 2CHVA 4HDQB 4PC6A 4B71A 4IEEA 3M0EA 3U44A 1Q1BA 4DDUA 4B48A 1Q0UA 4EPWA 3PG5A 3MCAA 1COWD 4KSCA 2JJ1A 4TL9A 5B30A 1ZMXA 1G5TA 2H18A 1WRBA 5CIWA 4PPFA 1G18A 2ZI5A 3IIKA 4KLNA 5CYPA 1FX0A 1KI8A 4URXR 3K0AA 2YYZA 3GLFE 4JYBA 1NG9A 1RRPA 2GF0A 4D4JA 3LLMA 5JMTA 4O0MA 2ZI6A 1WQ1R 2QNRA 4N1AA 4A0RA 3AF4A 3D3QA 4IXNA 2IS2A 1XF9A 5GADl 1DAKA 2W2XA 4GP6A 2FGJA 4RD3A 4NCNA 4DLZA 4QC2A 3RSLA 3K8YA 2BBSA 4XTRA 2AKAB 2LCFA 3EA0A 3P20A 1N6HA 2J0QA 1OLOA 1OHHA 4JL5A 1AQUA 2RH5A 4B33A 4AD8A 5C4MA 3SJAA 1Q21A 1I2MA 1COWA 4RZ3A 1Z28A 1QHYA 3IGFA 4AKIA 1W36D 4URVR 1SKQA 3QKSB 3W5IA 1G4AE 3NC1C 3M6AA 2GILA 1CS4C 1JBKA 4FMDB 4LRWA 1KI6A 2O8DA 2J3EA 2IUUA 8OHMA 4OI2A 4RD6A 2FSIA 3CB4A 1LS6A 3Q72A 4V0ME 1AZTA 5KHOC 2P6RA 5J4YA 2XXAA 1EFHA 2AKYA 5FH9A 2QGZA 3K53A 5KNBA 2AXNA 2VLIA 3W6OA 5L3QA 3V4RA 2JDIA 2H1LA 2XSZA 4ON9A 3HYRA 4BLRA 4LJ5A 3B8HA 3GFOA 3I62A 4E03A 3IPYA 4TMWA 4KFRA 3TLXA 3ZIAA 1E9DA 3ZYCA 1KDTA 2D7DA 3I5XA 2QT1A 2D74A 2QMUA 2ZANA 4ZIRA 2O0KA 4Z51A 1T91A 1R10A 3MD0A 4OL0A 4JBXA 1G7TA 2QAJA 1ZNXA 2QTHA 4JBWA 4II7A 5JSZB 3GLIE 3IO3A 2WWXA 4F91B 1KK2A 2REBA 3CWQA 1NSTA 4HLUA 4LSGA 1W47A 5CDFE 2J59A 3GLGA 2IYTA 2ZS9A 3AVYA 3DZDA 3C41J 3Q5DA 2IYRA 2VSFA 1GDDA 4IFEA 2GNOA 1T3HA 1XJ0A 2CVHA 4P4SA 1E1QD 4PPGA 1SXJC 3IUYA 1XPOA 4I1VA 3ZVLA 2EFGA 1WB9A 2ECKA 4JLMA 3TQCA 4EFNA 4C0HA 4MDFA 4A15A 2PT5A 2IL1A 1S1CA 3RABA 1GKIA 1YKSA 2FEOA 1G3MA 1BO6A 2P5SA 3PITA 2W58A 2ODEA 1GZSA 2BJWA 1FPMA 2QAGC 1VCIA 2OCAA 2D2EA 4EUNA 3HDTA 1X1RA 1BS1A 1MO5A 1MT0A 4BFZA 1EWRA 1G3RA 4NH0A 3SYLA 2JLZA 1E79D 4QGAA 2ZJAA 1N2CE 4PO9A 2O8EB 1QHSA 1X8KA 3FMIA 4H9GA 2FJUA 3SOPA 3LBIA 4QNRA 4UXIA 1XD2A 2RHDA 1HT2E 2D4HA 4ERNA 1XCMA 4M1YA 3KQHA 1I2DA 3ZZTA 4CEHA 4DBLC 4IJMA 4ZDKA 3SFVA 2YINC 3UG7A 1GNPA 3MJHA 2OCYC 1ZIOA 3OEHD 4CZ2A 1R5NA 2ZJYA 4M4SA 5DHFA 1H8ED 2JEOA 2FGKA 4PSKA 2XITA 5JCZA 4C0QC 1E2LA 2DCUA 4JLDA 4EJSA 1SVKA 2H8KA 1SULA 4CGZA 3TUZC 4L9WA 2YC2C 2WWWA 1OE0A 1D9XA 2G6BA 1ZM3A 2W83A 2FSHA 4W7SA 4ZO4A 5BYJA 1FNMA 5P21A 1E79A 5DSZA 5HE9A 2DR3A 1UBEA 1L8QA 3IPXA 1OB2A 4JLBA 2QRZA 2WKQA 5CB6A 3U6KA 5F9HA 1FFHA 3LFUA 4TMVA 1ANKA 4TLAA 1QHXA 2WIAA 2GEDA 4Q4JA 2FPMA 4I1UA 2FWRA 4A0FA 2AFIE 3GEHA 4KAXA 1FNNA 2HYIC 1D2MA 1IXSB 2F6RA 1CJTC 1ZC4A 5FUYA 2WIBA 2RGCA 3WP1B 1R8QA 1E0KA 1U90A 5EQTA 1H8EA 3LY5A 5EP4A 3ZH9B 2IW3A 5CJPA 4MUAA 4BLTA 4QBIA 4DSNA 1M6NA 3OEEA 4A36A 2EFCB 1ZU5A 2FX3A 1S0UA 1GG2A 2CXXA 3HPQA 4M1SA 4JYCA 3QXXA 2ZTSA 4POAA 5B57C 1NVVQ 4G0NA 1OSNA 4DB2A 1RRCA 4V0LA 3N70A 2B21A 1YRBA 4MRRA 3I5YA 4PHTA 4UQOA 4FXPA 4AIIA 1S4QA 3H1TA 3TSOA 1ZW6A 2GZAA 1TU4A 2OFWA 4Q7JB 4A92A 4BE7B 1E3MA 1ZP6A 4LBVA 3MLEA 1TL7C 4GSYA 4RZUA 2A5GA 2QI9C 3DMNA 1A7JA 1T3LA 1FP6A 3JZMA 1TPZA 4KYUA 2BCJQ 4LHZA 4P32A 4CT4B 4TL8A 2I1QA 4QHSA 3VU9B 4DSTA 5KO2A 3W8NA 3PEYA 1DO0A 2BM0A 4JLNA 4ESHA 3RLFA 2V8OA 1KYIA 4YDSA 2OESA 3CF0A 5J5CA 1QG2A 2XTZA 2F3TA 3CUEF 2UZIR 3KJGA 4QL3A 1SGWA 3SNHA 1WBDA 1KZGB 1US8B 1W0KD 2OEPA 1D8TA 3LW8A 4L9SA 3BXZA 1CJKC 4NTZA 3A4LA 4QGGA 3JVUA 4BRUA 1KY3A 2HV8A 4RZ2A 4ZDWA 2O8FA 1SXJE 1AN0A 2GJSA 2JJ8A 3SEAA 4D0NA 4KO8A 3VQTA 4C4PA 2C03A 4LX0A 4EPYA 2ZIAA 1DS6A 5FPYA 5FPSA 3HU1A 2C04A 4W9MC 1UKYA 2GCNA 5EXTA 2GCOB 4PR0A 3ADDA 1E2MA 5HCNA 3B9PA 3HJNA 4XH9B 3AVQA 1L2TA 1VG1A 3QI2A 1GL7A 3QQ5A 3THWA 3GLFB 1XRJA 3QXCA 1ZCBA 2PZGA 4NCHA 4B73A 4Q4LA 3SR0A 4QBHA 2JAQA 4A8JA 1W0KA 4Q9IA 4L5BA 2N46A 1W0JA 4LJ9A 4FWTA 2FFAA 1KI9A 1CJVC 1PLLA 5AJZA 4JVNA 4D2IA 1U8YA 1P2UA 3M1IA 1EX6A 1TUIA 2ZE6A 3NG1A 2P0EA 1XDBA 2ORVA 2IK8A 3CBQA 5IT5A 3C14C 2ATVA 2X1VA 1J7KA 2SHKA 3K0CA 4HAWA 3THXB 4ESVA 1Q3HA 1ZD1A 4PZZA 3AF3A 3MFYA 2X77A 2WSSD 1GILA 2GDJA 3FE2A 2FFHA 3V9PA 3CLVA 4L8GA 4EQ6A 3M4YA 3NIBA 4P33A 4GP7A 2JCSA 1XNJA 1MABB 1F2UB 5KTYA 3SJCA 3BB4A 3S1AA 3KXLA 1P6XA 1U9IA 2QRNA 4WVFA 4TL7A 5EP2A 1OFTA 4D25A 3LV8A 5E7JA 5C4GB 2ZS8A 4B3FX 1GRNA 2WPDA 1NLYA 1HQCA 4JVLA 5H1YA 2QU8A 4AKEA 2EYUA 2ZSFA 2OFOA 4LCBA 1XMVA 1N3BA 4C9BA 1KO1A 1OJLA 2DPXA 2CBZA 4GMXA 4KFUA 4QKQA 2DBYA 2ZRHA 3NHBA 3CRRA 1JPJA 1NF3A 4OI4A 1DAMA 2EWWA 4QM7A 3TNFA 3U2QA 2NO9A 1BYIA 4ARZB 1T9HA 4IOMA 4MH0R 2J0UB 1XTSA 4ZDJA 3R7WA 2QEQA 1ZNYA 4KFTA 5BQ5A 1QF9A 3WMGA 2KBEA 4TTPA 4BLOA 3K70D 5SZIA 1W4BA 5EXXA 4HZUA 2LKCA 3IBYA 1E2NA 2BBTA 1HY3A 3SDZA 3U3RA 4BFYA 4GL2A 1E69A 2PX3A 5JHGB 2ZE8A 3GLIB 2KWIA 3A36A 1TMKA 3OIUA 4URWR 2I3BA 3AV0B 3WXMA 1OW3B 2ZYWX 4DCNA 1E2GA 4LYJA 2FA9A 4F4CA 5G3YA 4FN5A 3BFXA 4TT3D 1SHKA 3QXHA 3KL4A 5JS8A 1ZC3A 2E87A 3CR7A 1ZYUA 2GJ8A 1YZLA 3PFIA 1R0YA 5DI9A 1F2TA 5JEEA 1ZRHA 5K8UA 2VP6A 1LNZA 4JIMA 1M34E 3IHLA 1OIWA 4N0DA 4JKYA 4FMBB 5FUVA 1W44A 4LJ4A 1E98A 5DI3A 4R9UC 1FZQA 1DAGA 1T4GA 4GT1A 2CE7A 3D7MA 4BFWA 2QBYA 2OV2A 1FUKA 3QJYA 4PQRA 1II8B 3OZXA 2GETA 1NJFA 2RMKA 4X8OA 1DELA 1KGDA 1DAIA 2G1KA 2PZFA 1QZXA 3E70C 1P7CA 4LYAA 2DWQA 3LX8A 1CIPA 1GRQA 4TMZA 3FKSA 1IM2A 4B76A 2ZR0A 1F5NA 2QGNA 4TTRA 1EX7A 1ONBA 2VL7A 2WOJA 3OIWA 3QVUA 1X6VA 4JMPA 2B8WA 3CNNA 4TT3A 2BDTA 2OT3B 4OHZA 2B6HA 1UAAA 1FP7A 3LVRE 1G21E 5HE8A 5LB2A 4NYMR 1N5IA 3T5DA 1CLUA 2DWPA 4MA4A 1KZ7B 1L4UA 4Q1DA 1CBUA 3NC0C 4Q4HB 2C78A 2WWIA 1G8FA 4EDHA 3Q3JB 4U02A 1A82A 1E2QA 1PZNA 4PSAA 3QG1A 4IDNA 4Q66C 5TVKA 3AGQA 2QA5A 4UXHA 4BZQA 4MITA 5KYKA 2JLWA 2HF8A 3H2YA 1P4SA 2CJWA 3GFTA 3A37A 1Z47A 5A5GA 3LRPA 1KJYA 2O8BB 4GPTA 4XVQA 2W00A 4Z1MA 3BWDD 1G5RA 4LHYA 3ICEA 4NZYA 5FR2A 5JJIA 3GP8A 4Q9HA 2XZPA 4UNQA 4L16A 5FPKA 4M1WA 2V54A 5JWOA 1CF4A 2GXUA 2MSEB 2ZXUA 4AYTA 5EE3A 1VCNA 1SVSA 1CR0A 2WKPA 3MG9A 3A1UA 3B6EA 3NH9A 3EZ2A 3SBDA 2YHSA 4IDOA 4PXAA 2ZUCA 3AKCA 3CKLA 3SQXA 4OBEA 5EJEA 2IHBA 4WZBE 3Q8XB 4L15A 3UG6A 2ZSEA 4FWIB 3FDIA 4C0BA 2A5FA 5FPHA 2X19A 4URZR 4Z8YA 1YZNA 1R4AA 2F7SA 1W4RA 2CNWA 4B34A 4TSFD 4Q47A 4PC3A 1NMYA 3B85A 4DDWA 3CX7A 2ZRDA 2C9OA 1XEWY 1W4CA 4MKHA 2WJJA 4BRWA 3F3YA 3BOSA 5F3WB 1XCPA 4JLAA 3VR5A 4YMWA 1BKDR 4LDJA 2Q3FA 2IT1A 3X2SA 1HQYE 2C8VA 2J1LA 3QF7A 2Q3MA 1RZ3A 3KKPA 1KTVA 4XVUA 4D81A 3QPWA 4AC9A 3U7FB 4CEJB 1YZUA 5JSZA 2N42A 5KUTA 5AUOB 3PUWA 4MRNA 1P9WA 1T5LA 2AK3A 2WOOA 3AB3A 3BERA 4F38A 5EXSA 4MKIA 2EVWX 2V1XA 4ASUA 4C0KA 4RFVA 2VH5R 3ND8A 5LD2C 4MRVA 4BGDA 4WW0A 3UANA 2J41A 2RB4A 3LNCA 4WOPA 3IIMA 1BOFA 5K8LA 621PA 2J7KA 3L8ZA 3NWJA 4X8HA 2FV8A 2DFKB 4FD2A 2PZEA 1SXJB 3EIHA 1XJCA 3CWZA 5K8TA 2ZM5A 4GBMA 4HLUC 3RRNA 2HXYA 2ZJ8A 3TBKA 1FTSA 3H84A 3R8FA 2VIIA 1I4LD 2IYVA 3MGCA 3K1JA 4NONA 3T34A 3B1YA 3TRFA 2IUSA 1T0HB 3ZZUA 2AD5A 5F2EA 3SYKA 2GXSA 4LJ7A 4ZI2A 1KI7A 3RYTC 3D31A 5LB4A 2PEZA 3CRMA 3U5ZB 2F1HA 1UF9A 2CDNA 3R8CA 4EAQA 2O8EA 3PVSA 3EG5A 1YJ5A 4Q4AB 1R2QA 3WHLA 3QEJA 4DLVA 5JS7A 5HTKA 5CIQA 4NCJA 4DRZA 2JJ2D 1IY1A 3C15C 3OHMA 2FPLA 1RYFA 3AP2A 1WCV1 2ZU0C 5G41A 4TLBA 3SE0A 3ADKA 1UBGA 1VIYA 4L4UA 4ILEA 4TYQA 2JASA 3A58B 2CCKA 2LKDA 3K9HA 3MWKA 2GESA 2RGGA 5L3SB 2HUPA 3RRZA 4A2WA 4LGMA 2ZETA 2QPAA 1S1MA 2A78A 1E2DA 2WHXA 1MRNA 2AHOA 3I3SR 3VR1A 3R9IA 5GJCA 3O8DA 1I4DD 4YMVA 3CONA 4H1UA 1XFAA 4LK2A 5FUWA 4ACAA 1CULC 4ABYA 4B44A 1GSIA 2G88A 1XZQA 2E1RA 5UKDA 2R8RA 4WZAE 1CJUC 4PHHA 4HUTA 5CITA 4EJSC 4B47A 3N2EA 3W34A 3VMFA 2PBRA 4ZPXA 4F93B 4FCWA 1VDZA 2GWHA 4PC1A 1ODFA 2O8CB 3DOEA 3KB1A 2PJRA 1R6BX 1TQ4A 4D82A 3ZVRA 2DWOA 1G20E 4DKXA 1E0SA 1AZSC 2VP2A 3GEEA 2ZSDA 4DUGD 1P2SA 2AK2A 2IXFA 3IILA 2CVFA 1CRQA 2VA8A 4ZCMA 1YRAA 4LOAA 1X86B 3B2EA 3LQQA 3U4QB 3EPJA 1GWNA 2V7QD 3EAQA 3X1XA 4PZLA 1NY5A 1WDTA 2OCPA 1Q1ZA 2OHFA 1MRSA 3QF4A 5CM8B 1JAIA 1YQTA 3QOFA 3NTUA 4EKDA 2QMOA 4Q21A 2QE7D 1U98A 4M9XA 2LWIA 4TWZA 4KI0A 1OFUX 3TSWA 2QM7A 4U5XA 3WNDA 3B1VA 4A4DA 4J0QA 1E1RD 1Z6TA 4XSGA 3NBZC 4WBSA 2Z4RA 2RGBA 3BH6A 4M1TA 1NVWQ 1RKBA 4AKGA 5TB5A 2B92A 1DAEA 2C99A 2QZ4A 3QBVA 4HI0E 3ZZ0A 4HAXA 3OFND 4E07A 4DDTA 3REGA 1IJEA 4QGFA 5E7IA 3VU9A 2NO7A 2WJHA 3VKGA 5DN6D 2WAXA 2ZVQX 4V0KA 4B6FA 3UWOA 3W8RA 1T3SA 1TEXA 2FPKA 4UNNA 3EZ6A 2QSYA 3DEFA 1ZM7A 2NTYC 1US8A 3PCRB 4PAQA 3E2IA 4RSGA 4C0JA 3UWKA 2IYLD 2QUZA 4Q1EA 2ZJBA 1Z2CA 2WWYA 4JSTA 2QE7A 1S2MA 3AF1A 4BLPA 3TW8B 1R8SA 4NBSA 1P2TA 2Q3HA 4YLGA 3A1VA 5AR1A 2B7BA 4IW3B 3ZS8A 4DLXA 4PHFA 6Q21A 1S9HA 2VHTA 1W5SA 2QY9A 1G8HA 3G82C 2F43A 4KU4A 1J8YF 4HB2A 5KSZA 3HYTA 4AG5A 1G41A 2GCOA 1UKEA 3WHKA 2WAYA 2J7PD 2HF9A 5EP3A 4Q9KA 5J4HA 4P31A 4CEIB 2ONKA 3HPRA 5DN6A 3KTAB 1YU9A 2CHQA 1HE8B 2V6JA 3B1ZA 4JBYA 1O87A 2NG1A 4TYPA 2CL7X 3CH4B 3CPJB 2ZR7A 1IXZA 3F5FA 1EG7A 2K5UA 4D4MA 2GJ9A 3N5CA 2ZI7A 1G1MA 4BQSA 1ZU4A 3H4MA 4GI7A 2P5TB 4RCZA 2P6UA 2A5YB 2WICA 3CO5A 3Q7PA 5FI0B 1VHLA 4A8JC 3THXA 3EIQA 4C2TA 1G291 1JEEA 5BYKA 2W6ID 3O47A 5ANRB 3VNUA 3W6NA 5JFGA 1OH6A 4HLCA 3A1WA 2GEVA 4QG7A 2OLJA 4B3CA 3AP1A 2KI5A 2R6CA 4NL4H 4BPBA 4HB0A 4U7DA 2W2TA 2WWGA 1VECA 3K09A 3K0CC 1AIPA 2OXCA 3AEZA 5J4KA 5FBVB 1ELOA 2IF2A 2P2LA 3QY0A 1QHGA 4LC0A 5FTMA 2FMXA 1ZIPA 5TDHA 3LX5A 1MV5A 3A8TA 3CPHA 5K8IA 3L82B 3UATA 4V0MA 2D3WA 4O25A 1R5BA 4HB3A 2ODBA 1GNQA 3X1ZA 2WTUA 4MKFA 1E0AA 1U9IC 3B5JA 4QBFA 4R71A 5FOXA 4DDVA 1DPFA 2ZQ5A 4Q01A 2ZRCA 1EK0A 4G5RA 4UKDA 2R62A 4C3ZA 1A1VA 4Q19A 3KQNA 2KBFA 2QG6A 2VP5A 2ZITA 3GLHE 1AGPA 4ARZA 2J0SA 4YONB 2J0UA 3GJ4A 2R9VA 4JJZA 3R20A 3R9XA 4LPKA 3OE7D 4RKFA 2WVJA 1IONA 4BZXA 4DHEA 3I1FA 3WRYC 1Z06A 2GBLA 1DOAA 1EFUA 1E1QA 4PC7A 4W5JA 5A0FA 4FW9A 2NZJA 1EFCA 2ERYA 5FOWA 4BASA 5CB8A 1G7RA 3O8CA 2WSMA 4DSOA 3GLIA 1U2RA 4MDEA 4MKGA 4LBYA 2ZRIA 3SC3A 2ZRGA 5IF9A 4IVQA 4O2LA 4RD1A 2PMKA 1X3SA 1JALA 2R6DA 2BM1A 5CDFA 3EXAA 4DEXA 4OK3A 5FR1A 3RRYA 3AQ4A 2OM2A 1U0HC 2FG5A 1A2BA 4F4IA 2GK6A 1E9EA 2A5JA 2HJGA 4LHXA 3CX6A 4IDQA 4M53A 2QP3A 4LJAA 2J9RA 1B0UA 2XTNA 1J99A 1Z29A 2QORA 2NGRA 5FOSA 3LVQE 1K5GA 1PUJA 1T6NA 5JI3E 3FHTA 1WA5A 1YZQA 5H70A 4AWXA 3HU2A 4BUJA 4CIDA 2X8AA 1YZGA 2ONJA 1J8MF 3DOFA 4X8LA 3OE7A 2KJQA 1JXOA 4A6XA 2FEMA 3BC1A 2IF0A 2VPPA 3DDCA 3F0TA 1TF2A 2RKOA 1II8A 1JNYA 4I1OA 3T06B 1JB1A 1C4OA 4WXPA 1GUAA 1AQYA 3DKVA 3C16C 3G0HA 3DZ8A 3GEIA 3OEHA 2ORIA 1E32A 5FOTA 2VHUA 3KJEA 4LZZA 3LA6A 3EC2A 3QXSA 5EE5B 4PO8A 2CE2X 4Y0AA 4C0LA 1HTWA 1BMFD 2C98A 3CNOA 1R7RA 1UDXA 2ZJZA 5EXPA 4Y0VA 1LF0A 3BIFA 1G64A 4HAVA 2ZYUX 3ASZA 1SZPA 4DIDA 3CIOA 2QP9X 4V0OA 1GKUB 5JRZA 2BMFA 2X2FA 4LJ8A 1UEIA 1B23P 4K81B 1NN3A 3AKYA 2PJZA 4Q4HA 1OXSC 1JQJC 2QL6A 3PV0A 3A1TA 3AVPA 4GZLA 2P65A 1ZVQA 1G6OA 5IDVA 1FL9A 3L43A 1XX6A 5FTKA 2F9LA 2W2VA 3KB2A 1J2JA 4MGIR 1SVOA 2TMKA 3U44B 1XEFA 1W49A 2XX3A 3QKTA 1P60A 1IN4A 2PH1A 1VYUA 2W6JD 5FBWB 4YMUA 5KNDA 2FSFA 4KVAA 1XTQA 5L8VA 1E2KA 1U99A 1FX0B 3RS7A 4R2IA 4D26A 4S2EA 1IBRA 3SHFA 2BKEA 5DNYB 1DADA 2QPOA 1BMFA 2XNDD 1T5IA 2IS4A 1KMQA 3W6PA 2CEAA 2OG2A 3QIAA 1TF7A 1GOTA 4MGKR 2EQBA 2PLRA 5EE9A 2NQ2C 3J81k 3OAAD 2G83A 1P72A 5J4VA 3PUZA 3U3KA 1N6PA 3VR3A 3RWMB 5FBLB 2NO6A 1U0LA 4Q18A 1LVGA 1P2VA 1G8YA 2Q9AA 3BJIC 4TMKA 2ZI3A 2J87A 3NBYC 4LY6A 5SZJA 2O52A 4N3NA 1NSFA 4CYMA 2FFBA 1EGAA 4P0TA 1NMZA 1ZNZA 2G9NA 4NYMQ 1DBSA 1OYWA 1U81A 5CK5A 1U8AA 1RJ9A 3TW4A 1RIFA 4Q7MB 1Y63A 4DC9A 1AM4D 1SXJD 3U3JA 2VP0A 1IN6A 4OJKA 4NE2A 3O8BA 4UNPA 4PC2A 1OXXK 4O2RA 3ZS9A 1G4UR 2XNDA 3GJ0A 2GAAA 3EARA 3TUJC 1UBCA 1XCGB 2KB0A 1G7CA 3SBEA 1TQ6A 3DO6A 4TMTA 1EFRD 2FSGA 3QSYA 3BFKA 1CR4A 2Q21A 5GJWC 5L3QB 1TTTA 4G3XA 4PHGA 4CEJA 3LXRA 1ZUIA 1NVUQ 2OILA 2IWRA 3CR8A 1XWIA 1N25A 2BC9A 4NKRA 4YXWD 1L4YA 4GZMA 2XJ4A 3PQCA 2ZAOA 2IYXA 4AYWA 1KNXA 2QN6A 4D4KA 1RFLA 1FOEB 2OE2A 2W0MA 4GOJA 4IOKA 2D06A 3W5JA 2C9YA 4EIWA 4EPRA 2GXAA 1FUUA 2VP4A 4MRSA 1XXHE 5LBIA 2BIFA 1AKYA 5L3RA 2YOFA 1QHNA 3FMPB 4Q1AA 1JJ7A 2BJVA 1AS2A 1Z07A 4MRPA 3AVVA 4NYJR 3REFA 1J90A 1NNEA 3T35A 2GK7A 2H16A 3G5UA 2A2ZA 1KDPA 2ZJ5A 4B2LA 1Z0IA 4OYHA 3B60A 5DISB 1JXMA 1KI2A 2ZRLA 3LBHA 3I8XA 3ZVNA 1G7SA 5KOYA 4TYWA 1YR8A 2JATA 4HZIA 4PQYA 1K8RA 1DO2A 4Q4AA 1X8JA 3VNVA 1E94E 1OXTA 1K6MA 4YQFA 1AS3A 4FMCB 2WSSA 2QPTA 1NI3A 1HUQA 2CCGA 5FOVA 3TMKA 2QMHA 1CRPA 4GMDA 2OLKA 4HSEA 3GPLA 1HURA 2AD1A 4Q1FA 4WAUA 3LBNA 1XPUA 2ZRNA 2WM9B 2Q6TA 4E5UA 1K5DA 1Q1QA 1LB1B 1M74A 4P4UA 1N5LA 4RD0A 4WIAA 1ZUHA 5KSPA 1XTJA 1UPTA 4URYR 3NEYA 1XEXA 4RD4A 3ADBA 4KBGA 4M1OA 3TAHA 4GRAA 1VCOA 4P4TA 3U7GA 3KZ1E 2WJGA 1XPRA 1E2JA 4TLEA 5E95A 1JR6A 5KPDA 2C2HA 2ZAMA 1CR1A 3RS5A 1Z6GA 2EFEB 2EU8A 2REXB 3VR2A 4HDCA 3X1YA 5AUQA 2PLFA 3VR4A 2DB3A 2ATXA 4DCTA 4KITB 3LO5A 1LFDB 4ITRC 4EJSB 3B13B 4A2QA 2O8CA 1SVMA 4G1UC 2CLDX 2F9MA 5F98A 1FTNA 5HR5A 1Z0FA 3KXIA 3AVOA 3THYB 1IN8A 3WRXC 3KUCA 1UBFA 1KSHA 2VHJA 3CX8A 3VR6A 1NLFA 1RPZA 1KK1A 2IXEA 2FN4A 5BN4A 2Q0HA 1Z2AA 4NP6A 1UKVY 3FHCB 3GLHB 3FKQA 2HT6A 4P3YA 4BFUA 1SKYE 5FTNA 3U4QA 1QRAA 2BKUA 4I99A 5JI2E 1Q1EA 3SYNA 4B3XA 1XTRA 3KDSE 3T1TA 1JQLB 2GZHA 3U7EB 4S35A 4WXRA 4CF7A 4XIGS 1NIPA 4CW7A 1UFQA 3MSXA 4Q9JA 5B58C 3K0FB 3ZLJA 1PUIA 1KI1A 2ZI9A 2ZRKA 1ZUNB 1U0JA 2RGNA 4B75A 1KHTA 4HUQB 1NG1A 3P1JA 2VHCA 1Z08A 4W5WA 1JR3E 4JLVA 5DH9A 3PUYA 1XMJA 2FF7A 4AYXA 2IS6A 1KK0A 3ZQJA 1Z0AA 2J45A 3JVVA 4KXFB 4HAYA 2WZQA 3OF5A 3E1SA 2Z0MA 2A3RA 2AX4A 1ZM4A 2OBLA 4JT2A 4EFLA 1II9A 1TF5A 4HAUA 2XJ9A 3H0KA 2EFDB 1L7VC 4LJYA 5EZ6B 1E96A 3NH6A 4IEIA 3QKRB 3T61A 3TUIC 4OQLA 1GKYA 2QROA 4M1MA 4WZ6A 3QNUA 2X2EA 2G3YA 2UVQA 3X1DA 5BW8A 2YKGA 4Q1BA 4RY2A 4XSHA 4EPVA 5HPYB 3DVLA 2H17A 2O5VA 1ESMA 3CRW1 3P4XA 4IDHA 5IHPA 4M1KA 1Z8FA 3PEWA 4PO1A 1XP8A 2WMOB 3QKSA 4JLJA 4JLOA 2J0VA 3AH8A 2IYYA 4URUR 4XTCS 3LLUA 3IEUA 2GZDA 1NN1A 3ECCA 1N6OA 1D6JA 2GEUA 5J40A 1YR7A 5FL7D 4JL6A 3GJ7A 1OT3A 4F92B 5KDDA 1U94A 4OK6A 1KMHB 1P5ZB 5CJ2A 2IYQA 1OB5A 2MSDB 4CEIA 1OFIA 3NBFA 4I1SA 4PX9A 2IA5A 4QHTA 2GVDC 3UPUA 721PA 2R6GA 2FU5C 2HXSA 5D3QA 4Q03A 3TR0A 1DARA 1NBME 3PIRA 1DAFA 4KSBA 2C9CA 1E9SA 4C7OB 1TAGA 1G9XA 1KO8A 2NO0A 4LHVA 4MGZR 1VPLA 3QG5A 1VKJA 1P62B 2HCBA 2IYUA 5GJBA 4O3MA 4PPQA 4JSYA 4OKSA 4F4JA 5AK0A 1G3UA 3AUXA 3KKQA 5JECA 2GVZC 3KJHA 3VHLB 4NYIR 3SQWA 1VG8A 1W36C 2DFNA 5TY0A 4DCUA 2C96A 4TSFA 5CLLA 3EPLA 3VKHA 5LDDC 3Q85A 2JIZD 2P67A 1P73A 2VSXA 2C5LA 1VTKA 5FPTA 1R0XA 1DTSA 2ZRBA 2ZRJA 3RDPA 2A30A 2G1JA 2JA1A 1H8HD 2GF9A 1IQPA 2R65A 1S8FA 4QFMA 5KSOA 5JJKA 3KQKA 1E9BA 2QAGB 3BD9A 3K09C 1ZCAA 2YOGA 2ZRPA 2IYWA 1G8GA 4B3DA 4D80A 3BB1A 3VX3A 4KLZA 2B8TA 3ICQB 2Z83A 4BFVA 1LS1A 1M7BA 3HR7A 4IOJA 5CYOA 3SN6A 2ZU6A 2DHRA 4M2LA 2CHGA 2A5DA 2QQ0A 1KSFX 1BYUA 2ZYVX 1KJWA 1GITA 2QM8A 1NL3A 1UEJA 1Z0DA 1GRRA 1W46A 2R2AA 4RFSB 4DCSA 1GM5A 3WYGA 1OPXA 2PL3A 4IXMA 4M8NE 3Q9LA 4YDHB 5L3VA 3RC8A 3MAAC 1XMIA 3SHWA 3TGPA 4UJ3A 2OAP1 4GDFA 1F6BA 3ONWA 4LJ6A 4MGYR 3IQXA 2VBCA 2I1VB 3KQUA 4QGHA 1KKLA 3FMOB 4DWJA 2GBLC 3A6PC 2XAUA 4CVNA 5FOUA 1HYQA 1ZNWA 3EWSA 3PUXA 2NMVA 2ZYTX 3KFVA 4X8MA 4TQUS 3UXMA 5EZ5A 5C1BA 4QJ5A 1W4AA 1MOZA 1IHUA 3PUVA 1XXHB 3LXXA 1HV8A 4WA7A 4HB4A 1KO5A 5B2ZA 3ETLA 3CM0A 1RRFA 2FZLA 1SVIA 2VRWA 1E2IA 1I4TD 521PA 3MMPA 2JJ2A 1LF5A 1NN0A 2IBMA 2IS1A 1CXZA 4CRWB 3RWOA 5DHAA 4B6EA 3FGNA 3E5HA 3TSZA 1OH8A 4KV9A 4TYYA 2BEKA 2JJ1D 4AI6A 4UJ5A 5LPNA 4ZKDA 2WJVA 2WMNB 1VCMA 1CU1A 2YOHA 1Q57A 2ANBA 2YV5A 2RGXA 3CW2A 4NMMA 3DM5A 3RAPR 3QEOA 1RC8A 2IEYA 3AKEA 5DI3B 4G5OA 1NIJA 3UMFA 4AG6A 4RD2A 1P9NA 2Z43A 3IBGA 4M22A 3LW7A 4PFSA 3RSOA 4B3BA 2NPIA 1ZAKA 3QUSA 4KCGA 4BFXA 4ZKEA 4FMDF 5BN5A 5TXGA 4RZXA 4DXAA 4QJ3A 2IWHA 3K9NA 5JBQA 4M9SA 1OHHD 3VTKA 2XOKD 4DVGA 1YZKA 3FFAA 2ZS7A 3SZRA 4FIDA 3WP0A 3U61B 3NDBB 2AFHE 4MYHA 1VG0B 4YMTA 2H7VA 1G19A 3CNLA 4XOIA 3T5GA 4DUGA 4RCYA 2ZROA 5EUMA 2YVUA 4BEJA 4QXAA 1DE0A 3ZJYA 3FTQA 1QBKC 1RRGA 2Z4SA 5FBRB 5E4FA 1OXVA 1AA9A 1GL9B 4NCKA 1LY1A 2V7QA 5AJYA 5GVSA 1TQDA 2KE5A 1KO7A 2CJWB 3ZQ6A 4D4LA 2JLXA 1E4VA 1P61B 2NPFA 3TAUA 1DG3A 4UNRA 1PLKA 1KNQA 4OHVA 1SKYB 2JDID 2XSZD 4DLRA 5KPJA 1E1RA 4OI1A 3EW9A 4GOXA 2XOKA 2WWFA 3NKVA 1CJMA 3TVDA 5KDOA 3ZIAD 1S96A 4IVPA 4JLKA 1TNDA 3WMFA 2VQSA 3AF0A 4LYHA 3GLGE 1IY0A 3OFNA 5B64A 2AL7A 4US0R 1KAOA 3T15A 1H65A 2N1BA 1JECA 3MWJA 4BZPA 4KVGA 3TVTA 1ESNA 1JAHA 1XEWX 5JJLA 4ZV4A 1A5TA 1GIAA 3GLFA 1FMJA 3TR5A 1PJRA 5HCIA 3TE6A 3TJZA 4Q1CA 4Z8XA 4CDGA 4OHXA 4HLDA 2BMJA 1J70A 4K8OA 4Q9LA 3L0PA 4TQ9A 1OV4A 2IEZA 5DE3A 5DLQC 2O0JA 4YMSA 4TLCA 1OYYA 3L0OA 3T1QA 4B35A 5A4JA 3PENA 1M2OB 2NIPA 2OAQ1 1FMLA 4US1R 2GTPA 3X1WA 1IOZA 4G01B 2HT1A 3VKWA 2WBLC 2PX0A 1FQKA 2VHQA 3HR8A 2CL0X 1E99A 2YNMA 3IHWA 3JZAA 5M04A 1YE8A 5D3MB 2OCBA 1VG9B 5GVRA 1KKMA 3C5CA 1BIFA 3PEUA 3GJ5A 1XJQA 5C18A 1XTKA 2J7PA 1MABA 4D6PA 1F2UA 1IXRC 2QP4A 1NLZA 3IDQA 4PZYA 1AJEA 2BCGY 1SVWA 1UDWA 4LBWA 4B32A 5TMPA 2WKRA 2BBWA 1E2HA 3RRMA 4XJXA 2Y8EA 1VMAA 2QTFA 1M7HA 5HZHA 1T8TA 3MWLA 1DG1G 2UKDA 3AVWA 3QVVA 1QHHB 1VIAA 4TTQA 5CLQA 1G6HA 1QVAA 1WP9A 2F3RA 2QSZA 3QE0A 4HLQB 5C2JB 5J4LA 1HH4A 3RNLA 2HLDD 4G5GA 2AN9A 5E7MA 1AK2A 1E2EA 2XGJA 3A1SA 1S3GA 2BV3A 4LPSA 4KODA 2W6IA 3T1VA 2VO1A 3C5HA 1GL6A 3DM9B 1F3OA 3DHWC 3L0SA 2OBNA 4JLPA 4LV5B 3Q7QA 1M8PA 4JVSB 3R9WA 4DEYA 3ADCA 5FL3A 3UIEA 4B74A 1D2NA 3WYAA 1KAGA 1YHNA 3WNBA 221PA 1Z6XA 3THOA 2HYDA 2ZSAA 1AS0A 3VHXA 2OO7A 1Q3TA 3HU3A
chains in the Genus database with same CATH superfamily
3EPHA 5EJAA 3K5HA 1D3AA 3WLJA 2ZVPX 3G3EA 4ALJA 3QMMA 3RIMA 4MVJM 4OJQA 2EWVA 4YAEA 3ZVMA 2AE2A 4DT1B 1CDDA 4AB1A 1N5KA 4RVOA 3S6JA 1Z12A 2PJUA 4BO2A 3GH1A 1W75A 3HM2A 4C2UA 1RSZA 1MO4A 2GPAA 3I9OA 2XMZA 4NNJA 5TS2A 1JVBA 5HQTA 2OGSA 2CB9A 1N0UA 3G13A 4BNYA 3D8BA 2WQ6A 2ZBPA 3V4FA 3MCWA 1MNAA 3K1AA 4MYSA 2P1DA 5CXXA 4CTOA 3PU6A 2PGIA 1HL3A 1U8ZA 1QB8A 1TT7A 3GUCA 3OEED 3KR9A 2DX7A 3PE3A 4G86A 1T9CA 4HQOA 5FIUA 3S68A 3ZZMA 1J9ZA 3EIXA 5TV2A 3HJTA 1TXGA 1RPAA 3F97A 3THYA 3M6MD 4BZXA 5I4BA 3HWSA 1SQ0A 4JR2A 1XTBA 4MQFA 5EE1A 1T9KA 1P0PA 4CR7A 1EM6A 3WMEA 3E22A 3DZKA 4NDZA 3GLHA 1V5IA 3Q7EA 2A59A 4U00A 5E3JA 2W8BB 1E2FA 2W4IA 1QGZA 3UXHA 3K9WA 3AHIA 1ORVA 5HIJA 3U1TA 1YS7A 3H2JA 1CZUA 1WSDA 3H2KA 3C4JA 4WOKA 2QTTA 2WMYA 4FCTA 2R6AA 5LXTB 1JKJA 1Y1KE 3NZEA 1M2JA 4KWCA 3JYLA 3RK4A 1QLHA 3IOBA 4RENA 1GZUA 1LSJA 3ZJTA 5IDXA 1YSCA 2PIAA 1DC5A 1P5FA 3L02A 3M6VA 4BGIA 1LDNA 4GDMA 1O6GA 3O91A 4M21A 2C82A 1CY6A 1NP6A 2G0TA 1LTQA 1SBIA 2V4ZA 3MLBA 4IF4A 4YFVA 4O8CA 3QE3A 1QHIA 2B1JA 1VJ1A 1Z5ZA 1OZGA 1U2DC 3VVLA 1V8BA 4DSAA 3QF4B 2ZSUA 1F6WA 5JVDB 1H4QA 1JS1X 1USVA 3IAAA 4IIEA 5KYVA 2QNBA 1LDGA 1KFBB 3CF4A 3GJSA 3RNOA 2RGNC 1BH6A 1HM5A 4MVJA 1U9YA 1LDEA 2VNJA 2W11A 1RMQA 4P7KA 5JEDA 4TYNA 3KKEA 4BJ5A 3WQQA 1I33A 1C0KA 1MVNA 1LPNA 1VOTA 1UBKS 4IKEA 3B6ZA 1NVXQ 2PT6A 4JL8A 4FI3C 3C3PA 3AR9A 4DV2B 2AWNA 2VF7A 3MJCA 2JG3A 1FYXA 10MHA 1EWQA 1KFCB 1NZDA 4JLUA 4IY1A 1ND5A 4LV8B 4GGPA 3WWZA 3FFXA 5CUQA 5H68A 3X2FA 3UMMA 1KDOA 1XRQA 3WYNA 3OTOB 1IATA 1EFDN 1L7DA 1W1WA 3GJ6A 2BEJA 2J0EA 3DE7X 3GEPA 4CKBA 4YT5A 2IEBA 5IVHA 2QY6A 3AILA 5BURA 4DB4A 3MQ4A 5D1NA 4HN2A 2CK3D 3NHAA 2HA0A 4UTPA 1P4AA 1PWXA 1GPYA 1U3DA 1QH0A 1YRLA 2WAAA 1F8UA 5G0WA 4HATA 5T64A 3UMSA 5DO9A 1HNWB 1D9ZA 4DREA 5HTOA 4LSWA 1E4YA 4PLCA 3N8HA 1KFKB 4BBJA 4D57A 1UQRA 2WU0A 2BFAA 5NLLA 3V46A 4CM7A 4G1FA 1Q5PA 3AG6A 3WNVA 1JZQA 3O90A 1F48A 2YZGA 2IOFA 4YV2A 2H54A 3PC7A 4YUXA 1NUHA 2ORWA 3KQVA 1GQYA 2WT8A 2ZSBA 3Q5EA 5C46F 2R00C 1M1YE 5ALPA 2VAVA 1U63A 3OZIA 1OKKA 2EZUA 4H35A 5IT4A 4HWGA 4LNAA 1VGQA 1VSUA 5DTMA 5A3RA 5K3EA 4MDEA 3UJBA 5KNCA 1ECFA 5FTJA 1PDOA 2B1GA 3V8MA 4G6ZA 4TVOA 1YD7A 4EG7A 1AXRA 4I4TB 1EP9A 3QEKA 3R5XA 1TYCA 5JNUA 1QO0D 4KJZA 5DV9A 1N9ZA 3P9ZA 3RGGA 3WK5A 1BWQA 5HJEA 1UH5A 1MBZA 3NBQA 4NJEA 2QT0A 4S05A 3AKDA 1LVHA 1CHDA 1QHFA 2DUWA 3E9RA 4KZPA 1PAUA 1CUDA 2AN1A 4Y0NA 5LZ7A 2DECA 2OCKA 4I36A 2ZT6A 4LHWA 4LUCA 4YRCA 4ZHSA 3W5BA 3P9XA 4JP8A 3NTLA 3CSSA 3KS9A 3QGMA 4YUWA 2Y68A 4IXTA 5D6NA 2YN4A 3DMPA 2JFPA 3BHJA 1XVTA 1U7WA 2HEIA 1K4YA 1O3YA 1U5BB 1V1RB 2PWPA 1CZNA 2ZUBA 3KXKA 3MWYW 2CJYA 4IGAA 3W78A 2QRLA 3Q2IA 1F60A 3TOCA 1I3LA 1UKZA 4H7FA 1TAQA 2VYVA 4NZ9A 4QOSA 1T1GA 3ELUA 1UODA 4LI0A 1NBHA 3D2LA 3GD5A 5CFLA 3TNYA 4EAAA 3D3WB 3DFUA 4S0XA 4TKLA 4IRUB 1ISJA 3MTJA 3CLUC 4P7FA 1F8YA 2VRCA 2V9PA 1XTTA 4BLWA 2XRYA 4ZK2A 4WNAB 4RDXA 3WRVA 2YN2A 2GLUA 2P11A 4HYYA 4HNRA 2HV9A 2RAPA 3D3NA 4XB6B 5CFRA 4FCVA 4BB0A 1KI4A 2EW1A 4U7JA 3B78A 4QAQA 2FG7C 3IJPA 3BFVA 1YRHA 4TLDA 2XVMA 1XZNA 1DEHA 1W2GA 1VL2A 3QXJA 3AUSA 3BCSA 1ZH0A 1YONA 1NQ5A 4NX2A 4RFSA 5FLYA 1ZM2A 3FNQA 2IV2X 3BKXA 1DTWB 3F8TA 1GU0A 1SHZA 2VPYA 4AP5A 2XTMA 1TUBA 2VZ0A 2QMEA 3ETEA 4C0AC 4Z0TA 3PQ6A 1L5LA 2I2AA 2OO3A 3L9XA 1V26A 5JSQA 1MVOA 3RHFA 3ITNA 2Q6LA 4X1KB 5AOVA 4MS3A 3K6KA 2P3SA 3FYDA 5JAHA 1I3NA 4CEHB 2JIOA 1CY8A 4KO4S 3DH0A 3DOCA 5I3CA 1ZJZA 2FI1A 3KQPA 3AQIA 4MQLA 1IULA 2WEKA 3OT4A 4IVRA 5L6LB 2GCGA 1DWOA 3FPSA 1G8PA 3AIOA 3CKKA 2ADFA 4QQFA 1KSGA 1NVVR 4DMRA 4I9NA 4IMPA 4IOLA 3ASYA 3F3SA 4RETA 4TWAA 1IJFA 4AULA 2W6PA 3AY3A 3FB4A 1H6AA 4N82A 2JKVA 2VYFA 3CF6R 4OI0A 1ZR4A 4KGXA 4TVSA 2EFJA 1Z0KA 5IMBA 4HBGA 3VAAA 4L95C 2DFLA 2V58A 1W7AA 1IBKB 1Q6ZA 2HHJA 2ZRFA 3T12A 3IVXA 4U7WA 5ALYA 4MW1A 4KVZA 1SQ5A 4FE4A 4PRZA 4C30A 4RY8A 2HQ1A 3EFOB 4NICA 5KQLA 3LWNA 4JXZA 2AR7A 3GN2A 1YCDA 3OPNA 5BN3A 5C8XA 4YHHB 4EY7A 4IZIA 2GK3A 2AKEA 1P9LA 3A05A 1YGYA 5F7XA 1Y4SA 5KDLA 3A28A 4HNUA 2B4QA 1EM8B 3AHEA 1B0PA 3AR8A 3CRVA 2Z2JA 3O5AA 5KU1A 3V3TA 4NFSA 1PFQA 1A2OA 4OQMA 1E1LA 2C5BA 2PGXA 4DLKA 1JI0A 4AJNA 2Z1NA 1O5OA 4U2DA 4B1FA 1T35A 3L8MA 5C3UA 4OXNA 1R27A 4Z4FA 5EIBD 1PNQA 5GAJA 2QL5A 3KYBA 1N5JA 1QDUA 2AOWA 2FWJA 2IZ0A 4N54A 4RLSA 5EMHA 3WMWA 4FYMA 2YWGA 1KGSA 2HO4A 5C5CA 4YCCA 4EEXA 4ZVSA 3ORHA 5FFNA 3KETA 2GSDA 4JV5B 5CVJA 5JCPA 3UJCA 4Y6SA 1F1BA 2PCJA 3EXHB 3OHSX 1VIVA 3SWWA 3V1YA 3AF2A 2CZGA 5C1OA 3LBFA 1N6KA 2C5GA 4G89A 4L8WB 5GGXA 3PXGA 1NUUA 5EIAA 4R31A 2FP4A 1JR3D 1ZA1A 4Q4CA 2AZDA 3I83A 1V2HE 1B7GO 1AKTA 2P7HA 1UADA 1VHTA 3FFBA 3OQPA 4KQKA 4BFSA 3UCXA 2DY1A 4R51A 1DX9A 2RC6A 1EUQA 4A0HA 2GHIA 3RAEC 2FK7A 1E6UA 1Z2DA 2DFTA 2WJ3A 3JZFA 3ELWA 2ZXFA 3RVSA 5D84A 4KHZA 4ZEWA 5AHXA 4GWLA 2CNWD 1IY2A 3TZBA 5KQSA 3K9QO 4KBFA 1VPVA 3B3AA 1LZLA 2L82A 1V7ZA 4UPVA 3QTLA 2WSBA 3RS2A 4WN9B 4LF5B 1Z3CA 1OVMA 1RWNA 3IPLA 3NORA 2RHMA 3DAFA 1O1YA 2I4TA 4H0CA 3AR5A 5GIOE 2BJHA 2X4LA 4ME6A 4NU6A 1OJ7A 3EQ6A 3VR5D 2AR9A 2Q1XA 4GSLA 2HY7A 3AEKB 3A6HA 1JKMA 4ZJPA 2XB4A 2R5WA 1NKSA 5ICEA 2VSOA 3QV2A 2X3FA 3RT9A 3K2QA 2Z5GA 1ZH8A 2ORYA 3FBGA 4UTXA 3VJMA 4AJIA 3B7GA 2YRXA 2QN3A 3K96A 1VHWA 1B8UA 1FQJA 3NQ41 4KPUA 1S2LA 1SXGA 3CZQA 4M9ZA 4DLWA 1GGFA 1JBEA 5ER9A 1FU4A 4CIYA 3LWBA 5TR9A 1MZPA 2BOVA 2QV7A 4DMHA 2WWHA 3OJOA 4U8HA 4AMYA 1O95D 3CH5A 2NXEA 1D7AA 4QUEA 5KTPA 2VT6A 3DDOA 2F1RA 4IDCA 3ZNNA 4MS1B 1K6IA 2HNBA 2QJRA 1P4RA 2H1FA 5AKIA 5EERA 5JZMA 1E9FA 2PPLA 3U4IA 1KAMA 3ZGVA 3GDWA 5A7HA 5JD6A 3DPSA 4DLTA 5CK4A 4YRQA 1WF3A 3PLAE 1NQTA 3BDVA 1WBJB 2XCLA 3OIDA 4OHWA 3HCRA 4QDXA 1U2GA 4TV9B 3HB5X 5DULA 4ZWNA 3QKUA 1E77A 4EYOA 1EBUA 5D3MA 3Q3CA 2IW1A 1XYVA 4HMQA 1Y6FA 5AM0A 4YBRA 1C80A 2HCJB 2WWTA 2EGHA 3PL1A 4LWPA 3TAXA 1NBMD 3CLRC 3FVQA 4C0XA 4ZYLA 3FOZA 4GVPA 2PX6A 4PAOA 3HWX1 4RSRA 5L9AA 3FXAA 2DQZA 4K28A 1IUOA 1N0VC 2ZYSA 1P9RA 2NSJA 2YNMC 3WYFA 1B00A 1Z3IX 3EUWA 2XUOA 4XQ0A 2YMPA 1KZ4A 5HF8A 3WIUA 2G1AA 1G3QA 2ZSJA 2HCRA 3BK7A 3E7WA 4AZ0B 4CM9A 2NZ2A 4EQ6B 2FF5A 3RANA 4CG3A 3ZYZA 1TAUA 2H57A 1SZCA 1TUGA 2B1QA 3GA0A 3KSDO 3ZKWA 4D4HA 4AWAA 1T8UA 4IWXA 1QHHA 3NHSA 5DHUA 1T0JB 3LWDA 1N3IA 1Z56C 2GARA 3BH0A 3PQ3A 2JH9A 3Q98A 3TK1A 1D7OA 4AQ7A 5HM6A 4GPEA 4R83A 4RPLA 4W5HA 5CVEA 1XELA 5FFFA 1K68A 5IVPA 1B3RA 2Z30A 1WMEA 3JXEA 4RS4A 2C5EA 2VPQA 1LBEA 3ZPXA 3ADPA 1A4IA 4OQXA 4Y1RA 4DPMA 3EIWA 3HDJA 4F97A 4OHYA 1Y3BE 2O1WA 3I6IA 4L5YA 2YZMA 1XHEA 1DJMA 2B1RA 1CTQA 3NBXX 5GJVC 5JWHA 4GNKA 1OX6A 4ZVQA 3MAJA 3W2IA 5JLAA 1KQFA 3A10A 3UC5A 4UTNA 3RS4A 3P94A 3UGQA 4C4YA 4AZWA 3N6RA 4E22A 2WD9A 1K06A 2ZTVA 4G9GA 4IJ6A 4I50A 4RVNA 5AKKA 4YH1A 3T5MA 2I4MA 4YJ2B 2GRUA 2VXCA 4ALMA 1KARA 3NPAA 4QT0A 1LV7A 4F04A 2JAUA 1CY0A 2ZJOA 1I1NA 2Q6VA 4HZUB 4C0SA 3PUHA 2XZLA 3KE8A 4JJ6A 3EWAA 3V8PA 4MAMA 2XNJA 4GECA 1KMCA 4QYMA 4IHJB 3TXXA 3EVNA 2B99A 3CJRA 5HBRA 2P9BA 4XRGA 2AEMA 3FYUB 4G07A 4JJ8A 3TKLA 4B2PA 2VXOA 2C94A 1PK8A 1QYRA 2MOKA 2VN8A 4J0FA 3AB8A 4JQYA 4XDZA 4NBNA 1MKYA 1X7YB 3P5BA 1GPLA 3G02A 1XYYA 3QENA 3S44A 4B31A 1ZCFA 4HEA1 1DEKA 2BHRA 5FQNA 1PQPA 4K6GA 2HJRA 1QFXA 1H1LA 1QNFA 3KYDB 1KSJA 1FXUA 2Q2QA 4KK3A 1B6GA 4I4LA 1HA3A 2VTBB 3UK6A 1MHTA 1IUNA 2AF4C 3DKIA 3EDYA 1W25A 1ZN7A 4KE7A 3PQ8A 4G5QA 4LJSA 4LXXA 4XX0B 4AT1A 5DCUA 1RE0A 4BKQA 2WUWE 3SC2B 1VJ5A 2KSQA 3K70B 2WYHA 4OGGA 4L0DA 4QYTA 5F64A 4R0MA 5JXHA 3PPYA 4ZO6A 1V3QE 2Y1DA 2WKWA 3FLBA 3T5PA 3NBKA 4DM4A 4MYRA 3IJEB 4IDDA 3OM8A 4QUGA 2QXUA 3H7AA 3KQWA 3JY6A 4KGVA 1TTQB 4F60A 1RHKA 2CMKA 3KZXA 1G2OA 2W2QA 4LZPA 1PQ4A 2AN3A 4MNTA 2AQ8A 2NZYA 4OYLA 4HDQB 5BSUA 4DTCA 4FE7A 4N0PA 1LRJA 1YB5A 4F2GA 4DDUA 2QX7A 4AF7A 3RV4A 4EPWA 1NFRA 8ATCA 1JDBB 1B42A 2DMRA 4EY4A 2GD0A 2H18A 4UTOA 2QTMA 4IINA 2P27A 1NBOA 4KXVA 2GJ4A 4PPFA 3VJRA 2ZI5A 3R7DA 1UIRA 2NAPA 1KI8A 4OQZA 5U4XA 4D3XA 3LO8A 4FYKA 5HOQA 3H8WA 3IUPA 3KUUA 2YYZA 1PBTA 1WKBA 3NALA 4JYBA 4MI1A 1ZRSA 3FR8A 4I4CA 4YVFA 1NG9A 2ADMA 1L8LA 3OOJA 2BLLA 2QNRA 3ZHTA 1K86A 1DWPA 1BX3A 3AF4A 4YB8A 1H4TA 3IIIA 3VSCA 4A0RA 2QX8A 1DAKA 1C2YA 4X71A 2FGJA 1GZ4A 1RQXA 5DGTA 3F6PA 4NCNA 3A4TA 3T3GA 4M98A 1Z2OX 4QC2A 5DVZA 3RF7A 4ZV9A 5CP8A 4MV4A 1OHHA 4HD8A 1RJDA 4PLHA 1L5YA 3R5HA 4EF6A 1MU0A 3QU7A 1AQUA 1E1CA 1NOIA 2C2WA 3I45A 2WD7B 5LYJB 4IIBA 3DW1X 1LLQA 4OU4A 4AD8A 5C4MA 1E3JA 3IA7A 1FP4B 1WDKA 1COWA 2CVQA 2VNSA 4RZ3A 1QHYA 1NUPA 1ISSA 2ZBVA 4EB8A 2VDWB 3NVKI 1VLHA 1VBMA 2EKDA 1AF4A 3KWFA 1IVYA 5FTWA 5E2BA 1G4AE 2XGMA 3OWHA 5IN5A 3Q5GA 4NE9A 4DIFA 1OTYA 4CTMA 3MJ4A 3GX1A 1JBKA 3AY0A 4FMDB 1KI6A 2O8DA 2NP7A 1V9SA 1ZH4A 2ZGVA 3H42B 2O05A 3EGXA 4BKRA 3CRZA 5H9WA 1THZA 4E5MA 4V0ME 1LS6A 4KOEC 1AZTA 2P6RA 4N6GA 2PRYA 5LOVA 2QGZA 1X1BA 1XQ6A 1ZJ5A 3JYOA 3KEMA 4UVIA 5AKYA 7GPBA 2AXNA 2IDMA 3QYJA 4R16A 5B6JA 1O4WA 1PEYA 2Y66A 3FNIA 3ZU2A 1T5BA 2X23A 4PQEA 4WOCA 2FVYA 1UC8A 2H1LA 4GI1A 3O31A 4U9UA 4BLRA 4EVRA 3B8HA 1W4LA 2VK1A 4AJ9A 3EEQA 3ZGNA 5DF1A 4E03A 1H2XA 3WK6A 4EQZA 4TMWA 3E05A 1KR2A 1VDMA 3AW8A 4MV3A 1E9DA 1QK3A 4JB0A 3FY4A 2QW8A 3IX7A 1RHRA 1V16B 3L1UA 3UCFA 4BIIA 2CN1A 4DCCA 4Z51A 4ZHQB 2OC9A 2PY6A 4Z3OA 1RBQA 3F6CA 3EXG2 1G7TA 3LQ2A 3UT5A 4II7A 3GLIE 4Y2JA 4ZU1X 3AKZA 1KK2A 3JQBA 2P0YA 1NSTA 1ZZGA 4LSGA 1W47A 1OU4A 2FUG6 3IDSA 3LUHA 5A03A 3U9TA 1TFUA 2DOKA 1R00A 3GVXA 2ZB8A 1R0LA 4YYEA 4CWAA 1Q83A 3TRDA 3LCMA 4Q4DA 1T3HA 4JQCA 4OUKX 1FE8A 3DYBA 2CVHA 3UO8B 3V4OA 3MIIA 1DP4A 3NHFA 2VJCA 1RKQA 2EFGA 1L9XA 3AVUA 1TA9A 3MLAA 3O3NB 3PZBA 1O94C 4HOYA 3NUZA 1I7NA 2PT5A 2IL1A 4INPA 5A2QA 4IG4A 4M7PA 1NOJA 3RYHB 2FEOA 3UMJA 3NIGB 5F33A 2VWPA 5KVCA 1FSZA 1YJCA 3B6MA 2W58A 4HPWA 4YRBA 5BNZA 1EK5A 1FPMA 4ZK6A 1H5NA 3PDWA 2XGOA 4EUNA 5JD5A 3F9RA 3EBOA 3W4JA 5K3CA 1EWRA 4R2JA 4NH0A 3T9EA 3TIIA 1HI9A 3OKPA 3USZA 4N5HX 2Q5LA 2VHEA 2ZJAA 4P98A 3N8NA 1ILEA 4R9NA 2AX3A 3FMIA 4R8MA 1PT5A 1VLJA 2OCXA 1PNOA 3G6WA 3LBIA 3OZTA 3LXMA 3MYRA 1XD2A 3PTZA 4QNRA 1QG6A 4XDHA 2CSXA 1CNFA 1M73E 1Q17A 1XCMA 3OZGA 1I2DA 4XB2A 5LXTF 5TS3A 5I3ZA 1CUJA 2I87A 2IXAA 2PDAA 3EGWA 3ISTA 3HVIA 4O4HA 3R41A 3RJ5A 4F5YA 3DFZA 1QKKA 4IJMA 5FULA 1KBOA 4ZDKA 2ILVA 1UZMA 1GN9A 3BDIA 1FRFS 4D5EA 4MUEA 5CH5A 1B2RA 1ETHA 4NS1A 3K05A 2CNOA 1R5NA 2Q7XA 4RESA 2QG9A 1ISRA 2FGKA 4GX0A 3WKCA 3LYUA 3F9IA 4PSKA 5KYYB 5JCZA 5IKPA 1ZI9A 4RK6A 2AXEA 1O8BA 1WR8A 2H8KA 1SULA 3IALA 4YRFA 2UZ1B 1M2WA 1Y6JA 3AJ8A 4DA6A 3RO7A 5G02A 2ODTX 5HILA 4RK0A 4QODA 3TUZC 1OE0A 1D9XA 3IBSA 3E9QA 4MTLA 1FDOA 4HDNA 3E3LA 4G37A 4NR0A 1E7YA 3TTUA 3ZGYA 3D0QA 2FSHA 3NAQA 1VCHA 3AUKA 5TPWB 1PL0A 1FYFA 4TGLA 3TW6A 1O58A 1OI7A 2F3PA 2WI8A 2Z57A 1UBEA 2G72A 3AFOA 3LQ4A 4F3CA 3MHTA 1R3DA 1ACMA 3T3DA 3N2YA 3UKOA 1FRNA 1LQ2A 1FFHA 3NEPX 5D5QA 5T67A 4TMVA 5F9HA 1YJXA 5EPOA 5C9ZA 2GFIA 1ND6A 2VAMA 1HDZA 5CCEA 4Q4JA 1SKUA 1U9CA 4L5AA 3OJLA 3TL6A 3O1JC 1FNNA 3MPOA 4G2NA 1PJSA 5HIAA 4PM4A 4OHPA 1SUWA 3MILA 5CA0B 2DR2A 5EQTA 1ZUWA 3FN4A 1H8EA 3EUFA 3LY5A 5EP4A 5HBGA 2IW3A 4BNFA 2D1YA 1QRSA 2A0KA 3C0KA 3PLRA 2BI7A 4DSNA 5K0SA 1H23A 4PCAA 4GS5A 4Y8VA 3VSAA 3OX2A 3JYQA 4LVCA 1ZU5A 3O7MA 3CNQS 4EMUA 4HNTA 4UVHA 3UM9A 3FWNA 2CXXA 4M1SA 3QXXA 1KFEB 1NZFA 1HO3A 3L6DA 1LCIA 4YJHA 4V0LA 2V7TA 5EC8A 3OZRA 3QX9A 6ABPA 1YRBA 1QH8B 1N5OX 2AYYA 2RHRA 1OLUA 4KXWA 1MX9A 1E3MA 1S4QA 1YUBA 1BQ4A 2GZAA 2OV1A 2OFWA 3OEWA 4QWWA 5AI8A 3TSOA 5LUAA 1ID8A 4LBVA 1K3TA 4DHWA 3H5IA 1DZ3A 3JALB 4I4TF 2Q4BA 2NU8B 1C9MA 1T3LA 1U7TA 4EOGA 1TPZA 2EG9A 2X22A 4GICA 4P32A 4RO0A 4QHSA 1M2EA 3AONB 4TL8A 4CT4B 2JHAA 4IICA 1IE3A 4DPLA 4ER7A 4JLNA 3HXLA 3UYKA 3O38A 2OESA 3OBIA 1FFXB 3U5TA 1LLCA 2F3TA 1QF7A 4O2AB 2UZIR 1C3LA 4R9VA 3UMBA 3SNHA 3JTMA 3ZWXA 1US8B 1NVAA 3HEMA 4B4KA 4DQXA 2JA2A 3DFFA 4BWVA 1LDMA 4Y18A 3GIWA 2BAGA 2QRUA 4KP7A 4L9SA 1CJKC 3ASVA 3RTDA 4YCDA 4B5KA 1U6KA 5ER6A 1P0QA 1XAIA 4ZCQA 5JNSA 1L7EA 3E5NA 1I0IA 3PS9A 4H15A 4PNHA 4H18A 3FJ1A 2KYRA 3OOWA 4G97A 4RZ2A 4ZDWA 5GZ3A 4KE9A 2CUKA 2F8MA 3IEKA 4CI9A 1RTKA 3OO0A 3NHZA 3SEAA 3IVGA 1W6UA 4RQTA 3R2JA 3TQOA 2C03A 4LX0A 5ARBA 3JWEA 4DY6A 1DS6A 2R2GA 5FPYA 5GQSA 3KSBC 3QLEA 5FPSA 1L5QA 4W9MC 1EGQA 2GCNA 2FP3A 2WB4A 4RKYA 3UAYA 4EENA 2GCOB 2ODQA 1WSAA 3M1AA 3PKIA 4Z99A 2XODA 4XPIB 5JDCC 3SVTA 1VPWA 1Y9EA 1VJDA 4AJKA 2K7FA 3ADDA 3EJ6A 3LT5A 2CVZA 3JVDA 4RU1A 4MO9A 1OY1A 2F2TA 4DY4A 5KNLA 1Y5MA 1CC1S 1LKZA 4KQ9A 3CNEA 4MDYA 4IM7A 3V9AA 4Q3KA 4JOSA 2L19A 1EX9A 2JAQA 3ZX4A 1W0KA 2FUKA 3PSHA 4LQDA 3CUKA 4Q9IA 2A1IA 3WZ2A 4II3A 4PGHA 4ENTA 4L5BA 2N46A 3HR4A 2FFAA 1M2NA 1CJVC 1PLLA 2AOTA 3AEQB 4YACA 5AJZA 1T43A 1U8YA 3KLOA 4MPJA 1ZJJA 3M1IA 4RX1A 4F0JA 1EB8A 2FEXA 1X7XB 2P0EA 3HH8A 2W6NA 3O26A 1QMGA 3E1KA 1P29A 5BNIA 4U63A 3C14C 2X42A 1DQSA 1QWSA 2HFKA 2R87A 3A32A 4EG6A 2WUFA 1Q3HA 1CE8A 3BVPA 3FOWA 1CQPA 1Y8RB 3MFYA 2EF1A 2VWGA 1Z37A 4LKOA 1GILA 4RTJA 4DR1B 3MTAA 1WZEA 1L8AA 2WTXA 5CTJA 4KR3A 5SY6A 2UAGA 3D1JA 4R0NA 3CLVA 4L8GA 1NQWA 4D4IA 1MABB 5BO5A 4DNFA 1IVSA 4EO4A 1GUBA 3S1AA 4KRXA 4EK9A 1P6XA 5A06A 2NU9B 3GFVA 3RSZA 2HSZA 3LV8A 3OE1A 4MWBA 3UBTA 4D43A 1ZONA 4ZEXA 5EFOA 2AZXA 1HQCA 5H1YA 4NBKA 3ZXSA 3ZWVA 2ZSFA 3AYXB 3G8YA 3OFSA 3RFCA 3ZWBA 4CBVA 2Z1DA 3F6BX 1A96A 1SHLA 2WM3A 1KO1A 1OJLA 3JQ8A 4NZOA 3SSOA 2ZRHA 1BXKA 1TOAA 3WB0A 4EWLA 2YIMA 1JPJA 5KAMA 4ODIA 3DTYA 1OGJA 1TCVA 1UOPA 2I3AA 4AUKA 1AGYA 1FB5A 1UJ4A 3C5WP 3FPBA 1W96A 1XTSA 5BV1A 3V8RA 3HFGA 1K75A 2QEQA 4KFTA 4P36A 1HTTA 5HRCA 3L4BC 3WMGA 3HZRA 5A05A 5IVDA 1XQXA 3EWNA 4PS1A 1EDBA 2RH4A 3A11A 4W9RA 4HTFB 5EXXA 4L5CA 5JO9A 3SDZA 3H9JA 1O9GA 3EOZA 4DABA 3U3RA 4PX3A 4LECA 1TM5E 3F2IA 5JHGB 2C4HA 1N5DA 4R2WA 4EKGA 2REQB 5L6MB 3A36A 3OIUA 1XGKA 3PWKA 3MS7A 1FYWA 1GPMA 2Q8NA 5A5FA 3Q1LA 3UJ8A 4OLAA 5DMHA 4BCDA 3ELDA 1A9YA 3VI4B 2H11A 3LPCA 2H59A 4PS0A 4YP9A 4NSNA 1YZLA 4BWGA 1BEEA 2WU8A 1RXUA 3KV1A 3LK7A 3GLQA 1R0YA 5LZ5A 2DVMA 5LMUB 1XAJA 2CZCA 1L7MA 3ZNPA 5JEEA 1M8GA 1XP5A 1YKGA 1C4XA 3KLPX 1J1ZA 3OJEA 1M34E 2YY7A 5JZ9A 3KWJA 4I8XA 4JQOA 4BVBA 1H5QA 5JISA 3UY4A 1JDPA 2O2EA 4ZPJA 1N1MA 2F90A 2GFHA 1DAGA 1DU4A 1R4NA 1T4GA 3FOAA 4LZWA 1JQKA 3OOYA 2OV2A 1FUKA 3ESBA 4UASA 4FHGA 5DTRA 2A86A 4EUEA 2GETA 2VAPA 2NV6A 1J49A 1JPUA 2VF5X 4XCVA 2CV2A 4X8OA 2JIMA 5SY9A 1Z6ZA 5C53B 1QZXA 3T3NA 3QBJA 3LX8A 1CIPA 1GYQA 3GL9A 5KCMA 3UEOA 3FKSA 1MDFA 1F5NA 2GNAA 3C5EA 4RMHA 1ONBA 3OIWA 5C3MA 1X6VA 2FLKA 4JMPA 1A8QA 4TT3A 1VFPA 5K3AA 1LBQA 1FNCA 3KAPA 4UUOA 4V2UA 5EYPB 5K09A 3E2PA 3LBAA 3TLGB 4HGNA 4HFMA 4X1IB 4G63A 5DYWA 5AW6A 1CBUA 2P3LA 1ODKA 3IV9A 4GLJA 5IF3A 3PEFA 2CJPA 2YDYA 3VV3A 4EO7A 2QTWB 4X1YB 2RAVA 3EDOA 1EEXB 2EHJA 4TSRA 4PSAA 4UUMA 5IDQA 2ZUWA 3NETA 3O73A 5JQGF 3A1DA 4IG9A 5TVKA 2BUAA 2ZTUA 4BZQA 5C7YA 2JLWA 5LP6B 2WIGA 2HF8A 3I0MA 4JC0A 2C3YA 2O3TA 1MAAA 4J0GA 3ZHOA 4QG3A 3WA7A 3ETHA 1MH9A 3PX3A 1J39A 4LXIA 3TZHA 1VPEA 4C6SA 3LRPA 2VPWA 1RPTA 4CLRA 4R5MA 4Z1MA 2RFLA 1SG9A 1G5RA 4LHYA 4TV9F 1UMKA 1JNXX 5JCOC 2OCGA 2EKZA 2PX5A 3N5KA 1CY4A 4Q9HA 5JJIA 4BV9A 1SA0A 4MQ5A 2H2WA 4L16A 2Z09A 4M1WA 5JWOA 2MSNA 1CF4A 1S8NA 4NE7A 1J00A 2BSXA 5DM2A 4CQLA 2ZXUA 1VKRA 1KORA 2BFNA 1KQ3A 5K6AA 1CR0A 3MG9A 1I3KA 3FVTA 1JSLA 3A1UA 1ZA2A 3B6EA 3HZHA 3PGXA 2EL9A 2VG8A 2HO5A 3PNVA 4OLHA 3TOSA 3TZLA 1O4VA 5AVXA 2YHSA 4RQUA 4PXAA 2ZUCA 2O23A 1JP7A 4RACA 5ALMA 3KVNA 3NYWA 4RXMA 4YRJA 1TZJA 2V6BA 4OBEA 5EJEA 1G0NA 3NIWA 4WZBE 4Y2SA 5D2CA 3T7CA 4CKCB 4UVGA 4L15A 4XIJA 2OO5C 3JPWA 4I55B 4PYIA 1JEYB 3AW9A 4BO5A 2L42A 3UG6A 3IURA 4FEAA 3FDIA 4FWIB 2C29D 4IILA 3JARA 5LUBA 2WFAA 4H3VA 5D3KA 4JDPA 1JH9A 2MYUA 1J09A 1UMCB 4TSFD 5CD1A 4Q47A 1I5RA 3GZNB 3FTPA 3CLUD 3G68A 3OZ7A 3QFHA 1JZSA 4LRQA 4YROA 4DHEA 5JTUA 2BHNA 1QO9A 4TTVA 2Z2YA 2PZBA 1DKUA 3RSCA 3F3YA 2RHLA 4BMSA 3VSBA 1LEHA 3P19A 3UWPA 3WXBA 1T2VA 1WCIA 4YMWA 2ZDHA 1QPGA 2DHQA 3G2LA 2PD6A 4H7DA 2IT1A 3RVOA 1QH1B 1R1DA 4D97A 5EWJB 1VM6A 1VXOA 3I04A 1P1CA 2RE8A 1RZ3A 1YR1A 2WFZA 3SQMA 1YMVA 2Q0QA 1T3ZA 3A0RB 4A5OA 4ZZ1A 4XVUA 3NKLA 4D81A 3SZMA 3QPWA 3MINA 3RTBA 2ZOSA 4JYPA 2C59A 3DWEX 4M0FA 1YZUA 3L07A 3OPYB 1QUFA 3M2PA 4YJ2F 5JSZA 5KUTA 1KZ1A 5E1MA 1P9WA 5I8ZA 1T5LA 3QH4A 4DSTA 3NI2A 4I3GA 3MUEA 2V1XA 5J1SB 1NW6A 4W99A 4Z3DA 3F1LA 3VGPA 4I66A 1X1DA 4BGDA 1EIWA 1BWSA 4W1PA 2R0QC 3LNCA 4WOPA 3AJRA 3H5AA 3IIMA 5JQWA 5K8LA 2HU8A 4X8HA 2BW0A 3NWJA 1QQ7A 2FV8A 2UYOA 5CB4A 2DFKB 4FONA 5BW4A 2OCDA 1SXJB 2JAXA 2P77A 3S2SA 2ZJ8A 3WQSB 4W9NC 3UNXA 2QJOA 1R8YA 1YUNA 3CUSA 3JYHA 2IYVA 1ATIA 3P2EA 3WDMA 3AI2A 2AVNA 3K1JA 1M5UA 2CFCA 1NMQA 4IRXA 5D5PA 3LLCA 5DX0A 1TK9A 2AD5A 1WCYA 2JK0A 3CR3C 4BV3A 3E3NA 4UHEA 4ZI2A 1AT1A 2NPOA 3KT6A 3FLAA 3UJ9A 5A9SA 3D31A 2BGIA 3LS2A 4RGVA 3TDKA 1VKZA 1TQ8A 2P6PA 2W4QA 3WLAA 2F1HA 3DULA 5B6PA 3WK7A 2O8EA 4GUAA 4NOJA 3HRIA 3MMXA 2HRRA 2ZSHA 3HN2A 2HA7A 2VKQA 3HU5A 2XWBF 4AAYA 4G1CA 1NI4B 3ZR4B 4YCBA 2DKNA 3VOSA 1RYFA 1T8RA 1NDQA 3GF4A 1YH3A 4HN4B 1WCV1 3C3CA 1EQUA 2E0IA 2ZU0C 5IM5A 5FUMA 3ADKA 1UBGA 4L4UA 4ILEA 3IL2A 2OZLA 3WLTA 3G2IA 3A58B 2CCKA 4QUDA 1B6TA 3K9HA 5AVJA 5LKAA 1QQAA 4OQEA 1NVBA 5LJIA 1JYSA 2GD6A 1Q0LA 3OLVA 4A2WA 1OCEA 1MGPA 1QKJA 4GWKA 5IBRA 4CQMB 1QX4A 1SBHA 2ZETA 3WTBA 1BDHA 5L53A 2ST1A 3IAFA 2PWAA 1I3MA 4KE6A 4UFOA 4DL9A 3P9KA 3SXUA 1E8DA 2ONZA 4IRMA 1TGVA 4YLYA 3UAVA 2X86A 3AOEA 3D2BA 4FHZA 4M54A 1I4DD 4YA6A 4CIVA 2X3YA 3QV1A 1KEUA 2QN2A 2SBTA 1LBSA 1MCZA 1WY7A 3GGGA 3HCCA 3NIDB 4ACAA 3DWFA 1GSIA 2EV9A 3ILSA 3PVCA 1BW9A 1XZQA 4PG5A 2YVKA 2E1RA 3NANA 4XJVA 4FFWA 3UK1A 1N2ZA 3WRXA 5IJ0B 1V1MB 4F5EA 3EXIA 3OQBA 4WZAE 4DWOA 3BT7A 1V5GA 2OC4A 1FTWA 3W34A 4R6XA 1JFFA 1WUHS 4IIJF 4FCWA 4DCPA 3A6EA 3S27A 3QZUA 4CMEC 3DOEA 1HT3A 1NW8A 1SCBA 2H0RA 4KLCA 1G42A 5CA1F 5IG2A 4MB6A 1TQ4A 5LQMA 3ZVRA 4OD0A 1G20E 1QK5A 5CCDA 2FFRA 4ZOQI 1ZICA 3GGOA 4XGIA 2VP2A 3SR3A 3U3DA 1P2SA 1ONPA 4DZTA 2OV3A 2NV2B 3F4KA 3L04A 2VA8A 5IFLA 5BN4B 1IRXA 2WV7A 3C1OA 4QDJA 2WPNA 2PO7A 1PRYA 2YXNA 2DQ4A 1AZWA 1X86B 1V7QA 4LOAA 4N0MA 4O4IB 3UW3A 1A04A 3A04A 3B48A 5BQFA 3EPJA 1SD5A 4TX1A 3T8YA 1MTZA 1QIJA 2HRQA 4AX4A 2JF0A 1GWNA 2SICE 3H9EO 4LE2A 2ZCJA 3WLHA 2XNKA